(data stored in ACNUC7421 zone)

EMBL: AP008229

ID   AP008229; SV 1; circular; genomic DNA; STD; PRO; 4940217 BP.
XX
AC   AP008229;
XX
PR   Project:PRJNA16297;
XX
DT   05-JAN-2006 (Rel. 86, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 4)
XX
DE   Xanthomonas oryzae pv. oryzae MAFF 311018 DNA, complete genome.
XX
KW   .
XX
OS   Xanthomonas oryzae pv. oryzae MAFF 311018
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Xanthomonas.
XX
RN   [1]
RP   1-4940217
RA   Ochiai H., Inoue Y., Takeya M., Sasaki A., Kaku H.;
RT   ;
RL   Submitted (16-NOV-2004) to the INSDC.
RL   Contact:Hirokazu Ochiai National Institute of Agrobiological Sciences,
RL   Genetic Diversity; 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
XX
RN   [2]
RA   Ochiai H., Inoue Y., Takeya M., Sasaki A., Kaku H.;
RT   "Genome sequence of Xanthomonas oryzae pv. oryzae suggests contribution of
RT   large numbers of effector genes and insertion sequences to its race
RT   diversity";
RL   Jpn. Agric. Res. Q. 39:275-287(2005).
XX
DR   MD5; 6c8c4da6a1cd1ca7c79ddbf328da5a2d.
DR   BioSample; SAMD00061078.
DR   EnsemblGenomes-Gn; EBG00000041243.
DR   EnsemblGenomes-Gn; EBG00000041244.
DR   EnsemblGenomes-Gn; EBG00000041245.
DR   EnsemblGenomes-Gn; EBG00000041246.
DR   EnsemblGenomes-Gn; EBG00000041247.
DR   EnsemblGenomes-Gn; EBG00000041248.
DR   EnsemblGenomes-Gn; EBG00000041249.
DR   EnsemblGenomes-Gn; EBG00000041250.
DR   EnsemblGenomes-Gn; EBG00000041251.
DR   EnsemblGenomes-Gn; EBG00000041252.
DR   EnsemblGenomes-Gn; EBG00000041253.
DR   EnsemblGenomes-Gn; EBG00000041254.
DR   EnsemblGenomes-Gn; EBG00000041255.
DR   EnsemblGenomes-Gn; EBG00000041256.
DR   EnsemblGenomes-Gn; EBG00000041257.
DR   EnsemblGenomes-Gn; EBG00000041258.
DR   EnsemblGenomes-Gn; EBG00000041259.
DR   EnsemblGenomes-Gn; EBG00000041260.
DR   EnsemblGenomes-Gn; EBG00000041261.
DR   EnsemblGenomes-Gn; EBG00000041262.
DR   EnsemblGenomes-Gn; EBG00000041263.
DR   EnsemblGenomes-Gn; EBG00000041264.
DR   EnsemblGenomes-Gn; EBG00000041265.
DR   EnsemblGenomes-Gn; EBG00000041266.
DR   EnsemblGenomes-Gn; EBG00000041267.
DR   EnsemblGenomes-Gn; EBG00000041268.
DR   EnsemblGenomes-Gn; EBG00000041269.
DR   EnsemblGenomes-Gn; EBG00000041270.
DR   EnsemblGenomes-Gn; EBG00000041271.
DR   EnsemblGenomes-Gn; EBG00000041272.
DR   EnsemblGenomes-Gn; EBG00000041273.
DR   EnsemblGenomes-Gn; EBG00000041274.
DR   EnsemblGenomes-Gn; EBG00000041275.
DR   EnsemblGenomes-Gn; EBG00000041276.
DR   EnsemblGenomes-Gn; EBG00000041277.
DR   EnsemblGenomes-Gn; EBG00000041278.
DR   EnsemblGenomes-Gn; EBG00000041279.
DR   EnsemblGenomes-Gn; EBG00000041280.
DR   EnsemblGenomes-Gn; EBG00000041281.
DR   EnsemblGenomes-Gn; EBG00000041282.
DR   EnsemblGenomes-Gn; EBG00000041283.
DR   EnsemblGenomes-Gn; EBG00000041284.
DR   EnsemblGenomes-Gn; EBG00000041285.
DR   EnsemblGenomes-Gn; EBG00000041286.
DR   EnsemblGenomes-Gn; EBG00000041287.
DR   EnsemblGenomes-Gn; EBG00000041288.
DR   EnsemblGenomes-Gn; EBG00000041289.
DR   EnsemblGenomes-Gn; EBG00000041290.
DR   EnsemblGenomes-Gn; EBG00000041291.
DR   EnsemblGenomes-Gn; EBG00000041292.
DR   EnsemblGenomes-Gn; EBG00000041293.
DR   EnsemblGenomes-Gn; EBG00000041294.
DR   EnsemblGenomes-Gn; EBG00000041295.
DR   EnsemblGenomes-Gn; EBG00000041296.
DR   EnsemblGenomes-Gn; EBG00000041297.
DR   EnsemblGenomes-Gn; EBG00000041298.
DR   EnsemblGenomes-Gn; EBG00000041299.
DR   EnsemblGenomes-Gn; EBG00000041300.
DR   EnsemblGenomes-Gn; EBG00000041301.
DR   EnsemblGenomes-Gn; EBG00001131121.
DR   EnsemblGenomes-Gn; EBG00001131122.
DR   EnsemblGenomes-Gn; EBG00001131123.
DR   EnsemblGenomes-Gn; EBG00001131124.
DR   EnsemblGenomes-Gn; EBG00001131125.
DR   EnsemblGenomes-Gn; EBG00001131126.
DR   EnsemblGenomes-Gn; EBG00001131127.
DR   EnsemblGenomes-Gn; EBG00001131128.
DR   EnsemblGenomes-Gn; EBG00001131129.
DR   EnsemblGenomes-Gn; EBG00001131130.
DR   EnsemblGenomes-Gn; EBG00001131131.
DR   EnsemblGenomes-Gn; EBG00001131132.
DR   EnsemblGenomes-Gn; EBG00001131133.
DR   EnsemblGenomes-Gn; EBG00001131134.
DR   EnsemblGenomes-Gn; EBG00001131135.
DR   EnsemblGenomes-Gn; EBG00001131136.
DR   EnsemblGenomes-Gn; EBG00001131137.
DR   EnsemblGenomes-Gn; EBG00001131138.
DR   EnsemblGenomes-Gn; EBG00001131139.
DR   EnsemblGenomes-Gn; EBG00001131140.
DR   EnsemblGenomes-Gn; EBG00001131141.
DR   EnsemblGenomes-Gn; EBG00001131142.
DR   EnsemblGenomes-Gn; EBG00001131143.
DR   EnsemblGenomes-Gn; EBG00001131144.
DR   EnsemblGenomes-Gn; EBG00001131145.
DR   EnsemblGenomes-Gn; EBG00001131146.
DR   EnsemblGenomes-Gn; EBG00001131147.
DR   EnsemblGenomes-Gn; EBG00001131148.
DR   EnsemblGenomes-Gn; EBG00001131149.
DR   EnsemblGenomes-Gn; EBG00001131150.
DR   EnsemblGenomes-Gn; EBG00001131151.
DR   EnsemblGenomes-Gn; EBG00001131152.
DR   EnsemblGenomes-Gn; EBG00001131153.
DR   EnsemblGenomes-Gn; EBG00001131154.
DR   EnsemblGenomes-Gn; EBG00001131155.
DR   EnsemblGenomes-Gn; EBG00001131156.
DR   EnsemblGenomes-Gn; EBG00001131157.
DR   EnsemblGenomes-Gn; EBG00001131158.
DR   EnsemblGenomes-Gn; EBG00001131159.
DR   EnsemblGenomes-Gn; EBG00001131160.
DR   EnsemblGenomes-Gn; EBG00001131161.
DR   EnsemblGenomes-Gn; EBG00001131162.
DR   EnsemblGenomes-Gn; EBG00001131163.
DR   EnsemblGenomes-Gn; EBG00001131164.
DR   EnsemblGenomes-Gn; EBG00001131165.
DR   EnsemblGenomes-Gn; EBG00001131166.
DR   EnsemblGenomes-Gn; EBG00001131167.
DR   EnsemblGenomes-Gn; EBG00001131168.
DR   EnsemblGenomes-Gn; EBG00001131169.
DR   EnsemblGenomes-Gn; EBG00001131170.
DR   EnsemblGenomes-Gn; EBG00001131171.
DR   EnsemblGenomes-Gn; EBG00001131172.
DR   EnsemblGenomes-Gn; EBG00001131173.
DR   EnsemblGenomes-Gn; EBG00001131174.
DR   EnsemblGenomes-Gn; EBG00001131175.
DR   EnsemblGenomes-Gn; EBG00001131176.
DR   EnsemblGenomes-Gn; EBG00001131177.
DR   EnsemblGenomes-Gn; EBG00001131178.
DR   EnsemblGenomes-Gn; EBG00001131179.
DR   EnsemblGenomes-Gn; EBG00001131180.
DR   EnsemblGenomes-Gn; EBG00001131181.
DR   EnsemblGenomes-Gn; EBG00001131182.
DR   EnsemblGenomes-Gn; EBG00001131183.
DR   EnsemblGenomes-Gn; EBG00001131184.
DR   EnsemblGenomes-Gn; EBG00001131185.
DR   EnsemblGenomes-Gn; EBG00001131186.
DR   EnsemblGenomes-Gn; EBG00001131187.
DR   EnsemblGenomes-Gn; EBG00001131188.
DR   EnsemblGenomes-Gn; EBG00001131189.
DR   EnsemblGenomes-Gn; EBG00001131190.
DR   EnsemblGenomes-Gn; EBG00001131191.
DR   EnsemblGenomes-Gn; EBG00001131192.
DR   EnsemblGenomes-Gn; EBG00001131193.
DR   EnsemblGenomes-Gn; EBG00001131194.
DR   EnsemblGenomes-Gn; EBG00001131195.
DR   EnsemblGenomes-Gn; EBG00001131196.
DR   EnsemblGenomes-Gn; EBG00001131197.
DR   EnsemblGenomes-Gn; EBG00001131198.
DR   EnsemblGenomes-Gn; EBG00001131199.
DR   EnsemblGenomes-Gn; EBG00001131200.
DR   EnsemblGenomes-Gn; EBG00001131201.
DR   EnsemblGenomes-Gn; EBG00001131202.
DR   EnsemblGenomes-Gn; EBG00001131203.
DR   EnsemblGenomes-Gn; EBG00001131204.
DR   EnsemblGenomes-Gn; EBG00001131205.
DR   EnsemblGenomes-Gn; EBG00001131206.
DR   EnsemblGenomes-Gn; EBG00001131207.
DR   EnsemblGenomes-Gn; EBG00001131208.
DR   EnsemblGenomes-Gn; EBG00001131209.
DR   EnsemblGenomes-Gn; EBG00001131210.
DR   EnsemblGenomes-Gn; EBG00001131211.
DR   EnsemblGenomes-Gn; EBG00001131212.
DR   EnsemblGenomes-Gn; EBG00001131213.
DR   EnsemblGenomes-Gn; EBG00001131214.
DR   EnsemblGenomes-Gn; EBG00001131215.
DR   EnsemblGenomes-Gn; EBG00001131216.
DR   EnsemblGenomes-Gn; EBG00001131217.
DR   EnsemblGenomes-Gn; EBG00001131218.
DR   EnsemblGenomes-Gn; EBG00001131219.
DR   EnsemblGenomes-Gn; EBG00001131220.
DR   EnsemblGenomes-Gn; EBG00001131221.
DR   EnsemblGenomes-Gn; EBG00001131222.
DR   EnsemblGenomes-Gn; EBG00001131223.
DR   EnsemblGenomes-Gn; EBG00001131224.
DR   EnsemblGenomes-Gn; EBG00001131225.
DR   EnsemblGenomes-Gn; EBG00001131226.
DR   EnsemblGenomes-Gn; EBG00001131227.
DR   EnsemblGenomes-Gn; EBG00001131228.
DR   EnsemblGenomes-Gn; EBG00001131229.
DR   EnsemblGenomes-Gn; EBG00001131230.
DR   EnsemblGenomes-Gn; EBG00001131231.
DR   EnsemblGenomes-Gn; EBG00001131232.
DR   EnsemblGenomes-Gn; EBG00001131233.
DR   EnsemblGenomes-Gn; EBG00001131234.
DR   EnsemblGenomes-Gn; EBG00001131235.
DR   EnsemblGenomes-Gn; EBG00001131236.
DR   EnsemblGenomes-Gn; EBG00001131237.
DR   EnsemblGenomes-Gn; EBG00001131238.
DR   EnsemblGenomes-Gn; EBG00001131239.
DR   EnsemblGenomes-Gn; EBG00001131240.
DR   EnsemblGenomes-Gn; EBG00001131241.
DR   EnsemblGenomes-Gn; EBG00001131242.
DR   EnsemblGenomes-Gn; EBG00001131243.
DR   EnsemblGenomes-Gn; EBG00001131244.
DR   EnsemblGenomes-Gn; EBG00001131245.
DR   EnsemblGenomes-Gn; EBG00001131246.
DR   EnsemblGenomes-Gn; EBG00001131247.
DR   EnsemblGenomes-Gn; EBG00001131248.
DR   EnsemblGenomes-Gn; EBG00001131249.
DR   EnsemblGenomes-Gn; EBG00001131250.
DR   EnsemblGenomes-Gn; EBG00001131251.
DR   EnsemblGenomes-Gn; EBG00001131252.
DR   EnsemblGenomes-Gn; EBG00001131253.
DR   EnsemblGenomes-Gn; EBG00001131254.
DR   EnsemblGenomes-Gn; EBG00001131255.
DR   EnsemblGenomes-Gn; EBG00001131256.
DR   EnsemblGenomes-Gn; EBG00001131257.
DR   EnsemblGenomes-Gn; EBG00001131258.
DR   EnsemblGenomes-Gn; EBG00001131259.
DR   EnsemblGenomes-Gn; EBG00001131260.
DR   EnsemblGenomes-Gn; EBG00001131261.
DR   EnsemblGenomes-Gn; EBG00001131262.
DR   EnsemblGenomes-Gn; EBG00001131263.
DR   EnsemblGenomes-Gn; EBG00001131264.
DR   EnsemblGenomes-Gn; EBG00001131265.
DR   EnsemblGenomes-Gn; EBG00001131266.
DR   EnsemblGenomes-Gn; EBG00001131267.
DR   EnsemblGenomes-Gn; EBG00001131268.
DR   EnsemblGenomes-Gn; EBG00001131269.
DR   EnsemblGenomes-Gn; EBG00001131270.
DR   EnsemblGenomes-Gn; EBG00001131271.
DR   EnsemblGenomes-Gn; EBG00001131272.
DR   EnsemblGenomes-Gn; EBG00001131273.
DR   EnsemblGenomes-Gn; EBG00001131274.
DR   EnsemblGenomes-Gn; EBG00001131275.
DR   EnsemblGenomes-Gn; EBG00001131276.
DR   EnsemblGenomes-Gn; EBG00001131277.
DR   EnsemblGenomes-Gn; EBG00001131278.
DR   EnsemblGenomes-Gn; EBG00001131279.
DR   EnsemblGenomes-Gn; EBG00001131280.
DR   EnsemblGenomes-Gn; EBG00001131281.
DR   EnsemblGenomes-Gn; EBG00001131282.
DR   EnsemblGenomes-Gn; EBG00001131283.
DR   EnsemblGenomes-Gn; EBG00001131284.
DR   EnsemblGenomes-Gn; EBG00001131285.
DR   EnsemblGenomes-Gn; EBG00001131286.
DR   EnsemblGenomes-Gn; EBG00001131287.
DR   EnsemblGenomes-Gn; EBG00001131288.
DR   EnsemblGenomes-Gn; EBG00001131289.
DR   EnsemblGenomes-Gn; EBG00001131290.
DR   EnsemblGenomes-Gn; EBG00001131291.
DR   EnsemblGenomes-Gn; EBG00001131292.
DR   EnsemblGenomes-Gn; EBG00001131293.
DR   EnsemblGenomes-Gn; EBG00001131294.
DR   EnsemblGenomes-Gn; EBG00001131295.
DR   EnsemblGenomes-Gn; EBG00001131296.
DR   EnsemblGenomes-Gn; EBG00001131297.
DR   EnsemblGenomes-Gn; EBG00001131298.
DR   EnsemblGenomes-Gn; EBG00001131299.
DR   EnsemblGenomes-Gn; EBG00001131300.
DR   EnsemblGenomes-Gn; EBG00001131301.
DR   EnsemblGenomes-Gn; EBG00001131302.
DR   EnsemblGenomes-Gn; EBG00001131303.
DR   EnsemblGenomes-Gn; EBG00001131304.
DR   EnsemblGenomes-Gn; EBG00001131305.
DR   EnsemblGenomes-Gn; EBG00001131306.
DR   EnsemblGenomes-Gn; EBG00001131307.
DR   EnsemblGenomes-Gn; EBG00001131308.
DR   EnsemblGenomes-Gn; EBG00001131309.
DR   EnsemblGenomes-Gn; EBG00001131310.
DR   EnsemblGenomes-Gn; EBG00001131311.
DR   EnsemblGenomes-Gn; EBG00001131312.
DR   EnsemblGenomes-Gn; EBG00001131313.
DR   EnsemblGenomes-Gn; EBG00001131314.
DR   EnsemblGenomes-Gn; EBG00001131315.
DR   EnsemblGenomes-Gn; EBG00001131316.
DR   EnsemblGenomes-Gn; EBG00001131317.
DR   EnsemblGenomes-Gn; EBG00001131318.
DR   EnsemblGenomes-Gn; EBG00001131319.
DR   EnsemblGenomes-Gn; EBG00001131320.
DR   EnsemblGenomes-Gn; EBG00001131321.
DR   EnsemblGenomes-Gn; EBG00001131322.
DR   EnsemblGenomes-Gn; EBG00001131323.
DR   EnsemblGenomes-Gn; EBG00001131324.
DR   EnsemblGenomes-Gn; EBG00001131325.
DR   EnsemblGenomes-Gn; EBG00001131326.
DR   EnsemblGenomes-Gn; EBG00001131327.
DR   EnsemblGenomes-Gn; EBG00001131328.
DR   EnsemblGenomes-Gn; EBG00001131329.
DR   EnsemblGenomes-Gn; EBG00001131330.
DR   EnsemblGenomes-Gn; EBG00001131331.
DR   EnsemblGenomes-Gn; EBG00001131332.
DR   EnsemblGenomes-Gn; EBG00001131333.
DR   EnsemblGenomes-Gn; EBG00001131334.
DR   EnsemblGenomes-Gn; EBG00001131335.
DR   EnsemblGenomes-Gn; EBG00001131336.
DR   EnsemblGenomes-Gn; EBG00001131337.
DR   EnsemblGenomes-Gn; EBG00001131338.
DR   EnsemblGenomes-Gn; EBG00001131339.
DR   EnsemblGenomes-Gn; EBG00001131340.
DR   EnsemblGenomes-Gn; EBG00001131341.
DR   EnsemblGenomes-Gn; EBG00001131342.
DR   EnsemblGenomes-Gn; EBG00001131343.
DR   EnsemblGenomes-Gn; EBG00001131344.
DR   EnsemblGenomes-Gn; EBG00001131345.
DR   EnsemblGenomes-Gn; EBG00001131346.
DR   EnsemblGenomes-Gn; EBG00001131347.
DR   EnsemblGenomes-Gn; EBG00001131348.
DR   EnsemblGenomes-Gn; EBG00001131349.
DR   EnsemblGenomes-Gn; EBG00001131350.
DR   EnsemblGenomes-Gn; EBG00001131351.
DR   EnsemblGenomes-Gn; EBG00001131352.
DR   EnsemblGenomes-Gn; EBG00001131353.
DR   EnsemblGenomes-Tr; EBG00000041243-1.
DR   EnsemblGenomes-Tr; EBG00000041244-1.
DR   EnsemblGenomes-Tr; EBG00000041245-1.
DR   EnsemblGenomes-Tr; EBG00000041246-1.
DR   EnsemblGenomes-Tr; EBG00000041247-1.
DR   EnsemblGenomes-Tr; EBG00000041248-1.
DR   EnsemblGenomes-Tr; EBG00000041249-1.
DR   EnsemblGenomes-Tr; EBG00000041250-1.
DR   EnsemblGenomes-Tr; EBG00000041251-1.
DR   EnsemblGenomes-Tr; EBG00000041252-1.
DR   EnsemblGenomes-Tr; EBG00000041253-1.
DR   EnsemblGenomes-Tr; EBG00000041254-1.
DR   EnsemblGenomes-Tr; EBG00000041255-1.
DR   EnsemblGenomes-Tr; EBG00000041256-1.
DR   EnsemblGenomes-Tr; EBG00000041257-1.
DR   EnsemblGenomes-Tr; EBG00000041258-1.
DR   EnsemblGenomes-Tr; EBG00000041259-1.
DR   EnsemblGenomes-Tr; EBG00000041260-1.
DR   EnsemblGenomes-Tr; EBG00000041261-1.
DR   EnsemblGenomes-Tr; EBG00000041262-1.
DR   EnsemblGenomes-Tr; EBG00000041263-1.
DR   EnsemblGenomes-Tr; EBG00000041264-1.
DR   EnsemblGenomes-Tr; EBG00000041265-1.
DR   EnsemblGenomes-Tr; EBG00000041266-1.
DR   EnsemblGenomes-Tr; EBG00000041267-1.
DR   EnsemblGenomes-Tr; EBG00000041268-1.
DR   EnsemblGenomes-Tr; EBG00000041269-1.
DR   EnsemblGenomes-Tr; EBG00000041270-1.
DR   EnsemblGenomes-Tr; EBG00000041271-1.
DR   EnsemblGenomes-Tr; EBG00000041272-1.
DR   EnsemblGenomes-Tr; EBG00000041273-1.
DR   EnsemblGenomes-Tr; EBG00000041274-1.
DR   EnsemblGenomes-Tr; EBG00000041275-1.
DR   EnsemblGenomes-Tr; EBG00000041276-1.
DR   EnsemblGenomes-Tr; EBG00000041277-1.
DR   EnsemblGenomes-Tr; EBG00000041278-1.
DR   EnsemblGenomes-Tr; EBG00000041279-1.
DR   EnsemblGenomes-Tr; EBG00000041280-1.
DR   EnsemblGenomes-Tr; EBG00000041281-1.
DR   EnsemblGenomes-Tr; EBG00000041282-1.
DR   EnsemblGenomes-Tr; EBG00000041283-1.
DR   EnsemblGenomes-Tr; EBG00000041284-1.
DR   EnsemblGenomes-Tr; EBG00000041285-1.
DR   EnsemblGenomes-Tr; EBG00000041286-1.
DR   EnsemblGenomes-Tr; EBG00000041287-1.
DR   EnsemblGenomes-Tr; EBG00000041288-1.
DR   EnsemblGenomes-Tr; EBG00000041289-1.
DR   EnsemblGenomes-Tr; EBG00000041290-1.
DR   EnsemblGenomes-Tr; EBG00000041291-1.
DR   EnsemblGenomes-Tr; EBG00000041292-1.
DR   EnsemblGenomes-Tr; EBG00000041293-1.
DR   EnsemblGenomes-Tr; EBG00000041294-1.
DR   EnsemblGenomes-Tr; EBG00000041295-1.
DR   EnsemblGenomes-Tr; EBG00000041296-1.
DR   EnsemblGenomes-Tr; EBG00000041297-1.
DR   EnsemblGenomes-Tr; EBG00000041298-1.
DR   EnsemblGenomes-Tr; EBG00000041299-1.
DR   EnsemblGenomes-Tr; EBG00000041300-1.
DR   EnsemblGenomes-Tr; EBG00000041301-1.
DR   EnsemblGenomes-Tr; EBT00001722293.
DR   EnsemblGenomes-Tr; EBT00001722294.
DR   EnsemblGenomes-Tr; EBT00001722295.
DR   EnsemblGenomes-Tr; EBT00001722296.
DR   EnsemblGenomes-Tr; EBT00001722297.
DR   EnsemblGenomes-Tr; EBT00001722298.
DR   EnsemblGenomes-Tr; EBT00001722299.
DR   EnsemblGenomes-Tr; EBT00001722300.
DR   EnsemblGenomes-Tr; EBT00001722301.
DR   EnsemblGenomes-Tr; EBT00001722302.
DR   EnsemblGenomes-Tr; EBT00001722303.
DR   EnsemblGenomes-Tr; EBT00001722304.
DR   EnsemblGenomes-Tr; EBT00001722305.
DR   EnsemblGenomes-Tr; EBT00001722306.
DR   EnsemblGenomes-Tr; EBT00001722307.
DR   EnsemblGenomes-Tr; EBT00001722308.
DR   EnsemblGenomes-Tr; EBT00001722309.
DR   EnsemblGenomes-Tr; EBT00001722310.
DR   EnsemblGenomes-Tr; EBT00001722311.
DR   EnsemblGenomes-Tr; EBT00001722312.
DR   EnsemblGenomes-Tr; EBT00001722313.
DR   EnsemblGenomes-Tr; EBT00001722314.
DR   EnsemblGenomes-Tr; EBT00001722315.
DR   EnsemblGenomes-Tr; EBT00001722316.
DR   EnsemblGenomes-Tr; EBT00001722317.
DR   EnsemblGenomes-Tr; EBT00001722318.
DR   EnsemblGenomes-Tr; EBT00001722319.
DR   EnsemblGenomes-Tr; EBT00001722320.
DR   EnsemblGenomes-Tr; EBT00001722321.
DR   EnsemblGenomes-Tr; EBT00001722322.
DR   EnsemblGenomes-Tr; EBT00001722323.
DR   EnsemblGenomes-Tr; EBT00001722324.
DR   EnsemblGenomes-Tr; EBT00001722325.
DR   EnsemblGenomes-Tr; EBT00001722326.
DR   EnsemblGenomes-Tr; EBT00001722327.
DR   EnsemblGenomes-Tr; EBT00001722328.
DR   EnsemblGenomes-Tr; EBT00001722329.
DR   EnsemblGenomes-Tr; EBT00001722330.
DR   EnsemblGenomes-Tr; EBT00001722331.
DR   EnsemblGenomes-Tr; EBT00001722332.
DR   EnsemblGenomes-Tr; EBT00001722333.
DR   EnsemblGenomes-Tr; EBT00001722334.
DR   EnsemblGenomes-Tr; EBT00001722335.
DR   EnsemblGenomes-Tr; EBT00001722336.
DR   EnsemblGenomes-Tr; EBT00001722337.
DR   EnsemblGenomes-Tr; EBT00001722338.
DR   EnsemblGenomes-Tr; EBT00001722339.
DR   EnsemblGenomes-Tr; EBT00001722340.
DR   EnsemblGenomes-Tr; EBT00001722341.
DR   EnsemblGenomes-Tr; EBT00001722342.
DR   EnsemblGenomes-Tr; EBT00001722343.
DR   EnsemblGenomes-Tr; EBT00001722344.
DR   EnsemblGenomes-Tr; EBT00001722345.
DR   EnsemblGenomes-Tr; EBT00001722346.
DR   EnsemblGenomes-Tr; EBT00001722347.
DR   EnsemblGenomes-Tr; EBT00001722348.
DR   EnsemblGenomes-Tr; EBT00001722349.
DR   EnsemblGenomes-Tr; EBT00001722350.
DR   EnsemblGenomes-Tr; EBT00001722351.
DR   EnsemblGenomes-Tr; EBT00001722352.
DR   EnsemblGenomes-Tr; EBT00001722353.
DR   EnsemblGenomes-Tr; EBT00001722354.
DR   EnsemblGenomes-Tr; EBT00001722355.
DR   EnsemblGenomes-Tr; EBT00001722356.
DR   EnsemblGenomes-Tr; EBT00001722357.
DR   EnsemblGenomes-Tr; EBT00001722358.
DR   EnsemblGenomes-Tr; EBT00001722359.
DR   EnsemblGenomes-Tr; EBT00001722360.
DR   EnsemblGenomes-Tr; EBT00001722361.
DR   EnsemblGenomes-Tr; EBT00001722362.
DR   EnsemblGenomes-Tr; EBT00001722363.
DR   EnsemblGenomes-Tr; EBT00001722364.
DR   EnsemblGenomes-Tr; EBT00001722365.
DR   EnsemblGenomes-Tr; EBT00001722366.
DR   EnsemblGenomes-Tr; EBT00001722367.
DR   EnsemblGenomes-Tr; EBT00001722368.
DR   EnsemblGenomes-Tr; EBT00001722369.
DR   EnsemblGenomes-Tr; EBT00001722370.
DR   EnsemblGenomes-Tr; EBT00001722371.
DR   EnsemblGenomes-Tr; EBT00001722372.
DR   EnsemblGenomes-Tr; EBT00001722373.
DR   EnsemblGenomes-Tr; EBT00001722374.
DR   EnsemblGenomes-Tr; EBT00001722375.
DR   EnsemblGenomes-Tr; EBT00001722376.
DR   EnsemblGenomes-Tr; EBT00001722377.
DR   EnsemblGenomes-Tr; EBT00001722378.
DR   EnsemblGenomes-Tr; EBT00001722379.
DR   EnsemblGenomes-Tr; EBT00001722380.
DR   EnsemblGenomes-Tr; EBT00001722381.
DR   EnsemblGenomes-Tr; EBT00001722382.
DR   EnsemblGenomes-Tr; EBT00001722383.
DR   EnsemblGenomes-Tr; EBT00001722384.
DR   EnsemblGenomes-Tr; EBT00001722385.
DR   EnsemblGenomes-Tr; EBT00001722386.
DR   EnsemblGenomes-Tr; EBT00001722387.
DR   EnsemblGenomes-Tr; EBT00001722388.
DR   EnsemblGenomes-Tr; EBT00001722389.
DR   EnsemblGenomes-Tr; EBT00001722390.
DR   EnsemblGenomes-Tr; EBT00001722391.
DR   EnsemblGenomes-Tr; EBT00001722392.
DR   EnsemblGenomes-Tr; EBT00001722393.
DR   EnsemblGenomes-Tr; EBT00001722394.
DR   EnsemblGenomes-Tr; EBT00001722395.
DR   EnsemblGenomes-Tr; EBT00001722396.
DR   EnsemblGenomes-Tr; EBT00001722397.
DR   EnsemblGenomes-Tr; EBT00001722398.
DR   EnsemblGenomes-Tr; EBT00001722399.
DR   EnsemblGenomes-Tr; EBT00001722400.
DR   EnsemblGenomes-Tr; EBT00001722401.
DR   EnsemblGenomes-Tr; EBT00001722402.
DR   EnsemblGenomes-Tr; EBT00001722403.
DR   EnsemblGenomes-Tr; EBT00001722404.
DR   EnsemblGenomes-Tr; EBT00001722405.
DR   EnsemblGenomes-Tr; EBT00001722406.
DR   EnsemblGenomes-Tr; EBT00001722407.
DR   EnsemblGenomes-Tr; EBT00001722408.
DR   EnsemblGenomes-Tr; EBT00001722409.
DR   EnsemblGenomes-Tr; EBT00001722410.
DR   EnsemblGenomes-Tr; EBT00001722411.
DR   EnsemblGenomes-Tr; EBT00001722412.
DR   EnsemblGenomes-Tr; EBT00001722413.
DR   EnsemblGenomes-Tr; EBT00001722414.
DR   EnsemblGenomes-Tr; EBT00001722415.
DR   EnsemblGenomes-Tr; EBT00001722416.
DR   EnsemblGenomes-Tr; EBT00001722417.
DR   EnsemblGenomes-Tr; EBT00001722418.
DR   EnsemblGenomes-Tr; EBT00001722419.
DR   EnsemblGenomes-Tr; EBT00001722420.
DR   EnsemblGenomes-Tr; EBT00001722421.
DR   EnsemblGenomes-Tr; EBT00001722422.
DR   EnsemblGenomes-Tr; EBT00001722423.
DR   EnsemblGenomes-Tr; EBT00001722424.
DR   EnsemblGenomes-Tr; EBT00001722425.
DR   EnsemblGenomes-Tr; EBT00001722426.
DR   EnsemblGenomes-Tr; EBT00001722427.
DR   EnsemblGenomes-Tr; EBT00001722428.
DR   EnsemblGenomes-Tr; EBT00001722429.
DR   EnsemblGenomes-Tr; EBT00001722430.
DR   EnsemblGenomes-Tr; EBT00001722431.
DR   EnsemblGenomes-Tr; EBT00001722432.
DR   EnsemblGenomes-Tr; EBT00001722433.
DR   EnsemblGenomes-Tr; EBT00001722434.
DR   EnsemblGenomes-Tr; EBT00001722435.
DR   EnsemblGenomes-Tr; EBT00001722436.
DR   EnsemblGenomes-Tr; EBT00001722437.
DR   EnsemblGenomes-Tr; EBT00001722438.
DR   EnsemblGenomes-Tr; EBT00001722439.
DR   EnsemblGenomes-Tr; EBT00001722440.
DR   EnsemblGenomes-Tr; EBT00001722441.
DR   EnsemblGenomes-Tr; EBT00001722442.
DR   EnsemblGenomes-Tr; EBT00001722443.
DR   EnsemblGenomes-Tr; EBT00001722444.
DR   EnsemblGenomes-Tr; EBT00001722445.
DR   EnsemblGenomes-Tr; EBT00001722446.
DR   EnsemblGenomes-Tr; EBT00001722447.
DR   EnsemblGenomes-Tr; EBT00001722448.
DR   EnsemblGenomes-Tr; EBT00001722449.
DR   EnsemblGenomes-Tr; EBT00001722450.
DR   EnsemblGenomes-Tr; EBT00001722451.
DR   EnsemblGenomes-Tr; EBT00001722452.
DR   EnsemblGenomes-Tr; EBT00001722453.
DR   EnsemblGenomes-Tr; EBT00001722454.
DR   EnsemblGenomes-Tr; EBT00001722455.
DR   EnsemblGenomes-Tr; EBT00001722456.
DR   EnsemblGenomes-Tr; EBT00001722457.
DR   EnsemblGenomes-Tr; EBT00001722458.
DR   EnsemblGenomes-Tr; EBT00001722459.
DR   EnsemblGenomes-Tr; EBT00001722460.
DR   EnsemblGenomes-Tr; EBT00001722461.
DR   EnsemblGenomes-Tr; EBT00001722462.
DR   EnsemblGenomes-Tr; EBT00001722463.
DR   EnsemblGenomes-Tr; EBT00001722464.
DR   EnsemblGenomes-Tr; EBT00001722465.
DR   EnsemblGenomes-Tr; EBT00001722466.
DR   EnsemblGenomes-Tr; EBT00001722467.
DR   EnsemblGenomes-Tr; EBT00001722468.
DR   EnsemblGenomes-Tr; EBT00001722469.
DR   EnsemblGenomes-Tr; EBT00001722470.
DR   EnsemblGenomes-Tr; EBT00001722471.
DR   EnsemblGenomes-Tr; EBT00001722472.
DR   EnsemblGenomes-Tr; EBT00001722473.
DR   EnsemblGenomes-Tr; EBT00001722474.
DR   EnsemblGenomes-Tr; EBT00001722475.
DR   EnsemblGenomes-Tr; EBT00001722476.
DR   EnsemblGenomes-Tr; EBT00001722477.
DR   EnsemblGenomes-Tr; EBT00001722478.
DR   EnsemblGenomes-Tr; EBT00001722479.
DR   EnsemblGenomes-Tr; EBT00001722480.
DR   EnsemblGenomes-Tr; EBT00001722481.
DR   EnsemblGenomes-Tr; EBT00001722482.
DR   EnsemblGenomes-Tr; EBT00001722483.
DR   EnsemblGenomes-Tr; EBT00001722484.
DR   EnsemblGenomes-Tr; EBT00001722485.
DR   EnsemblGenomes-Tr; EBT00001722486.
DR   EnsemblGenomes-Tr; EBT00001722487.
DR   EnsemblGenomes-Tr; EBT00001722488.
DR   EnsemblGenomes-Tr; EBT00001722489.
DR   EnsemblGenomes-Tr; EBT00001722490.
DR   EnsemblGenomes-Tr; EBT00001722491.
DR   EnsemblGenomes-Tr; EBT00001722492.
DR   EnsemblGenomes-Tr; EBT00001722493.
DR   EnsemblGenomes-Tr; EBT00001722494.
DR   EnsemblGenomes-Tr; EBT00001722495.
DR   EnsemblGenomes-Tr; EBT00001722496.
DR   EnsemblGenomes-Tr; EBT00001722497.
DR   EnsemblGenomes-Tr; EBT00001722499.
DR   EnsemblGenomes-Tr; EBT00001722500.
DR   EnsemblGenomes-Tr; EBT00001722502.
DR   EnsemblGenomes-Tr; EBT00001722504.
DR   EnsemblGenomes-Tr; EBT00001722506.
DR   EnsemblGenomes-Tr; EBT00001722509.
DR   EnsemblGenomes-Tr; EBT00001722510.
DR   EnsemblGenomes-Tr; EBT00001722513.
DR   EnsemblGenomes-Tr; EBT00001722515.
DR   EnsemblGenomes-Tr; EBT00001722516.
DR   EnsemblGenomes-Tr; EBT00001722518.
DR   EnsemblGenomes-Tr; EBT00001722520.
DR   EnsemblGenomes-Tr; EBT00001722522.
DR   EnsemblGenomes-Tr; EBT00001722525.
DR   EnsemblGenomes-Tr; EBT00001722528.
DR   EnsemblGenomes-Tr; EBT00001722530.
DR   EnsemblGenomes-Tr; EBT00001722532.
DR   EnsemblGenomes-Tr; EBT00001722534.
DR   EnsemblGenomes-Tr; EBT00001722536.
DR   EnsemblGenomes-Tr; EBT00001722538.
DR   EnsemblGenomes-Tr; EBT00001722540.
DR   EnsemblGenomes-Tr; EBT00001722541.
DR   EnsemblGenomes-Tr; EBT00001722543.
DR   EnsemblGenomes-Tr; EBT00001722546.
DR   EnsemblGenomes-Tr; EBT00001722548.
DR   EnsemblGenomes-Tr; EBT00001722550.
DR   EnsemblGenomes-Tr; EBT00001722552.
DR   EnsemblGenomes-Tr; EBT00001722554.
DR   EuropePMC; PMC2772435; 19749062.
DR   EuropePMC; PMC3036861; 21637492.
DR   EuropePMC; PMC3131649; 21515727.
DR   EuropePMC; PMC3364877; 22404966.
DR   EuropePMC; PMC4235730; 25437615.
DR   EuropePMC; PMC4907191; 27107122.
DR   EuropePMC; PMC5505973; 28698641.
DR   EuropePMC; PMC6037387; 29864161.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02222; sX2.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02224; sX5.
DR   RFAM; RF02225; sX6.
DR   RFAM; RF02226; sX7.
DR   RFAM; RF02228; sX9.
DR   RFAM; RF02230; sX11.
DR   RFAM; RF02231; sX12.
DR   RFAM; RF02232; sX13.
DR   RFAM; RF02233; sX14.
DR   RFAM; RF02235; asX1.
DR   RFAM; RF02237; asX3.
DR   RFAM; RF02238; asX4.
DR   RFAM; RF02240; Xoo1.
DR   RFAM; RF02241; Xoo2.
DR   RFAM; RF02242; Xoo5.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; AP008229.
DR   SILVA-SSU; AP008229.
DR   StrainInfo; 373786; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4940217
FT                   /organism="Xanthomonas oryzae pv. oryzae MAFF 311018"
FT                   /strain="MAFF 311018"
FT                   /mol_type="genomic DNA"
FT                   /note="T7174"
FT                   /note="pathovar: oryzae"
FT                   /db_xref="taxon:342109"
FT   CDS_pept        41..1369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0001"
FT                   /product="chromosomal replication initiator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66756"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66756"
FT                   /db_xref="GOA:Q2P9M1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P9M1"
FT                   /protein_id="BAE66756.1"
FT                   /translation="MDAWPRCLERLEAEFPPEDVHTWLKPLQAEDRGDSIVLYAPNAFI
FT                   VDQVRERYLPRIRELLAYFAGNGEVALAVGSRPRAPEPAPAPVAATIAPQAAPIAPFAG
FT                   NLDSHYTFANFVEGRSNQLGLAAAIQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAAGNA
FT                   LRQAKPAAKVMYLRSEQFFSAMIRALQDKAMDQFKRQFQQIDALLIDDIQFFAGKDRTQ
FT                   EEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRAAIV
FT                   LAKARERGAEIPDDVAFLIAKKMRSNVRDLEGALNTLVARANFTGRSITVEFAQETLRD
FT                   LLRAQQQAIGIPNIQKTVADYYGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPE
FT                   IGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKLSE"
FT   CDS_pept        1647..2747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0002"
FT                   /product="DNA polymerase III beta chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66757"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66757"
FT                   /protein_id="BAE66757.1"
FT                   /translation="MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLT
FT                   GTDLEVEMIARTMAEDVQDGETTIPARKLFDILRALPDGSRVTISQTGDKVTVQAGRSR
FT                   FTLATLPANDFPSVDEVEATERVVVPEAGLKELIERTAFAMAQQDVRYYLNGLLFDLRD
FT                   GLLRCVATDGHRLALCEMELENAGGAKRQIIVPRKGVTELLRLLEGADREVELEVGRSH
FT                   IRVKRGDVTFTSKLIDGRFPDYEAVIPIGADREVKVDREALRASLQRAAILSNEKYRGV
FT                   RVEVSPGQLKISAHNPEQEEAQEEIEADTKVDDLAIGFNVNYLLDALSALRDEHVVIQL
FT                   RDANSSALVREASSEKSRHVVMPLRL"
FT   CDS_pept        3999..5087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0003"
FT                   /product="DNA replication and repair protein recF"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66758"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66758"
FT                   /db_xref="GOA:Q2P9L9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P9L9"
FT                   /protein_id="BAE66758.1"
FT                   /translation="MHVMRLSIHRLRRFQTVELHPASALNLLTGDNGAGKTSVLEALHL
FT                   MAYGRSFRGRVRDGLIQQGANDLEVFVEWKEGGSAAGERTRRAGLRHSGQEWTGRLDGE
FT                   DVAQLGSLCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHVEPDFLALWRRYVRALK
FT                   QRNALLKQGAQPRMLDAWDHELAESGETLTSRRMRYLERLQDRLIPVADVIAPSLGLSA
FT                   LTFAPGWKRHEVSLADALLLARDRDRQNGYTSQGPHRADWMPHFDVLPGKDALSRGQAK
FT                   LTALACLLAQAEDFAFERSEWPVIALDDLGSELDRHHQARVLHRLVSAPAQMLITGTEI
FT                   PPGLADAGALLHRFHVEHGQVD"
FT   CDS_pept        5219..7663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0004"
FT                   /product="DNA gyrase subunit B"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66759"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66759"
FT                   /protein_id="BAE66759.1"
FT                   /translation="MTDEQNTPPTPNGTYDSSKITVLRGLEAVRKRPGMYIGDVHDGTG
FT                   LHHMVFEVVDNSVDEALAGHADDIVAKILVDGSVAVSDNGRGVPVDIHKEEGVSAAEVI
FT                   LTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEHLWLDIWRDGFHYQQEYALGEPQYP
FT                   LKQLEASTKRGTTLRFKPSAAIFSDVEFHYDILARRLRELSFLNSGVKITLIDERGEGR
FT                   RDDFHYEGGIRSFVEHLAQLKSPLHPNVISVTGEHNGIVVDVALQWTDAYQETMYCFTN
FT                   NIPQKDGGTHLAGFRAALTRVLGTYIEQNGIAKQAKVALTGDDMREGMIAVLSVKVPDP
FT                   SFSSQTKEKLVSSDVRPAVENAFGARLQEFLQENPNEAKAITGKIVDAARAREAARKAR
FT                   DLTRRKGALDIAGLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRNRKNQAVLPLRG
FT                   KILNVERARFDRMLASDQVGTLITALGTGIGRDEYNPDKLRYHRIILMTDADVDGSHIR
FT                   TLLLTFFYRQMPELIERGYIYIGLPPLYKLKQGKSELYLKDDAALNAYLASNAVEGAAL
FT                   IPATDEPPITGEALEKLLLLFTSANEAIARTAHRYDPALLTALIDLPPLDVETLQAEGN
FT                   QHPALDALQAVLNRGTLGTARYQLRFDPATENAPATLVAIRRHMGEEFTQVLPMGAFES
FT                   GELRPLREVSLALHDLVREGAQIVRGNKSHSITSFAQAHAWLLDEAKKGRQVQRFKGLG
FT                   EMNAEQLWETTVNPDTRRLLQVRIEDAVAADQIFSTLMGDVVEPRRDFIEDNALKVSNL
FT                   DI"
FT   CDS_pept        7731..8567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66760"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66760"
FT                   /protein_id="BAE66760.1"
FT                   /translation="MSTDLPPPPAPRSVAGKPPLLPVLVGFWVDVLIAAGLLLSLSVAG
FT                   FALWGAVRGFSHVQAAKAQGLTPSPSEVMAAIGQPGVLVQLVTALVSTATPALLLYYWR
FT                   RRVTAAEQTASRAAARRASTWGWTALIAAAVFLLSNLVSVTATALGIKPVPTNLPLMEE
FT                   ALHQWPLALTLFAVVIAPAYEELLFRRVLFGRLLSAGRPWLGVVLSGAIFALVHEVPGI
FT                   SGNGPAAIAQLWLVYGSMGAAFAWLYWRTGTLWASIAAHGINNATALAALYFSGLG"
FT   CDS_pept        8754..9560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66761"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66761"
FT                   /protein_id="BAE66761.1"
FT                   /translation="MKAKLLTVFAVLALTACATTTSPTGRRQVVGGVSQQQLDQLGAQS
FT                   FAQTKAKEKVSTDVRQNAYVQCVVNSLVAQLPPQWRETKWETALFVDDEANAFALPGGK
FT                   VGVNTGIFTVAKTQDQLAAVLGHEIGHVISRHHEERITRHLGAQTGLGIIGALAGAAYG
FT                   DGVASAVNQVGGMTAQTVFLLPGSRAQESEADVVGQRLMAQAGFDPAQAVTLWQNMMAV
FT                   SGNRQPQWLSTHPDPANRIRELQTDVGQLEPVYQQAKQAGRVPRCG"
FT   CDS_pept        9837..11030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66762"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66762"
FT                   /protein_id="BAE66762.1"
FT                   /translation="MKLLNRKQALLSLFIAASLGGAVVTDAVAQSDRSSERASRKSKSG
FT                   KAEELYPQSTRQAPTIKPSSKLSSKLQKLIETFNKGEDYPGVRSQADEILANSAANAAD
FT                   KALAAQLAAQAAYNLDDTAAAKKYLQQAIGLNALDNNGQFQSMLMLAQLQLQDNQQAEG
FT                   LATLDKYLEESKSQRPEDLILKGQALYQAERYKEAIPVLKQAIAASPQPKDTWNQLLMA
FT                   SYAEAGQTGEAVAAAEALAAKTPNDKKAQLNLASMYMQADQMDKAAAVMDKLRAAGQLT
FT                   EEKEYKQLYSIYANTENKEKDVIAVINEGMQKGILKPDYQTYLALAQSYYYSDNVPKAI
FT                   ENWQKAAPLSKDGETYLNLAKALHSEGRIPEAKQAAQQAIAKGVKKPEEAKKIINLK"
FT   CDS_pept        11184..11855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0008"
FT                   /product="tonB protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66763"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66763"
FT                   /protein_id="BAE66763.1"
FT                   /translation="MTEQLVIHRHDYDAGNQGLSWARIIGIAFVIALHLTALMMLLIPA
FT                   VAPKAPAEKERTTMVTLVDAPPPPPPPPPPPPPEDKPPPPVKNLSPPKPSPVPPPPEAP
FT                   VVDVPEPRPSDIVTPPSPPTPPAQPSDIGASVDISSKNMNPPKYPPAAFRAGVQGEVIL
FT                   IVDVDANGNVTNVSVEKSSRNRDLDRAAMDAARKWKFNASTVNGQKAAGRARVPVNFAL
FT                   N"
FT   CDS_pept        11940..12701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0009"
FT                   /product="biopolymer transport ExbB protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66764"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66764"
FT                   /protein_id="BAE66764.1"
FT                   /translation="MLQEFFIAAAAGGSNPSAALSQMGFEHLITEMTSSPGDFAVSWVV
FT                   LITLISMSAASWYWTVINIFRATRLKGAADRVTTAFWDAPNAQDAIRAMEEQPASEPFS
FT                   KIALDAAQAAAHHQRAEGSTGGLGESLSRSEFVDRALRQAVTRESTKLQSGMTLLATVG
FT                   ATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAFN
FT                   FFSKVNSSVIAKFDTFAHDLHDFFATGSRVR"
FT   CDS_pept        12748..13170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0010"
FT                   /product="biopolymer transport ExbD1 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66765"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66765"
FT                   /protein_id="BAE66765.1"
FT                   /translation="MAFSSGNSGGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVE
FT                   LPQANLIQKEDAEKRAAPITLAVKEDGSLYWNDEPISKEALESRLSTAAQQTPQPPLNL
FT                   RGDRTTKMRTINEITKIAQGQGMLDVGFVATKVKGQ"
FT   CDS_pept        13174..13587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0011"
FT                   /product="biopolymer transport ExbD2 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66766"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66766"
FT                   /protein_id="BAE66766.1"
FT                   /translation="MAFSTGGSRGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVD
FT                   LPQRVLNPPPQTTEPPPPIDLRIDASNQVSWNNSPTPVDQLQQKMEEVVQADPTNQPEL
FT                   RIDANPDAEYEVMAKVLAAAKNAQMKKIGFMQQ"
FT   CDS_pept        complement(13883..14650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0012"
FT                   /product="pyridoxal phosphate biosynthetic protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66767"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66767"
FT                   /db_xref="GOA:Q2P9L0"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P9L0"
FT                   /protein_id="BAE66767.1"
FT                   /translation="MTIQLSVNVNKIAVLRNSRGGTDPDVLQAARTCIAAGAHGITVHP
FT                   RPDQRHIRAGDVLALSALTREHAVEFNIEGNPFAPPRAGYPGLLELCRATRPEQITLVP
FT                   DGDGQLTSDHGFDFAQDTTQLAELIAAFKAVGSRVSLFVDAGNPDIAGAAALGADRVEL
FT                   YTGPYAHAHASGQTDTALALFADAGRRASAAGLGINAGHDLSQANLGDFLAAVPGVLEV
FT                   SIGHALISEALYQGLEATVRAYVDILRGSQVGA"
FT   CDS_pept        complement(14661..14972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66768"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66768"
FT                   /protein_id="BAE66768.1"
FT                   /translation="MPDATLPPFNGELIMHWLFLLMALGALVLAFSTPHVWLLVVSLLV
FT                   ALLLLLLWTRGWFASRMDDTQRDTRSMIDPAELRRLRELAEARKSAALAAARDSEPQA"
FT   CDS_pept        complement(15005..16465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0014"
FT                   /product="cardiolipin synthetase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66769"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66769"
FT                   /protein_id="BAE66769.1"
FT                   /translation="MLAFAQGAWEWLATIPHIEALLLAAYVLYLLWIAGWIVLQKREPV
FT                   ATLSWVLSLAALPYLGLLIYYWLGPQKVKRQRLRRGRSRSGMESYSSVCPPDADCTELA
FT                   KIAQSTTGLAPSSATEVHWLVDGAATYAAIIEAMRGARDHIHLEYYIFQPDHSGTAICA
FT                   ALMERARAGVKVRLLMDAIGSSAMTRRALRTLREAGVETAWFHPSQLLKPFKRPWLNLR
FT                   THRKVIVIDGRVGFTGGINVTDDENEQVRQDAYRDLHVRLQGHVVRSLQLVFLEDWLYA
FT                   TGQGRAAFHGQQLWPDGVPTRAQGTVEAQVLVSGPDSSWEAIHRLMVAAIHEAKHRVWL
FT                   VTPYFVPGEAARMALTSAALGGLDVRLLVPRVSDSRLVTYAARSYFDELLEAGVRIYEY
FT                   GPRMLHTKALLADDDVCIAGSANFDSRSFRLNFELSMLFRDQAVAAEMAGLIGTDMAQA
FT                   QEVRFVRHRPLWRSRLPEAFARLLSPLL"
FT   CDS_pept        complement(16475..16870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66770"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66770"
FT                   /protein_id="BAE66770.1"
FT                   /translation="MVGIRLRHGLLLNSGWCHRDGAVYSIDCVEVWSACGAITDAVAFP
FT                   TNPKSTKLLNIAIIFIIKRSVSIPCCTSVTAFMAAVKPQSRRYLRRSSLIALDCDVRAS
FT                   CEQSRAFIGARAALRQSRRRSDRCGGS"
FT   CDS_pept        complement(17112..18122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0016"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66771"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66771"
FT                   /db_xref="GOA:Q2P9K6"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P9K6"
FT                   /protein_id="BAE66771.1"
FT                   /translation="MSRPSLTRFLIEEQHAGRIDAELRQLITIVSRACKRISIAVSKGA
FT                   LGGVLGDAGTGNVQGEAQKKLDVLSNDILLEANAWGGHLAACASEEMDHSQPVPEQYPS
FT                   GDFLLLFDPLDGSSNIDVNVSVGTIFSVLRAPKGTEKPGDEHFLQPGTQQVAAGYCIYG
FT                   PSTMLVLTLGHGTHAFTLEREEGSFLLTQANMRVPDETAEYAINMSNQRHWEPAMQAYV
FT                   GDLLAGKDGARGKDFNMRWIASMVADVHRILTRGGIFIYPWDKKDPSKPGKLRLMYEAN
FT                   PMSMLVEQAGGAATTGRERILDIQPTQLHQRVPVFLGSKNEVAAATRYHLDADKA"
FT   CDS_pept        complement(18394..19596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0017"
FT                   /product="aromatic-amino-acid aminotransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66772"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66772"
FT                   /protein_id="BAE66772.1"
FT                   /translation="MSFFANVEQVPGDPILGLTEAYNADSRPNKVNLGVGIYYDENGRI
FT                   PLLRAVHKIEQQLAQDTKPRGYLPIDGLAAYDKATQELLFGAESALLAAGRVATSQTVG
FT                   GSGALRVGADLLKKLLPTSTIAISNPSWENHRAVFGAAGFEVVDYTYFDAASHGLNFDG
FT                   MLADLAKLEPGTVVLLHACCHNPTGADLSKEQWKQVAGLLKERNLFPFVDIAYQGFDKG
FT                   IEADAHAVRLLAAEGIDSYVVASSYSKSFSLYGERVGALSVVSATAAEAKAVQSQVKRI
FT                   IRTIYSSPSTHGAALVAGVLTSPELRDVWEQELTEMRERIHALRAGLVEKLATLGAPEF
FT                   EFIQRQAGMFSYSGLTKTQMDRLRDEFAIYAVGTGRICVAALSQRNLDYVAQAVATVSR
FT                   M"
FT   CDS_pept        19738..21876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0018"
FT                   /product="iron transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66773"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66773"
FT                   /protein_id="BAE66773.1"
FT                   /translation="MSRLTVLAAACGLFATSATPPVLAADPAPPASTPIQRLPAVQVDA
FT                   ARVRGVDDFDLPASFTVVSADDDNRRGAQVSELLDGIPGLVARDRQNYAQDTQLSIRGF
FT                   GARSTFGVRGVRLLVDGIPASMPDGQGQLSHFNVLGAERVEVLRGPFSALYGNSSGGVL
FT                   QLWSADGAPNDPWRLRATYGSNATVDVGTQLLGQQGAVHYNLAANHFETDGVRDHSRAK
FT                   RDSVNAKLGFDLAEGSRLDLVLNYLDAPDAQDPLGLTRAQFNADPAHATSVATQFNTRK
FT                   SVRQSQAGAIFTQQFDNQALRLMAYDGQRSVEQFLAIPLAVQRNPLHSGGVIDLDSNYE
FT                   GADARWAWQGEALGRPLQLTVGTNVDRQRQHRTGYENFVGDILGVKGALRRNQRDEVQN
FT                   VDQFAQLWWQWSERWSALLGVRHSDVRFASDDHYTVGRNPDDSGQREYSATTPVAGIVF
FT                   RADEDLRFYASLGRGFETPTFNELGYRSDGGAGLALDLGAATSRNVEVGSKWRAQSGAA
FT                   VEFALFRADTDDELAVASNTNGRSTYRNIRATRRQGAELSWHQPIGATQQLQLAYTFVD
FT                   ATVRDGYLTCASSGCATPTVPVANGARLPGVPRQQLFARWQWQPAQWRFAAESVASGAT
FT                   VVNDLATERAPGDALVNLEASRRWTTTLGALRTFARVDNVLDRQYVGSVIVNDGNGRYY
FT                   EPGPDRTYTVGLQWDFGG"
FT   CDS_pept        21940..22380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66774"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66774"
FT                   /protein_id="BAE66774.1"
FT                   /translation="MRAGSITPNHHITRHTSPSLPPQMCFRRSAPRRDEAFPIRPLPTP
FT                   YRSTMIVIDHAPADWFLLCEGDRCWLDINGSISATGVSILLLNASERALVQADPHAACA
FT                   TSASQVQARPHDYAARAGSAVDGKRVRAAVRQWRARGSTAAG"
FT   CDS_pept        22497..23042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66775"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66775"
FT                   /protein_id="BAE66775.1"
FT                   /translation="MRPDTAERAASLSHALTAWSTTMMVWKQTVIVAAMAAGLLVGNAA
FT                   WADHMDMCIVRDDPAGTPAIPQIHAWLQPQARRMTQPRQTSPPADAAALGAVRISTAIF
FT                   DRPLNTRADTASKAAPLPARGQRSAMRSTSTRAMPANAIVGCLSGSSLGPAQPGRCALT
FT                   GSTGRPIARCHRKSPRPL"
FT   CDS_pept        complement(23156..24136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0021"
FT                   /product="ISXoo7 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66776"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66776"
FT                   /protein_id="BAE66776.1"
FT                   /translation="MQLTFGDAEGPVKRKQTRREIFLSEMEQMVPWQQLRVLIAPHSPV
FT                   SGRPGRQPYALATMWRIHLLQQWYALSDPAMEEALHEIATLRRFTQLGGLDDIPDEPTI
FT                   LNVRRLLETHGLAARMLEAVNAHLARKGQSLRSGTIVDARLIAAPSSTKNAHHARDTEM
FT                   HQTRKRNQWYFGMKAHIGVDAFSVRAHHVHGTAANVADVTVTHTLLHGKEDRVFGDSGY
FT                   TGAEKRDELRDCKAASFFAARPSTIQAIGNNRERAREQRWEHVKASVRAKVEHPFRVIK
FT                   RRFGYTKVRYRGLAENTAHVLSLFALSTLWMKRKQLLHAMESVRL"
FT   CDS_pept        complement(24184..25350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0022"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66777"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66777"
FT                   /db_xref="GOA:Q2P9K0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P9K0"
FT                   /protein_id="BAE66777.1"
FT                   /translation="MIISAASDYRAAAQARLPPFLFHYIDGGAYAEHTLRRNVSDLADV
FT                   ALRQRVLRNMSDLRLSTELFGETLAMPVALGPVGLTGMYARRGEVQAARAAAARGIPFT
FT                   LSTVSVCPIEEVAPAIERPMWFQLYVLKDRGFMRNALERAKAAGVTTLVFTVDMPTPGA
FT                   RYRDAHSGMSGPNASLRRMLQAVTHPRWAWDVGVLGKPHDLGNISAYRGNPTGLQDYIG
FT                   WLGANFDPSIAWKDLEWIREFWTGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLD
FT                   GVLSSARALPAIADAVKGELKILADSGIRSGLDVVRMLALGADAVLLGRAFVYALAADG
FT                   QAGVENLLTLIEKEMRVAMTLTGTHSIAQISADALSRVTREQANAVSP"
FT   CDS_pept        complement(25497..26063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66778"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66778"
FT                   /protein_id="BAE66778.1"
FT                   /translation="MSASSLFGALNLVWGGDELLLSRRRRASDGGAHDQGSLKHLWRVL
FT                   SAAVAVAVVLAYSGLAHWPQGWDASLQWAGCALIGSGLALRVWAIQVLARWFTVDVTIQ
FT                   PDHQLMRSGPYRWLRHPSYTGALLAFHGLALGMGNALSVMAIVMPVTWVFLHRIRIEEA
FT                   ALQRAFPVAYPAYAAQSRRLLPLVW"
FT   CDS_pept        complement(26207..26911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0024"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66779"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66779"
FT                   /protein_id="BAE66779.1"
FT                   /translation="MRTITAVRCWVRRPGATAARLWGGRHWTRRMQTCALGGLEGALAR
FT                   HAGHTFRALPGDAQAALGEVLALLSVIHPDSDAVTARRALWSALPANSAARVLVEAFVH
FT                   AHLFVGGPGVAVAHEALLRQWPRAAEWIHENRRLRQARKRLPQASQRWATEGRRTDHLL
FT                   NSGRPLSEARACGSTVCNINNTVKPTSTLQRQAPWGEASGRNDSATAAMVNAPARRRGC
FT                   HRLQKEEFIRRC"
FT   CDS_pept        complement(27062..27400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0025"
FT                   /product="hypotethical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66780"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66780"
FT                   /protein_id="BAE66780.1"
FT                   /translation="MRAQLRTATATDLRSGELCCFSAPPCRAWSHLLAIVEAPSSCAAG
FT                   ISAMSLRRERVTQLGSVSRFRLGRLLVEPERLTLIDDGQTIALEPRMMEVLIALAERPG
FT                   EVVSAEQC"
FT   CDS_pept        27538..28746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66781"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66781"
FT                   /db_xref="GOA:Q2P9J6"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="PDB:3S8M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P9J6"
FT                   /protein_id="BAE66781.1"
FT                   /translation="MIIHPKVRGFICTTTHPLGCERNVLEQIAATRARGVRNDGPKKVL
FT                   VIGASSGYGLASRITAAFGFGADTLGVFFEKPGTASKAGTAGWYNSAAFDKHAKAAGLY
FT                   SKSINGDAFSDAARAQVIELIKTEMGGQVDLVVYSLASPVRKLPGSGEVKRSALKPIGQ
FT                   TYTATAIDTNKDTIIQASIEPASAQEIEETITVMGGQDWELWIDALEGAGVLADGARSV
FT                   AFSYIGTEITWPIYWHGALGKAKVDLDRTAQRLNARLAKHGGGANVAVLKSVVTQASAA
FT                   IPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLYRQDGQPAEVDEQNRLRLDDWEL
FT                   RDDVQDACKALWPQVTTENLFELTDYAGYKHEFLKLFGFGRTDVDYDADVATDVAFDCI
FT                   ELA"
FT   CDS_pept        complement(29374..30396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0027"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66782"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66782"
FT                   /protein_id="BAE66782.1"
FT                   /translation="MSRARILCFGELLLRLGAPGHELLLQQPRLDVHCGGAEANVGVSL
FT                   AHFGHEVAMVSTVADNPLGAAVLGELRRHDVDTRHVRRVDGRMGLYFLTTGAIHRPSEV
FT                   IYDRADSAFALAPADAYDWPHLLAGVQWLHVSGVSPALGADVAQATLAAARAARAAGVK
FT                   VSFDGNYRPTLWQRWQGDARGILHQLFACADVVFADYRDIGVVLGGEFAQDTPEARVEA
FT                   AAQQAFAAFPQLQLMACTQRVAHHVDHHSLGAMLVPREGAVARAPSEELTPIIDRIGGG
FT                   DAFAAGVLHGLIEGWSLDDTVRFGLAAGCLKHSIPGDFNPLSVADVQACVGDARFDVKR
FT                   "
FT   CDS_pept        30683..30964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66783"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66783"
FT                   /protein_id="BAE66783.1"
FT                   /translation="MQFRTTSRKTPVTLLALSIGPALSGHAAAQEAAQSPAEPAVDLDT
FT                   VTVSGYRASVEKALDIKRGDAGVVDAIVAEDIGKFPDLNLADSVSFLP"
FT   CDS_pept        31219..32187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0029"
FT                   /product="ISXo1 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66784"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66784"
FT                   /protein_id="BAE66784.1"
FT                   /translation="MQLTFGDAEGLGKRKQTRREIFLAEMERIVPWKRLLALIEPHYPV
FT                   SGRPGRQPYALARMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPDETTI
FT                   LNFRRLLETHGIAARMLEAVNAHLSRKGQSLRSGTIVDATLIAAPSSTKNADRARDPEM
FT                   HQTKKGNQWYFGMKAHIGVDEFSGLVHHVQCTAANVADITVTHALLHGKEDSVFGDSGY
FT                   TGAEKRDELQSCEAAFFIAAKRSTIQAIGNKRARAWAERWEHFKASVRAKVEHPFRVIK
FT                   RQFGYTKVRYRGLAKNTAQVQTLFALSNLWMVRRHLLPARG"
FT   CDS_pept        32675..33811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0030"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66785"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66785"
FT                   /protein_id="BAE66785.1"
FT                   /translation="MIFLLTPLERRLATVLPCTGARVVVWYSRWWRLRKYRIEAIANVA
FT                   MLLGIILALVWVSWLPMRTVQPHVLPAGGKLGLLGGMLLSGGVSGWLSSRRTSFYLHGH
FT                   WLAWCMHHRHYCNEQKLRCLCGGLRGAVSMACISVVASHWFFISRLGVATAAAVFFTGF
FT                   VFAFFGNRGRLNFLISTSVANSRELKRIMPAAPMLQMPRPKTVGFFFIFAILSISITSV
FT                   WAVRIEHPGMLGMAVAISAITFIFCQSFLVAGAMELHRLLAWTGVAPWRAVSRLMWFPV
FT                   AIAAGMTAPIAIAGVVLHKLIWIMVVLVELVVVCYVGVIWVVSDLVGIGGGRRSIFRMV
FT                   NTIFPLVALVAGPIAVFILPLHLFWLILRGNHAWMEKV"
FT   CDS_pept        33793..34515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0031"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66786"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66786"
FT                   /protein_id="BAE66786.1"
FT                   /translation="MDGESVTLLNMNAVCAGYAAHHVLLDFTARIAAGEVVVLIGANAS
FT                   GKSTLVRILSGLHKISGGTVVYKDLEIGSRPPIGLAVAPNMLPERLTGFHALDLVAAAL
FT                   HTNAIKMAIDYATVVDLYPYMHAPIASYSFGTRQKLAISLAMVGTPRLLLLDESLNGLD
FT                   LPSVGRTLKFLHELTQVSGQSVLLVTHNIDLAQSYAQRVWMLENGRLAREWKQDELSRM
FT                   QCEGQLISRQVLEHFSGA"
FT   CDS_pept        complement(35117..36493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0032"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66787"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66787"
FT                   /protein_id="BAE66787.1"
FT                   /translation="MLTRRPAAEQLHADELFRSRLENQIDLRHPLVQLSHRLPWSALEQ
FT                   ALSPRLPATTSTGGRPALPVRLIAGLLYLKHAYDLSDEAVCERWLENPYWQFFTGEVVF
FT                   QTCLPCDPSSLTRWRQRLGEAGMEELLAHTINTAHAMKAVDTRELSRVIVDTTVQEKAI
FT                   AHPTDSRLLEVARKKLVLLAKRHGIVLRQTYVRQGPGLSRKAGRYAHARQFKRMRKVLR
FT                   RQRTILGRVLRDLQRKLAQQEPSVRERIGVWLERAHRLLTQRPKDKQKLYALHAPEVDC
FT                   MSKGKASSPYECGVKVGIAVSARKGVIVGARSFPGNPYDGDTLAEQLVQARGLLQDVDV
FT                   IPQVAIVDLGYRGRDVEGVQILHRGKAKTLTRRQWRWIKRRQAVEPVIGHLKQDCRLNR
FT                   CHLKGAQGDALHVLGCAAGDNLRWLLRWIAFLRAWLQVVRARPSTCSSIMWPANMAFGV
FT                   "
FT   CDS_pept        complement(36450..37697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0033"
FT                   /product="ISXoo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66788"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66788"
FT                   /protein_id="BAE66788.1"
FT                   /translation="MAHTQNADFFRQPLAEMIDPRHPLAVLARRLPWAQIEAVLAPHFA
FT                   RKVRAGRAVAQHDLFGPSVQVAGAGIAAAGRPRLPIRLMASLLDLKHAYKLSDEELVER
FT                   WAQNVVWQHFSGMAFYEPRLPCDATQVGRFRAAIGEAGVEELLKATIDTAVSSKAIVPA
FT                   EFERLIVDTIVQEKAIAHPVDWRLMENARHKLVVAAKRAGIALKQTFAKETKTLRRKAG
FT                   GYAHARQFKRLRKVLKRQRTLLGIVLREVQRKIGQASQATPPALENLHTLMQRAERIHA
FT                   QQPNGKNKLYALHAPEVECIGKGKARKPYEFGVKVSVAITHKQGLMVGARSFTGTLYDD
FT                   HTLHEQLEQARILSEDTAGAPKQSPLKNPQTASIARPHLRFWRAGTASFRYSTYWFLAV
FT                   FAHAYTPSCCRAIACR"
FT   CDS_pept        37823..38086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66789"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66789"
FT                   /protein_id="BAE66789.1"
FT                   /translation="MPTTLNDDADLHAWHPGNDVTVRLVRGIVRACQAVPALKAWFDGD
FT                   ALSRTLHNQIDIGIAVDTEEGLFVPALRNADMLDAHGIREPD"
FT   CDS_pept        38132..38947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0035"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66790"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66790"
FT                   /protein_id="BAE66790.1"
FT                   /translation="MLGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATPHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWRMKHKLMQAMPQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGA"
FT   CDS_pept        39096..39452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66791"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66791"
FT                   /protein_id="BAE66791.1"
FT                   /translation="MSPCSPLKVRANQVRESVNRLRQQVEKRSIAASELSGYTISLSNF
FT                   GMFAGRYATPVVVPPCVAIMAAGRARYQITPVMGGVETHKVMPLSLTFDHCAATGGEAA
FT                   RFLRALLDDLALAN"
FT   CDS_pept        complement(39690..40304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0037"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66792"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66792"
FT                   /protein_id="BAE66792.1"
FT                   /translation="MMKPSHIGNAHFSHPGSSNAEVADTSRRQQQSSGTTSQEHVNPAL
FT                   EGLGSAPRSRRVSFGSWVGVQGESRPVGLDSREKNEKYQDGKYKASSENRQVMIEEYGR
FT                   KTAERLYETFQGAPLPKEYKANLKAGSPSYMRIRGDEKERKKEGAVALKHYEYLARDAN
FT                   DPKVNYEHKTLYAPKEVRRSRLRELEADADQEQGGASSSGS"
FT   CDS_pept        complement(40479..41459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0038"
FT                   /product="ISXoo7 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66793"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66793"
FT                   /protein_id="BAE66793.1"
FT                   /translation="MQLTFGDAGDLGKRKQTRREIFMADMEQVVPWQQLRVLIAPHSPV
FT                   SGRPGRQPYALATMWRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGCLDDIPDESTI
FT                   LNVRRLLETHGLAARMLEAVNAHLARKGQSLRSGTIVDARLIAAPSSTKNAHHARDTEM
FT                   HQTRKRNQWYFGMKAHIGVDAFSVRAHHVHGTAANVADVTVTHTLLHGKEDRVFGDSGY
FT                   TGAEKRDELRDCKAASFFAARPSTIQAIGNNRERAREQRWEHVKASVRAKVEHPFRVIK
FT                   RRFGYTKVRYRGLAENTAHVLSLFALSTLWMKRKQLLHAMESVRL"
FT   CDS_pept        41819..42070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66794"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66794"
FT                   /protein_id="BAE66794.1"
FT                   /translation="MTRWQVAGQPSNAIEAATIADGIARTTTLAMTGHGRGEVALDASD
FT                   LGTTHRLLSPPLGGTMDRSALQAHLHVVAACTPSTMCG"
FT   CDS_pept        42078..43367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0040"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66795"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66795"
FT                   /protein_id="BAE66795.1"
FT                   /translation="MSRKADLLSLQLPPLFESALARAGVRTLTPIQVAMIPPMLAARDL
FT                   IVTAQTGSGKTLAYALPLLQQRLQAPEQVPRVLGGLILVPTRELVAQVAQTLLSLAAAL
FT                   PRRLKIVAATGGEAINPQLMALRGGADIVIATPGRLLDLVTHNALRLSQVRTLVLDEAD
FT                   RLLDLGFGAEIDRILALLPAQRQSVLVSATFPPAIASLAKRRLRDPLRITIDATPEHAP
FT                   AIAQRAIAVDAGQRTQLLRHLLQEHAWPQLLVFVASRHTADKVAEKLSKTGIEALPLHG
FT                   ELSQGRRERTLRAFKQADVQVLVATDLAARGIDIDALPAVLNYDLPRSTVDYTHRIGRT
FT                   ARAGASGEAISFVTAERAQQWRLIEKRQGLRVPTSVIEGFEPSPAEASARDAPDAAVRA
FT                   ADDNGGIKGKRPSKKDKLRAAAQAQTGKPG"
FT   CDS_pept        complement(43807..44142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66796"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66796"
FT                   /protein_id="BAE66796.1"
FT                   /translation="MRKTYQLNLEGKNRDRLLESSKHDIRKYIRRERRKDLPEGADYWD
FT                   FDMRFGVDEASAVALPPAELIRSINALVADGGDQFFVEILRKPGKRVLRAAGDHAFGDG
FT                   ELDFEQD"
FT   CDS_pept        complement(44269..44406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66797"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66797"
FT                   /protein_id="BAE66797.1"
FT                   /translation="MICDAIACVASQRSKSCAAVCTTSRVAWAAAARLAQVRELPGGVL
FT                   "
FT   CDS_pept        complement(44417..44848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0043"
FT                   /product="VirK protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66798"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66798"
FT                   /protein_id="BAE66798.1"
FT                   /translation="MPRLVPAALFATLCACALPALATESLNNRAEVLAALDAGYDVSVS
FT                   TDLARCVPEEGTPVTQTRGGRHIDAYRITADGTVAFSDSHFTVANDGKPIQQFMRYQLL
FT                   PDGSLRFTTYMYDLPGLQQRGPVLAYQCKLNEGIRFHAN"
FT   CDS_pept        complement(45197..46633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66799"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66799"
FT                   /protein_id="BAE66799.1"
FT                   /translation="MRIIQRDVHMETHITVIGAGFCGTALVRALAQTADAQVRITLVGV
FT                   AETFGSGIAYGAARPEHLLNVRAKDLGIDAQVPGAFADTLHLGESGRLEFLPRLAYGDY
FT                   LRSELDAAVSGAQASIMRLSQEAVAVERVRKGFRVFLANGDAFQSDRVVLAVGALQPQA
FT                   LAGIGPRLSVHPRYIGWPWQGDALARLSPDDDVLIVGTGLTMVDVALTLHTRGHRGRLL
FT                   AISRRGLAPQAHLRQPGAPLELPPHLQRALKDADLRGLLRGVRQLSAVVDDWRRVVDAL
FT                   RPHLQPLWQRLELSQRARFLRHLRPYWEVARHRVAPGAAEQLAQLQASGQLQIVSARLL
FT                   RARWVPDGVEAVIRPRGAADAQTGHYDAVIRATGLDTDIDRTSDPLIAGMREAGLLRAD
FT                   PLGLGVDTDAQLRVRDSTGQIVPGLYCVGPLLRGRYWEITAVPELRVATRALADRLLLG
FT                   ATPALQPTPERLPREVNTRL"
FT   CDS_pept        complement(46712..47260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66800"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66800"
FT                   /protein_id="BAE66800.1"
FT                   /translation="MAASPRSGCKNADSQQGLNASQMTVRPLGAVMMAIGKYRAAPRAA
FT                   RKKLRARNCYAALGRSMGAAASITATEPSGCSCIKWPSCRKWVGMPLACRRCTASWLAW
FT                   RVTVARAPRVSPVRHGRRSLCTLALYRHIGCSGLHCRIAQRRRKQACANGRSNTAYGGD
FT                   RCHIAAMYDRRCLPRLPHH"
FT   CDS_pept        complement(47426..47722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66801"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66801"
FT                   /protein_id="BAE66801.1"
FT                   /translation="MQNPAATRPCSGRAVLKRESAVRMQWGAVSVPSVHDDEAVPRRPM
FT                   DGLVEHKAASTRRAQIYGKCLIGLQNPCNAAWPGLVGCKCSAYAWQPGAGSGT"
FT   CDS_pept        complement(47924..48184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66802"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66802"
FT                   /protein_id="BAE66802.1"
FT                   /translation="MPTQFTQGIRFEVAQDVLGALIAHWAEAAAQAFDAANPDLGRLAE
FT                   IEAEQRKLRNLRADLNPRDAAQIESVIAEHAPLARRLYAPA"
FT   CDS_pept        complement(48201..48596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66803"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66803"
FT                   /protein_id="BAE66803.1"
FT                   /translation="MGCSDARRWLCQCLPRRSSTLMIDQPTTVELQATGVRFFSRGDET
FT                   AFFGWIKSFPFVEQIEGHGRTLFMKVNSSAIDEDGLRELLALFRRYGVDMAQLVAFDRE
FT                   EFAEWFRRADAYWHNDIFGSSSTSHNT"
FT   CDS_pept        complement(49351..50574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0049"
FT                   /product="ISXoo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66804"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66804"
FT                   /protein_id="BAE66804.1"
FT                   /translation="MPTMRASEVLQKCLSNSLSGMHALRQRALLRAVEALVHGGRLTLI
FT                   DIARAWPGARRVRAPLKACDRLLCNRALQVERSAIERDMAHWLLRGDQPVIVIDWSDLK
FT                   PDKSWCLLRAAVPVGGRTLTLLDMVVSGKQQGSPGAEKRFLQQLRALIPDDVRPILVTD
FT                   AGFRTPWFRAVSAMGWDWVGRLRGRTQVKPQDVPDDAVQWIDSRRLHALASNRARELPP
FT                   MQANRSDPLDCRLVLYAKTRQGRQQRNRRSPAKVSRASSSLKAAAREREPWLIVASPQL
FT                   HAPSAKQLVNLYARRMQIELAFRDLKSHRYGQAMEDSLTRRGERLQILLLLNTLATFAS
FT                   WLAGLGCEATGIAQWLSPRSSTRKLYSTLRVGREALVRCWPMEPVSRWLERLRALPDAV
FT                   REQMTLVL"
FT   CDS_pept        complement(50590..51015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0050"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66805"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66805"
FT                   /protein_id="BAE66805.1"
FT                   /translation="MRDSAHAPISVHEVAQSLPARTYRQVSWRQGSDATLSSRFAAVRV
FT                   RAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTRPKQTPVKTLVATAQGRWRIERDYQEL
FT                   KSELGLHLRFPHISSCEIKHLLHQGVEEGARMGHASR"
FT   CDS_pept        51086..51442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0051"
FT                   /product="ISXo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66806"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66806"
FT                   /protein_id="BAE66806.1"
FT                   /translation="MREKNDPSDVSRERFEQIRPILEQARKRTKPVTVDMYEVWCAVLY
FT                   LLRTGCPWRALPSDFPKWRTVHSYFAKWSEVDDEGMSLLERALKKSGWRGPRETGAQGL
FT                   QYVLDRGRAEREEQ"
FT   CDS_pept        51408..51884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0052"
FT                   /product="ISXo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66807"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66807"
FT                   /protein_id="BAE66807.1"
FT                   /translation="MIVDAQSVKNSDTAGQKGYDAGKKVSGIKRHIAVDTQGFPHAVAV
FT                   TTAEVTDRQGALEALKRCRSGLGRVKRLLCDSGYTGDPFAEGVQDILGKHVTVQIAKRS
FT                   ELHTFKVMPKRWSVERSFAWLEKNRRLWKNCERRLNTSLQFIHLAFLALLLRRS"
FT   CDS_pept        complement(51871..52701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0053"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66808"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66808"
FT                   /protein_id="BAE66808.1"
FT                   /translation="MLQIIVSLCHYWKTFRPRGRAVLNRSLEVRFEQYGEVVAAALSHA
FT                   DRKQPAHWYLKGLLLPGGRKSVEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAV
FT                   AAQVLPPLSRKSAACHWIVDDTGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANE
FT                   HGSLPVGYRLYLPEQWAQDTVRRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVL
FT                   ADAAYGTETHWRDQLSERGLLYMVGVRSNTKVWWGSHQPAPMPPASPKNLFTIS"
FT   CDS_pept        complement(52689..53501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66809"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66809"
FT                   /protein_id="BAE66809.1"
FT                   /translation="MIPAQVRLQGIFDGKNHRVLWNEFEDDVGLGSWTGRVVKQTQADG
FT                   GVLTIDYAHVEGNVLGRLITKPDGSKRRVTFDPATLYPKTDTAAYGTNLAQTITYERSA
FT                   GGQITAQIAPLGRRTEYSYDGSGRKTQITMMAGTTQARTTILVYKANGDLESITDPLKH
FT                   KTTFGYTSRCLTSVTNPLGNVTTATCNAAGQRLTLTDALNHTTSFIWTGEDLTQISDPL
FT                   GRNVHFRYDVLGRMIAAQDVQGNLTRMEYDGLGRAVKSIDPLVPLCYK"
FT   CDS_pept        53566..54564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0055"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66810"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66810"
FT                   /protein_id="BAE66810.1"
FT                   /translation="MLGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGDAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRYLAETMWRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTLFTAESAC"
FT   CDS_pept        54983..56302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0056"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66811"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66811"
FT                   /protein_id="BAE66811.1"
FT                   /translation="MLNRSLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPTLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGMAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQRLPARTYR
FT                   QVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTRPKQTP
FT                   VKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
FT                   KKNSVAFKMPAVSKSVRPRWSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        56420..57466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0057"
FT                   /product="methylamine utilization protein precursor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66812"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66812"
FT                   /protein_id="BAE66812.1"
FT                   /translation="MSRQIIISIFLTVVLLLLGVRWLAGLDLDQGERRQATVALGNTLF
FT                   QDTTLSARRTLACSSCHDPSKAFAQDIAVPIVYGQRTGTRNVPSLLDLPYFTHFFWDGR
FT                   EEKLERVAVAAFTNQAEMAQPDMSVLIKAVSQRLDYRTQFKAAFGDERVDQERISSAIL
FT                   AYLASVTTGRSRYDAFVAGNTTALTTAERRGLDVFRGKADCSSCHALNGTPAAFTDNRF
FT                   HHSNVGMDRMAGQISTTIESFKTKREQGVPVAELVLSDPDMAALGRFAISGQGNDLAAY
FT                   RTPTLRNVTRTPPYMHDGSVQNLEEAIQREIYYRSLSRGTPISLTAGEKNDLYAFLHAL
FT                   EDLPNNAH"
FT   CDS_pept        complement(57607..58104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0058"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66813"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66813"
FT                   /protein_id="BAE66813.1"
FT                   /translation="MQILKKGILAALVGALCGCSAPSGSADKEPQADVASQAAASSAKI
FT                   REILVVAERSGVNTQNRSMPVSSDSPISVTVSVTHSGVDTPPISLRFIDLKNGQVLGEQ
FT                   SQPMTPGGDSVRFEFKPAKPWSEGRHLLEARLGKTGKVVQREFDVVQSPPSAAAKIEAK
FT                   SG"
FT   CDS_pept        complement(58268..58948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66814"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66814"
FT                   /protein_id="BAE66814.1"
FT                   /translation="MRASSPKAHVDAEDGLMDVLLAGATGLVGKQVLQQLLADTRCTGV
FT                   VALTRRPLTQIHPKLRNQVIDFERLEHWTAPRMEAAICALGSTMKQAGSREAFYRIDHD
FT                   YPMAIARAACAHGTSVFVLNSAAGANAQSRIFYSRVKGELERDLRQIGFPSLTFVRPGL
FT                   IGGEREERRAGEHLGSLVLGALGPILPRRFRINPAERIAAAMVAAALAPARGEHSVEAA
FT                   ELVQ"
FT   CDS_pept        complement(58917..61079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0060"
FT                   /product="glycogen debranching enzyme"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66815"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66815"
FT                   /protein_id="BAE66815.1"
FT                   /translation="MATRKFTQRSRIREGRPNSLGATWDGLGVNFALYSRNATRVELCL
FT                   FDDRGREQERIALPEYTDEVWHGYLPDARPGQLYGYRVHGPYAPDAGHRFNHNKLLLDP
FT                   YAKQIVGELKWAPHLFGYIIGHRDKDLSFDRRDSAAFMPKSAVIDPAFTWGQDRPPQTP
FT                   WNRTVIYEAHVRGLSMLHPAVPPEERGTFSALKTDELIDHISSLGVTAVELLPVHAFVD
FT                   DQYLLENGLRNYWGYNTLGFFAPQARYMSTRTVAEFKQMVARLHHAGLEVLLDVVYNHT
FT                   AEGNELGPTLSFKGIDNASYYRLADDRRFYINDTGTGNTFDLTNVGALRMVMDSLRYWV
FT                   QEMHVDGFRFDLASILGRERYGFDPSGSFLDAVRQDPVLSQTKLIAEPWDIGPGGYQVG
FT                   NFPPGWVEWNDKFRDNVRAFWRGDGGQLAELATRLTGSADLFNHSGRRPTASVNFVTAH
FT                   DGFTLRDLVSYEGKHNLANGEDGRDGSDHNISCNYGVEGETNDPTIKQLRRQQMRNLLA
FT                   TLLLSQGTPMLLAGDEFGHSQNGNNNAYCQDNELTWIDWTAATKAAAADQAAFVRRLIR
FT                   IRQRYPLLHRARFFDGKFDEALGLKDLTWLAPDGHEMDEAGWHDPEARALMLRLDGRSP
FT                   ATGLREIAANVTLLMLINAASTSVSFTLPAMHDEHWRVLVDTARHGGRVVAGGSEWKAS
FT                   AHSLTLLAVERDRIISSARIVSEGAR"
FT   CDS_pept        complement(61194..61379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66816"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66816"
FT                   /protein_id="BAE66816.1"
FT                   /translation="MNDMERQARLAQLAREIWEAEGRPDGHADRHWAMAERLVEAEERA
FT                   AEQAAEYAARPIAARQ"
FT   CDS_pept        complement(61402..64005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0062"
FT                   /product="maltooligosyltrehalose synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66817"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66817"
FT                   /protein_id="BAE66817.1"
FT                   /translation="MIDLRATARLQLHAGFTLHDALAQLPYYAGLGISHLYLSPIGTAV
FT                   PGSTHGYDNIDPTVVNPELGGEDALIALSQAAREHGMGLIADIVPNHMATHAQNAWWWD
FT                   VLRNGRSAKHADWFDIDWRAPGRDGKVWLAVLDRPYATALAEGLITLVIEDDGSAALAH
FT                   YDQRYPIRPQTLEIPEKTALAQWLRDYNDGARRGDGRLHKLIERQPYRLNWWRVGNDML
FT                   NYRRFFDITSLVALRVELPAVFDAVHALPLRLVAEGHLDGLRIDHVDGLTDPTGYVRKL
FT                   RSRLDAAGRTRGLRPGTLGLYLEKILAPGEHLPADWPCDGTTGYDFMDQVGAVLHDAAG
FT                   FKPLARAWQKVSGRSGDFAQEERSARDEILRGPLQTEFNRAVGALSALARLDPPTREFS
FT                   PQMLARGLCVLLRWFPVYRTYAGAQGITGSEAERLRATAAKARAGMPESIVAAVDAIER
FT                   WLLDDAGADRAQIALRRILRRRVEQLSAPLNAKSVEDTAFYRHGVLLSRNEVGSHPTHF
FT                   ANEAAEFHAQNLERAKHSPRALLATATHDHKRGEDLRMRLAVVSEQPRWWAEQSAQFDA
FT                   LADALESPALAGGDQQMLWQTLVAAWPLGLGADQTEPLADYAERIAQWLLKAVREAKLH
FT                   SSWTDGSPAYEQAVQATVEQVLCSPAGLPLRRALLRASNRIAAAGARNALVQTTLRLTV
FT                   PGVPDLYQGTEGWDLSLVDPDNRRPVDYAQRQQWLQQARDFTGLLRSWRDGAVKARLTA
FT                   LLLQLRREHPLLFAKGDYQPLNVAVSGDAQALAFRRQYRGQSLVVAVTRLGAGAEGDLP
FT                   LLVAPATWGRASLALGEGTYRNVLDGSTLQPQRGRVALSTLFARAPVAVLLSQDN"
FT   CDS_pept        complement(64002..65951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0063"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66818"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66818"
FT                   /protein_id="BAE66818.1"
FT                   /translation="MSTRAPGSEDLDALAAAAGVMVDWVDASDQPRHVSEQSVHAVLTA
FT                   LELPAATAAQRADSLRRCQAQAAEPAPLLTVQVGELLPLRVAANTIGRWTDDSGASEDA
FT                   RTDARGQLRAPPRFGYWTLQIGAITQHVAVAPRRCFSVADACGQASPRAWGMALQVYSA
FT                   RSLDDGGIGDAAGTVEWLRHATLAGADALALSPVHASRPVTGAYSPYSPSDRRFLDPLH
FT                   AAPVRILGELALDAINAVPGLRERFDRLHDGALIDWQASAHAKWELLRQLYTRVAPDHA
FT                   DLVAFGNADGAALQGFARFAAQDFGDNDPQLHVFTQWLAARSWSDAQRQAHERGMKIGL
FT                   IADLAVGFDPNGAEAAAAADTVLRGLVLGAPPDAFNADGQHWGIGAYSPTALRRSGYAP
FT                   YIALLRAVLRDRGGIRIDHILGLMRLWVVPDGASSNEGAYLAYPLHDLLNLLALESWRH
FT                   RAIVIGEDLGVVPPGIREELSRRGVMGIDVLMFTRDDDGAFVSPALWRPDAIATTTTHD
FT                   LPTLTGWREGRDIAWRRKLALIQPAQASDDAKARIKDVARLEAAVEHAGLSSAHDPLLG
FT                   ALRFTAASVSPLALLPVEDALALDEQPNLPGTVEVHPNWRRRLPDPLPHARLSSALQGF
FT                   AEARRVAAVSEPHP"
FT   CDS_pept        complement(65948..67705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0064"
FT                   /product="maltooligosyltrehalose trehalohydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66819"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66819"
FT                   /protein_id="BAE66819.1"
FT                   /translation="MNQRTAITPVWGAWPAGEGQVRFALWAPAAKNVDVVFDTGARSAL
FT                   QAGQDGFFSAVIDCAPGARYRYSIDGGEPVPDPASRWQPEGVHGPSAVQPTDGHAWQNT
FT                   RWQGRPWDQAVIYELHVGTCGGYAGVQAQLPQLAAMGITAIELMPLSAFPGAHNWGYDG
FT                   VLPYAPVEAYGTPDDLKALIDAAHGHGLMVLLDVVYNHFGPDGNYLHSYAAPFFNEDKP
FT                   TPWGAAIDFRKPPVQRYFLDNALMWLHEYGFDGLRLDAVHAISPNAFLDTLRETIETSL
FT                   PAGRHVHLVLENEANQASQLQRGYTAQWDDDFHNALHVLLTGEEEGYYAAFADKPTEHL
FT                   ARVLGEGFAYQGEPDPRGHVRGEPSGALPPHKFVVFAQNHDQIGNRARGERLSVLVLPQ
FT                   RLRAALALTALTPMIPLFFMGEPWGAKQPFLFFTDFGPPLDEAVREGRRREFAHFAAFA
FT                   DAAQRATIPDPNSHSTFAASRSPIADATHGDGAQWAAWFKALLDVRRQWLVPGVAQARA
FT                   VRASVLADGALTGTWQLPGGLWHIAFNVGTQAVPMPPLRGRVAHVENVAADTQELPVDG
FT                   FIAWYEPQS"
FT   CDS_pept        complement(67708..69942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0065"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66820"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66820"
FT                   /db_xref="GOA:Q2P9F7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P9F7"
FT                   /protein_id="BAE66820.1"
FT                   /translation="MSERQGGQEQDREADGVTTEGISEMSQTLQALADGLPVDAFAVLG
FT                   PHPLADGRRQVRVLAPGAEAMGLIDSRGKLLARMQASAIDGVFEGILSIEGPYRLRIVW
FT                   PDMVQEIEDPYAFAVTLDESLLLQIAAGDGQALRRALGAQHVQCGEVPGVRFAVWAPHA
FT                   QRVAVVGDFNGWDVRRHPMRQRIGGFWELFLPRVEAGPRYKYAVTAADGRVLLKADPVA
FT                   RQTELPPATASVVPGTDTFAWTDAAWMAKRDPSAVPAPLSIYEVHAASWRRDGHNQPLD
FT                   WPTLAEQLIPYVQQLRFTHIELLPITEHPFGGSWGYQPLGLYAPTARHGSPDGFAQFVD
FT                   ACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEHADPREGMHRDWNTLIYNYGRPEV
FT                   TAYLLGSALEWIDHYHLDGLRVDAVASMLYRDYGRAEGEWVPNAHGGRENLEAVAFLRQ
FT                   LNREIAAHFPGVLTIAEESTAWPGVTAAISDGGLGFTHKWNMGWMHDTLSYMQRDPAER
FT                   AHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQMPGDDWRRFANLRAYLALMWA
FT                   HPGDKLLFMGAEFGQWADWNHDQSLDWHLLEGARHRGVQLLVGDLNATLRRTPALYRGT
FT                   HRAKGFDWSVADDARNSVLAFIRHDPDGGGVPLLAVSNLTAQPLHDYGVGVPRAGAWRE
FT                   ILNTDSAHYGGSNLGNSGRLATEPMGMHGHAQRLRLTLPPLATIYLQAEK"
FT   CDS_pept        complement(69939..71468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0066"
FT                   /product="glycogen synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66821"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66821"
FT                   /db_xref="GOA:Q2P9F6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P9F6"
FT                   /protein_id="BAE66821.1"
FT                   /translation="MLPALKKGGRPRDALGRFIRHHERLPVSLADTRGVLFVVSEMADF
FT                   IKAGGLGDVAAALPRALRHRYDVRVLIPGYRAVLERAGKVEIVGRVLAHAALPACDIGR
FT                   IVQSDGLPIYILLSRELFERDGSPYVSTSGSEFEDNAIRFATLSHAAADIAAGHAGLGW
FT                   KPRLLHLNDWPCALAAGYVRWSGGTTPCLLTIHNLAYQGLVPYSMAGALGIPAERVAEL
FT                   EFYGQMSFLRGGIVNADHVNTVSVSYAKQITGPAQGCGLDRLLAGRAAKGALTGIVNGI
FT                   DASWDPRTDEYLDSHFSVNQWQGRQDNAAQVRKAFGLRESTGPLFAVVSRLVHQKGLDL
FT                   ICEVAPQIVAAGGQIAVIGGGEPDIERQVAELTRRYPGQVGAFIGFEEGLARRMFAGAD
FT                   FLLMPSRFEPCGLSQMYAQRFGCLPIAHATGGLIDTVDDGVTGFLFQHASVEALRRCLE
FT                   RAFRTFRLPGLLAAMRRAAMLRPSGWDVAGNKYLSLYERTAAIAPALATVS"
FT   CDS_pept        71996..73624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66822"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66822"
FT                   /protein_id="BAE66822.1"
FT                   /translation="MADQPESPSRPRGGLRRLLPWSGADTARTATTVHTVINGERGGQG
FT                   LAAHQLVPAKAKSGAHDPAAATALLIRLFSHAAHPEALLLAFAEGITSLHGELGDMGVR
FT                   LSAAYAAGDWPGYGRALRQLIDKYIRTIDIGDSLAEGRTEAEQLRDLLRHALGNALATL
FT                   LQRSPELAEEAQTLASALRHWRPGHELLTLEQRLRELSHQIGLRAEDASEQQNLLLGLF
FT                   DLLLENVGELLDDRSWLQGQISVVRQLISGPLDVSSIEQARGTLREVIYKQGLLKQGIA
FT                   ESKTAMREMMVSFVDRLDGMATSTGEYHDRVAGYSQAIGEARGIPDLNRLLQDLLQDTA
FT                   GVQAQALAARDELLSARRQVEDCEQRIASLEQELKDVAGLVREDQLTGALNRRGFEELF
FT                   QREAVRTQRSGQPLCVAMLDLDDFRRLNETHGHAGGDAALRHTVDVAKAVLRTTDAIAR
FT                   FGGEEFVLLLPDSTIFEASAAVIRLQRALSQRSLLHDDVRVFISFSAGVALRGTDETQD
FT                   DVIRRADRAMYDAKSAGKNRVINAD"
FT   CDS_pept        complement(73621..74985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66823"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66823"
FT                   /protein_id="BAE66823.1"
FT                   /translation="MQKRIDDRAHAGGSAQADSANAANGARAEPIRAGAMIGRRRFLSL
FT                   GAAAIAASTTGAPARAALPGQRQMRATWVTSVLNLDWPSAVSAQMADPVARVMAQQQEL
FT                   LTILDQAQALHLNTLVFQVKPCADALYRSRILPWSQVLTGVLGKDPGFDPLAFLLRHAH
FT                   ARGIQVHAWLNPYRVSTDISQATLEMLRTAASDSPPSVYVQHPEWVGVAADRLVLDPGI
FT                   PAVRRWICAVVAELIVHYDVDGVQFDDYFYSETAQSPLDDAQTYARQGAGFADKGDWRR
FT                   DNTYRLIRDVGTTIRAIRPSVAFGFSPAGVWRNRQDDPRGSDTQAGAPSFDVAYADTRR
FT                   WVREELIDYIVPQIYWPFARQIVRYDVIARWWADTVGTGRVQLYIGMALYKVGTSSALE
FT                   PDWTVAGGVPEIARQLDLNAALPQIRGCMLFRHGFLAQPQTAQVVDYLTLRWQGD"
FT   CDS_pept        complement(75178..76119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66824"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66824"
FT                   /protein_id="BAE66824.1"
FT                   /translation="MAGASLFTLLDDIATLLDDVSILTKVAAKKTAGVLGDDLALNAQQ
FT                   VTGVTADRELPVVWAVAKGSLVNKMILVPAALAISALEAWLRGRGYNVPLVMPLMMIGG
FT                   AYLCFEGVEKLAHKFLHNDEEQAQRHAERTRALADQNVDVVALEKDKVKGAIRTDFILS
FT                   AEIIVLSLGVVTEVSFGQQVVVLVAIALAMTIGVYGVVAAIVKLDDLGLYLTKKGAALA
FT                   AMGRGILVAAPWLMKFLSVAGTLAMFLVGGGILVHNIPALHHLVVDLATSSGSMGWLVE
FT                   ALGNILVGVVAGAVVLGAVMLFQTLRGSKNVQ"
FT   CDS_pept        76360..78084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0070"
FT                   /product="ABC transporter substrate binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66825"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66825"
FT                   /protein_id="BAE66825.1"
FT                   /translation="MALIQNDPHRAPAQATGPADHAVVGGMSRRTQILRLLLRYRGSGV
FT                   FAGMHLDPAAINEYEVPAEGTPDQFVSDLESLGPTFVKLGQMLSTRPDIVPPEFATALE
FT                   RMQENTSSVPVEHIRQIIEEELGVSVNKAFSHFDPVPLGCASLAQVHRAALRDGTPVAI
FT                   KVQKPEVAAQVRSDMEVLKSFATAADRLTGIGRRVRFADWLGEFGKTLRAELNYQDEAE
FT                   TLVRFGKHLKPFPQLWVPQPIWDLSSRRVLTMQLAEGVRVDKISGLRRTEQPMDGLAAE
FT                   LVKGYLDQMFVHGEIHADPHPGNLRVLQDGRLAIFDLGMVAHVPPRLRERLLKLLFAAV
FT                   DGRGEEVAEETIALSTRLEDYDEERYQRETGQMIARYAAHDATSEGRVVLDLVRIATST
FT                   GLRTPPELSLLGKTLLNLEGVCRALSPTLDTRRIVERHLQHVMRARLKKSMSAANLASE
FT                   AMELQHLVREGPRRISEILSLAAENRLQMRVTGLEESHLMESLQKIANRVAAGIVTAAL
FT                   IMASAQMMRIDTGLKLWGYPAIAMVLFLLGVVLGLGIVVSALLFDRRVRAREERGHR"
FT   CDS_pept        complement(78091..78375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0071"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66826"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66826"
FT                   /protein_id="BAE66826.1"
FT                   /translation="MERPVHLLMDRAYEGNETRQLALDLGFVPVVPPKSNRVDPWEYDK
FT                   EMYKRRNEVERLFRRLKGYRRIFTRFEKLDVMFLGFLSFVLVVDGLRMC"
FT   CDS_pept        complement(78435..78881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0072"
FT                   /product="ISXoo12 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66827"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66827"
FT                   /protein_id="BAE66827.1"
FT                   /translation="MSRAIKLLGMEITPAQFALIEHCLPLQRGNVSMTNLQVVNALLYV
FT                   AEHGCKWRGLPERFGNWHTVYTRINRWAKSGVLDRMFAQLQTCQIVRIKIEAVSLDSTS
FT                   IKVHPDGTGALKKTAHNPSGNRGADGTPKFIWLPQMLEQPSRSD"
FT   CDS_pept        78914..79174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66828"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66828"
FT                   /protein_id="BAE66828.1"
FT                   /translation="MWFAAAAAILLLVLFVGWAMLGYFRRELSTVKEELQRYENAMRVL
FT                   QAYSASDAVICDGCVCVNVDPNGQRTGDKHQYRQAKPRPQQ"
FT   CDS_pept        complement(79193..81658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66829"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66829"
FT                   /protein_id="BAE66829.1"
FT                   /translation="MSEFRFTCGARRGLLRRLLLLAALWMVCVGTALAQDEDTVLEAAQ
FT                   TQLDSMQKVLTQAEAGMEKSDTDQLRKLADDVTGAQRQAQDLARSLEPPLKELSVRLAG
FT                   LGEEQKTDPPDLRDHRRALTRERNGLDAELKRANLLALDAKDLADRLEGERAQRFSEKL
FT                   SARVASPLSPALGNEIAQQWPDDRTRLQALSDKAVQALRTGAATNGVAGPVIGTLGALM
FT                   LAFPLRIFLRHLGRRYAASRAPVGRLRRSGLALWFLLVGTLTLGMAAGALAESVRALSE
FT                   LPTDLEQLLSAFVVISCVAAFVGSLSASLLMKHQPTWRLFPLDDATVDRLRVHCLATAA
FT                   VSWFSGMAIRINDVARSSSALTIATDAVAALLYAGLILSALSGLTLSLRAHAANVGAAD
FT                   ADSSAPPPVVSRGGGYIVLIRLLGHLAVIFALVAALFGYINLALFVEQQIIWITLVCSV
FT                   LALLVMFADDLTTWVFKPESRFSRALSHALSVGNGRLVQVGLLISAAVRVLLVLLGIAA
FT                   LVTPYGANLAAVTGWLENVSHGIAIGKELVITPGDVARALCVFLLGMGLVHIVQRWLLS
FT                   TYLPKTELDAGARNSISTAARYLGWLIVAVWGLTALGLDLRRLALVLSALSVGIGFGLQ
FT                   AITQNFVSGLILLAERPVKIGDWVRIGDQEGDVRKISVRATEIQVGDRSTLIVPNSELI
FT                   TKSVRNMTLSNPMGRVQLQFSVPLETNVAKVRDVLLALFAEHEKVLAEPAPSVFIDSLA
FT                   GGHVNFNSFAYVRSPRDSYGVRSELFFALLQRMATASIALQSPQEIRFSRPGTAMERDA
FT                   GDGAPVSED"
FT   CDS_pept        81936..82277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66830"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66830"
FT                   /protein_id="BAE66830.1"
FT                   /translation="MQIQIQTDNHVPHDPSVVAHVEKTCTAQLAHFASDITRVEVHLRD
FT                   ENGQRGGAADRTCSIEAHVAGLPPIAATNSAETTASAVTGAARKLRTAIEHARGKQHSK
FT                   ATAPPPDML"
FT   CDS_pept        82627..83394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0076"
FT                   /product="ISXoo2 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66831"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66831"
FT                   /protein_id="BAE66831.1"
FT                   /translation="MERKGSGRPRTLTPAQERQVLGWVNGKNPGQHGFAFGLWTRQVVR
FT                   ELIEKKCAARLSLASVGTLLARLGLSPQKPLQHAYQRDPLAVAQWQEQTSPAIVKHAKR
FT                   EKAEIDFWDASGFRANAVQGRTWAVKGVTPVVAVPGQRQSISAASAVNSKGGFWFAVYS
FT                   GGLNGELFVDLLKRMMKGRRRPIHLVLDGLPAHKTRGVRDDVDSLKGRLTLHFLPGYAP
FT                   DLNPDEIGVELHQAHGRSAQPAAQWREAGRSGA"
FT   CDS_pept        complement(83720..83980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0077"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66832"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66832"
FT                   /protein_id="BAE66832.1"
FT                   /translation="MPVPIDGVDGLSARPARVVWHGEQLAAFPSTKIAKPTRCNRTKAA
FT                   DSCLSGVFPTSAATYLLLRIPLFACKPHAAESCGPGRAWLD"
FT   CDS_pept        complement(84159..84422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66833"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66833"
FT                   /protein_id="BAE66833.1"
FT                   /translation="MPDDGYLIRTGVATRVLIAACGSLLAARRVDRTIMRHVRHADPAG
FT                   CICCAPLPVQLERDFFARNRCAQASLLSTATLGGMFHRRRRA"
FT   CDS_pept        85028..86047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0079"
FT                   /product="putative protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66834"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66834"
FT                   /protein_id="BAE66834.1"
FT                   /translation="MHQTTSVGPTTFVRELIGEAMFAAFRHLPPEAVVAMQAVSGTLHL
FT                   ALHTLRRNRENRNPDAAARGFHNLNLEQWEALSEDERHHKRGEQQHYSDLVTRLALTGI
FT                   LSNIAIGAAGKAHGRPEMAARLLTSELKVAPYAAARDAIQATFRMVGTRAPTNGGVSDP
FT                   HVTSAGRFYGIANILTNLASNELEAPDFASARQRWAGLLSPFNIGDATRIVFQQAAVNA
FT                   ALNVALETADWLSVTQHEADEAGTQQIWEPAWKAKREDYERIMDHSVARTAAINSNIAF
FT                   GTAVNMIGTWLGLPPARSALLSNTLAGVAAGMQYKVIAGTWQAAAAVREAEAARAQTE"
FT   CDS_pept        complement(86511..86984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0080"
FT                   /product="Hpa2 homolog"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66835"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66835"
FT                   /protein_id="BAE66835.1"
FT                   /translation="MHAQLSRCGRWAGTGPQRILFAAALACAAPFARADCFEEAAGYQH
FT                   VNPWVLRAIAWQESRGRADAIHRNNNGTVDYGKMQINSIHLRRLFGYGISKEALMQPCV
FT                   SVYVAAWRLREMTNKYGNTWAAVGAYHSETPGERDKYAHAIHSILLRRGVIGE"
FT   CDS_pept        87450..87869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0081"
FT                   /product="Hpa1 homolog"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66836"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66836"
FT                   /protein_id="BAE66836.1"
FT                   /translation="MNSLNTQFGGSTSNLQVGPSQDTTFGSNQGGNQGISEKQLDQLLC
FT                   QLISALLQSSKNAEEGKGQGGDNGGGQGGNSQQAGQQNGPSPFTQMLMHIVGEILQAQN
FT                   GGGAGGGGFGGGFGGDFSGDLGLGTNLSSDSASMQ"
FT   CDS_pept        complement(88608..90425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0082"
FT                   /product="HrcC protein"
FT                   /note="HrcC protein (HrpA protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66837"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66837"
FT                   /protein_id="BAE66837.1"
FT                   /translation="MAPACTTTHRQRAPLFAVLLLSLLPLFSPQADAAQVPWHSRTFKY
FT                   VADNKDLKEVLRDLSASQSIATWISPEVTGTLSGKFETSPQKFLDDLAATYGFVWYYDG
FT                   AMLRIWGANESKSATLSLGTASTKSLRDALARMRLDDSRFPVRYDEAAHVAVVSGPPGY
FT                   VDTVSAIAKQVEQGARQRDATEVQVFQLHYAQAADHTTRIGGQDVQIPGMASLLRSIYG
FT                   ARGASVAPIAAFGANFGRVQPIGGGSSNTFGNAAQGQGGGASGTLGLPSAWFGGASPSD
FT                   RMPVSPPLPGSGAAAGSPASVWPELSKGRRDESNPIDAGGGAELASDAPVIEADPRTNA
FT                   ILIRDRPERMQSYGTLIQQLDNRPKLLQIDATIIEIRDGAMQDLGVDWRFHSQHTDIQT
FT                   GDGRGGQLGFNGVLSGAATDGATTPVGGTLTAVLGDAGRYLMTRVSALETTNKAKIVSS
FT                   PQVATLDNVEAVMDHKQQAFVRVSGYASADLYNLSAGVSLRVLPSVVPGSPNGQMRLDV
FT                   RIEDGQLGSNTVDGIPVITSSEIKTQAFVNEGQSLLIAGYAYDADETDLNAVPGLSKIP
FT                   LLGNLFKHRQKSGSRMQRLFLLTPHVVSP"
FT   CDS_pept        complement(90508..91338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0083"
FT                   /product="HrcT protein"
FT                   /note="HrcT protein (HrpB8 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66838"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66838"
FT                   /protein_id="BAE66838.1"
FT                   /translation="MNDVTDALLALSSQGVSLLTLLALCGVRVFVMFIVLPATAQDSLP
FT                   GIARNGVIYVLSSFIAYGQPADALAKIQTVGLVGVVFKEAFIGLLIGFAASTVFWIAES
FT                   VGLLIDDLAGYNNVQMTNPLSGQQSTPVSTVLLQLAIVSFYALGGMLMLLGALFESFRW
FT                   WPLTQLGPNMGAVAESFVIQQYDSMMAAVVKLSAPVMLVLVLVDLAIGLVARAADKLEP
FT                   SNLSQPIRGVLALLLLALLISVFIAQFGEALGFLHFQQQLHDAANLGGKAGASH"
FT   CDS_pept        complement(91335..91844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0084"
FT                   /product="HrpB7 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66839"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66839"
FT                   /protein_id="BAE66839.1"
FT                   /translation="MREPAYTWSVLHQLKARRCERMQERLSDCRRALEHCDRELARCRQ
FT                   DTEACTTRLADCDAALMDKTGVGGSINIDTILQHERFRTVLVEACRAAEQAQAAADQSL
FT                   QSARDELASVQQALSKLQAQAQVYADKAASARRARQAQRDAAEEEDAIETLVALRSHRA
FT                   AHGGAR"
FT   CDS_pept        complement(91837..93165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0085"
FT                   /product="HrcN protein"
FT                   /note="HrcN protein (HrpB6 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66840"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66840"
FT                   /protein_id="BAE66840.1"
FT                   /translation="MLAETPLLETTLERELATLAFGRRYGKVVEVVGTMLKVAGVQVSL
FT                   GEVCELRQRDGTLLQRAEVVGFSRDLALLAPFGELIGLSRETRVIGLGRPLAVPVGAAL
FT                   LGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTLGEG
FT                   QRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVV
FT                   VCATSDRSSIERAKAAYVGTAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPT
FT                   RRGFPPSVFAELPRLLERAGMGESGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILS
FT                   REIAAKNQYPAIDVLASLSRVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQG
FT                   SDAVADEAINRIDAIRDFLSQPTDQLSDYESTLEQLANVTDDA"
FT   CDS_pept        complement(93155..93856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0086"
FT                   /product="HrpB5 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66841"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66841"
FT                   /protein_id="BAE66841.1"
FT                   /translation="MRVWLRSTPDAIGLDCDVVPREALASVLALDAAAVEVHARCEQAL
FT                   SQAQARAQTLIEEAQQQAEAILHDARQKAERSARLGYAAGLRRQLDEWNESGLRHAFAA
FT                   ETAAHRARERLAEIVARTCEHVILGHDPAALYARAAQALEGALDEAKALRVSVHPEALD
FT                   AARRAFDAAATKAGWTLQVELCGDADLAVGACVCEWDTGVFETDLRDQLRSLRRVIRRV
FT                   LAAPQEPADVG"
FT   CDS_pept        complement(93841..94470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0087"
FT                   /product="HrpB4 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66842"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66842"
FT                   /protein_id="BAE66842.1"
FT                   /translation="MDNTRIDNAARCVQRWTDALAQLAESLDAARVAHWLGPVAASGWA
FT                   AAPVYRRMRVIQAWSGWSELSPSALGVHANQLALLMPARLANVLIARALFSRGLAVRRC
FT                   IERERLGWLEQCVGPAVLEHVRQNASAGLSVPLLPRDADQAAWVGDGWRRMQADGVWSN
FT                   PVVAKLLALSLPLGAAQVATVAADGASAAFLTALPTLMPEASCVSG"
FT   CDS_pept        complement(94478..95239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0088"
FT                   /product="HrcJ protein"
FT                   /note="HrcJ protein (HrpB3 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66843"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66843"
FT                   /protein_id="BAE66843.1"
FT                   /translation="MRALRYLVVLLALLLSACSQQLYSGLTENDANDMLEVLLHAGVDA
FT                   SKVTPDDGKTWAVNAPHDQVSYSLEALRAHGLPHERHANLGEMFKKDGLISTPTEERVR
FT                   FIYGVSQQLSQTLSNIDGVISADVEIVLPNNDPLATSVKPSSAAVFIKFRVGSDLTSLV
FT                   PNIKTMVMHSVEGLTYENVSVTLVPGGAESDAQLTASAPPRPSPWPWVVGCVVTLCLAG
FT                   AAALYWWPNPQAGRWGGLQRLRELTTKGKAG"
FT   CDS_pept        complement(95241..95633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0089"
FT                   /product="HrpB2 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66844"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66844"
FT                   /protein_id="BAE66844.1"
FT                   /translation="MTLIPPVQAIAGTSAAATQALSPVAAPNQALVNRFQALMQSSSPL
FT                   PPAMQRVGSPSMMSRVVDVQNDGVRTIAEHIDAFSMQAPTMGLQEMAAQQIKLMHELTM
FT                   VGFNLNVSVGVAQSGKNAVQTLVKNQ"
FT   CDS_pept        complement(95667..96122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0090"
FT                   /product="HrpB1 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66845"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66845"
FT                   /protein_id="BAE66845.1"
FT                   /translation="MEKIQCPGSVVSGLIELITVGLTHEKIQDAAAVLAAVRVLRPELK
FT                   ALDTFDAWISIKRGNYVDGARLLRELEGDAGSKPLCRALYACCLFAMGDPSWHGVADGL
FT                   IEEDADADAVALVKALSGRTTPTSAPADVPVESSAPMEVPNSQYLRA"
FT   CDS_pept        96337..97416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0091"
FT                   /product="HrcU protein"
FT                   /note="HrcU protein (HrpC1 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66846"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66846"
FT                   /protein_id="BAE66846.1"
FT                   /translation="MSEEKTEKPTEKKLRDARKDGEVPVSPDVTAAAVLFGALLVMKSA
FT                   GDYFVDHMRALTRIGFDFSENTRDATAINRALAHIGIQGLLLMLPFLAACLVAGLVGGA
FT                   FQTGLNASLKPVSPKFDSLNPANGVKKLFSLRSLINLLKLIIKAILIGVVMWVGIRTLM
FT                   PMIIGLAYETPLDISQIAWRTLSMLFALGVLLFILVGAADWSVQHWLFIRDKRMSKDEQ
FT                   KREYKESEGDPEIKGKRKEFAKELVFGDPRQRVAKAKVMVVNPTHYAVALAYEPDDFGL
FT                   PQVVAKGVDDGALELRAFAHNQGIPIVANPPLARALYQVELGDAIPEQLFETVAVVLRW
FT                   VDGLGRDHGDGDGNGALPC"
FT   CDS_pept        97410..99347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0092"
FT                   /product="HrcV protein"
FT                   /note="HrcV protein (HrpC2 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66847"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66847"
FT                   /protein_id="BAE66847.1"
FT                   /translation="MLGDRVRATRYFAYSGEVAIAALVVAVIGLMILPLPTPMIDTLLG
FT                   INITLSVVLLMVTMYVPDSISLSSFPSLLLFTTLLRLSLNIASTKSILLHAEAGHIIES
FT                   FGELVVGGNLVVGLVVFLIITTVQFIVIAKGSERVAEVGARFTLDAMPGKQMSIDADLR
FT                   GGNLTADEARRKRARLAIESQLHGGMDGAMKFVKGDAIAGLVITMVNILAGIVVGVTYH
FT                   GMTAGDAANRFAILSVGDAMVSQIASLLISVAAGVMITRVANENETRLSSLGLDIGRQL
FT                   TSNARALMAASVLLACFAFVPGFPAVLFLLLAAAVGAGGYAIWRKQRDISGNDQRKLPS
FT                   TSRKGAKGEAPHIRKTAPDFASPLSMRLSPQLAALLDPARLDQAIESERHQLVELLGLP
FT                   FPGIAIWQSESLQGMQYEVLIHDVPETRAELENTEDMQGALARQAIAPLHARAHLFVGI
FT                   QETQWMLEQVAADYPGLVAEVNKAMPAQRIADVLRRLLEERIPVRNIKSILESLVVWGP
FT                   KEKDLLMLTEYVRCDLSRYLAHTATAGTGQLPAVMLDHAVEQLIRQSIRATAAGNFLAL
FT                   PPEQANQLVEQVERIVGGQAQHPMAVVASMDVRRYVRRMIEARLTWLQVYSFQELGSEV
FT                   QLQPIGRVVV"
FT   CDS_pept        99371..99988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0093"
FT                   /product="HpaP protein"
FT                   /note="HpaP protein (HrpC3 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66848"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66848"
FT                   /protein_id="BAE66848.1"
FT                   /translation="MRILPVSGALQRPATPATPARSAQRSSFLQLRQRLRSVELALPCM
FT                   VLPPQCDDEDRPEPDAEERFTEARDSAPVQTDPPLRLDGPKHREPPQGNDNGAVGRQIA
FT                   TEWIRTQRAQMAIDHIALRVADFCNAKPVRSAGSWEAWLDIDQEVVAQTTLFLRLSPHQ
FT                   LSLRFNTSSPDAREVLWCGRQRLEAALTSTLSSTLQISIEVV"
FT   CDS_pept        100120..101034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0094"
FT                   /product="HrcQ protein"
FT                   /note="HrcQ protein (HrpD1 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66849"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66849"
FT                   /protein_id="BAE66849.1"
FT                   /translation="MFGDPRAGRQCGFVTHCRGISPNDAALLRLQVDTGQMDLRIAARD
FT                   GLALLLNEDDDALRVSIAGMLLADHLGAFAPLGLAAAEVIAFERDATPDDCHGIGMTLG
FT                   DLDAIALKASASLLDTLQAAVDGLAAPAQLPAWLAALRVNTRLRIGGRTASAALLQSLR
FT                   PGDVLLHCTAAAALTSGEVLWGIAGGAVLRAAVRLNMQQMILEASPTMQHDTFEPEVAP
FT                   STSNVAELELPVQLEVDQLALSLSTLSGLQPGQILELSVPVDQADIRLVVYGQTIGTGR
FT                   LLAVGEHLGVQILSMSESTHADA"
FT   CDS_pept        101021..101665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0095"
FT                   /product="HrcR protein"
FT                   /note="HrcR protein (HrpD2 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66850"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66850"
FT                   /protein_id="BAE66850.1"
FT                   /translation="MQMPDVGSLLLVVIMLGLLPFAAMVVTSYTKIVVVLGLLRNAIGV
FT                   QQVPPNMVLNGVALLVSCFVMAPVGMEAFKAAQNYGAGSDNSRIVVLLDACREPFRQFL
FT                   LKHTPEREKAFFMRSAQQIWPKDKATTLKSDDLLILAPAFTLSELTEAFRIGFLLYLVF
FT                   IVIDLVVANALMAMGLSQVTPTNVAIPFKLLLFVAMDGWSMLIHGLVLSYR"
FT   CDS_pept        101670..101930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0096"
FT                   /product="HrcS protein"
FT                   /note="HrcS protein (HrpD3 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66851"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66851"
FT                   /protein_id="BAE66851.1"
FT                   /translation="MDHDDLVRFTSEALLLCLKVSLPVVGVAALTGLLIAFVQAVMSLQ
FT                   DASISFALKLVVVVAAIAVTAPWGASAIMQFGQALMQAAFP"
FT   CDS_pept        101927..102754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0097"
FT                   /product="HpaA protein"
FT                   /note="HpaA protein (HrpD4 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66852"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66852"
FT                   /protein_id="BAE66852.1"
FT                   /translation="MIRRISPGPLQPSVSTEHGGSHHHADHHADAASTSAGSPADIAAR
FT                   ATRLRPAPPRRRRRGNRSLDGHEDEFDANEQEEIEAKRECALRGRVSVAIAPAQSREHG
FT                   QSDQHGGDRNTHTDDTQAGPWHGGAPRQVTDSIRTCIDAILNRYVARRDADPVAKRDAL
FT                   AAALVELRAIGVSHPAVAPLTETVWRLMREHLSSYDKATAAENLQTLRTRLLELMPSEL
FT                   EPVPALRNFHLLLPLILLNAEKPRRQVDRRHAITRLNTLLIEQPEQAAQEVRP"
FT   CDS_pept        102751..103689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0098"
FT                   /product="HrpD5 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66853"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66853"
FT                   /protein_id="BAE66853.1"
FT                   /translation="MTMQLRVLTGTHAGARLDLAPGRYTLGSDPQTDIRIDDWPGCSLS
FT                   IEVDQDGQIRYSSDTLPETSFVAFQPVRFGPLVLCVGDAGADWPDDVALLERLLSPAPP
FT                   PAPRTSRRNIVRTAVGAVLALAAAALLPSLQPAFLSDAAARQHPETAVNQAKGLLKQLG
FT                   FREAHVAQVGTRVLIEGLVPSSADAARLRAQVRRYHPGVAVNVAVVDEVVATLRDTLAD
FT                   PALSVRYEGNGVFSVSGSSDYAERASRRIADVRSDLGPEVRALHVEISQQDPSIKTPDN
FT                   YDAALLADDLHYVETPDGTKHMTSLPQQAAQ"
FT   CDS_pept        103699..103941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0099"
FT                   /product="HrpD6 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66854"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66854"
FT                   /protein_id="BAE66854.1"
FT                   /translation="MFDAMTDAVTQDMSKILQTKAADLSGERLRNVDTALDATAQQIRG
FT                   HWSAASDQAARSDFNVLHDGITAARNIVAHIANMR"
FT   CDS_pept        104022..104303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0100"
FT                   /product="HrpE1 protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66855"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66855"
FT                   /protein_id="BAE66855.1"
FT                   /translation="MEILPQISSLNSRFQQGMDGYTGGVANGISGASALSGSNGQMGSL
FT                   LGDMSASDEAQKSMNNKITQLKNDLDFNVALNKFIGKAGDNAKQLVGQ"
FT   CDS_pept        104358..104828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0101"
FT                   /product="HpaB protein"
FT                   /note="HpaB protein (HrpE2 protein)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66856"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66856"
FT                   /protein_id="BAE66856.1"
FT                   /translation="MSSARFETIVRQMCESLDLPDVESVLSRRVLWVEGFEVYLHLPTP
FT                   QPGDDAQQEALYLRIAYGLPPAGRTLTVFRLLLEANLSVYAQDQAQLGLNDNGVIVLIV
FT                   RVPLDDDVDGAWICDLLAHYAEHGRYWNNNIFVAHDEMFEGIATGNYLWLRA"
FT   CDS_pept        104839..105111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0102"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66857"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66857"
FT                   /protein_id="BAE66857.1"
FT                   /translation="MASCRSINHGCSCTDQPWHSNRVAVHCLPRAVSGLRRGARCVAVV
FT                   FHHDWQRLRATNKTTALTARRARPVRGIGMYHADPPVLSAPSAPT"
FT   CDS_pept        complement(105243..107228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66858"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66858"
FT                   /protein_id="BAE66858.1"
FT                   /translation="MKLSGGIEAASSSGAASHPPVEPTQAEDVDAPREEHAQTEPLWGL
FT                   TSSSTALRSRRTSLSGRSRPHADEEGATLGGSHPQSSQSSGARFYTAEVVSQVQEINAP
FT                   AVPAAAATYAERSTAAAAEVKAQLRARLDALPFAAPSKEQTALQASYLEWADARVQERI
FT                   TAFGPDAGYQAVGDMKTAGTKAALPIAYQCLRSFIIGAMRNPVGLATGAAYAARRPIGA
FT                   EELSTVMVSGVAAGSASYISDTLLIPAMDRRTRVANMPKFQAVDPKILAPDPPPVILEV
FT                   TAEGKRFTRPGDNDAPTLAELKAQTYDRRLEITQLQSNLDDKSLNTLLLKPVINGIFNA
FT                   ARRTGGNPDLLTPAGQLGFSALAIGGAGIVQKTLLETGKAVARTGQMSVPDLVGGEQRL
FT                   NLFALALPDKERRPAQWSDAVHFPPRYLLDTGKEALALARQGINSANAIATTTRDLLTR
FT                   HMLSNVISSFASMGAARIITAPLRGGSHTRVAGEAANSRAVVAQQAVQTLFNDTLWNAL
FT                   KAKNGTNTSQAARLDNERAVLAAKHQRTIEQTIEALAEPVGQAIATLSDQTRAMEEGMR
FT                   VAPGAWLRGQTLRTALQALLKEIRAQSVSIATIDAVRTALREEGGQTSRAVPPDAATHA
FT                   LDGQLQTLKRALHDSEELRQWQSGRA"
FT   CDS_pept        complement(107225..107671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66859"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66859"
FT                   /protein_id="BAE66859.1"
FT                   /translation="MILESHNQTAATTAFFIGLSACLGLPGELAQRLGEGETILGPAGM
FT                   LCRVHTQGQPGELMAFPEVILPLAARELGGEEVVMLLSLQEQLLTEYGWRLTLSDLGLL
FT                   CVCPLLLVRTPEEVAAALDRGQVVARVVLDALATQVDTTQEVAS"
FT   CDS_pept        108236..109222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0105"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66860"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66860"
FT                   /protein_id="BAE66860.1"
FT                   /translation="MHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPE
FT                   QWAQDTVRRKKAGVPDQVVFQTKTALAMDQIDSALSTGIAAGVVLADAAYGTETHWRDQ
FT                   LSERGLLYMVGVRSNTKVWWGSHQPAPMPPASPKGSRPRTRPMRDSAHAPISVHEVAQR
FT                   LPARTYRQVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFS
FT                   TRPKQTPVKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFL
FT                   MRERLRSKKNSVAFKMPAVSKSVRPRGSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        109372..110340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0106"
FT                   /product="ISXo1 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66861"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66861"
FT                   /protein_id="BAE66861.1"
FT                   /translation="MQLTFGDAEGLGKRKQTRREIFLAEMERIVPWKRLLALIEPHYPV
FT                   SGRPGRQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPDETTI
FT                   LNFRRLLETHGIAARMLEAVNAHLSRKGQSLRSGTIVDATLIAAPSSTKNADRARDPEM
FT                   HQTKKGNQWYFGMKAHIGVDEFSGLVHHVQCTAANVADITVTHALLHGKEDSVFGDSGY
FT                   TGAEKRDELQSCEAAFFIAAKRSTIQAIGNKRARAWAERWEHFKASVRAKVEHPFRVIK
FT                   RQFGYTKVRYRGLAKNTAQVQTLFALSNLWMVRRHLLPARG"
FT   CDS_pept        complement(110553..111872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0107"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66862"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66862"
FT                   /protein_id="BAE66862.1"
FT                   /translation="MLNRSLEVRFEQDGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPPLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQRLPARTYR
FT                   QVSWRQGSDATLSSRFAAVRVRAAHNCQAHDEQWLLIEWPPGESEPRHYWFSTRPKQTP
FT                   VKTLVATAQGRWRIERDYQELTSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
FT                   KKNSVAFKMPAVSKSVRPRRSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        complement(112061..113044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0108"
FT                   /product="ISXoo6 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66863"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66863"
FT                   /protein_id="BAE66863.1"
FT                   /translation="MQLTFGDAEYNGKRKRTRREVFLAEMDQVVPWKGLLALIEPHYPK
FT                   SGQPGRQPYRLETMLRIHFLQQWYALSDPSAEEALYDTVSMRRFAKIGGLDEVPDETTI
FT                   LHFRHLLERHDLARKLFNRVNAHLSRKGQSLRGGTIVDTTIIAAPSSTKNKQGERDPDM
FT                   HQTKKGNQYDFGMKAHIGVDDDSGLVHHVECTAANVADITQAHKLLHGKEDTVCGDSGY
FT                   TGLEKREEMKRKRTLRYLIAEKPSKLKQIKNKRELKLAKRWEHTKASLRAKVEHPFRVI
FT                   KRQFGYVKVRYRGLVKNTAQMLTLFALSNLWLKRKELMPAAGNVCL"
FT   CDS_pept        113766..116138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0109"
FT                   /product="HrpF protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66864"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66864"
FT                   /protein_id="BAE66864.1"
FT                   /translation="MSLNMLSTGSNPSQLLGTSSNESSSSELFGSDSSNDGSDLPSTMD
FT                   TIFQQIYLLLAALQANTQTSASGDTPANTASGDADTQMSASDWQATQPIEKRTSWPSLG
FT                   YDFDPKNIKGKDAPPALEGSTVTWNDGTLTKSELQIVSTLNAHKDQMPIEYKNLDDKIN
FT                   DPSTPPDLKAALQGLKQDPRLFFAIGSQGDGKCGGKVSAQDLWDFSDSHPQVKDLGGKN
FT                   DEFNPKDIKGSNPPQAAEGSTVTWNDGQLNQSELEIVSVLDRHKDQVDSLSFDQLDAKI
FT                   NDPSTQPDLKKALKGLQKDPRLFFAIGSQKDGKCGGKIKAQDLTDFSYYHPQIAEYNDK
FT                   KAKSYTQNYIASDSPDKTKASVMTKSDALREMYRYSDYLPGNLSEDEFAKIVDGDSKTG
FT                   KCPPQLIAAAQYFRDHPDEWKEFSGDAGTMSTPDFLQKSTSEMHLTADEQKTLDTINSH
FT                   QDAFYGDGKELTRDKLDAISKDNKADPAVKEAATQLASDPLLFGLLNNSITGYKKPHHF
FT                   FGGGHVVDSGKISQNDFRQFYDHMSAANKTVNTPATHEASSPDQQKAVADMLMGKDDPP
FT                   AIKKPKKDVGTFQQGLHEFLKWDSKILDWMSVGLSALNGIPVIGEIADAAAIALESEAQ
FT                   AAQVVDTAIQGGDMSLALKLAGINMAGAVVGAVGGPTARIGAKEAAEGAAKGTAKGAAK
FT                   GAGKTAAERPSAAAFAKGYVAGSTISKSTEILKKPVMAGLHYEEYQLDKQKDGEIHQKL
FT                   DNAGGAPVGKQIIPTGIADNFEGDVRQNLRNVRIRRR"
FT   CDS_pept        116702..118642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0110"
FT                   /product="hrp-associated protein"
FT                   /note="HpaF protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66865"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66865"
FT                   /protein_id="BAE66865.1"
FT                   /translation="MFNINRLLRSRPQTDNADQAPAQDRPSRQPSPAQGLLSPLLARPR
FT                   RRESRSAADTSTPRNAAQGRFSRSPLHPSSQPEALAGASSAPPRSIEHDIDDWLAQSLP
FT                   MAERIPTGYNLHDGSRDTSRDVLQSAAEAIRRAATRRSTELLVDGLPATRLPDAIGRLD
FT                   ALQKLMLLYTGVQSLPDSLGQLSQLRHLQISGAQELKTLPPSLTRLSNLRTLQLMMVPL
FT                   DELPADLGRMQGLRSLALGGGHYARLPASIVELSRLTGLRVWHSSHFRELPENIGLMQG
FT                   LRSLELASNSKLEQLPGSLTQLHRLKKLDLSSNRRLAHLPEDIGQLRGLTELSLKSCAA
FT                   LRQLPGSVGDLAQLQLLDLRGTGLQTLPPWLARLPDRCDIKVSDHLADQLQQIRDPERA
FT                   QRAAQRLADRRRHASVPAAQQAGASWNRVPEFTRVLRSVDADLGERFEKWTQGLTQNAR
FT                   IFGASITSADMPLLDQVVAEAIRSPEFRSTFGQFLNEHTVKTLNMDGMTQVGDGGPRVR
FT                   GDVKTAFAEMLKHNIMHTQDQETALGLLQQALQNSGLGLARERLLRSTNQLTGRAEMWP
FT                   PLKAYISMHDVEGKAAQDAAITWAMAQLDEAHEGVIGEAEAKQESEQAQANANRFIERR
FT                   ARVLLREWGIH"
FT   CDS_pept        complement(118980..119195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0111"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66866"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66866"
FT                   /protein_id="BAE66866.1"
FT                   /translation="MMFSTVASSLLCRRAEWRPVKNRISHVPNRRSRLRAANNTTALTG
FT                   RRARPVAGSGIYHASTAVLSAPSAPT"
FT   CDS_pept        complement(119200..119583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66867"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66867"
FT                   /protein_id="BAE66867.1"
FT                   /translation="MKFGTLRQRVERAELLVDGRAQETRLHWSQLRQTWRAGWSPLRIV
FT                   TVGFGLGFVTGRNEPQAALGSIAGKLGGIPKILQMISTISALFTAQRAQEACEQAEGAA
FT                   DNAEEVASDPPVAVVQVPVDRAA"
FT   CDS_pept        complement(119580..120065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66868"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66868"
FT                   /protein_id="BAE66868.1"
FT                   /translation="MSDQASTAAGADAPDAHAETPGLDESVRAVGAAGRATLSSAKDTS
FT                   RALRRLVSADLQLARSAFGRGLAWACVAVVFGASSWLLLAGAIIALLQRAGLSWFQAMF
FT                   FTALASLLVTGIAAWRVFFYFDHTGLNATRRQLIKLGIFDDPSQDEDATTSARGART"
FT   CDS_pept        complement(120069..120431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66869"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66869"
FT                   /protein_id="BAE66869.1"
FT                   /translation="MSPTNTDQLRENLSEAGTHLKSAASAAGEAVKGATSAAGDELKLG
FT                   RANVKAELSDTALAGMAAAEFGGAAAKEQIDVLVAKGNDLLESATDLIRERPLAAFGVA
FT                   FAAGWVIAKLARSNDN"
FT   CDS_pept        complement(120548..121984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0115"
FT                   /product="protease DO"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66870"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66870"
FT                   /protein_id="BAE66870.1"
FT                   /translation="MRPLPTLLTLSLAAAFGGFAATGINAWLDNRAQATPQSNAAFTLP
FT                   TTAALPAAVAGQPVPSLAPMLQQAMPAVVSVNTKQVVRVRNPFFNDPILRRLFPEVPQD
FT                   RINESLGSGVIIDAQKGYVLTNHHVIENADDVQVTLGDGRTVKADFIGSDADTDIALIR
FT                   IKADNLTDIKLADSNALRVGDFVVAIGNPFGFTQTVTSGIVSAVGRSGIRGLGYQNFIQ
FT                   TDASINPGNSGGALVNLQGQLVGINTASFNPQGSMAGNIGLGLAIPSNLARNVVEQLVT
FT                   KGVVVRGTLGLETQNLTQQMLQGLGVDSLRGALVTRVLPGSAAAAAGVQPGDVVVAAND
FT                   QRVDSAEALHNYEGLQAVGSAVTLDIRRDGKPLKLKATLKEQDRAVTGDMLDPRLTGAT
FT                   FVDLPESLRQSGITGVMVSEVKRGGRAAANGLVTGDVIVASSVGEFADLASWRANFQRK
FT                   PQQLVVRILRGNAQYDALMR"
FT   CDS_pept        122226..123077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0116"
FT                   /product="histone H1 homolog"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66871"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66871"
FT                   /protein_id="BAE66871.1"
FT                   /translation="MSNGNGVTATLSDAVDSVKSTANELTETIASTTSEAVASVQEAAG
FT                   TAVEEVKTRVVKARKAVVKVEKTVAKKAGDAATAVKRSVAKTKRSLTATKDAAKDKLVA
FT                   TKDAAKQKLVSTKDAAKHKLTSTTDAAKQKLSSTSAAAKKKITDTKANTKRKLEIAKAN
FT                   AKAEAAALSAKTAAKSAARKTAVATVNARTAAKKAAAKSAAAKKSVAKTPAKPVAKKAP
FT                   AAKQTATKQAAVKKAPLKKAVTKTALKKAAKVTKTPATRAVAKTTAARKAVGKKAAKRV
FT                   AR"
FT   CDS_pept        123189..123500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0117"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66872"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66872"
FT                   /protein_id="BAE66872.1"
FT                   /translation="MSFNGTMLRSPSVTLLRTYAHPPLRGTFSPMQGDNVPVGGWNAMD
FT                   QGSEHGDDAALRERTARQYRRSIAMHRGMTHAVNVARPTASNRLRAAAKMQRPVPKWL"
FT   CDS_pept        complement(123537..123854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66873"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66873"
FT                   /protein_id="BAE66873.1"
FT                   /translation="MPGNEVQGSGIGLSVVAGIARLHGATIETGEGNDGRGLCVRVVFA
FT                   CDRPVGAVGNQLPAVQCEALRNQTSAQPRGWRGRCSVRHTGGGTWKARVCKHGPSAISA
FT                   V"
FT   CDS_pept        complement(124160..125047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0119"
FT                   /product="cell division inhibitor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66874"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66874"
FT                   /protein_id="BAE66874.1"
FT                   /translation="MHLLITGGTGFIGQALCPALLQTGCQVSVLTRDVRRAQRTLPGVT
FT                   AVETLDGVRADAVINLAGEPLAAGRWTDARKQRFRKSRLGITRHLHAWVAQQPAAQRPS
FT                   VVISGSAVGYYGERGDTALTEAEPAGDDFSAVLCRDWEAEANTIAALGPRVSWIRTGIV
FT                   LDRDGGALARMLPAFRFGGGGPFGDGRHWMSWIHRADMVALLLWLLQHGEHGAYNATAP
FT                   NPVTNAEFARTLAHVLHRPALLALPSGMLRLGFGEMADLLLISQRVLPQRALDAGFRFH
FT                   YTHLDPALRAILQR"
FT   CDS_pept        complement(125248..125673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66875"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66875"
FT                   /protein_id="BAE66875.1"
FT                   /translation="MLGVLAAIDENEIALAKQAIEQDLGGATGDVAQQMLHDQEANLEQ
FT                   TKSLGAAESPRAQAMRAKGKAAVEALSKTLTLPDGKDAYRNAFMRTMVIDHGDTIKIID
FT                   SELLPAAESAPVKQDLEQTRRVVSAHFERAHAVSSSR"
FT   CDS_pept        125754..126704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0121"
FT                   /product="ISXoo6 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66876"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66876"
FT                   /protein_id="BAE66876.1"
FT                   /translation="MQLTFGDAEYNGKRKRTRREVFLAEMDQVVPWKGLLALIEPHYPK
FT                   SGQPGRQPYRLETMLRIHFLQQWYALSDPSAEEALYDTVSMRRFAKIGGLDEVPDETTI
FT                   LHFRHLLERHDLARKLFRVNAHLSRKGQSLRGGTIVDATIIAAPSSTKNKQGERDPDMH
FT                   QTKKGNQYDFGMKAHIGVDDDSGLVHHVECTAANVADITQAHKLLHGKEDTVCGDSGYT
FT                   GLEKREEMKRKRTLRYLIAEKPSKLKQIKNKRELKLAKRWEHTKASLRAKVEHPFRVIK
FT                   RQFGYVKVRYRGLVKNTAQMLTLFALSNLWLKRKE"
FT   CDS_pept        complement(127095..127355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66877"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66877"
FT                   /protein_id="BAE66877.1"
FT                   /translation="MKTPYQVQQELERLERLVPHIVSDQGDRAEEILGFHIASLLGSAP
FT                   ANEHMLIRARTARMACTCRSAQDAVRARKAPVRPLGIAPVA"
FT   CDS_pept        complement(127408..127689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66878"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66878"
FT                   /protein_id="BAE66878.1"
FT                   /translation="MSRDPSVIDVQAEIAHWQARHAQGNLGAGKFSELSPVVKMACDIY
FT                   LQAPRSSDQERLRLFRDRLEHHFISSSTQSNYEQLATDCWQRLGARNG"
FT   CDS_pept        127828..128886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0124"
FT                   /product="ISXoo2 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66879"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66879"
FT                   /protein_id="BAE66879.1"
FT                   /translation="MSVSAVQPSMMKRDGRVVSRAALEEMRLMALQRMGEGESPAKVAS
FT                   SFGLHRGWAYKVLARAQEGGAGALMTRKGSGRPRTLTPAQERQVFGWVNGKNPRQHGFD
FT                   FGLWTRQVVRELIEKKFAARLSLASVGTLLARLGLSPQKPLQHAYQRDPLAVAQWQEQT
FT                   SPAIVKHAKREKAEIDFWDASGFRADAVQGRTWAVKGVTPVVAVPGQRQSISAASAVNS
FT                   KGGFWFAVYSGGLNGELFVDLLKRMMKGRRRPIHLVLDGWPAHKTRGVRDDVDSLKGRL
FT                   TLHFLPGYAPGLNPDELVWSYTKRTGVARSPLRSGEKLADRVHDQLSDIAARPELVRSF
FT                   FRHPSVAYISDL"
FT   CDS_pept        129027..129974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0125"
FT                   /product="ISXoo15 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66880"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66880"
FT                   /protein_id="BAE66880.1"
FT                   /translation="MSINSIARRLNRNACTLSREIRRQGAPGYAATSAASNYRLRRRAC
FT                   VRRRRLVEGSAIFQQVRDDLVLYRWSPQQIAAKLKAMHPDDPSQRVSHETIYTAIYTHP
FT                   RGGLKKELVEALRQHKPTRGLRRTTAAKRTWVPEELRIVHRPEEVAQRLIPGHWEGDLI
FT                   KGAFNRSCVGTLVERKTRFVVLCKMDGCTPQDALEGFTRQMKKLPHCLLGSLTYDRGTE
FT                   MTCYPELMKRLNIDLWFADPHAPWQRGSNENTNGLLCQFMPKGVDLSKASQEYLNNVAD
FT                   LMNARPRQTLGWKTPNQALEEEIAQFNSRVALAS"
FT   CDS_pept        complement(130229..130540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66881"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66881"
FT                   /protein_id="BAE66881.1"
FT                   /translation="MSPQRPPVETGATLRLAREGGVAAFPAMRRERQLAMDALDDAQRL
FT                   QLRRVLDQCMAHALPAPQAGGDDRRYFSIVWDGASEPLRIPEEHAPTEVVRLWKQGTL"
FT   CDS_pept        complement(130629..131252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0127"
FT                   /product="putative metalloprotease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66882"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66882"
FT                   /protein_id="BAE66882.1"
FT                   /translation="MYGRNSIDAKRMPLIGSVHYERGDDNAFWNGEQMVFGDGDGEVFN
FT                   RFTIAIDVVGHELTHGVTERTTNLIYQRQSGASNEAVSDVFGLLIKQYTLRHSAEQADW
FT                   IIGAGLLMPGIKGVGLRSMQAPGSASDDPARGKDPQPATMTGYVDTHKDDGGVHYNSGI
FT                   PNHAFYRAAVAIGGAAWEKAGRIWYRALTGGELAPVWTSPPSPR"
FT   CDS_pept        131619..131999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0128"
FT                   /product="hypotehtical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66883"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66883"
FT                   /protein_id="BAE66883.1"
FT                   /translation="MGGASDYAGAGFRNALAGASDRVPCGSRGVLRSFQLRQCLWNRRL
FT                   AVDNAQRFADAGQRCQYGSDHLCHVAARDAARSVAACTDITRMRVHPPLRATAIASCMA
FT                   LLKHPGMWRSKMPASIPRSRHI"
FT   CDS_pept        132040..132477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0129"
FT                   /product="MutT-nudix family protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66884"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66884"
FT                   /protein_id="BAE66884.1"
FT                   /translation="MSSELRPRVGCGAFIQRADGHLLLVLRGRAPEQGHWGLPGGKVDW
FT                   METVEATVVREVLEETGLQVHPQRVLCVVSHFEPDMDPPQHWVAPVYLASIQGPEHAVL
FT                   CEPEVLLELGWFALDALPTPLTRSAMQAVRHVQAERAATRE"
FT   CDS_pept        132647..133339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0130"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66885"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66885"
FT                   /protein_id="BAE66885.1"
FT                   /translation="MHTLEAAEDGFQRALRFAAREFAQDRPIKDLFAIQSRIIEHLRLV
FT                   LNDPGHSVVPEVPTDAARMHRLFHTEIAQLSQMWATRPPNATREENLKRRCIACAIDAR
FT                   PAMELLHDAQALRERVSLGMFNGEAPTCVDTAVSLEQLEREFAALSLSRRYQGSTWGAH
FT                   ARVPRAPWTRCMPRRCRPAICCRRWTACICSTTAKRSKNCASANAPPFQQAPGAAASAV
FT                   RSTALTRC"
FT   CDS_pept        133431..133829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0131"
FT                   /product="AtsE protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66886"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66886"
FT                   /protein_id="BAE66886.1"
FT                   /translation="MSLQVPQGALVVVADGGEARWFTNTGNQSTVVLRQHARTDVQNVD
FT                   DDGPAGKAPRDLTEADLDEMTFAKQLSHALNDGALKHEYMHLVLVADPTTLGRVRPLLH
FT                   KQTQQRLVGDLAKDLTNVTLADIQRALS"
FT   CDS_pept        133850..134122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0132"
FT                   /product="thioredoxin"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66887"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66887"
FT                   /protein_id="BAE66887.1"
FT                   /translation="MGFVREYATQAPERSAVDTRAGLQILEFGTDWCGHCMAAQPLLHT
FT                   LLGGYEAIDYRKIEDGRGRPLGRSFRVTLWPTIILLREGEELARA"
FT   CDS_pept        134631..135587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0133"
FT                   /product="IS1112 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66888"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66888"
FT                   /protein_id="BAE66888.1"
FT                   /translation="MSSSRLDLSERYRLHALHETGMSMRAIADALERAPSTISRELRRN
FT                   QHAARYRPDHAQRISEHRRTQASRRPRIDAERIGQIEDLLREDFSPEQIAGRTGLASHE
FT                   WIYRHIYADQKRGGQLFMHLRKRRRKRRRRGMRDGRGQLTHRRSWTQRPSVVEQRSRIG
FT                   DWELDTIRASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHTVHTLT
FT                   ADNGKEFADHRLIAACLQSDFYFADPYCAWQRGSNENANGLTRQYLPRQTDFSTITNAH
FT                   LRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSVANQS"
FT   CDS_pept        136224..137471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0134"
FT                   /product="acriflavin resistance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66889"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66889"
FT                   /protein_id="BAE66889.1"
FT                   /translation="MNNSADLLKELRIDRKAPSRESPSGRGWGIAIATLVVVIVLLLGL
FT                   AAWWWWLGRARPLQVRTVPVVAISAGSTSSSVLDASGYVVARRIATVSAQVTGKVLQVM
FT                   IEEGMRVEAGQVMATLDPIETNAQREVGAAQLAAARSQVQNVQAQLVVAEADAMRLQSL
FT                   VGEQLVSRSQYDQAMSQRDALRAQLQVAQRNVAVATHELSLSDIHVDFTVVRAPFAGVV
FT                   TAKAAQPGEIVSPLATGGFTRTGMIVDMDSLEVEVEVGEAYIGRVQPKMPAEVILDAYP
FT                   DWRIPAKVIAIIPAADRGKATVKVRVALKVKDARIVPDMGVRVSFLEKATAQQQNTPKG
FT                   VRVPVASLLHRDGTSRVFVLGNDNHVALREVKTGIDMGSDKQVVSGVSAGDTVVVEPPQ
FT                   ALKDGDAVTLSSDAQE"
FT   CDS_pept        137861..138439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0135"
FT                   /product="ISXoo12 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66890"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66890"
FT                   /protein_id="BAE66890.1"
FT                   /translation="MGQVRCAGPDVRPIADLPDRAHQNRSGLAGLHQHQGASGWHWRIK
FT                   KNGPQSIGKSRGGWNTKIHMVAADARTAITFGLTPGNAHDAPAGRALLEHLGPVERPVH
FT                   LLMDRAYEGNETRQLALDLGFVPVVPPKSNRVDPWEYDKEMYKRRNEVERLFRRLKGYR
FT                   RIFTRFEKLDVMFLGFLSFVLVVDGLRMC"
FT   CDS_pept        138695..139384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0136"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66891"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66891"
FT                   /protein_id="BAE66891.1"
FT                   /translation="MTALVTLRNVTKTYQRGPEKVQVLHGIDLEIERGDFVALMGPSGS
FT                   GKTTLLNLIGGLDTPSGGEIEIEGERIDLMSGGQLATWRSHHVGFVFQFYNLMPMLNAQ
FT                   KNVELPLLLTNLGAAQRRRHAEIALTLVGLDERRSHKPSELSGGQQQRVAIARAIVSDP
FT                   TFLICDEPTGDLDRHNAEEILKLLQQLNREHGKTIIIVTHDPKAAEYASHTVHLDKGEL
FT                   ADALVAD"
FT   CDS_pept        139397..140554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66892"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66892"
FT                   /protein_id="BAE66892.1"
FT                   /translation="MKYFSLVWAQLFRSETRTLLTLLSVVAAFLLFGMLDSVRVAFNSG
FT                   GSIEGVNRLVVTSRLSITQSLPIRLGTQIREVAGVRDVTSAIWFGGIYKDPKNFFANSS
FT                   VAPNYFDVYRELQIPPEQLKAFHTTRAGAIVGESLAKEFGWKLGDTIPLQATLFPRGGS
FT                   NNWPLELVGIFRSKDRTLAANEERQLMMNWKYFDESNDYIKNKVSWYTVTLDNPDHASR
FT                   VAQAIDAISANSDHETKSQTESAFQQAFVKQFADIGMIVTSIMGAVFFTLLLLTGNTMA
FT                   QAVRERIPELATLKTLGFKDGTLLTLVMVESVLLIGLGGATGLGLAALILPGLASKAMG
FT                   MLPPNVPLQTWLVGAGLIVVIGVVVGVLPALRAKRLKIVDALAGR"
FT   CDS_pept        140567..141877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66893"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66893"
FT                   /protein_id="BAE66893.1"
FT                   /translation="MKKHWLGNALSILLMVVGLGVWIALPWIGVLAVAVALMLWLLLTR
FT                   SGRLSLAAARIGIASLPQRWGASSVIVVGIAGVVGVLVAMLAMGRGFEVTLNSTGDDTT
FT                   AIVLRGGSQAETNSVITRDLVPLVSALPGIAKDVQGRAMISPELSQVVNLVSKSDGTDV
FT                   NAQFRGVGEQGWAVHDKVKIVDGRRFGTGLREIVVGKGAQNQFRGLDVGRTLSLGNQTW
FT                   TVVGVFASGDAHDSELWTDAQTLASTYQRSAWQSISARTEGKAGFDRFRAAMAADPRLK
FT                   LDVDTTRSYYGKQGGGLSKLIGILGTVIGAIMAVGAVFGALNTMYAAVATRVREIATMR
FT                   ALGFRSTPVVMAVMLETMLLALLGGVLGGAIAWAVFNGYSVSTLGSNFSQVVFQFKVSP
FT                   ELLWSGLKWALGIGLVGGLFPALRAARLPITTALREV"
FT   CDS_pept        complement(141890..142411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0139"
FT                   /product="ISXoo15 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66894"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66894"
FT                   /protein_id="BAE66894.1"
FT                   /translation="MHRPEEVQTRLVPGHWEGDLIKGAFNRSCVGTLVERKTRFVVLCR
FT                   MDGCTAADALEGFTRQMKKLPASMRTSLTYDRGTELTCYAELMQGLNIDVWFADPHAPW
FT                   QRGSNENTNGLLRQFLPKGADLSTVSQEYLNHIALLMNTRPRQTLGWKTPSEAMEEEIA
FT                   ALKSRVALES"
FT   CDS_pept        complement(142740..143555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0140"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66895"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66895"
FT                   /protein_id="BAE66895.1"
FT                   /translation="MVGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLCAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGA"
FT   CDS_pept        complement(143753..144115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66896"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66896"
FT                   /protein_id="BAE66896.1"
FT                   /translation="MRQPSSRRSKTTNKRSPSQATPCTDRQWTFVEPTLSPMMTREQAE
FT                   ALNAAELARKQRPPRRLRATQQCTMGYGYYPDSHQRVPALRLRGRWLEQLGFAIGCKLR
FT                   ITVRDSELVITVVGEE"
FT   CDS_pept        complement(144457..144828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66897"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66897"
FT                   /protein_id="BAE66897.1"
FT                   /translation="MEATADDIAIDNVPAAAALVKRVFAHVEQLIEPPDSGSRLQELKR
FT                   SRYRQIVEPPCRVIYRLDGQRIVVVHVLRSERALRKRRISRWKRLTKRRRSRPVGAACA
FT                   PCCMDNASTPVVNALSTPG"
FT   CDS_pept        complement(144882..145112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66898"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66898"
FT                   /protein_id="BAE66898.1"
FT                   /translation="MRTERVTTLKGQATELLAATERDKEPILITQHGLPSAYLVDVASY
FT                   ERMQQRMAILEGIARGEMAVAQGRTLTHEQA"
FT   CDS_pept        complement(145179..145841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0144"
FT                   /product="hemolysin III"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66899"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66899"
FT                   /protein_id="BAE66899.1"
FT                   /translation="MPVSTNVTAPHYKSVPARRADIAVHAAGLFLAIVGGAWLVWRAHA
FT                   SQTMLLATCIYALGLLVMFACSAAYNFAPPQRQPMLRKFDHAGIFVMIAGSYTPFFLVA
FT                   LDGTWRWVMILSVWCVALFGVFAKLCLPGIAKGFWVAIYLLLGWAGIVVINQMIAGLDS
FT                   VVLWLIAAGGAFYTVGVAFYVRKSLIYNRAIWHAHVLGGALSHWYAIWLCLRPLSEA"
FT   CDS_pept        146019..148514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0145"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66900"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66900"
FT                   /protein_id="BAE66900.1"
FT                   /translation="MPPFALAPRTETAERALATTDGRPSRDGALLTERLERRYHDRITG
FT                   SFTIPGRDGRYAPIPEDVPSALADALQARGISQLYSHQADAWAATQRGEHVAIVTPTAS
FT                   GKSLCYTLPVVSAAMTSGAKALYLFPTKALAQDQVAELLELNRAGELGVKAFTFDGDTP
FT                   GDARQAIRLHGDIVVSNPDMLHQAILPHHTKWAQFFENLRYVVIDEIHTYRGVFGSHVT
FT                   NVLRRLKRICAFYGATPQFILCSATIGNPQAHAQALIEEQVHAITESGAPTGDKHVLLW
FT                   NPPVVNADLGLRASARSQSNRIARIAIKSGLKTLVFAQTRLMVEVLTKYLKDIFDHDPR
FT                   KPPRIRAYRGGYLPTERREVERAMRAGTIDGIVSTSALELGVDIGALDVVILNGYPGSV
FT                   AATWQRFGRAGRRQQPALGVLVASSQPLDQYVVRHPDFFADASPEHARTAPDQPLILFD
FT                   HIRCAAFELPFIASEPFGPIDPLVFLEVLAESEVIHQEGDRWEWIADSYPATAVSLRSV
FT                   ADGNFVVVDKSDGKQQIIAEVDYSAAALTLYEGAIHMVQSRPYQVERLDWAGRKAYVTR
FT                   THVDYYTDSIDYTKLKVLDRFDGGVAGRGDSHHGEVHVVRRVSGYKKIRYYTHENIGYG
FT                   PVNLPDQELHTTAVWWQLPQATLGKAFASKQDALDGFLGAAYALHVVATVAVMADARDL
FT                   QKAVGNGDGAWCAVADQTGRGQLRGVEEGETATVELLQTFVPTVYLYDNFPGGVGLSEP
FT                   LWLRQAELLQRADELVRRCDCSAGCPACVGPVLAAHEEGKGDSPKSLALTVLALLFDAQ
FT                   APLRHATQVDDDLALDVPA"
FT   CDS_pept        148638..149132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66901"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66901"
FT                   /protein_id="BAE66901.1"
FT                   /translation="MQMPRMWVRCRSQLQMEFCLARRPHRWRMRSQVRRRPMCTSVRRC
FT                   CSQRMACVRPMRGTLLMHCVSIRRRPRGSARKMRRRRRQANARRGRLCRSCIAQWSGDQ
FT                   PLIRLALALLQAVRGWVPKAPCLRRVSHCSQHKTQQRLRLPVRRASARNVYACCGVRSV
FT                   G"
FT   CDS_pept        149387..150337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66902"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66902"
FT                   /protein_id="BAE66902.1"
FT                   /translation="MRHKPALSSDVDVDVDAIIAADADSASHSLTARSTTAPSTATPTA
FT                   PPVQRRTDIAGLRKMIGLRERAVSAHTPIRAPSTDRYLPGNEIAPGLHLIEALLPQAIP
FT                   CEALSLAFAKRDDAVDPMDLLFFDTETTGLAGGTGTRAFMIGVADWYVDAVQGSGLRVR
FT                   QLMMSTMAAESAMLDLFRTWLTPRTVLSSYNGRCYDAPLLKTRYRLARRGDPIAALDHV
FT                   DLLFPTRRRYRGTWENCKLSTIERQLLRVVREDDLPGSEAPAAWLSYLRGGSARNLRRV
FT                   AEHNHQDVVTLSLLMQRLVALEAEERHALTLARTP"
FT   CDS_pept        complement(150826..152970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0148"
FT                   /product="avirulence protein AvrBs2 homolog"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66903"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66903"
FT                   /protein_id="BAE66903.1"
FT                   /translation="MRIGPPQTSIAHTDALAIPTHTSASSPTQVPHVQGNTPPLRERAP
FT                   RRAVSIPPLVPLNDSAMTGKPALVALDSEFSEQRLAEVQARQITVQTLQGKLAAHLAQA
FT                   GTALTPDSIAARFAAGALEPVYLDTAAFNAMSRGLPARARAASGPVLIDAQQCRIVFNL
FT                   QRAFASGDTFSDAALTALGKALDLPGHGLATPDWLQPAARTPTRRKLQHAPRYHGHEVP
FT                   ARDGGAAFFKANDHRLLEGKQALLRNHRKALVHDHYFEAPSTRALGKDVMVHRGLFDNH
FT                   AGIPENSLSSIDNAYAKGYRNLELDVEVSADGVPVLMHDFSVGRMAGDPQNRLVSQVPF
FT                   AELREMPLVIRNPSDGNYVKTDQTIPGVEQMLEHVIKKPEPMSVALDCKENTGEAVAML
FT                   LMRRPDLRNAAAIKVYAKYYTGGFDQFLSNLYKHYQINPLHSQDAPRRAALDRLLAKIN
FT                   VVPVLSQAMLNDEHLRGFFRSNDDGAEGLADTAMQWLESWTRMRPVIVEAVATDDSDAG
FT                   KAMAMARERMRQPDSAYAKAAYSVSYRFEDFSVPRANHDRDYYVYRNFGELQKLTNEEF
FT                   GVKRTTAGAFRDDGESLLTDQAEAELLAILENRTLARGHTGNELDVPPETPIDINRDAE
FT                   IVKQRTREFQAGSIPADPNHIAAVREGKQRDHRADMVHDPAATRAVDKRAQASGLLTEK
FT                   YRGAPVTHYLNERANQTEPE"
FT   CDS_pept        complement(153161..154318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0149"
FT                   /product="xylose repressor-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66904"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66904"
FT                   /protein_id="BAE66904.1"
FT                   /translation="MPSLFANAAIRSHYRRRSDGQAAAPRERLLLDLIRRAGQCERSDL
FT                   PRASGLSVPGIKGIIDPLVADGLLQLGPSLRRGRGQPSAQVRLVPEYAYSVGVSLMVDG
FT                   IAVVLIDFAGQVRGMRQFTAFPLTLAVVRAQLPALLQVLLLAAGVDRQQLFGVGLSMTG
FT                   PRIGDGTRVNPPLSLAAEWMQVELDRLVADCLHLPVWMDNDAHCAALAEAVYGIGRQSP
FT                   DLVYLSIADGFAAGVIAAGNVRRGAHGNVGELGRISAITGMARPTLESLRQALAADGYV
FT                   LPDLHTMLQHYDAGWPQIDAWLDAVQPTVTLAVAAIIALIDPRVIVFGARLPTDLAHRL
FT                   IARIAFEPAPRRGVALPCPALKVGQVTAYASVLGAAMLPFKETLF"
FT   CDS_pept        154422..157079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0150"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66905"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66905"
FT                   /protein_id="BAE66905.1"
FT                   /translation="MRLLHPHSRPRCPALHCPPHPHALSLALGLALLGWLPSHAIAAEP
FT                   SAGADAHTLDAVQVLSSFQSQNTRAIATKQAASTIVDSVAADSIGQLPDFNVGDAVRRV
FT                   TGVSTVEYQGEPRYVTVRGLNGNYNSMLIDGFAFASNDIGSRQALMDVLPANFVDRIDV
FT                   VKSLLPENDGGAIGGVTNLVTATGFARPDGLLTASAKGGANLMGSRYGGRTPVGEGELK
FT                   WGKRFGHDGEFAFLGAASVWRRDISVPQQENGSALNWYNADGTRAPVAYGGTGAAVPSE
FT                   RRWYNYDNSRERSGVTARVDWQPEGPLSGHVSGYTFRQHEASDRNTQAAQVQSSARLTR
FT                   SGPQSGTLDNLNQLVELGQLRWKRGLSGINGELLAELPAQWRGALRASTSRATVDNPQT
FT                   WDRFQQNHLAYGFDWSGTLPAFTALNPALADNPSRYANFNHQQERTAYAERVSDLQLEL
FT                   RRNMDEDSRGLGLAWGLRQVRTHMQTAFQRTTWSGLPYSLADVLGDPTCALGCNAPMLT
FT                   IDPDLADARWDAASGQARGVVDTTAQNSGTYSVDEQVRAGFAQAQWRGERWRLAGGVRL
FT                   EQTRFGSSGQQLSGTVWSPVSAQRSYRNWLPSLAGQLQTSANGTLRFGASRSIGRPRLD
FT                   QMALNGGVLTLSSTPPTLNQGNPDLQPRRSQNLDLGHDWTFDDGGSLLSIALFHKTIDD
FT                   EIFRYGQLQTIDGQQVLVTQPRNTDRPVRMRGAELGAIKELGPWLPALAGLSVGANITF
FT                   LDVQYPVVLGDGSRTTLSVLPQQPKQLWNLTLNYARGPLRSTLAWSRTGELWDDRYPNY
FT                   SNQQEFYRNRYQQPLDRLDLKLAWDLSPAVAVSLDVLNLAGQGYEYHIGRHQEYVQSAW
FT                   KMAPTVMLGINVKL"
FT   CDS_pept        157090..157875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66906"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66906"
FT                   /protein_id="BAE66906.1"
FT                   /translation="MSSFLDTRITRRHLMAAAGTSLLTSSIPALAKTPPPPDVGYKFWG
FT                   SRRPMPFAGNTFLGHLEQQGDGYDSFDRVLNIYRELPEQRFANKFALLPPSSYHVTLLG
FT                   GVNESDRAHGPWPSDLERDHALADINADYLLRVKERATPPLGACRFLVNPTAAKTGANN
FT                   NLLIPLKPADTQTAQRLETARQALMQLTRLQRPDYINFQFHISLAYLCDTLDAAEQTAY
FT                   RTAVGGWLTRLAAAGPITVPRFHFCTFDDMYAFRTMHEV"
FT   CDS_pept        complement(158189..159328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66907"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66907"
FT                   /protein_id="BAE66907.1"
FT                   /translation="MTYRVVVLGGFGHFGARIVRALAATTQVHVIAAGRHPGDAATKWP
FT                   GSAPGSISTCRLDIDASDFAAQLAATGADAVVHTAGPFQGQDYAVAQCCLQAGMHYIDL
FT                   ADGRAFVRDFPAAMGAAARHAQRVAISGASTLPALSSAVIDALSPRFSALHEIRMVIAP
FT                   AQGTPLGLATVRAVLSYCGTPFSWWQAGRWQQVVGWAQPTRVHFAQLAPRLASPCDVPD
FT                   HDLLPQRYPGVQTVEFRAALEVPFLQCCLAVIAWLRQRGVPLPMQRLADVFAKAGRWFD
FT                   RFGTDLGGMRVELRGTRHTAEGASQPLLLHWDLTAAMLHGPEIPCFAAILLIRKLAAGK
FT                   PLPVGAHACLGLLTLAEFEREFAAWQMRTAVAQVDASSV"
FT   CDS_pept        complement(159417..159803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66908"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66908"
FT                   /protein_id="BAE66908.1"
FT                   /translation="MLWFRADGKQYLVRDPTLLHQMAMVHLRSQQLTDAQVRLAARQQA
FT                   LSEWQAAPAAGVDTHSIGHCFHASAAACNARCVAGIGAAATGAGAATGRIGKQAGRCIP
FT                   AGHAAGIECVARSTEKRPRDACQR"
FT   CDS_pept        160479..160784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66909"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66909"
FT                   /protein_id="BAE66909.1"
FT                   /translation="MIRILAPLAAVVLLSACASNQVAQVQPIDGAISGQCHIDKVRGAV
FT                   GLAAAAQTIERARVDSDSQQVILRHGEPAQGASESGGNQLTIETGPNNRITAIYCG"
FT   CDS_pept        complement(161072..162235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66910"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66910"
FT                   /protein_id="BAE66910.1"
FT                   /translation="MKAKRVLRNAAVTASTAGKLAAVATAAAVAPAAVASAAAVAQAKA
FT                   TARAAGLTYVNDQQPGISRRKAGKSFSYRDADTLQRIRSLAISPAYTEVWICATPNGHL
FT                   QATGRDARRRKQYRYHAGWAQVRGEGKFERVIAFGTALPKLRRRLRRDLVLPGFPREKV
FT                   LAIVVALLADTLVRVGNAEYARSNRSYGLTTLRNRHMEFLKGGRARLRFRGKSGQDHDI
FT                   EVDDKQLVTLIRQCQQLPGQSLFQYRDDDGQLQPVDSGEVNDYLREAMGEEFTAKDFRT
FT                   WGGTLAALQRLARLPLPERSTERALTQVQNDVIREVADALGNTPSVCRKAYIDPCVFEG
FT                   WRAGQLQAMAAGVRGERQWEAATLKFLTASRSKLKAQATPASKRKSA"
FT   CDS_pept        162382..162762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66911"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66911"
FT                   /protein_id="BAE66911.1"
FT                   /translation="MRAVLPVARLTCTLVVLTALTACNKPQPDEQEAVTAKAQHAAEQA
FT                   AAPAPDAAPEAPPIGSCDATQVQSLVGQPLTDAVGEQARNDAGAKSVRVLKPGQMTTME
FT                   FNGERLNLEVDAKNLITSVRCG"
FT   CDS_pept        162964..167436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0157"
FT                   /product="glutamate synthase alpha subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66912"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66912"
FT                   /protein_id="BAE66912.1"
FT                   /translation="MAPRTRQGLNEHGLYNSARDERDACGFGMVAQLDDQPSRSLVDTA
FT                   IAALSRMTHRGGVAADGLTGDGCGLLIRKPDAFLRVLARDAGITLGTRYAAGVVFLPLD
FT                   EADAARCRAELQAQLQSAGVQVRGWRVVPTDDSVCGQLARETLPRIEQVFVNAGAKQTE
FT                   DAFTLALFLARRRAEQALHAVEDFYVTTLSPNGISYKGMVLPDKLSTFYPDLQRSDLSS
FT                   SAIVFHQRFSTNTLPRWPLAHPFRLLAHNGEINTIEGNRRWAQARSKVWQTPRFDIAEF
FT                   DPVISMHGSDSQSLDNMLELLIAGGMDLLQALRILVPPATQALEFKDADLAAFYEFYGL
FT                   NTEPWDGPAGIVACDSRYAACMLDRNGLRPARWMLTSDRHFLVASEAGVWELPAERITR
FT                   KGKLGPGEMMAIDLKRGDLLDSDAIDRINRARAPYKQWLQQGVTYLQTELIDPSLVEEP
FT                   FSEQTLRSYHKLFQLSTEEVEQILRPLAETEQEATGSMGDDTPMAVLSRQTRPLYDYFR
FT                   QAFAQVTNPPIDPLREGIAMSLTTQLGKETNIFHAGAETVNHVILNSPVLSQRKLRQLL
FT                   KMEQYVARNRLIDLSYSVEEGLKAGLERICQDVEAAARAGAVMLLLSDRYPVPDRPMAH
FT                   ALLATGAVHHHLCKVGLRCEVNLIIETGTARDAHHMACLLGFGATAVYPYLAYQTLFDL
FT                   GRRGILQLSKGGEQSQIGRRYRKGIYKGLSKIISKMGICTIASYRGAQLFEIVGLDPDV
FT                   VELCFADTPARIGGVSLSRLDTESRELTARAWNDQLKPEVGGLLKYVHGGEYHMYNPDV
FT                   VMTLQRATRTGDAGDWQKYVDAVHSRPASTLRDLVQLKRAGTPTPLDDVAPAEDVLRRF
FT                   DTAAISLGALSPEAHEALAIAMNRLGGRSNSGEGGEDPARYGTEKRSKIKQVASGRFGV
FT                   TPEYLVNAEVLQIKVAQGAKPGEGGQLPGHKVNELIARLRYAKPGIGLISPPPHHDIYS
FT                   IEDLAQLIYDLKQVNPSALVSVKLVAHAGVGTIAAGVVKAGADLITVSGHDGGTGASPV
FT                   SSIRYAGVPWELGVAESHQALVANDLRERTILQTDGGLKTGLDVVKAALLGADSFGFGT
FT                   APMIVLGCKYLRICHLNNCATGVATQDERLRAGYFTGLPERVEHFFRLLAEEVRQWLSY
FT                   LGVRSLDDIVGRTDLLEQLELSPRPGVKVDLSRLLTHAHYDGSHCAAQRLYESPDSLAT
FT                   QMDGLLADAIAHKTGGEHRFLIHNTDRSIGARLSGAIARVHGNHGMSDAPLNLRFRGTA
FT                   GQSFGAFNAGGLQLELEGEANDYVGKGMAGGRLVVRPPRGARFEARSTPIVGNTCLYGA
FT                   TGGELFAAGRAGERFAVRNSGALAVVEGAGDHCCEYMTDGVVLVLGKVGLNFGAGFTGG
FT                   LAYVLDIERDFVDRYNHELIDIHRVSAEGFENHRQHLHTLISRHRELTGSIWAQQILDE
FT                   FRDYIGKFWLVKPKAASIESLTESLRRAA"
FT   CDS_pept        167631..169112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0158"
FT                   /product="glutamate synthase beta subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66913"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66913"
FT                   /protein_id="BAE66913.1"
FT                   /translation="MSRKQAFQFLDLPRTMPTRIPVELRTSGDWGELYGKFDKAEAQYQ
FT                   SGRCLDCGNPYCSWKCPVHNAIPQWLQLVQENRIEEAAALCHSTNPLPEVCGRVCPQDR
FT                   LCEGSCTLEEFGAVTIGAVEKYIVDTAFKMGWRPDLGNVHPTGHRVAVIGAGPAGLACA
FT                   DRLARAGIEAVVYDRYEQIGGLLQFGIPSFKLDKSVIGKRREILEGMGVQFRLGVEIGR
FT                   DISIEQLLGEYDAVFLGTGAYRYTDGGLPGQDLKNVLPALPFLVQNSRIVSGNDPHGRP
FT                   IAGWENQLALPDLTGKRVVVLGGGDTGMDCVRSAIRLGAAKVTCAYRRDEASMPGSARE
FT                   VANAREEGVRFLFNRQPLSIESGADDEAIGVTVVETKLGEPDASGRRNAVPVEGSESLL
FT                   EADVVIIAFGFSPSLPDWLASQGVEAGSNGRIVAPADGHGRLPYQTSNPRLFAGGDCVR
FT                   GADLVVTAVAEGRDAASSIVQLLGVKAQVKEPAAA"
FT   CDS_pept        169346..169756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0159"
FT                   /product="ISXoo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66914"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66914"
FT                   /protein_id="BAE66914.1"
FT                   /translation="MPTMRASEVLQKCLSDSLSGMHALRQRALLRAVEALLHGGRLTLI
FT                   DLARAWPGATRVRAPLKACDRLLCNRALQVERSAIEQDMAHWLLRGDQPVIVIDWSDLK
FT                   PDKSWCLLRAAVPIGGRTLLRLNLQVQHPLSS"
FT   CDS_pept        169760..170209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0160"
FT                   /product="ISXoo15 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66915"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66915"
FT                   /protein_id="BAE66915.1"
FT                   /translation="MHMSKSYQHLSAEERAMLQIERARGQSVRAISRILGRSPSTLSRE
FT                   LAKQDSTTYCARSAGKRYRARRQLSVRQRRLTPGTPLFQLVRDHLVLWRWSPQQIAAKL
FT                   SHMYPDDPAQRVSHETIYANIYAHPRGGLKKELVQALGQHKPKRG"
FT   CDS_pept        complement(170350..171348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0161"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66916"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66916"
FT                   /protein_id="BAE66916.1"
FT                   /translation="MVGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGVVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKARRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRSLAETMWRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTMFTAESAC"
FT   CDS_pept        171426..171860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0162"
FT                   /product="ISXoo15 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66917"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66917"
FT                   /protein_id="BAE66917.1"
FT                   /translation="MGTLVERKTRFVVLCRMDGCTAADALEGFTRQMKKLPASMRTSLT
FT                   YDRGTELTCYAELMQGLNIDVWFADPHAPWQRGSNENTNGLLRQFLPKGADLSTVSQEY
FT                   LNHIALLMNTRPRQTLGWKTPSEAMEEEIAALKSRVALES"
FT   CDS_pept        171883..172725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0163"
FT                   /product="ISXoo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66918"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66918"
FT                   /protein_id="BAE66918.1"
FT                   /translation="MVVAGKQQGSPGAEKRFLQQLRALIPDDVRPILVTDAGFRTPWFR
FT                   AVSAMGWDWVGRLRGRTQVKPQDVPDDAAQWVDSRRLHALASNRARALPPMQANRSDPR
FT                   DCRLVLYAKTPQGRQQCNRRSPAKVSRASSSLKAAAREREPWLIVASPQLHAPSAKQLV
FT                   NLYARRMQIELAFRNLKSHRYGQAMEDSLTRRGERLQILLLLTTLGTFAGWLAGLRCEA
FT                   TGIAQWLSPRSSTRKLYSTLRVGREALARCWPMEPVSRWLERLRALPDAVREQMTLAL"
FT   CDS_pept        complement(172751..173227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0164"
FT                   /product="ISXo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66919"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66919"
FT                   /protein_id="BAE66919.1"
FT                   /translation="MIVDAQSVKNSDTAGQKGYDAGKKVSGIKRHIAVDTQGFPHAVAV
FT                   TTAEVTDRQGALEALKRCRSGLGRVKRLLCDSGYTGDPFAEGVQDILGKHVTVQIAKRS
FT                   ELHTFKVMPKRWSVERSFAWLEKNRRLWKNCERRLNTSLQFIHLAFLALLLRRS"
FT   CDS_pept        complement(173193..173549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0165"
FT                   /product="ISXo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66920"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66920"
FT                   /protein_id="BAE66920.1"
FT                   /translation="MREKNYPSDVSRERFEQIRPILEQARKRTKPVTVDMYEVWCAVLY
FT                   LLRTGCPWRALPSDFPKWRTVHSYFAKWSEVDDEGISLLERALKKSGWRGPRETGAQGL
FT                   QHVLDRGRAEREEQ"
FT   CDS_pept        complement(173788..175227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0166"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66921"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66921"
FT                   /protein_id="BAE66921.1"
FT                   /translation="MLELPVFVTLPTGFWQFSPMRTRRPAAEQLHADELFRSRLENQID
FT                   VRHPLVQLSHRLPWSALEQALSPRLPATTGTGGRPALPMRLIAGLLYLKHAYDLSDEAV
FT                   CARWLENPYWQFFTGEVVFQTCVPCDPSSLTRWRQRLGEAGMEALLAHTINTAHTMKAV
FT                   DARKLSRVIVDTTVQEKAIAHPTDSRLLEVARKKLVLLAKRHGIALRQTYARQGPALRR
FT                   KAGRHAHAHARQFKRMRKVLRRQRTILGRVSRDLQRKLDQLEPSVRERIGVWLERAQRF
FT                   LAQRPKDKQKLYALHAPEVECMSKGKASSPYECGVKVGIAVSARKGLIVGARSFPGHPY
FT                   DGDTLAEQLEQARGLLQDVNVIPQVAIVDLGYRGRDVEGVQILHRGKAKTLTRRQWRWI
FT                   KRRQAVEPVIGHLKQDCRLNRCHLKGAQGDALHVLGCAAGDNLRWRLRWIAFLRAWLQV
FT                   VRARPSTRSSIMWPANMAFGV"
FT   CDS_pept        complement(175491..175712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0167"
FT                   /product="truncated 5-keto-4-deoxyuronate isomerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66922"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66922"
FT                   /protein_id="BAE66922.1"
FT                   /translation="MALERGALETSNERIIYQYIVPATCQSSQLLLGLTVLKPGSVWNT
FT                   MPPHLHDRRSEVYFYFDPGTNDCVYHFT"
FT   CDS_pept        complement(175740..176177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0168"
FT                   /product="putative 5-keto-4-deoxyuronate isomerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66923"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66923"
FT                   /protein_id="BAE66923.1"
FT                   /translation="MCHVPVLQNPLRHPSRRHQGRQQHDLRELYLLDGLFVDDAVTLKY
FT                   THYERFVLGGAAPLGKTLQLPKQTEPASAAGHASLERRALGILNVGAGTGTVTVDGTAC
FT                   TMGPKDGLYVAMSSTDVSFASEDAANPAKFYLASTPAHARL"
FT   CDS_pept        complement(176572..177600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0169"
FT                   /product="transcriptional regulator lacI family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66924"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66924"
FT                   /protein_id="BAE66924.1"
FT                   /translation="MHGLPKGKVATINDIARMSGVSKKTVSRIINNSPLVRQDTREKVE
FT                   ALMRQVGYAPDPLARGLAFRRSFLIGMVYDHPTAQYIVDMQYGALDALRGSSFELVVHP
FT                   CDSRSPGYIEGARRFAQAQKLHGVILVPRASEDQALADMLAEIGCRYTRIASIALDATS
FT                   QTVITHDRDGAAEAAEYLLSLGHRDIALVTGPSAYRSSIERTCGFADALTRRGIELPPE
FT                   RIVEAGYTFESGVAAAEKLLLGKKRPTAIFTGNDEMAAGIYKVALRAGISIPRQLSVIG
FT                   YDDSSLASRLWPPLTSVRRHTRDTGRTAAAMLIQPDNAPQLPTASVRPHLIVRESCQPP
FT                   ED"
FT   CDS_pept        complement(177845..178372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66925"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66925"
FT                   /protein_id="BAE66925.1"
FT                   /translation="MTVTTTTSPRLHRRTPSSSGFRAATLGPQWAFFNPAADEAKCLQL
FT                   GNGVLRLQGKGSAPRHALPLTVIATAPAYQFEVQMTVAPGRQSGARLFYSDKLYAGVGS
FT                   NGEHFVMHRYGGNAPARWPPVLPVLPCGCGSPTTATSSPSTAVPTARSGPRTRCRWKYP
FT                   ATTTTWPASSWP"
FT   CDS_pept        complement(178549..178773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66926"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66926"
FT                   /protein_id="BAE66926.1"
FT                   /translation="MQIDGVRIHVLHDLKTLAPQVQADVIISGHSHKPLVHTRAGVLCI
FT                   NQRSAGPRRFSLLTSVAMLWLGDGAPRAQ"
FT   CDS_pept        complement(178731..178991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66927"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66927"
FT                   /protein_id="BAE66927.1"
FT                   /translation="MGTGTRIGVISDTHGLLRPEALAALDGCTQIIHAGDVGKPEALEA
FT                   LRALAPLHVIAGNIDANPGPRVYHRRWMCRSMACASMCCTI"
FT   CDS_pept        complement(179195..181390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0173"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66928"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66928"
FT                   /db_xref="GOA:Q2P949"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P949"
FT                   /protein_id="BAE66928.1"
FT                   /translation="MSGVMTAVSNRWDPGVIRALAEARHGDAFAVLGAHRTDTGRVLRT
FT                   YLPGAERVSAVLDDGQTIALEAGPEPGLFAGDLPAQGGYRLRIGWPGGEQDTADPYAFG
FT                   PQLSDFDLHLISEGHHLQLADALGANVVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDA
FT                   RRHPMRLRHQSGVWELFVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASI
FT                   VADPTPYQWSDDGWMATRARRQAHDAPMSVYEMHAGSWLREEGVDLDWDGLADRLIPYV
FT                   ADMGFTHVELMPVTEHPFGGSWGYQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVD
FT                   WVPAHFPTDAHGLAHFDGTALYEHADPREGFHRDWNTLIYNHGRREVSGFLIASAMEFL
FT                   QRYHVDGLRVDAVASMLYRDYSRNAGEWVPNIHGGRENYETIAFLRRLNALVREHTPGA
FT                   VMIAEESTAFPGVTADVAHGGLGFHYKWNMGWMHDTLHYAGLDPIYRRYHHGELTFSMV
FT                   YAYSERFVLPISHDEVVHGKGSLLGRMPGDDWQRFANLRAYLGFMFTHPGRKLLFMGCE
FT                   FGQPTEWNHDSGLPWHLLDDPRHRGVQTLVRDVNRLYVQYPALHAHDDDPSGFAWVVGD
FT                   DAGNSVVAFLRKGKRGDAPVLVVINFTPVVQHGYRIGVPQGGQWREVFNSDAGIYGGAN
FT                   LGNGGIVTAEQQSMHGHAHALPLLLPPLGAIVLTPPG"
FT   CDS_pept        complement(181390..184740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0174"
FT                   /product="trehalose synthas"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66929"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66929"
FT                   /protein_id="BAE66929.1"
FT                   /translation="MNAVASLQADAEPSAVVADQRWYKDAIIYQVHVKSFFDSNDDGIG
FT                   DFPGLISKLDYIAELGVDTIWLLPFYPSPRRDDGYDIAEYMAVHPDYGSIEDFEQLVAQ
FT                   AHARGIRIVTELVINHTSDQHPWFQRARTAPAGSPGRDFYVWSDTDQEYEGTRIIFCDT
FT                   EKSNWTWDPVAGQYFWHRFYSHQPDLNFDNPAVLEAVLEVMRFWLDRGVDGLRLDAVPY
FT                   LIERAGTSNENLPETHAILRKIRATLDAEYPDRMLLAEANMWPEDTQQYFGQNADECHM
FT                   AFHFPLMPRMYMAIAREDRFPITDIMRQTPEIPESCQWAIFLRNHDELTLEMVTDSERD
FT                   YLWQTYAADRRARINLGIRRRLAPLLERDRRRIELMTSLLLTMPGTPVLYYGDEIGMGD
FT                   NIHLGDRDGVRTPMQWSIDRNGGFSRADPAQLVLPPVMDPLYGFQAVNVEAQIRDQHSL
FT                   LTWTRRVLSVRKRYQAFGRGTLRFLYPGNRRMLAYLRCYQDETVLCVANLSHTLQAVEL
FT                   DLSEFEGRVPVDIIGGGSFPPIGRLTYLLTVPPFGFYAFELVSEGTLPDWHVPSPVPLP
FT                   DYRTLVLRSDADGSAALLPHLPTLEGEILPAWLSARRWFSAKDQALRSVRIARRTPLPG
FT                   DQPMTLLELEVELEDGRRERYMLPVGIVWEREQPSTLAEQLALARVRQGREVGYLTDAF
FT                   ALKPMVRGVIDALCSNAALKFCDGEEASQQGQVRFEATPALAMLDIPHDPEIRWLSAEQ
FT                   SNSSLVIADKAVFKLLRHVAVGANPEIEIGRRLTEMGYANAAPLLGSISRVDGQGTVTT
FT                   IALLQGFIRNQGDAWRWTLDHLARSFDEYVTAQTEQARAEAVAGYDAFAAVVGTRLAEL
FT                   HEALARDTDDADFAPQRIDLPTANDVVAGVGRQVEAMWDTVNARLAGSEDSAEREALEA
FT                   VLAERPQLDALLAKAPSVLADSLLTRVHGDFHLGQILVAFDDVVLIDFEGEPAKPLAER
FT                   RAKASPLRDVAGFLRSLDYASEVSARGEEGSAARAGVGVDAHLDAFLVQFRRRSTWAFL
FT                   DAYHAVLDASAHPWIAPAAFNAATLLFLVEKACYEVRYEAANRPGWLMVPIEGLRRILQ
FT                   RARAGAGDI"
FT   CDS_pept        complement(184737..187853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0175"
FT                   /product="alpha-amylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66930"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66930"
FT                   /protein_id="BAE66930.1"
FT                   /translation="MRICVLNEATTTSTGLEQRCVAAREAGCDCVVMAAPFGRDAEGRL
FT                   IEPLAGADTHAERLQAAVQAARRAGVKLLIDVRLDEVGGASAVVRDNPQWFRARSTAVP
FT                   DPRQPRATPEVAEARFAYAQEGAALVEWWSARLLEWVGQGVGGFRLLQAQQVPVQRWRE
FT                   LIARVHAGAPEVVFAAWTPGLGLEALQQLAGAGFDAAFSSLAWWDGRGSWFFDEDTALR
FT                   ALASQVVAVLDAPDGTRAAAPEQHWQLASALGGAWLLDDAQLDAFPLAIRASDGPPTSN
FT                   AGMRLRPLLREATGLTAVAVEPLGGLPSLLLINGDTRHVVPVPASDLLRLLGDAEALVA
FT                   ENGRSLSGAMLEALEPGEVRVYRSVPARHVLAVPRMRPRAQAAGAWPRVCIESVTPSVD
FT                   NGRFPVKRTVGDRICVEADAFCDGHDRIAVAVLWRPADAKTWASAPMRVLGNDRWRTEF
FT                   PLERIGTYEFRVEAWRDVFATLHADLEKKRAANTVLPVDVQEAVAVVQAAQARSEGTLA
FT                   ERLHSVLTRIGAQSEALQQLAIVLEPDTVQAMALADDKPFRSEYPVTFRVESERRAAHF
FT                   ASWYELFPRSQSGDVDRHGTFDDVIQRLPHIRAMHFDVLYMPPIHPIGLNNRKGRNNAV
FT                   TAVEGEPGSPYAIGATDGGHTEVHAELGGLEGFRRLMHAARAQGLEVALDFAIQCAPDH
FT                   PWLKEHKDWFTWRADGSIRYAENPPKKYQDIVNVDFYASGAVPDLWNTLRDAVLFWVNE
FT                   GVTLFRVDNPHTKPFPFWEWLIADVRGRRPDVVFLSEAFTRPKMMYRLAKCGFSQSYTY
FT                   FTWRNHKHELQAYVEELNDGVPRECFRPHFFVNTPDINPLFLQTSGRNGHLIRAALATT
FT                   LSGLWGMYQGFELCEATPLAPGKEEYLDSEKFQLRAWPERVPGDIVDEITRFNQLRRMH
FT                   PELQSHLGTRFYQAHNDQVLYYGKFLDAGYLSRSRSMVLVAINLDPHAGQDADIDIPLW
FT                   ELGLPDHATVAVDDLWEGHRFAWHGKYQHIRLEARRPFALWRIRAGEVA"
FT   CDS_pept        188173..188385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66931"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66931"
FT                   /protein_id="BAE66931.1"
FT                   /translation="MASDGVHCRVASATARMSSKQCIWCTANQLAMQTLVASPAIFRVA
FT                   HYSHPHAPMRAPYRFLRQAGTTDTV"
FT   CDS_pept        complement(188613..189428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0177"
FT                   /product="ISXoo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66932"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66932"
FT                   /protein_id="BAE66932.1"
FT                   /translation="MREWIAGGASERCALAAIGMSASALRYRPREDRNVELRERILALA
FT                   HRHRRYGVGMISLKLRQEGRLVNYKRVERLYCEQQLQVRRRTRKKVPVGERAPLLRPTQ
FT                   ANQVWSMDVVFDRTAEGRAIKCLVIVDDATHEAVAIDVERAISGHGVVRVLDRLAHSRG
FT                   LPKMIRTDNGKEFCGKAMVAWAHANGVQLRQIQPGKPNQNAYVESFNGRLRDECLNEHW
FT                   FPTLLHARTEIERWRREYNEHRPKKTIGGMTPAAYAQQLANSDIINPGL"
FT   CDS_pept        189773..190333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0178"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66933"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66933"
FT                   /protein_id="BAE66933.1"
FT                   /translation="MVGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSQDEPVGAGVDATPGSELPDSVANEAQADAGHDPTRGEPQVGRDRATGRCLPGRR
FT                   TQRWQGRARLGEQAPFRDRRGDH"
FT   CDS_pept        190128..190772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0179"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66934"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66934"
FT                   /protein_id="BAE66934.1"
FT                   /translation="MRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDARPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRYLAETMWRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTMFTAESAC"
FT   CDS_pept        190785..191780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0180"
FT                   /product="IS1113 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66935"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66935"
FT                   /protein_id="BAE66935.1"
FT                   /translation="MGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTT
FT                   RDIESALVDVYGVEISHGLIAQMTDAVLEEARAWQSRPLEAIYPIVWLDGIVVKVQHNK
FT                   QVINKAAHVVLGVNLRGEKEVLGLWLAEHEGAKYWLSVLTELRHRGVRDIYIACMDGLK
FT                   GLPEAVQAVFPQTLTQLCIVHLVRASLRYVNAGDSKAVVAALKRIYQSATAEEAAAELE
FT                   ALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRR
FT                   IFPNDDSALKSLFLAVREASKNWRSIHHWKPALQSFQVMFGEERVPMNAL"
FT   CDS_pept        complement(191708..192292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0181"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66936"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66936"
FT                   /protein_id="BAE66936.1"
FT                   /translation="MLGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGRIVQLDDAYLGLS
FT                   SQLCNQVFHSAFIGTRSSPNITWKLCRAGFQ"
FT   CDS_pept        192375..193388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0182"
FT                   /product="ISXoo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66937"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66937"
FT                   /protein_id="BAE66937.1"
FT                   /translation="MSSKAIVPAEFERLIVDTTVQEKAIAHPVDWRLMENARHKLVAAA
FT                   KRAGIALKQTFAKETKTLRRKAGGYAHARQFKRLRKVLKRQRTLLGIVLREVQRKIGQA
FT                   SQATPPALENLHTLMQRAERIHAQQPNGKNKLYALHAPEVECIGKGKARKPYEFGVKVS
FT                   VAITHKQGLMVGARSFTGTPYDGHTLHEQLEQARILSEDTAGAPKQVVVDLGFRGVDAA
FT                   NPGVEIIHRGTFKRLTDERRRWLKRRQAVEPAIGHLKHDNGMDRCWLQGANGDALHAVL
FT                   CAAGDNIRWLLRAMVRLGLKGLFAPMVARLIMLATVLAMSLRARNTRPHRLAWCVW"
FT   CDS_pept        193470..194222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0183"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66938"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66938"
FT                   /protein_id="BAE66938.1"
FT                   /translation="MLELPVFVTLPTGFWQFSPMRTRRPAAEQLPADELFRSRLENQID
FT                   VRHPLVQLSHRLPWSALEQALSPRLPATTGTGGRPALPVRLIAGLLYLKHAYDLSDEAV
FT                   CERWLENPYWQFFTGEVVFQTCVPCDPSSLTRWRQRLGEAGMEALLAHTINTAHAMKAV
FT                   DARELSRVIVDTTVQEKAIAHPTDSRLLEVARKKLVLLAKRHGIVLRQTYVRQGPGLSR
FT                   KAGRYAHARQFKRMRKVLRRQRTILGRV"
FT   CDS_pept        194286..194903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0184"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66939"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66939"
FT                   /protein_id="BAE66939.1"
FT                   /translation="MERAQRLLAQRPKDKQKLYALHAPEVECMSKGKASSPYECGVKVG
FT                   IAVSARKGLIVGARSFPGHPYDGDTLAEQLEQARGLLQDVNVIPQVAIVDLGYRGRDVE
FT                   GVQILHRGKAKTLTRRQWRWIKRRQAVEPVIGHLKQDCRLNRCHLNGAQGDALHVLGCA
FT                   AGDNLRWRLRWIAFLRAWLQVVRARSSTPSSIMWPANMALEV"
FT   CDS_pept        194998..196317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0185"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66940"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66940"
FT                   /protein_id="BAE66940.1"
FT                   /translation="MLNRSLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPPLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGMAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQRLPARTYR
FT                   QVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTRPKQTP
FT                   VKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
FT                   KKNSVAFKMPAVSKSVRPRRSGPNATSPSQLDCHADLRTG"
FT   CDS_pept        complement(196474..197994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0186"
FT                   /product="competence related protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66941"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66941"
FT                   /protein_id="BAE66941.1"
FT                   /translation="MSLALVHSRARVGVHAPEVRVEVHLSGGLPSTQMVGLPEAAVRES
FT                   RERVRAALLCAQFEFPARRITINLAPADLPKEGGRFDLPIALGILAASGQIDRQALGDY
FT                   EFLGELALTGELRGIDGVLPAALAAAQAGRRLIVPLANGAEAAIAEHVEAFTARTLLEV
FT                   CATLNGSQKAPAAELAVQALGARALPDMADVRGQPHARRALEIAAAGGHHLLLVGSPGC
FT                   GKTLLASRLPGLLPEASEAEALETAAITSISGRGLDLARWRQRPYRAPHHTASAVALVG
FT                   GGTHPRPGEISLAHNGVLFLDELPEWQRQTLEVLREPLESGLVTISRAARSVDFPARFQ
FT                   LVAAMNPCPCGWAGDGSGRCRCSSDSIRRYRSRISGPLLDRIDLHVEVPRLPPQALRSG
FT                   NLGEDSASVRCRVVAARQRQLARGALPNAQLDQPDTDRHCRLQHDDQVLLERAIEHLQL
FT                   SARSMHRILRVARTIADLHDSADIATRHLTEAIGYRKLDRALSAASAA"
FT   CDS_pept        complement(198011..198289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66942"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66942"
FT                   /protein_id="BAE66942.1"
FT                   /translation="MIDFNQLDDLARRLSDLVPPGLRQSREELQSTFKGALQAGLGKLD
FT                   LVTREEFDVQRAVLLRTREKLDALEQTVAALEARAPGTPPAASPTAP"
FT   CDS_pept        198479..198817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0188"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66943"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66943"
FT                   /protein_id="BAE66943.1"
FT                   /translation="MKMIMAIVKPFKLDDVREALAGCGVAGITATEVKGFGRQKGHAEL
FT                   YRGAEYVVDFLPKVKIEVAVTDDQAERVVEAIVAAVGTGKIGDGKVFAYDLGTVVRIRT
FT                   GELGSDAL"
FT   CDS_pept        199430..201415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66944"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66944"
FT                   /protein_id="BAE66944.1"
FT                   /translation="MTRRNSKPGVRLLSVLVALGMAAPALAQAVTEPVTQPAIYPTPVS
FT                   ITLDGATIALGRSVVLVVAPGADKATVALVRSILSSAGVTKMATATRLPATLDRPHIVL
FT                   GTGDAAVVRDALARSKARQDTHKEGYTLASVALDGGSLITLAGHDDDGLFHAAQTLRQL
FT                   VERPAIPTLTIHDYPAMPIRGTIEGFYGAPWSMSDRSKHIDFLARTKANTFIYSPKDDP
FT                   YARDRWRAPYPKATLKALGQLAATAKRNHVDFVYAISPGPTVCFSDPADAKALLRKFDA
FT                   FRALGVRSFYVALDDIEYTKWNCERDKTAFGESGAQAAGIAQSHLLNLVQADLVARHDA
FT                   TSELIMVPTEYYDAKESPYKEALRKHLDPKIVVQWTGTDVVPPAISIPDARAATKAFGR
FT                   KTLLWDNYPVNDFETSAGRLLMAPYARREAGLSAELSGIVSNPMNQEVPSRVAVMGLTA
FT                   FAWNDKDYDAQRTWHAAARDLAGGDARVTAALLIFFDTQHLAPTFGSQPWQEQAPRLKA
FT                   VLDHVREAIALGDAAARTQAIAELARTADEMAAAPQIIRDSVADKGFAKQSRPWLEAME
FT                   VWGGALQKTAAGLDAANRGDTQAPALFAEAAAHAAVAAVVPSIPGATRFDGPVKIADGV
FT                   LDRFIAQAPRLIAYRVPAVADSAAAK"
FT   CDS_pept        complement(201373..201777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66945"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66945"
FT                   /protein_id="BAE66945.1"
FT                   /translation="MHYQPLDVPSLHPITPVLLRHGTRRLKPNVYRTHMDGQPVVIKDD
FT                   SRYYRTLLAPIARLMVHHEAGMLRQLQGRNRHGPRVHCGSERAVRAHLTAARCGLFAAL
FT                   NTRTVAHARSCASALSHHFAAAESATAGTR"
FT   CDS_pept        201975..202280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66946"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66946"
FT                   /protein_id="BAE66946.1"
FT                   /translation="MLATHAGNASRKSPCRVASAMPGSPQGLRQPRLLAVRQRSRRFLT
FT                   AAETPETVSAAVRGLHHASVRARSLDGAWIDVARHPVMPGKPPNSTATAPLPDAVR"
FT   CDS_pept        202335..203147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66947"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66947"
FT                   /protein_id="BAE66947.1"
FT                   /translation="MKRTATLLLACTAFGVMAQASAQSLSRGWDSYRQQQKQQVGTQGA
FT                   TASAAQSSRPAQAGTGGAPAAVGGSGSGQPGEPSGFRTVTEQTSAAATPAAPAYVPPPP
FT                   REEEQRLKSGLFLGVQSGNAKVFENGKQDMHGFSVGYRWRAGPVTLIGIEAATGKVDGS
FT                   KDEDGFVVVPNADFGSIGGTARFNFGDAPVFALVRLGYWGGTAKGEDYNERVYGAYVGA
FT                   GLGVDIGKHVSLSALYTNYVYADDYYDNYEDLTINRAEVLSFGAEIRF"
FT   CDS_pept        203340..203951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66948"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66948"
FT                   /protein_id="BAE66948.1"
FT                   /translation="MDALAQFLTDEQDPVAVGKILPKITELLTRDEQVAYIAVQKKMVM
FT                   NLSPDAVVLTNRRFIVVSPKLLGMTFRDFPWREVLDVHMSEQMLGATIMCRTTQGAYAS
FT                   IDSLPKKQARRVYAYAQQVEESAYEKRQQLEIDKLRAAAGGVVVHAPTAQGALPSAQPV
FT                   AVAASDDPVQVLSKLKQLLDAGLVTQEEFDAKKAEVLARL"
FT   CDS_pept        complement(204368..205225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0194"
FT                   /product="spermidine synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66949"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66949"
FT                   /db_xref="GOA:Q2P928"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P928"
FT                   /protein_id="BAE66949.1"
FT                   /translation="MSTNDNWYIEHFQPTGSAIGFRISGKLDEVQSLFQKIEIYQTTDW
FT                   GKLMLIDGAVMLTSRDNFFYHEMISHPALFTHPTPKRVVIIGGGDCGTLREVLKHPGVE
FT                   SATQCDIDEQVTRMSEKYFPELCDSNHDARAELLFDDGVAYMANCPAGSVDIVIVDSTD
FT                   PVGPAEGLFNKAFYESCFKALKDDGLLVQQSESPLALLDLIKEMRTEMGKAGFQSFKTL
FT                   PFPQPCYPTGWWSVTMASKQAKADFAFRQGAAQAKGFETLYYTAHLHTGVLVAPPFVAK
FT                   ALGE"
FT   CDS_pept        205412..207349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0195"
FT                   /product="biosynthetic arginine decarboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66950"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66950"
FT                   /protein_id="BAE66950.1"
FT                   /translation="MPGVTLHALFYSSRDSEMSDWSLDQARKTYSIPHWADGYFDVNAA
FT                   GHVVVTPTADGPAVSLPEVVDAARAAGAKLPLLVRFPDILGQRLGKLQAAFAQAQSEWD
FT                   YAGGYTAVYPIKVNQHRGVAGTLASHHGDGFGLEAGSKPELMAVLALSRPGGLIVCNGY
FT                   KDREYIRLALIGRKLGLQTFIVIEKPSELNLVLEEARALDVKPGLGVRMRLASLGAGKW
FT                   QNSGGDKAKFGLSPRQVLDLWKTLRDTEYADSLNLLHFHMGSQISNVRDIANGMREATR
FT                   YFVELSRLGAKISHVDVGGGLGIDYEGTRSRSYCSINYGLHSYASNIVQPLASACEEHG
FT                   LAPPRIVTECGRAMTAHHAVLIANVSEVEQAPEGRVPDAHADEPAAIRHLREIHDELDV
FT                   RPAVELFQEAQHFHAEGLSAYALGQIDLTHRARIDDLFYAIAHGVRARLSFDEKSHRPV
FT                   LDELNERLVDKYFVNFSVFESIPDVWAIDQVFPIVPIERLNEAPQRRGIIADMTCDSDG
FT                   MVKTYVENESLDSSLPLHSLNAGESYRIGFFLVGAYQEILGDIHNLFGDTDAVEVAVDG
FT                   DGYRIAQQRRGDTTDVMVDYVGYHLDTLRATYAERIAAAQLPPERAQELSAALEAGLTG
FT                   YTYLSDEPLG"
FT   CDS_pept        207915..209291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0196"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66951"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66951"
FT                   /protein_id="BAE66951.1"
FT                   /translation="MRTRRPAAEQLPADELCRSRLENQIDVRHPLVQLSHRLPWSALEQ
FT                   ALSPRLPATTGTGGRPALPVRLIAGLLYLKHAYDLSDEAVCERWLENPYWQFFTGEVVF
FT                   QTCVPCDPSSLTRWRQRLGEAGMEALLAHTINTAHAMKAVDARELSRVIVDTTVQEKAI
FT                   AHPTDSRLLEVARKKLVLLAKRHGIVLRQTYVRQGPGLSRKAGRYAHARQFKRMRKVLR
FT                   RQRTILGRVLRDLQRKLAQLEPSVRERIGVWLERAQRLLTQRPKDKQKLYALHAPEVEC
FT                   ISKGKASSPYECGVKVGIAVSARKGLIVGARSFPGNPYDGDTLAEQLEQARGLLQDVNV
FT                   IPQVAIVDLGYRGRDVEGVQILHRGKAKTLTRRQWRWIKRRQAVEPVIGHLKQDCRLHR
FT                   CHLKGAQGDALHVLGCAAGDNLRWLLRWIACLRAWLQVVRARSSTPSSTMWPANMALKV
FT                   "
FT   CDS_pept        209826..210272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0197"
FT                   /product="ISXoo12 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66952"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66952"
FT                   /protein_id="BAE66952.1"
FT                   /translation="MSRAIKLLGMEITPAQFALIEHCLPLQRGNVSMTNLQVVNALLYV
FT                   AEHGCKWRGLPERFGNWHTVYTRINRWAKSGVLDRMFAQLQTCQIVRIKIEAVSLDSTS
FT                   IKVHPDGTGALKKTAHNPSGNRAADGTPKFIWLPQMLEQPSRSD"
FT   CDS_pept        210269..210616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0198"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66953"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66953"
FT                   /protein_id="BAE66953.1"
FT                   /translation="MTPGNAHDAPAGRALLEHLGPVERPVHLLMDRAYEGNETRQLALD
FT                   LGFVPVVPPKSNRVDPWEYDKEMYKRRNEVERLFRRLKGYRRIFTRFEKLDVMFLGFLS
FT                   FVLVVDGLRMC"
FT   CDS_pept        210764..213235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66954"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66954"
FT                   /protein_id="BAE66954.1"
FT                   /translation="MVTAVRQLGADGGFSSYRLRIQPALALLAYRRTCRIFQDVSVPDI
FT                   VAQIVQEHRASNPPIAASFRLDQQLRQTYAPRSYCMQFDEDDLGFIHRVLAEEGINYTF
FT                   VFADDQGAPTHTLVLFDDVNDLAQASPARIGYRRAEDATPADSLLAWQGERQVMTSATA
FT                   LVSYDYKPAASSNADDRSVIDQGEEGRAASATLRDYSALSPYYASDSAEYARYAQVRQT
FT                   WHDQRAKTWYGGATTPGLEVGTYVEIADHPSLAEDSSEQRQFVVTEQFLDITNNLPADM
FT                   TRQLPSGLLGLSSADVGPPPSLAAVPPPPAGAAQYLRFAGVRRGVALVPSRVPSLRRPT
FT                   ASGPQTAAVVGKAGEVVDTDELGRILVQMHWPLAQEHAKGGADDDERSSTRVRYASPSA
FT                   SEGFGHQFIPRVGDEVLIEFLHGDIDRPIAVAVIHNGRRPTAAFSGARGLPGNRTLSGI
FT                   LTREHNGSGANELLFDDTTGQPRARLASTHQASELNLGYLTHPRADGQADPRGQGAELR
FT                   TDAAAALRAAQGMLLTTYARSQAAGHQLDRGELDALLAQCLELFKGLGDYAAQHGGQAV
FT                   ETGGQDALRQALQGWPSGTERSAAGKPLMAFAASEGMVSATPHSHLSYAGHNIDSVAQQ
FT                   HLQLTSGQSTRVHAGQGIALFAQASGLSAIANQGPVHLQAQADALVANAQTNLQLTANT
FT                   GEVLLSAPRIRLVAEDGSFLSIGGGGITLGTQGGVELHAASHALLGSSTEQADRPSFGK
FT                   DGTDQKFQLHYPSHSADTPQLAANQPYSITLDDGRVVQGVSDANGLTDLLRDEVTRIAR
FT                   IEVHKPPLGGG"
FT   CDS_pept        213303..215456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66955"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66955"
FT                   /protein_id="BAE66955.1"
FT                   /translation="MTDSAPHVVAQADALLLPNRMGNRPVQVPADRPGIVIFIHGVNDP
FT                   GAGYPTVEKGLCQGLNERLSRIDLRAGQYGVKYAEAKKSPVKPGEQGYKEVASVKYDPD
FT                   TYLYQRSEDTTSKLPTHSMFIPFYWGYRASNNEIAKDKRGNPTRLRSQYQDTAGNRLDA
FT                   HFAKAGGFFANATSNLPDMYGKGFDTSLMTATIQPVASDFTYFGKAPPRRYFVLAAERL
FT                   AMLVSEIRRLAPDDTITIMGHSQGTLITLLAQAMLADRRQRCADCLILVDSPYSLLEPK
FT                   GEEQTTQAKLRTLINIVNAVTTKPYARPSLSELQVGQPGYGGRTGHGWTPSQGTRLDAE
FT                   GKQIVFAERDNRGKVYLYFCPQDTTVALDQVQGIGTYGVPDTVHVAWKRKFYSTERTAT
FT                   LPAMDALKDLRFHQRMWTKLLRGGKPVAVGLPPQHIPLRMEDEARYPGGGVGPTTTLSQ
FT                   TPLPQEGRYINGEALHPPHAPHMEEGEADARQYGSSTSLRGTPTRAGKDAPDDVSVDVA
FT                   LGNPAASLGQYMVTERFSPGELHASELQELTDHFNAQHPDINDQTPGYICNGSREMGYI
FT                   VQRYATPNEVRAQMARNPAALVDNSYHSAMLRSTENHRWVTAMDVAIGQAQTLDDPEWR
FT                   KVLIAFANWRTPFAPPKYQTASSVYISELANFKKLSPGARKLVEASCLYYEKGVFPAGL
FT                   VSSSPPAKYVESRTRAQRAESTE"
FT   CDS_pept        215453..217144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66956"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66956"
FT                   /protein_id="BAE66956.1"
FT                   /translation="MSASQRPGIKPYALVWLGTLMAWVALILFIYYRQWQSTGVEDSGL
FT                   GNDIRNGVLAITALVGLAFGGHWLWKVRSAVAKDPAAMASAQATAAAATPHGRMLAGEG
FT                   ERYVLEVRGLGLAVDRYYQEDTWRLFKDKDDNYLSVLSKDPKDYDPNTRIGDGEMAASA
FT                   AFGYAAKAAVERWPLPVIVLGPPTTINDGSTMASGIAYWRQSQSLGLTLFLWQDDANLA
FT                   SAQGTLERLFQFFDDHPDVPEVLLVSNDSEGGRYGWKSPGLPKQPEGVHVPIMPDSMTA
FT                   LLVARSDRVDRLVRPYAVDVDDGINKDDTQYDIIKLWNFFWDKSDSQEEGSFDAYYRKL
FT                   AAEKHYASDYPPGTMKADWWIAQLPELWKQINNKGPGEFKPSPYLPVRWARWQVQQFDE
FT                   SPLLGYLHRPVHVPLTDEQGKPLKRAGQVEALRKGWAQAVSALPEDAKPTRVFYDTSLD
FT                   REWVIPLTQALHGNAEGIELDDKHEGYDIGRRLGNTGVSSALVQIALGIVSGYDDGRTS
FT                   ATVNLTPDGYAGIVMVSPPDEASKAAAIQHGKHPFYDLLRDKKATP"
FT   CDS_pept        217466..219667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66957"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66957"
FT                   /protein_id="BAE66957.1"
FT                   /translation="MRQRERRQTLERDGNAKAAYSYPASFFDLHAEKKSEVGHINVAYL
FT                   RNWAGDLNLWLSLPAVPARIWIRWRAGTERAALDERLSRIDLRAGGYGVKYAEAKASKA
FT                   KPGDRDYRKVAAVKYDPDTYLYQRSEDTTSKLPTHSMFIPFYWGYRASDNEIAKDKRGN
FT                   PTRLRSQYQDTAGNRLDAHFAKAGGFFANATSNLPDMYGKGFDTSLMTATIQPVASDFT
FT                   YFGKAPPRRYFVLAAERLAMLVSEIRRLAPDDTITIMGHSQGTLITLLAQAMLADRRQR
FT                   CADCLILVDSPYSLLEPKGEEQTTQAKLRTLINIVNAVTTKPYARPSLSELQVGQPGYG
FT                   GRTGHGWTPSQGTRLDAEGKQIVFAERDNRGKVYLYFCPQDTTVALDQVQGIGTYGVPD
FT                   TVHVAWKRKFYSTERTASLPAMDALKDMRFHQRMWTKLLRGGKPVAVGLPPRHIPLRME
FT                   DEARYPGGGVAPATTLSQTPLPQEGRYINGEALQPPHAPQMEDGEADARQYGSSTSLRG
FT                   TPTRAGKDAPDDVSVDVALGNPATKLRQYMILISIEQEEVPESKLAEMTSEFNAQHPDI
FT                   NDQTPGYTCDATDMGCTVWRHATPNEVRAQMARNPAALSDNSYHSAMLRSTENHRWVTA
FT                   MDVAIGQAQTLDDPEWRKVLIAFANWRTPFKPSESQLPGQLTLLELANFEKLSPGAQML
FT                   AQQTAYYYKTGKFPDVVSKEPPDKYVISRTRAQRAESTE"
FT   CDS_pept        219664..221352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66958"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66958"
FT                   /protein_id="BAE66958.1"
FT                   /translation="MSASQRPGITPYALVWLGTLLAWVALILFIYYRQWQSTGVEDSGL
FT                   GNDIRNGVLAITALVGLAFGGHWLWKVRSAVAKDPAAMASAQVTAAAAATATPHGRMLA
FT                   GEGERYVLEVRGLGLAVDRYYQEDTWRLFKEKDDNYLSVLSKDPKDYDPNTRIGDATIA
FT                   ANASFGYAAKKAVERWPLPVIIIGPPKTIDDGSSMADAIAYKRQAASLGLTLFLWQEDD
FT                   NTASAQATLEKLFRFFDEHPDVPEVLLVTQDGEGPRYRWKSPGMPDKRPEAPHVPLLPD
FT                   SMTALLVARSDRVDRLVRPYAVDVDDGINKDDTQYDIIKLWNFFWEKADVFDMQYEAAL
FT                   KAKGVKWPDGTNVPKADWWIAQLPELWKQINNKGPGEFKPSPYLPVRWARWQLQQFDES
FT                   PLLGYLHRPVHVPLTDEQGKPLKRAGQVEALRKGWAQAVSALPEDAKPTRVFYDTSLDR
FT                   EWVIPLTQALHGNAEGIELDDKHEGYDIGRRLGNTGVSSALVQIALGIVSGYDDGRTSA
FT                   TVNLTPDGYAGIVMVSPPDEASKAAAIQHGKHPFYDLLRDKKATP"
FT   CDS_pept        221672..223858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66959"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66959"
FT                   /protein_id="BAE66959.1"
FT                   /translation="MRQRERRQTLERDGNAKAAYSYPASFFDLHAEKKGEVGHINVAYL
FT                   RNWAGDLNLWLSLPAVPARIWIRWRAGTERVALDERLSRIDLRAGQYGVKYAEAKASKA
FT                   KPGDRDYRKVAAVKYDPDTYLYQRSEDTTSKLPTHSMFIPFYWGYRASNNEIAKDKGGN
FT                   PTRLRSQYQDTAGNRLDAHFAKAGGFFANATSNLPDMYGKGFETTLKTRGVQMVSPDFT
FT                   YFGKAPPRRYFVLAAERLAMLVSEIRRLAPDDTITIMGHSQGTLITLLAQAMLADRRQR
FT                   CADCLILVDSPYSLLEPKGEEQTTQAKLQTLIKIVNAVTAQPYARPALNELQVGQPGYG
FT                   GRTGHGWTPSQGTRLDAEGKQIVFAERDNRGKVYLYFCPQDTTVALDQVQGIGTYGVPD
FT                   TVHVAWKRKFYSTERTASLPAMDALKDMRFHQRMWTKLLRGGKPVAVGLPPQHIPLRME
FT                   DEARYPGGGVGPTTTASQTPLPQEGRYINGEALQPPHAPQMEDGEADVRQYKSSTPLRG
FT                   TPTRAGKDAPDDVSVDVALGNPAAKLRSIEQEEVPESKLAEMTSEFNAQHPDINDQTPG
FT                   YTCDATDMGCTVWRHATPNEVRAQMARNPAALSDNSYHSAMLRSTENHRWVTAMDVAIG
FT                   QAQTLDDPEWRKVLIAFANWRTPFMPSEDQPAGQVSISELANFKKLSPGARKLVEASCF
FT                   YYEKGVFPAGLVSSSPPAKYVESRTRAQRAESTE"
FT   CDS_pept        223855..225549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66960"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66960"
FT                   /protein_id="BAE66960.1"
FT                   /translation="MSASQRPGITPYALVWIGTMLAWVALILFIYYRQWQSTGVEDSGL
FT                   GNDIRNGVLAITTLVGLAFGGHWLWKVRSAVAKEPAAMASAQATAAAATPHGRMLAGEV
FT                   ERYVLEVRGLGLAVGDYYQTVWQAIREDDDAFKSVLPQDPKYYDPNTRIGDATIAASTS
FT                   FGDAAKEAVERWPLPVIIIGPPKTIDDGSSMAHAIAYKRQAASLGLTLFLWQEDDNTAS
FT                   AQATLEKLFRFFDEHPDVPEVLLVTQDGEGPRYRWKSPGMPDKRPEAPHVPLLPDSMTA
FT                   LLVARSDRVDRLVRPYAVDVDDGINKDDTQYDIIKLWNFFWDKSDSQEEGSFDAYYRKL
FT                   AAEKHYASDYPPGTMKADWWIAQLPELWKQISNKGPGEFKPSPYLPVRWARWQVQQFDE
FT                   SPLLGYLHRPVHVPLTDEQGKPLKRAGQVEALRKGWAQAVSALPEDAKPTRVFYDTSLD
FT                   REWVIPLTQALHGNAEGIELDDNHDGYDIGRRLGNTGVSSALVQIGLAIQAGYEDDRTS
FT                   ATVNLTPDGYAGIVMVSPPDAASKGINTKHRGKNPFMAHVPGWQDPQ"
FT   CDS_pept        225574..225963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66961"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66961"
FT                   /protein_id="BAE66961.1"
FT                   /translation="MPTATAAMCRPVPNTQALMARQACEGHPAICPLHGRMHIEGASSH
FT                   LNIHGRKAALDGDKLACGATLIPGRQGRLKFQVQHFSPLQTRVFCQNTGSRNFCTINGL
FT                   LGCPSIRCANSRSLELLHLTLETAL"
FT   CDS_pept        complement(226083..227987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0207"
FT                   /product="glucose inhibited division protein A"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66962"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66962"
FT                   /db_xref="GOA:Q2P915"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P915"
FT                   /protein_id="BAE66962.1"
FT                   /translation="MSDSFYRYDVIVIGGGHAGTEAALASARAGAHTLLLTHTIETVGA
FT                   MSCNPAIGGIGKGHLVKEIDALGGAMAHAADLAGIQWRTLNASKGPAVRATRCQADRNL
FT                   YRTAIRCIVQAQPKLTVFQAAVDDLIIHNGTCEADSVRGVITQTGLRFEAPSVVLTAGT
FT                   FLAGKIHVGDTQYAAGRLGDPPATTLAARLRERPFAIDRLKTGTPPRIDGRTLDYGVMG
FT                   EQPGDDPLPVMSFMGQVSDHPRQVSCWITQTTEQTHDIIRNALHRSPLYSGQIEGIGPR
FT                   YCPSIEDKVVRFAEKTSHQIFVEPEGLDVAEIYPNGISTSLPFDVQLALVRSIHGFAQA
FT                   HITRPGYAIEYDFFDPRGLKASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAAR
FT                   HVHGLPAWSPRRDEAYLGVLVDDLITHGTTEPYRMFTSRAEYRLQLREDNADARLTGAG
FT                   REMGLVDDARWARFSAKQEAVQRETARLSALWATPGNALGREVADALGVTVSRETNVLD
FT                   LIKRPELNYATLMRVPTLGPGVDDAQVAEQVEISVKYTGYLDRQRDDIARQQRHETTPI
FT                   PEGFDYAGVRGLSIEVQQKLEHVRPQHIGQAQRIPGMTPAAISLLLVHLERARRHRVA"
FT   CDS_pept        complement(228561..229028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66963"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66963"
FT                   /protein_id="BAE66963.1"
FT                   /translation="MKFRLIFAAGLLALSGCATYDYTGAGSGGYYRGAPDVQYRYPPGY
FT                   SPYFYGNPYGLPYGYGAGSIGLYDYPVYPVYRGSYYYREYDRRPQYRPPRPNGSFYNGS
FT                   RPADSLPQQPDRSPATGAQPSRPPPRIGAPPRVIHEIQRQTAPRNTRAQIP"
FT   CDS_pept        229186..230145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0209"
FT                   /product="threonine dehydratase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66964"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66964"
FT                   /protein_id="BAE66964.1"
FT                   /translation="MIETVPLAHSDVLQAAARIAPHCAPTPLLTSHSLDALSGARLFFK
FT                   AEHLQRSGAFKFRGACNAVWSLPDERTAHGVVTHSSGNHGAALALAARTRGMGCHVVVP
FT                   EGAVAAKLANISRHGATLWRCAPTIAAREQLCAEVQASSGATLVHPYTDVAVIAGQGTA
FT                   TLELLHQSGGLDVLVAPVGGGGLAAGAALALRCAPGCELVLAEPAGAADTARSLAAGQR
FT                   LVDFVPDTVCDGLRGTLGAPNFALLQHAGAQVITVDDAAVVQAMRLIWQLLKQVVEPSS
FT                   VITLAAVLAEPARFAGRRVGLILSGGNVDLDALPWAAA"
FT   CDS_pept        230130..230747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66965"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66965"
FT                   /protein_id="BAE66965.1"
FT                   /translation="MGRGVSSRSRGLGLLGWGWRLCMPALIWLVAVAGWIVWIGDRDQA
FT                   APADVIIVLGAAAYDARPSPVFEERIRHALDLYAQGYAPRLLFTGGFGNGARFAESQVA
FT                   RRYALRHGIPPEAIVIETTSRTTRQNLEQARTLMERHGMHRAIIVSDPLHMARALRLSQ
FT                   ELGIDALASSTPSTRFRSFHTSWRFLLQELYYFHRDLLVQGP"
FT   CDS_pept        230790..231209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66966"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66966"
FT                   /protein_id="BAE66966.1"
FT                   /translation="MSETHRQHAIGLVQDYYAAFNRGDWDGMLAFLADDVAHDLNQGAR
FT                   EIGRAEFAAFLQRMNDSYREQLRDVVVIANDDGTRVGAEYVVHGVYHTTDEGLPEATGQ
FT                   TYVLAGGAFFDVQGDKITRVTNYYNLQEWIAQVSR"
FT   CDS_pept        complement(231462..232367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0212"
FT                   /product="aspartyl-asparaginyl beta-hydroxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66967"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66967"
FT                   /protein_id="BAE66967.1"
FT                   /translation="MLKWLLIALFIASALYIHYRGRVRHRLSRQMLDHSTFMAPINTLM
FT                   YLCSRVPTTPFIDPGKEFPELAPLLANWLLIRDEAMALQQMQKIRAADGYTDIGFNSFF
FT                   RRGWKRFYLKWYGTAHPSAAELCPQTTALLKSIPAVKAAMFAELPPGSELRPHRDPFAG
FT                   SMRLHLGLATPNDDRCFIDVDGQRHSWRDGEWTMFDETYIHYVRNDTDQDRIILFCDIE
FT                   RPMRWRWAAAVNRFVGRSLLSAGASPNQEGDKTGGINRVFRYFYAARLKAKALKERNNP
FT                   LYQALKWSIFVLVVVGIVLL"
FT   CDS_pept        complement(232616..233500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0213"
FT                   /product="biotin synthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66968"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66968"
FT                   /protein_id="BAE66968.1"
FT                   /translation="MNSTFDTRHVRRAFARAASTYTAAAALQREAEARLLESLDYLGAQ
FT                   VPKVVLDVGAGPGHASGAIKKRWPKAQVIALDQAMPMLRQARKAAGWWKPFAQVCADAR
FT                   ALPVADGSVDVIFSNLCMQWVEDLPAVFAGLRRALRPGGLLLCSTFGPETLIELRDAFA
FT                   QTDPAPHVSRFPPIAQFGDALLMSGFRDPVLDRDLFTLTYNDLPALMHELRAMGATNAL
FT                   SNRRATLTGRGRFAAASAAYEPLRRPDCTLPSSWEVIYAHAWAPAPGAPIREHGHDVAS
FT                   VPVSAIPIRRRID"
FT   CDS_pept        complement(233564..234346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0214"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66969"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66969"
FT                   /protein_id="BAE66969.1"
FT                   /translation="MDMGIAGRWALVCAASKGLGLGCARALASKGVNVAIAARGRDALE
FT                   RAADTVRALPGAGEVRSVVADIATPEGRSAALAACQQIDILINNAGGPPPGDFRQWERA
FT                   DWLRALDANMLAPITLIRATVDGMRARRFGRIINITSSAVKAPIDILGLSNGARAGLTG
FT                   FVAGLARNTVVDNVTINNLLPGQFATDRLRGNFAAIAQQQGSTAEEVAERKRAGIPAAR
FT                   FGEPDEFGAACGFLCSAQAGYITVQNLLIDGGSYPGTF"
FT   CDS_pept        complement(234391..235152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0215"
FT                   /product="biotin biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66970"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66970"
FT                   /db_xref="GOA:Q2P907"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P907"
FT                   /protein_id="BAE66970.1"
FT                   /translation="MHIDVIGHGPALVLLHGWALHGGVFAPLVERLAPHYQLHLVDLPG
FT                   HGFSRDDSTPLALPYVVAEIAAATPPAVWLGWSLGGLFALHAAATLPQVRGLAMIAATP
FT                   RFVRGSDWPDAVQRELFVQFGTELSRDYRGTLERFLALDTLGSAHARSELRSLRETLTA
FT                   RGEPAPEALQQGLSLLERTDLRRALPQLARPSLWIAGQRDRLVPAAGMHAAAALSPHAQ
FT                   ALTIAGGGHAPFLGHADQVSEALQRFVASVP"
FT   CDS_pept        complement(235316..235645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66971"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66971"
FT                   /protein_id="BAE66971.1"
FT                   /translation="MWEALSRLYLDNDSRDDDSVAHVLAASPFRLEQLRMMLLHEVHPV
FT                   LIGNLRSVASVWDGFDPDWLAATIQARRARRWCWPARWCRRGDARTQWALLAPKIVALR
FT                   ATTTQ"
FT   CDS_pept        235964..237055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66972"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66972"
FT                   /protein_id="BAE66972.1"
FT                   /translation="MSNSPKLVVPLMVTGAVALLCMTSSGAATPAPAVECIQLRSKAVE
FT                   LSATPAFGGRVLSFNLRGQPNVLKVGAAVEQQPAPEVSAASGDIAYFGHDVWVGPQSQW
FT                   WLHQQLNHERQAAAAVWPPDPYLSLAHTHLARRSHDALEFEGVPSPLTGVQLRKQIQLS
FT                   AGRADTVEIQASARNIRTEAIAWDLWFNTRVAATTRVFVPVAAAGDIRVQPPSEAGTTA
FT                   PRFKRARGVFALRADAGQDGLIQRGKLLLQPSAGWMAGFAGGQVLLIRFAHQPLAAIHP
FT                   EQGQVELYLDTPRRHPEQGLLEMEVHAPYRQLAPGAQMQAQEQWTLLRYTGPDEEQAQR
FT                   QFLCSQAKALALANACDAPSAPR"
FT   CDS_pept        237124..238722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0218"
FT                   /product="periplasmic glucan biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66973"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66973"
FT                   /protein_id="BAE66973.1"
FT                   /translation="MQRRHLLKNAAAALAALGLPALPQWALAAKAVGLRRLGQPQPFDY
FT                   AWLKGRARELAKAPYKSHKQVLPGPLEALNWDQYQSIRYRQDHALWADGNGKFQAKFFH
FT                   LGLYFHTPVHIYDIVDGKAQQLAYDPAAFDYGKSGLGGKQLPKDLGFAGFRLNTRKDTE
FT                   RDFSAFLGASYFRAVGKEGQYGQSARGLAIDTGTGGPEEFPDFIAYYLEQPAADSNTVV
FT                   VYGLLDSPSIAGAYRFAITNGDVLLMDIDSALYPRKTIERLGIGPCTSMYQVGENDNRM
FT                   DWDWRPEIHDTDGLAMWTGGGEWIWRPLCNPPHVRFNMFVDENPRGFGLLQRDRNFDHY
FT                   QDDGVFYEKRPCLWVEPKSGWGKGSVQLVEIPTVDETFDNIVAFWNPQAKPQPGQELLM
FT                   GYRLYWGAQPPASAPLAHCVATRTGLGGIVGQKRSHFSWRFAVDFAGGELAALAKDPKA
FT                   KVEAVLQVSRGTTEIVSARPLHELKGYRAMFDLVPPDEGTQQIDIRLYLRANGKPLTET
FT                   WLYQWTPLAASERKN"
FT   CDS_pept        complement(238887..240131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0219"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66974"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66974"
FT                   /protein_id="BAE66974.1"
FT                   /translation="MGPLPPALRADIARVGRLSSVPDILTVLTRLTGMGFAAVARVTEA
FT                   RWITCQVHDTLSLGLRPGDELSLATTFCDSVRVRGNSVWFGHASDDPVYREHPSPRLYG
FT                   FESYVSVPIKFDDGSVFGTLCALDPQPRVVDAPLVEKVELLAQLLAAQIQAEQRAEESA
FT                   LESRRARSELGRVGASARLREEFIGILAHDLRNPLQSMHAVVDVLSIDQLNQHYGGSIR
FT                   SMQRSLRRMEELIDFACDFARGIERDWLQLDYGDGSDLLDALSQVVDETRAAYPNQVLS
FT                   THVAIDEPVHGDAIRLAQMFGSLMINAVVQGPQSSLIKAVAVTEQGRLRIEVCNLDGID
FT                   PRRLDILHASTHVHADGRALPEVDLGLHMAAQIAKAHQGELRIISGKQGTCFRVELACA
FT                   RPRGRLQLVDTPAPA"
FT   CDS_pept        complement(240583..241212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0220"
FT                   /product="thymidine kinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66975"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66975"
FT                   /db_xref="GOA:Q2P902"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P902"
FT                   /protein_id="BAE66975.1"
FT                   /translation="MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRAG
FT                   SGVVASRIGLRADGRIFERDTGLQQLVERDIHNDGALHCVLVDEAQFLSRAQVWQLSEV
FT                   VDRLRVPVLCYGLRTDFRGELFEGSQFLLAWADELEEIKTICHSGSKATMTVRVDAQGH
FT                   AVQDGPQVEIGGNERYVSVSRAEFKKIMRGEGRIDPLQIALPLPVA"
FT   CDS_pept        241419..243395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0221"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66976"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66976"
FT                   /protein_id="BAE66976.1"
FT                   /translation="MFGLNPPQSAAVLHCEGPLLVLAGAGSGKTRVIVEKIAHLIAIGR
FT                   YPAKRIAAITFTNKSAKEMGERVAKRIRGDGADGLTICTFHALGLKFLQIEHAAAGLKR
FT                   GFSIFDSDDAAAQIKDLMHGAKPDAIEDAKNLISRAKNAGLSPEQAMVAARSNREKEAA
FT                   SLYERYQARLTTFNAVDFDDLIRLPVQILEANEDIVMGWRERIGYLLVDECQDTNDAQY
FT                   RLLKMLAGPRGNFTCVGDDDQSIYAWRGANPENLQQMARDYPALKIIKLEQNYRCSNRV
FT                   LRAANALIAHNPHEHLKTLWSDQADGERIRVWECRDSEHEAEKVAAEISFLGTAKQVPW
FT                   SDFCILFRGNFQSRPLEKALQLLRVPYHLTGGTAFLERQEVKDLLSWLRLIVNPDDDVA
FT                   FLRAVQSPKREVGATSLARLAELASAKSVPMSRAAESMGALQHLPPRAANGLSAFTDIV
FT                   RDMREHSASMPAGELVRTLAEKSGLLNDLRNQSKDETGFQRRKRNLDELAEWFEGGPRG
FT                   ASASDLAAQLALLSRNDKDDGGNQVRMMTMHASKGLEFRYVFIVGCEDGVLPHEVSLEE
FT                   GNLQEERRLLYVGITRAKEQLWMSHSKLTRKFGEHVRLKPSRFFDEIPAEELQRDGADP
FT                   VADAERKKERASAGLAAIQALFD"
FT   CDS_pept        243473..243781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66977"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66977"
FT                   /protein_id="BAE66977.1"
FT                   /translation="MMSECAVTVVIQTPRLRLRTLDPEHDADAMLELVNDPGFIAGIND
FT                   RGIRTCEQARASARLGAGPPCATVLRTGRCRRARTPRLSARWACYIVRPCWCRISVT"
FT   CDS_pept        244030..244977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66978"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66978"
FT                   /protein_id="BAE66978.1"
FT                   /translation="MNQVGDGQMTQSRYHLMRHVQRHFTFEVDDAAFVALAQWAEQANA
FT                   VCFLADGSVRDPQGRVLISQGEPAIDDDAQVPSPPNALQRRAQQLALLTAQGIRVPPSL
FT                   SSVPGEAEVRVRDAAVVIQRMLALFAVALRAEMLAAGDTPPSLDEVDAHLPSGARPRRR
FT                   HRSVVGARAVRTRYRPVHPSSRRVWRLGLAGRLDAGTADLTGDTVSITACRGAGRVIAQ
FT                   LPDQPKRTRRRCRTVRRCHRSCRTMWPTDQAPAAFSRACNAANASCMSATVASRLCTRA
FT                   SSSLVSLPLRAPCAARAVAACSASTSSSPLSRCA"
FT   CDS_pept        complement(244782..245447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66979"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66979"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8Z8"
FT                   /protein_id="BAE66979.1"
FT                   /translation="MTETSPTPVLDTAQARVLGCLIEKEATTPDAYPLTVNAAQVAANQ
FT                   KTAREPVLNLQTGVVHHALRQLENLGLVRQQFCSRAERYEHRLGSVLDLTRQQVALIGL
FT                   LLRGPQTLGELYARSERLARFADTDDVRHHLDRLIQRGLAAQLPRASGQREDRYAHLLS
FT                   GELDVEALQAATARAAQGARSGSDTSELEARVQSLEATVADMQDALAALQARLNAAGA"
FT   CDS_pept        245908..246738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0225"
FT                   /product="putative acid phosphatase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66980"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66980"
FT                   /protein_id="BAE66980.1"
FT                   /translation="MPTPALRSAKAATSSTTAPAGDDNLNAVLWMQRSEEYRAVAEQTY
FT                   RAAADKLDSALNQPNWDALVPEERGNAATGLKPAVVLDVDETVLDNSPYLARLLRDGKE
FT                   YDALSWDQWVAEKKATAIPGVVDFAKAANARGITLIYISNRAVHLKDATLANLRSVGLP
FT                   VADDSVFLGLGTVAQGCEQNGSEKNCRRQLAGQKYRVLMQFGDQLGDFVQVSANTRQAR
FT                   GALLQQYHDWFGERWWMLPNPSYGGWEPAQFNNDYAQPWQTRHDAKRAALEVAR"
FT   CDS_pept        246735..247466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0226"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66981"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66981"
FT                   /db_xref="GOA:Q2P8Z6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8Z6"
FT                   /protein_id="BAE66981.1"
FT                   /translation="MSRAPLPLAAHERLIFALDVPSHDEAIAWVDRLGDSVAFYKIGME
FT                   LLASGEYFHVLDALAKRDKRVFVDLKFFDIPATVAGTIRRLAQWPVSYCTVHGWHAGML
FT                   QAAADANHGAMRLLAVTVLTSMGRPDLAAMGIDREPVDVVVERALAAEAAGIDGVIASG
FT                   QEAGPIRRATGPAFSIVCPGIRPGGPVADDQQRIVGVAQAFTDGADAIVVGRPIRLAAD
FT                   PAAAAAAIQAEILAAVGQDRS"
FT   CDS_pept        complement(247820..249349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0227"
FT                   /product="tryptophan halogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66982"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66982"
FT                   /protein_id="BAE66982.1"
FT                   /translation="MIPAPLRNIVIVGGGTAGWMAAAAFARVLGPTFTVQLIESEQLGT
FT                   VGVGEATVPHIKAFNNLLGIDEAEFVRQTQGSFKLGIEFVDWQRPGTAYMHGFGTQIGH
FT                   PLGLLPFHQYWIKQHARGKAQPLGAYTLNTVAAARGKFMTSAGDVPANSPLANIAYAYH
FT                   FDATQYAHFLRRYSQQRGVTRIEGLVEQVQLHPESGHVQSLQLASGQTVHGEVFIDCSG
FT                   FRGLLIEEALHTGYHDFTHWLPCDRALAVPCEKVGPPTPYTRSTARAAGWQWRIPLQHR
FT                   TGNGYIYCSAHISDDEAAATLLANLDGKPLADPRPLRFTTGRRKQFWNRNVVALGLASG
FT                   FLEPLESTSIHLIQSGISKLLELFPREGISPVLVQRYNDRSAFEFDRIRDFLLLHYHAT
FT                   EREDSAFWRHCRSMPITPELQTTLDLFRDSGRFYRNAEEMFAEISWVQVMVGQGILPQG
FT                   YHPLVDQVPDRDAEGFLASVAHTIAHCVDVMPPHQQFIDRYCKAAALPCGG"
FT   CDS_pept        complement(249459..252491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0228"
FT                   /product="OmpA-related protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66983"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66983"
FT                   /protein_id="BAE66983.1"
FT                   /translation="MKNHRTVSTLPPRSLLYCTLAASLLAANPAMAQSSNATLRGQVAS
FT                   AQSGSEVVVTNIATGSVRRAPVNANGNYTIVGLQPGTYKVESNGISRTVTLSVASSATV
FT                   DLGNETAAAPAGDATTLDTVTVNAPMMREVKTSEVGNTVSLRQIQQLPQATRNFLEFAD
FT                   TVPGMVFTIDQDGNTKLRAGASNASSSNLYIDGVSQKSYVSGGGIAGQNETQGNPFPQL
FT                   AIGEYKVITSNYKAEYGQISGAAITAATKSGTNQFHGEAFYRFTNQDLRKERPDEENGK
FT                   VDSQTKEYGLAIGGPLIQDRMHFFFAYEGKDNVAPKSVQPSAEASPFVGLLPSNLRDQF
FT                   GASNMPFTEDLYFGKIDVEPTDNDRIELATQYRDETQVSNVGGQNAPDRAVDKINKDKR
FT                   TSLRWQHSADSWFNEAIITTEDSSNVPTPRGTGNGSIYTYVDRTEADPRQWVFLNTGAA
FT                   SGEDFKLRSQKGWSFQNDLTFNALEWHGEHTIKTGVTYRDIKLTSRESSSLNPQFSYEV
FT                   SQNGIAPVPFQVRYIRAFDNPGQVPVVESPSKQYGIYLQDDWAVNDKLMLNIGMRYDYE
FT                   DTQAYTDFVTSQPFINALYSDDPDNPGQPWANRLVPSGINVADYISTGNNRKNFKDAWA
FT                   PRFGFSYDFFGDESAVLHGGAGRSYDRNLFEQLALESVKAALSPVVVYFSDAASRQPCF
FT                   RDDRVCTAWNPGYLNGIDQLNTIPGTNDSSELFMFNNKLKTPYSDQYSIGISNQVGDWL
FT                   TDVTFQRVLAYDGLVMSLVNRYPNGAYFDSTGSVPWGEPVPGYRNTILGYNGLEQRSSQ
FT                   FLLSAEKPYTKESGWGLNLSYTHTSARQNRTIDEPFAFDKATIRDYPFVKSDAVAAHRF
FT                   VASGSIDGPWGVTFGAKLILATPEPINTIACYGFTDPDGGTCQAVGVTPPGNGKFLVGG
FT                   KIWGYRTVDLQANKEFTVVGDFKLNARINVLNAFNFKNYTQYQYNSFGSDGRLQPDITV
FT                   VDNGEISYVPRSVVLEIGAKF"
FT   CDS_pept        complement(252790..255828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0229"
FT                   /product="OmpA-related protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66984"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66984"
FT                   /protein_id="BAE66984.1"
FT                   /translation="MKNHRTVSALPTRSLLCCALAASLLAANPAMAQSSNATLRGQVAA
FT                   SQAGTTVTATNVATGTTRRVATGPDGSYALVGLPPGTYKVDAGPGTEKTVTLSVASSVS
FT                   LNLGGGGEAATPADGTATTLDTVKVTATSLQEVKTSEVGTNVSLKQINTVPQLTRNFLE
FT                   FADTVPGMQFETDPNGNSRIRGGAQASSAVNVYIDGVGQKSYLFGGVSGQEQSAGNPFP
FT                   QLAIGEYKVITSNYKAEFDQVGSAAIVASTKSGGNEFHGEIFGRTTNTDFRARQADERA
FT                   SAPNADGTKRQTHQDEYGMAFSGPIVKDKAHFFVSYEGKGFEVSANPVSVPDTFSALSD
FT                   DLPAGVQSRLGSVTRPFKEDLYFGKIDWDVGENDRLELTAKYRDEKSRDDVGDRNTAIA
FT                   GKNNLNTEERYDLRWQHFGQTYVNEARISYEDVLFNPNAFTLGNQNIYTRGVAEDDVLI
FT                   RDNATSGLAIQRKGQKGPSFQNDLTLNSIDWHGSHVVKMGVKYKEVELTQSENSTVNPS
FT                   FYYAVADGLGTSAIPYQVKFNLPFAGAAPSVTTKSKQLGLYIQDDWDVNDKLQLNLGVR
FT                   WDGEKIPSYLDNVTPPEVVAALNGPGTDPTVSATYAEQLAKGGVNINDYISNGRSRKQD
FT                   TNNFAPRLGFSYDFRGDESLVVFGGAGRSYDRNLFDVLGLEQVKSALAQYTLRFAEAAP
FT                   GCTPAPGTCVNWNPAYLSDPGSLGSLVNSGVRNGEIDLLNNDLKTPYSDQYSLGLRTRL
FT                   GEWNTSATVSYIHSKEGLIFTLGNRYPNGDFFQAGTQPWNENPPGFGSLLIGNNGVETK
FT                   TGQLLLSADKPYSQESGWGLTAAYTFSRARGNRGNDDRYGFDAATIANYPFLDLNAVPR
FT                   HRLVLTGIYDLFWGISASAKLTLATVTPRNEAVSFDQYGGQPSENIRIVSVDAPGGKFI
FT                   AGGDIFGTRQLDLSLSKDMHVTEALTVQVRGDLINALNFRNYDQYAIDWGQGGIYAPRA
FT                   SINQYGALSTPPRTMFLSARIIW"
FT   CDS_pept        complement(255993..257045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0230"
FT                   /product="transcriptional regulator lacI family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66985"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66985"
FT                   /protein_id="BAE66985.1"
FT                   /translation="MSRPRSEGGSVTIKDVAREAQVSVATVSRTMNGHQHVAESVRERV
FT                   LQVARALNYIPHHAARSLSSRRTHTIGVVLPDLHGEFFSELIRGIDQVAHHQGYHLLVS
FT                   SSHGDPQAQRRALERLPGRVDGVVVMSPSLGDSGVHEDALPGCLPAVLLNCAGSASQRP
FT                   VLNVDNYGGARVMTRHLRDGGHRRIAFIAGPDDNFDAHERLRGYHDEMAMDADAQPWVL
FT                   PGNFDEESGYRAGQSLAQDTRPDAVFAANDMMALGCLFALGHAGLKVPQDIALAGFDDV
FT                   PMARYVLPALTTMRVDIAGLGAGALQLLLGQQLVDAPALPADAAPPALSEMVPELIVRA
FT                   SSAARGTPGQ"
FT   CDS_pept        257458..258423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66986"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66986"
FT                   /protein_id="BAE66986.1"
FT                   /translation="MSLPTVRTGRFQSAAWLLLGALCVSGCQRNETAPALPGAKAEPAA
FT                   AMQSMTLPLRRNDLVAYARIRVTPAQYTQLEAAWRSGASRWPLTELPLPNEVGALLGSL
FT                   SAPDAERRMQQAFDAELAGQAQGIAQAAQSLRQFGVQYLRSRNDYPPEQRAHYVQLVDA
FT                   LSAWAATAPLADRPRAKASIADLVAAARATGITSDADLQRLGMEESLRRLGPFWEICKK
FT                   VLEHYDLSIDNSLDALRTGLIKQDGDTAQVRLRYPLAAHDIDLTVALIKRDGHWYQLQT
FT                   QNQVQVLLNGIQAAPLPNATVAPDTAAAAPADTGQRPAGR"
FT   CDS_pept        258423..261083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0232"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66987"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66987"
FT                   /protein_id="BAE66987.1"
FT                   /translation="MTVMPEQNPLPFPDGPPAPPSAAVADTGATTAALPLAEPVPPEVA
FT                   PSIAPAVAAARSAKRPWWARLLGRLADPWLGLTIEPDQPGRYDDGRPVVYVLEDYGMSN
FT                   ALILDKACREVGLPSPLVPLPGDPLERKRAYLALSRRSSNSLIPEQRGGKTHSDSLAKL
FT                   LQAHRVRTDLDVHLVPVSIFVGRAPDKQSGWFAVLFSENWALVGRFRRLLSVLLNGRTT
FT                   IVRFAPPISLRQTMAEGLPPERTLRKLQRVLRTHFRRIREAVIGPDLSTRRLLVDQVLA
FT                   AESVREAIAVQAKRDNSKPVDAWRKAHAYAWEIAADYSSPVVRSARFLLTHVWNRIYAG
FT                   VLVHHLDKLKQAAPGHEVVYVPSHRSHMDYLLLSYVLYERGIVPPHIVAGINLNLPVVG
FT                   TLLRKGGAFFIRRSIKGNALYSAVLSEYVAQLVAGGYSIEYFVEGGRSRTGRLLQPKGG
FT                   MIAMTLRAYLRQPRKPVLFQPVYIGYEKLMEGNSYLDELTGRPKEKESIWGLLWSIPKV
FT                   LKQNYGQVVVNFGEPIALNDVLAKHAPDWDGQPLPEDEKPTWLAPAVDTLSTQIQTRIN
FT                   CAADVNPINLLALALLSTPKHAMGEADLIAQIELCKKLLAEMPYSDRVTVTPHTPARII
FT                   THAEEINVLTRVSHPLGDVLSVSGDTAVLLSYFRNNVLHLFTASSWVACCFQNNRRMSR
FT                   AGLLRLGRTVYPFLQAELFLPWSEDRFAERIEQIIDMFVREGLLLNVTDDDGGILARNT
FT                   GQTDEVFRLRAIGHSLQQAFERYYIAISVLVKNGPGVLGAGELESLCQQAAQRLSLLYA
FT                   PAAPEFFDKTLFRSFIQKLRELGLVWPDENSKLMFDERLDAWAKDAKFILGRELRHTIE
FT                   RVSPEAAKPDVLPPP"
FT   CDS_pept        261283..261873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66988"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66988"
FT                   /protein_id="BAE66988.1"
FT                   /translation="MRAAIHTQFGDPGKVLELGERPTPQPGKGQVRIAMRRSPIHNHDL
FT                   WTVRGNYGYKPALPAIGGSEGSGVIDVLGEGVEGLQVGQRVVAAGVHESWAEYFLADAT
FT                   GVVPLPDALDDDRGCQLIAMPLSALMLIEFLQVKKGDWIVQNTANGAVGKTVAMLAAAR
FT                   GINVINLVRRAAGVDELNALAIGNAVSTAQDGW"
FT   CDS_pept        261955..262263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66989"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66989"
FT                   /protein_id="BAE66989.1"
FT                   /translation="MGLLAEGGELISFGSMTGEPLEISSGDVIFKQATVRGFWGSKVMQ
FT                   ATTSEDKRRMIGELLKAALDGSLALPVEAVFDLEDAAKAAAASAEPGRRGKILLRAG"
FT   CDS_pept        complement(262902..263120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66990"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66990"
FT                   /protein_id="BAE66990.1"
FT                   /translation="MYARRVETLSTAEIVEQIAELRRAHRALDEEIQRVPANLDDELQM
FT                   KRLKKRKLHIKDCITRLEMELVPDEPA"
FT   CDS_pept        263258..263590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66991"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66991"
FT                   /protein_id="BAE66991.1"
FT                   /translation="MRLHSSLLALGLFTVANLASAADVAKYDGFLCCNLRTDGSWISDS
FT                   NYAEDGKRMLPVGTPVSVTGFGRNPVNLKIAGEKQSIGNDYSRDLDNTAFAARYVVTAD
FT                   PTSPQV"
FT   CDS_pept        263639..263902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0237"
FT                   /product="ISXoo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66992"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66992"
FT                   /protein_id="BAE66992.1"
FT                   /translation="MKKRFSEEQIIGFLREAEAGMPIKDLCRRHGFSEASYYLWRSKFG
FT                   GMSVPDAKRFKDLEAENTRLKKLLAEQVFQNDLIKDALQKQW"
FT   CDS_pept        263899..264252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0238"
FT                   /product="ISXoo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66993"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66993"
FT                   /protein_id="BAE66993.1"
FT                   /translation="MSAPARRTLVREWIAGGASERCALAAIGMSASALRYRPGEDRNVE
FT                   LREHSVALAHRHRRYGVGMISLKLRQEGRLVNYKRVERLYCEQQLQVRRRTRKKVPVGE
FT                   RAPLLRPTKANPV"
FT   CDS_pept        264256..264741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0239"
FT                   /product="ISXoo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66994"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66994"
FT                   /protein_id="BAE66994.1"
FT                   /translation="MDVVFDRTAEGRAIKCLVIVDDTTHEAVAIDVERAISGHGVVRVL
FT                   DRLAHSRGLPKVIRTDNGKEFCGKAMVAWAHANGVQLRQIQPGKPNQNAYVESFNGRLR
FT                   DECLNEHWFPTLLHARTEIERWRREYNEHRPKKTIGAMTPAAYAQQLANSDIITPGL"
FT   CDS_pept        264760..265317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0240"
FT                   /product="sugar-phosphate isomerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66995"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66995"
FT                   /protein_id="BAE66995.1"
FT                   /translation="MGGHRGDNDHRLTYIHLGIVASLLLNSKAVDFVVAGCGTGQGAMM
FT                   SLNAHPGVFCGYCIEPTDAYLFAQVNNGNALSLAFAKGYGWGAEINVRYIFEKAFSGER
FT                   GMGYPAERRESQAANAGILTQVKQATAKSYLDGLRAIDPELIKQAIGGARFQQCFFENA
FT                   QDAEIRNFVAGLLGKTEAAAAA"
FT   CDS_pept        265680..266165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66996"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66996"
FT                   /protein_id="BAE66996.1"
FT                   /translation="MHRLLIAMLLRCTGIAHAAPQRIFIAGDSTAAEYAAERAPQAGWG
FT                   QLLQDWFDSAQLQVHNHAKGGLSTRSFIAEGRRDAIAKQLQRGDVLRIQFGHQDAKREA
FT                   PTRCTDPTTDDLQLLRRYIAAARDKGATPILITPAARLLYDFGALLDTHGRYTLAMQ"
FT   CDS_pept        complement(266745..267389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66997"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66997"
FT                   /protein_id="BAE66997.1"
FT                   /translation="MDLTHLRIRRLELDDTRLLFTLANSIRIDEPIEAHRLLFKASPPQ
FT                   RAQWQITEDGFGVNWPAVAPPTPEGLLNMPALLWRRRSARVLAKLTNLRGRLDALSPGE
FT                   RELVALARLDADMSESGYARYFDRWDAATRDDAVRGLAAMGAAQLRQAVEGLGAVFERL
FT                   EEDPNLLSIEDILDAMHETDRQRVDGWEEVYYRRSDELARLGLIHYGVDKA"
FT   CDS_pept        complement(267530..268420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0243"
FT                   /product="phenylalanine hydroxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66998"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66998"
FT                   /protein_id="BAE66998.1"
FT                   /translation="MNTAPHRIENQLTDKGYVPVYTTAVVEQPWDSYSADDHATWGSLY
FT                   RRQRELLVGRACDEFLRAQDAMGMGETHIPRFDALNQVLQAATGWTLVGVQGLLPELDF
FT                   FDHLANKRFPVTWWIRRPDQIDYIAEPDLFHDLFGHVPLLMNPPFADFMQAYGRGGVKA
FT                   HGIGPDALQNLTRLYWYTVEFGLIDTPQGLRIYGAGIVSSKGESLHSLESAAPNRIGFD
FT                   LQRIMRTRYRIDSFQKTYFVIDSFAQLMEATTPDFTPMYADLAQQTQVPAGAVLPTDQV
FT                   MQRGNGEGWSRDGDV"
FT   CDS_pept        268548..269030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0244"
FT                   /product="transcriptional regulator asnC family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE66999"
FT                   /db_xref="EnsemblGenomes-Tr:BAE66999"
FT                   /protein_id="BAE66999.1"
FT                   /translation="MDHPIALDRTDLRLLALLQAQGRTSNAELAVQVNLSASACLRRTQ
FT                   RLEAAGIIAGYGARLDARALGLGLQAFVRVQLEQHGQADIEHFAQGVRGWDEVVACWAL
FT                   TGDMDYLLQVQVRDLEHFSRFLLDRLLNATGVSDVNSSFVLRMVKAPEGLPLSHLA"
FT   CDS_pept        269533..269949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67000"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67000"
FT                   /protein_id="BAE67000.1"
FT                   /translation="MSVIGLQRLEAQSLFSTDDVMRHVTGVNVSFYDTQRPLYFARGFQ
FT                   ITDFQVDGLPTYSGAINQEYDTVFYDRIEVIRGANCLLTGAGIPSATVNLLRKPPGKDF
FT                   DASSGVSAGTWDFRRMQADVTHRSPKTGVFAAAW"
FT   CDS_pept        269943..270956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67001"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67001"
FT                   /protein_id="BAE67001.1"
FT                   /translation="MVAAWQDRDSYYDRYHDTKMSGMAVLEGDLTESSTLTVGYQRQDN
FT                   TPVDSTWGTVPFFAADGSYANLSRSTNMAPEWTRWQRETSTAFANLEQRFGEDWLLRVN
FT                   TAHTKGAVQNLRVYGTGYPAADGSGVFLRTGAGHTQDTRDSVDVYLSGGFALFGRQHDV
FT                   VIGGSWQDLQSTTYRVAQTYPADWASCPNAFGPPERCYFIPNIRNWNGDASEVTYTRTG
FT                   ARRQARTTQRGVYASTRFRLADPLSLIAGARLSAWETRTQAFEASGSYTGTSGRYEVSD
FT                   EVTPYVGLVYDIVPDVSVYASYTEIFNPQNYRDKDNNLLAPVEGRSQLASATRELN"
FT   CDS_pept        complement(271116..271808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0247"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67002"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67002"
FT                   /protein_id="BAE67002.1"
FT                   /translation="MQGFICVFGVLELPVFVTLRPGFWQFSPMRTRRPAAEQLHADELC
FT                   RSRLENQIDLRHPLVQLSHRLPWSALEQALSPQLPATTGTGGRPALPVRLIAGLLYLKH
FT                   AYDLSDEAVCARWLENPYWQFFTGEVVFQTCVPCDPSSLTRWRQRLGEAGMEALLAHTI
FT                   NTAHTMKAVDARELSRVIVDTTVQEKAIAHPTDSRLLEVARKKLVLLANRHGIALRQND
FT                   ARQGPAQQ"
FT   CDS_pept        complement(272066..272599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0248"
FT                   /product="outer membrane lipoprotein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="lipocalin"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67003"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67003"
FT                   /protein_id="BAE67003.1"
FT                   /translation="MRRSSMLVLLMLALYGSASASDSRAALPRAETVDVPRFMGDWYVI
FT                   AHIPTRPERNAYDAVESYALRPDGRIQTTFTFRKGSFQAPLKSMHPIGQVAKEGNGALW
FT                   SMQFLWPFKAEYVIAWQDAGYTQTIVARSKRDYVWYMARTPQVSDADYQQAVQRIAAMG
FT                   YDVSKLRRVPQSAR"
FT   CDS_pept        272777..273769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0249"
FT                   /product="ISXoo14 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67004"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67004"
FT                   /protein_id="BAE67004.1"
FT                   /translation="MFTVKRLEEFIPANHPLRPVREMVNDALRRLDGLFERMYAPNDKG
FT                   GRPSIAPEKLARAMLLQVFYSIRSERQLMEQVQYKLLFRWFIGLSMDDAVWVPTVFSKS
FT                   RERLIEHDVVVALFNEIVEMADAKGWLSGEHFSVDGTLIQAWAGHKSFVRKDGDDNGDG
FT                   TDFRGTSRSNETHASTTDPHARLYRKGKTASELRYMGHTLADNRHGLIANARVTHADGH
FT                   AEREAAKAMIGDARQANPDGALTLGADKGDDAAEFVEALKEIGVAPHIAQNTSNRRSAV
FT                   PDEVAARVGYAISQTKRKLIEQGFGWAKLIGTIGQVIVRGLEKVDQVLW"
FT   CDS_pept        274286..274672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0250"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67005"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67005"
FT                   /protein_id="BAE67005.1"
FT                   /translation="MLNRTLEVRFEQYEEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPPLSRKPAQRTRPLVH
FT                   GRRPQQHEGLVGIAPTCAHAASQP"
FT   CDS_pept        274653..275246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0251"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67006"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67006"
FT                   /protein_id="BAE67006.1"
FT                   /translation="MPPASPKGGRPRTRPMRDSAHAPISVHEVAQRLPARTYRQVSWRQ
FT                   GSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTRPKQTPVKTLVA
FT                   TAPGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRSKKNSVA
FT                   FKMPAVSKSARPRRSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        complement(275415..276473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0252"
FT                   /product="alcohol dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67007"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67007"
FT                   /protein_id="BAE67007.1"
FT                   /translation="MSTAHAYAAQAADQPLAPFVFERRVPGPNDVQIDIAYCGVCHSDM
FT                   HIARNEWHNTLYPSVPGHEIVGRVTAVGNAVTGFKVGDLAGVGCMVDSCRSCASCQEGE
FT                   EQYCEAGFTGTYNGPMFGGGENTYGGYSDHIVVDQKYVLRITHSDNLAAVAPLLCAGIT
FT                   TYSPLAHWKVGPGQKVGVVGLGGLGHMAVKIAKAMGATVVLFTTSESKRADALRLGASE
FT                   VVISKDEAQMAAQYNTLDFILNTVAAPHNLDPFLNALKRDGAMVLVGVPEQSHPSPAVF
FT                   NLVMKRRTLAGSLIGGIRQTQEMLDFCAKHNIVSDIETIRADQINAAYERMLKSDVKYR
FT                   FVIDMATLDKAA"
FT   CDS_pept        276781..277854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0253"
FT                   /product="cellulase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67008"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67008"
FT                   /protein_id="BAE67008.1"
FT                   /translation="MFRTPPHFPRLRTAALALTLLAATPLVQAKEPPGSKKETAGLKYV
FT                   GVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPALNGPLD
FT                   QAQLGLIKKSLEAAKANKQYLILDLHNYATYNGKRIGTSDVPASALADLWRRLALEFKD
FT                   DKAVIFGLMNEPNGISAPDWANAAQGAINAIRKTGAKNLILVPGTAYTGAHSWRSTSYG
FT                   VSNAKALQILKDPGNNMAFEAHQYLDKDYSGTKPVCTSDSVGQEKLEGFTSWLRENKQK
FT                   GFLGEFATANNPVCDKALEGMLTYMQKNSDVWLGWTWWAAGSWWKPDYAFTVQPGKDGS
FT                   DKPQMAILSKYARRAGK"
FT   CDS_pept        278617..279669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0254"
FT                   /product="cellulase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67009"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67009"
FT                   /protein_id="BAE67009.1"
FT                   /translation="MPSPHTRTRRPRCRALSLLLLAAMPLAQAQGTYGLKYAGVNLSGA
FT                   EVNSSQQPGVLDIDYHYPAADEYTYFAGKYMNTVRLPILWERLQPKPGGQLDPAQLALI
FT                   REAVANAKAAKMYLIVDVHNYAKYYGHTIGSTNVPIRTFNDLWRRLAIAFKSDKAVIFG
FT                   LMNEPHDIEPQAWATAAQASIDTIRKTGATNLILVPGALWTGAHSWYSTVAGQSNAVAM
FT                   ASIHDPLNRYAIEAHQYLDADSSGTSGACVSATVGVERLRSFTQWLRLNGKRGFLGEFG
FT                   TGKTVTCNLALKGMLGYMESNSDVWMGWAYWAAGTWWNRGYPFNVQPDAQGRDKPQMSI
FT                   LSQQAHRITD"
FT   CDS_pept        280317..281447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0255"
FT                   /product="cellulase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67010"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67010"
FT                   /protein_id="BAE67010.1"
FT                   /translation="MSAFCFSLRALLRYTLLFIVFGNLSLAHAQTRALTYAGVNLSGAE
FT                   FASSQKPGVLNKDYTYPAASDYTYFAGVGMNTIRLPILWERLQPTARGKLDPTQLALLQ
FT                   QAVARAKAAGMYLVIDLHNYAKYYGYKIGSPEVPVSTFTDVWRRLALTFKSDNAVMFGL
FT                   MNEPNNISASEWAGAAQAAIDAIRKTGANNLILVPGALWTGAHSWYSPTSDGYSNATAL
FT                   ASIYDPLNRYAFEVHQYLDADSSGTSTTCVSATIGADRLRNFTKWLHTNRKRGFLAEFG
FT                   TANNAVCNQALKRMLAHMETNADVWLGWTWWSAGSWWNTTYSYNVYPNKDGTDKPQMAI
FT                   LSPQAAKATRAPGATAARTSATATSKTSTSTARTTR"
FT   CDS_pept        281702..282016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0256"
FT                   /product="IS1112 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67011"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67011"
FT                   /protein_id="BAE67011.1"
FT                   /translation="MSSSRLDLSERYRLHALYETGMSMRAIADAVARAPSTISRELRRN
FT                   QHAARYQPDHAQRISAHRRTQASRRPRIDAERIGQIEVLLREDVSPEQIAGRTGLASHA
FT                   "
FT   CDS_pept        complement(282071..282544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0257"
FT                   /product="IS1112 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67012"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67012"
FT                   /protein_id="BAE67012.1"
FT                   /translation="MRIGDGADIGLPWQVLACQSVGILVAAALPWAVRICEIEIALQAG
FT                   GNEPMIGELLAVVGGEGVNCMAQAAQSLDNGVAHVLGGAVGRVSQQMQATAAFGHADHH
FT                   ALSVRGPDGLQLPVADTASLLNHTGALCPAAPMRQLPAAIAHATPTALAAAFA"
FT   CDS_pept        282764..283153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67013"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67013"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8W4"
FT                   /protein_id="BAE67013.1"
FT                   /translation="MPTSMPNDPCPCGRPADYARCCGPYHAGAAAPDAETLMRARYSAH
FT                   VRRDAAYLLASWHPSTRPGELSLDEGGRTTWLGLTVQRTLETGPETAEVVFLARYRIGG
FT                   GSAVRMTEHSRFVRDAGRWYYLDAR"
FT   CDS_pept        283361..283567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67014"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67014"
FT                   /protein_id="BAE67014.1"
FT                   /translation="MATLNLWQWVIVAAVVFAIVLPACVATALIRFGPRHDAPRRARTR
FT                   QVTAGAPSASALSLLTGITGDGS"
FT   CDS_pept        283799..284767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0260"
FT                   /product="ISXo1 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67015"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67015"
FT                   /protein_id="BAE67015.1"
FT                   /translation="MQLTFGDAEGLGKRKQTRREIFLAEMERIVPWKRLLALIEPHYPV
FT                   SGRPGRQPYALARMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPDETTI
FT                   LNFRRLLETHAIAARMLEAVNAHLSRKGQSLRSGTIVDATLIAAPSSTKNADRARDPEM
FT                   HQTKKGNQWYFGMKAHIGVDEFSGLVHHVQCTAANVADVTVTHALLHGKEDSVFGDSGY
FT                   TGAEKRDELQSCEAAFFIAAKRSTIQAIGNKRARAWAERWEHFKASVRAKVEHPFRVIK
FT                   RQFGYTKVRYRGLAKNTAQVQTLFALSNLWMVRRHLLPARG"
FT   CDS_pept        285021..287183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0261"
FT                   /product="transglycolase"
FT                   /note="epimerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67016"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67016"
FT                   /protein_id="BAE67016.1"
FT                   /translation="MTLPRRALPLVLGLLPLAACADPAFDRCLAGLQTQAAAKGVDPAG
FT                   FQRFTAGLVPDPSVLPLLDAQPEFTTPIWDYLASLVDNQRVTDGQAMLVTHRALLTRLS
FT                   EQTGVDPATIVAVWGVESDYGRVTGKRPLLVSLATLSCAGRRQPFFRDEFLALLSLLQR
FT                   GDLAADGLTGSWAGAFGQTQFMPSTYTRIAVDGDGDGRRDLVASIPDALASTANYLVKA
FT                   GWERARPWGMEVTLPRGFDASKAGRTRRQPLQAWQTAGLLGTDGKPLAPIGLPAETPAA
FT                   LLLPAGATGPAFLVFRNYDAIYAYNAAESYALSIALLADRLRGGPGLIATWPTDDPGLG
FT                   RPERRELQQLLLARGYQIGEADGMVGSATRRAIQVEQIRLGLQPADGRPGQRILTALRA
FT                   APPLAGVAAVRATAFKLPTAYPAFAQSAIVHKASPMSDTTGLTTGDFHGFPSLLIETPF
FT                   STAAISLFGGQLVSFVPKGGQDVMWLSPLAKQPPTPIRGGAPVCWPYFGRQGQIGDVPA
FT                   HGFVRTVAWRLTESRREDDGTVVLTLTPPRLDDLALRLRMTLRIGRTLEQRLITENTSA
FT                   APVRFTQALHNYFRVGDALKISVQGLDGLDYLDKYENYATAHRQQGDWSLRDPRDPGRS
FT                   DRIYTNAGGRYTLTDPVLGRRIVIATEGSRSLVAWNPGEEAGKKMADVGDGWRDYVCLE
FT                   AANAGPDVIELAPGASHTLTQTISVE"
FT   CDS_pept        287731..289035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0262"
FT                   /product="tetracycline-efflux transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67017"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67017"
FT                   /protein_id="BAE67017.1"
FT                   /translation="MTLPPDSAPAPGRRRAALIFIFITVLIDVLSFGVIIPVLPGLVRH
FT                   FTGGDYVQAAAWIGWFGFLFAAIQFVCSPLQGALSDRFGRRPVILLSCLGLGLDFILMA
FT                   VAHSLPMLLLARVISGVCSASFSTANAYIADVTASDQRAGAFGMLGPVFGIGLVAGPLI
FT                   GGWLGSMGLRWPFWFAAGLALLNVLYGWFVLPESLPVERRTARLDWSHANPLGALKLLR
FT                   RYPQVFGLASVVFLANLAHYVYPSIFVLFAGYQYHWGPREVSWVLAGVGVCSIIVNVLL
FT                   VGRLVRWLGEPRALLLGLGCGVIGFVIYGLADSGAAFLIGVPISALWALAAPSAQALIT
FT                   REVGADAQGRVQGAHRSGQPGRHRRPAVVRQCVRLVYRQRCATASARRTMVAGRCAARR
FT                   RLGHGLETGRAGHRHRGCNAGIKTTYSACARVRFF"
FT   CDS_pept        289095..289697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67018"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67018"
FT                   /protein_id="BAE67018.1"
FT                   /translation="MSSDALAVPPSAALALRHATQEAHRLVEAVPLMQALGRGQVDSAA
FT                   YAQILRRHHALLAGFEAQLSDWLTTVVGNGWHYRRRVPALREDLRALGQQPDPPVALPS
FT                   AAAGADDAARWGMVYVIEGSQLGGRMIARTLRRQQPALAGALRYFELADDDPAGWRRFQ
FT                   AALDRRLDTASARAAAIDGAQTMFAHFHTCLAAEPHL"
FT   CDS_pept        289694..291598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0264"
FT                   /product="phytochrome-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67019"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67019"
FT                   /protein_id="BAE67019.1"
FT                   /translation="MNQPTEPLDMDVCAREPIHIPGLIQPYGVLLVIEPADGRIVQASS
FT                   TAAELLGVPMDALLGMAYTQVLEMPDAQPGAVDDQPQHVLHADVRFPQRSAPTDHPWVA
FT                   AWHLYPEQWLIEIEPRDARLMDVTLREALPLLRSIERDAGIEEASVRAAKGLRSMIGFD
FT                   RVMVYRFDEEWNGDVIAEARQPELEAYLGLHYPASDIPAQARALYLRNRVRQIADVRYQ
FT                   PSPIQPTLHPRLGTPVDLSDVSLRSVSPVHLEYLANMGVSATLVSSIVVNDALWGLISC
FT                   HHYSPHFTSHAMRDATDAVTRALAGRIGALQAVGRARLESVLLTIREKLITDFNDAEHL
FT                   TVDMLADMAPDLMDVVDADGVAIFHGNEISRHGSVPDADALRRIRDHIESEHHDALRAD
FT                   AVGALHVDAIGEVFPELADLAPLAAGFIFVPLMPQSRSALLWTRREQVQQVKWAGNPQL
FT                   AKLQDIPNSRLSPRKSFDLWQQTVRGRARRWSPLHLESARSLRVLIELMERKRFQQDFS
FT                   LLEASLSRLRDGVAIIERGANAAAHRLMFVNPAFADLSQTEVADLIGCDILALLADDAE
FT                   RGKVELLEEALRLGRAAYVTLPLRTQGGEPAYRQFHLEPLPSSSGVTAHWLLQLRDPE"
FT   CDS_pept        complement(291707..291943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67020"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67020"
FT                   /protein_id="BAE67020.1"
FT                   /translation="MFAAFPRELVMAIAGIALLDTIGNRLTAALRADSEREAALITFLV
FT                   TASGLTLGRIGAAFWGLAAGTITLLALRSKTAP"
FT   CDS_pept        complement(291921..292877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0266"
FT                   /product="putative benzoate transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67021"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67021"
FT                   /protein_id="BAE67021.1"
FT                   /translation="MPASRTLLGDLSLPAIAAGFVTVLVGLASSAVIVFKAARHLGADQ
FT                   AEIASWMWALGIGMGVTCIGLSLRYRVPVVTAWSTPGAAMLIGSAAGVPLREAIGAFLV
FT                   AAVLRMVAGFSGLFARAIRRIPVSLASGTLAGVLLRFGVDIFVAMQSQVVLALAMLATY
FT                   LCGRRWFARYAVIATLSVGIAIAASRGLLQVGTVQLELAHPVLVVPSLSWAALSGLAIP
FT                   LLMVTMASQNVSGVAVIRASGYAVPISPTIGWIGVVNTVLAPFGSFALNLAAITAAICM
FT                   GREAHEDPARRYERRDVPCGDRFIRRNRSGGVCGLPT"
FT   rRNA            293626..295175
FT                   /gene="XOOr01"
FT                   /product="16S ribosomal RNA"
FT   tRNA            295269..295344
FT                   /gene="XOOr02"
FT                   /product="tRNA-Ala"
FT                   /note="Found by tRNAscan-SE"
FT   tRNA            295364..295440
FT                   /gene="XOOr03"
FT                   /product="tRNA-Ile"
FT                   /note="Found by tRNAscan-SE"
FT   rRNA            295668..298590
FT                   /gene="XOOr04"
FT                   /product="23S ribosomal RNA"
FT   rRNA            298722..298840
FT                   /gene="XOOr05"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(298935..299480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0267"
FT                   /product="ISXoo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67022"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67022"
FT                   /protein_id="BAE67022.1"
FT                   /translation="MPVGERAPLLRPTKANPVWSMDVVFDRTAEGRAIKSLVIVDDATH
FT                   QAVAIDVERAISGHGVARVLDRLAHSRGLPKVIRTDNGKEFCGKAMVAWAHANRVQLRQ
FT                   IQPGKPNQNAYVESFNGRLRDECLNEHGFPTLLHARTEIERWRREYNQHRPKKAIGAMT
FT                   PATYAQQLANSEIIPPGL"
FT   CDS_pept        complement(299773..300042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0268"
FT                   /product="ISXoo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67023"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67023"
FT                   /protein_id="BAE67023.1"
FT                   /translation="MDVKKRFSEEQIIGFLREAEAGMPIKDLCRRHGFSEASYYLWHSK
FT                   FGGMSVPDAKRLKDLEAENTRLKKLLAEQVFQNDLIKDALQKQW"
FT   CDS_pept        complement(300085..300426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0269"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67024"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67024"
FT                   /protein_id="BAE67024.1"
FT                   /translation="MVGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGRRPPLV"
FT   CDS_pept        300917..301732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0270"
FT                   /product="formamidopyrimidine DNA glycosylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67025"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67025"
FT                   /db_xref="GOA:Q2P8V2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8V2"
FT                   /protein_id="BAE67025.1"
FT                   /translation="MPELPEVETTLRGLSPHLVGQRIHGVILRRPDLRWPIPEQIERLL
FT                   PGATITNVRRRAKYLLIDTDAGGSALLHLGMSGSLRVLPGDTLPRAHDHVDISLQNGRV
FT                   LRFNDPRRFGCLLWQSDIQAHELLAALGPEPLSEAFTGDYLHALAYGRRAPVKTFLMDQ
FT                   AVVVGVGNIYAAESLHCAGISPLREAGKVSLDRYRRLAAAVKDILSYAIRRGGTTLRDF
FT                   ISPDGAPGYFEQELTVYGREGEPCKQCGRVLKHAMIGQRATVWCGSCQR"
FT   CDS_pept        complement(302079..303041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0271"
FT                   /product="ISXo2 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67026"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67026"
FT                   /protein_id="BAE67026.1"
FT                   /translation="MGINLVQFQPGLSLSEFMDRYGTEAKCYRALYRWRWPKGFRCPQC
FT                   DGRARSRFRRDDQVYYQCRACRHQTTLRAGMLLQSSKLSLRLWMQAMYLLTSSKTNLAA
FT                   LELKRHLGVTYKAAWRMKHKIMQAMTEREEPRKLKGFVQIDDAYLGGERSGGKRGRGSE
FT                   NKQPFVIAVQVDHTHEHPVFAVIEPVKAFDNASLEDWIARRLEPECEVYSDGLACFRRL
FT                   EEAGHAHTTLDTGGGRAATDVQGARWLNVVLGSVKRAISGTYHAVGQAKYARRYLAEAA
FT                   YRFNRRFDLKQMLPRLATALLRCTPCPERVLRMASNFHG"
FT   CDS_pept        303146..303565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0272"
FT                   /product="ISXoo12 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67027"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67027"
FT                   /protein_id="BAE67027.1"
FT                   /translation="MEITPAQFALIEHCLPLQRGNVSMTNLQVVNALLYVAEHGCKWRG
FT                   LPERFGNWHTVYTRINRWAKSGVLDRMFAQLQTCQIVRIKIEAVSLDSTSIKVHPDGTG
FT                   ALKKTAHNPSGNRGADGTPKFIWLPQMLEQPSRSD"
FT   CDS_pept        303523..303909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0273"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67028"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67028"
FT                   /protein_id="BAE67028.1"
FT                   /translation="MVAADARTAITFGLTPGNAPDAPADRALLEHLGPVERPVHLLMDR
FT                   AYEDNETRKLALDLGFVPVVPPKSNRVDPWEYDKEMYKRRNEVERLFRRLKGYRRIFTR
FT                   FEKLDVMFLGFLSFVLVVDGLRMC"
FT   CDS_pept        303955..304734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0274"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67029"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67029"
FT                   /protein_id="BAE67029.1"
FT                   /translation="MQGFICVFGVLELPVFVTLRPGFWQFSPMRTRRPAAEQLPADELC
FT                   RSRLENQIDVRHPLVQLSHRLPWSALEQALSPRLPATTSTGGRPALPVRLIAGLLDLKH
FT                   AYDLSDEAVCERWLENPYWQFFTGEVVFQTCVPCDPSSLTRWRQRLGEAGMEALLAHTI
FT                   NTAHAMKAVDARELSRVIVDTTVQEKAIAHPTDSRLLEVARKKLVLLAKRHGIVLRQTY
FT                   VRQGPGLSRKAGRYAHARQFKRMRKVLRRQRTILGRV"
FT   CDS_pept        304774..305415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0275"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67030"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67030"
FT                   /protein_id="BAE67030.1"
FT                   /translation="MRERIGVWLERAQRLLTQRPKDKQKLYALHAPEVECMSKGKASSP
FT                   YECGVKVGIAVSARKGLIVGARSFPGHPYDGDTLAEQLEQARGLLQDVNVIPQVAIVDL
FT                   GYRGRDVEGVQILHRGKAKTLTRRQWRWIKRRQAVEPVIGHLKRDCRLNRCHLNGAQGD
FT                   ALHVLGCAAGDNLRWLLRWIAFLRAWLQVVRARPSTRSSIMWPANMAFGV"
FT   CDS_pept        complement(305708..306766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0276"
FT                   /product="lipoprotein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67031"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67031"
FT                   /protein_id="BAE67031.1"
FT                   /translation="MTQFRSLPLLACLLLGACASQAPKSAPPSGGTAIAPAADAPVRDD
FT                   AVMTAQAAAAGVSAPDAMPASAAAPADQQAAAGTDTATAGAPTDAESDFDALYGSTTPQ
FT                   AGANGAPAQPGAAPAYDPWERYNRGMHRFNMAVDRGVARPLATAYTKVVPSPARLGVTN
FT                   FFDNLGTPLTMVNQLLQGHPVYAVQSLGRFVMNSTLGVAGLFDPASAAGIPRRSEDFGQ
FT                   TLGAWGWRNSRYFELPLFGPRTLRDTFGLAGDIPLSWIRHVDDGGTRFALQGLQLVETR
FT                   AQLMSLDSLRDQAPDEYALTRDAWMQRRNYQITRDLRSHNEKKNNALPDYLREDKDNTV
FT                   PGNAMPIPNWVR"
FT   CDS_pept        complement(306777..307067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67032"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67032"
FT                   /protein_id="BAE67032.1"
FT                   /translation="MATDTVQRTGDALVITGVLDRAAVTAIWPQAIAQLDGARTLDLAG
FT                   VQRLDSAGVAMLAELAARLRHTGSGAVVGEASGLDELRAAYRLSPTLDFQA"
FT   CDS_pept        complement(307057..307719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0278"
FT                   /product="toluene tolerance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67033"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67033"
FT                   /protein_id="BAE67033.1"
FT                   /translation="MKTTLLSAVLASTLLVCAPATVLAQPAAASAPTQGAATKTVIDSS
FT                   TRILSTLDQRRAEFRSNPAALRQFINGELNQAFDRDYSARLVLGVHGRGASDADVKLFA
FT                   DALADNLMQRYGTALLNFEGKPTFRAKSESALPGNRGVKVSTDLLRAGNDPTPVDYLMR
FT                   NTGGQWKIFDVMIEGISYVQTFKTQFDGPLREKGIAKVAAELRTGNLQVGAAPANGN"
FT   CDS_pept        complement(307716..308261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0279"
FT                   /product="toluene tolerance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67034"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67034"
FT                   /protein_id="BAE67034.1"
FT                   /translation="MRGPRLEFAVGAFLLLTLASLLVLAVASTNQRWGFGSSQYTLTAR
FT                   FSQIGQLRAQAPVKIGGVTIGKVSDISLDPTKFDSIVTLSLDTRYKDLPADTSAGIFTS
FT                   GLLGESYIGLQPGGDPDTLKPGDEIGFTQPAVDLLQLVGKYMFSGGGSGSNANVPAATN
FT                   GQAPAPARTAPPPTEPHQ"
FT   CDS_pept        complement(308279..309028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0280"
FT                   /product="toluene tolerance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67035"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67035"
FT                   /protein_id="BAE67035.1"
FT                   /translation="MAFVDSIRAFGRAGLFSLTVLRGSLPTRDFIAELVREIYKVGARS
FT                   LPIIAVGGAFVGLVLTLQGYRTLTTYGASDALSTLLGLSLYRELAPVLTALLFIGRAGS
FT                   SIAAELGLMRATDQIKALELMAIDPVAKAVAPRFWAAVLTVPLLTGVFCSLAITGGYVE
FT                   AVHVLGIDNGTFWSGLSNSVDVWDDFGVAMLKSAIFGGTAALVAAYVGFHAEPTIEGTS
FT                   VATTRAVVNASLLVLMFNFVLSAMLFR"
FT   CDS_pept        complement(309028..309822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0281"
FT                   /product="toluene tolerance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67036"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67036"
FT                   /protein_id="BAE67036.1"
FT                   /translation="MTAFASPVVQLSGVRIDRDGRTILRDVSLDVPRGSITAVLGPSGS
FT                   GKSTMLAALTGELRPVAGTVTLFGNAIPTGSRALLEMRRNVGVLLQGNGLLTDLSVAEN
FT                   VALPLRTHTRLPAAVLQRLVQMKLHAVGLLAAADAWPRELSGGMARRVALARALALDPP
FT                   LMIYDEPLTGLDPIASGVIMSLIQRLNDSLGLTSIIVTHHVHETLPICDQAVVIANGGI
FT                   VFAGTPEQLQDSADPLVQQFLHGQPDGPIAFDAAPRRDRSAA"
FT   CDS_pept        310168..310494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67037"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67037"
FT                   /protein_id="BAE67037.1"
FT                   /translation="MTIHAASSLQESSMELLTLEHFAGSVNETFAAALNEGEVPFVLVE
FT                   ARPLQHARNSQRAPFSLLFRNGSAFLFPQQTYQMRHARLGEIGIFLVPVARERDGFLYQ
FT                   AVFN"
FT   CDS_pept        complement(310513..311094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0283"
FT                   /product="acetyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67038"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67038"
FT                   /protein_id="BAE67038.1"
FT                   /translation="MLIRSIDAMTRPLSSEVVKASGGASQTTLPGAQAIALRGEQDADL
FT                   PWLQYLYASTRSDELARVPWPYATKRAFADQQFALQRTHYRQQFADADFLIVQANGLSI
FT                   GRLYLHRATAHHTLVDISLLPDWRGKGIGSQLIAHAQARACDAGCALSLHVLHANPAAQ
FT                   RLYVRLGFVAGNSTQTHLQMHWHPRDHLLS"
FT   CDS_pept        complement(311088..312086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0284"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67039"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67039"
FT                   /protein_id="BAE67039.1"
FT                   /translation="MLGPSLHRDQIMAMNRVQFQARLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRYLAETMWRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTLFTAESAC"
FT   CDS_pept        complement(312264..312797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0285"
FT                   /product="ISXoo2 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67040"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67040"
FT                   /protein_id="BAE67040.1"
FT                   /translation="MASSFGLHRGWAYKVLARAQEGGAGALMTRKGSGRPRTLTPAQER
FT                   QVFGWVNGKNPRQHGFAFGLWTRQVVRELIEKKCAARLSLASVGTLLARLGLSPQKPLQ
FT                   HAYQRDPLAVAQWQEQTSPAIVKHAKREKAEIDLWDESGFRADAVQGRTWAVKGVTPES
FT                   RCRGSARASVRPRR"
FT   CDS_pept        312897..313853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0286"
FT                   /product="IS1112 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67041"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67041"
FT                   /protein_id="BAE67041.1"
FT                   /translation="MSSSRLDLSERYRLHALYETGMSMRAIADAVARAPSTISRELRRN
FT                   RHAAKYRPDHAQRISEHRRAQASRRPRIDAERIRQIEVLLREDFSPEQIAGRTGLASHA
FT                   WIYRHIDADQKRGGQLFMHLRKRRRKRRRRGVRDGRGQLTHRRSWTQRPSVVEQRSRIG
FT                   DWELETIRASHGRAVVVSMTERCSGLHLLAYSPDGTAENVRNAIVQRLGGLRHAVHTLT
FT                   ADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTITDAH
FT                   LRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSVANQS"
FT   CDS_pept        313898..314344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0287"
FT                   /product="ISXoo12 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67042"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67042"
FT                   /protein_id="BAE67042.1"
FT                   /translation="MSRAIKLLGMEITPAQFALIEHCLPLQRGNVSMTNLQVVNALLYV
FT                   AEHGCKWRGLPERFGNWHTVYTRINRWAKSGVLDRMFAQLQTCQIVRIKIEAVSLDSTS
FT                   IKVHPDGTGALKKTAHNPSGNRGADGTPKFIWLPQMLEQPSRSD"
FT   CDS_pept        314341..314688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0288"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67043"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67043"
FT                   /protein_id="BAE67043.1"
FT                   /translation="MTPGNAHDAPAGRALLEHLGPVERPVHLLMDRAYEDNETRKLALD
FT                   LGFVPVVPPKSNRVDPWEYDKEMYKRRNEVERLFRRLKGYRRIFTRFEKLDVMFLGFLS
FT                   FVLVVDGLRMC"
FT   CDS_pept        complement(314727..315203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0289"
FT                   /product="ISXo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67044"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67044"
FT                   /protein_id="BAE67044.1"
FT                   /translation="MIVDAQSVKNSDTAGQKGYDAGKKVSGIKRHIAVDTQGFPHAVAV
FT                   TTAEVTDRQGALEALKRCRSGLGRVKRLLCDSGYTGDPFAEGVQDILGKHVTVQIAKRS
FT                   ELHTFKVMPKRWSVERSFAWLEKNRRLWKNCERRLNTSLQFIHLAFLAMLLRRS"
FT   CDS_pept        complement(315169..315525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0290"
FT                   /product="ISXo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67045"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67045"
FT                   /protein_id="BAE67045.1"
FT                   /translation="MREKNYPSDVSRERFEQIRPILEQARKRTKPVTVDMYEVWCAVLY
FT                   LLRTGCPWRALPSDFPKWRTVHSYFAKWSEVDDEGISLLERALKKSGWRGPRETGAQGL
FT                   QHVLDRGRAEREEQ"
FT   CDS_pept        315657..316871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0291"
FT                   /product="ISXoo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67046"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67046"
FT                   /protein_id="BAE67046.1"
FT                   /translation="MRASEVLQKCLSNSLSGMHALRQRALLRAVEALLHGGRLTVIDLA
FT                   RAWPGARRVRAPLKACDRLLCNRALQVERSAIEQDMAHWLLRGDQPVIVIDWSDLKPDK
FT                   SWCLLRAAVPVGGRTLTLLDMVVSGKQQGSPGAEKRFLQQLRALIPDDVRPILVTDAGF
FT                   RTPWFRAVSAMGWDWVGRLRGRTQVKPQDVPDDAVQWIDSRRLHALASNRARELPPMQA
FT                   NRSDPLDCRLVLYAKTRQGRQQRNRRSPAKVSRASSSLKAAAREREPWLIVASPQLHAP
FT                   SAKQLVNLYARRMQIELAFRDLKSHRYGQAMEDSLTRRGERLQILLLLNTLATFASWLA
FT                   GLGCEATGIAQWLSPRSSTRKLYSTLRVGREALVRCWPMEPVSRWLERLRALPDAVREQ
FT                   MTLVL"
FT   CDS_pept        316931..317287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0292"
FT                   /product="ISXo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67047"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67047"
FT                   /protein_id="BAE67047.1"
FT                   /translation="MREKNYPSDVSRERFEQIRPILEQARKRTKPVTVDMYEVWCAVLY
FT                   LLRTCCPWRALPSDFPKWRTVHSYFAKWSEVDDEGMSLLERALKKSGWRGPRETGAQGL
FT                   QYVLDRGRAEREEQ"
FT   CDS_pept        317253..317762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0293"
FT                   /product="ISXo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67048"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67048"
FT                   /protein_id="BAE67048.1"
FT                   /translation="MIVDAQSVKNSDTAGQKGYDAGKKVSGIKRHIAVDTQGFPHAVAV
FT                   TTAEVTDRQGALEALKRCRSGLGRVKRLLCDSGYTGDPFAEGVQDILAKHVTVQIAKRS
FT                   ELHTFKVMPKRWSVERSFAWLEKNRRLWKNCERRLNTSLQFIHLAFLALLLRRSRTGSK
FT                   EFARFE"
FT   CDS_pept        complement(317924..318418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0294"
FT                   /product="ISXoo13 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67049"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67049"
FT                   /protein_id="BAE67049.1"
FT                   /translation="MDKTRRIEQRTEKSLKGMRWTLLKDVFSLKPTAGAALHGLITAPK
FT                   LTRTARAWLYKEQLREALDRKQINVMRERLKHWCVCVMRSKVEAMKEVPALVRRHMDGI
FT                   VAWAQTRQTNGFLEAINGLFQSAKRRARGFKRLSTIKTVIFLIAGKLDFQTFNPHARQP
FT                   T"
FT   CDS_pept        complement(318582..319157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0295"
FT                   /product="ISXoo13 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67050"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67050"
FT                   /protein_id="BAE67050.1"
FT                   /translation="MTAKVFEAALGIGAPWSVGAVEFDEATKVLTVPVDFKPGTRFKVS
FT                   GQKGLHPVHDTVVKTYRHLNFFQHECYLKVRTPRVKLGDGSVRLVEPDFAGRLSGFTLL
FT                   FEALVLMLSQQMPFAAVARIVGESAYRCMQVCNRYVEMALEQADFSDVTSLAIDETSRA
FT                   RGHDYVTLAADAQARRVIFVTEGRTPKP"
FT   CDS_pept        complement(319220..320017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0296"
FT                   /product="ISXoo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67051"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67051"
FT                   /protein_id="BAE67051.1"
FT                   /translation="MRCARVDAGGASERCALAAIGMSASALRYRPREDRNVELREHSVA
FT                   LAHRHRRYGVGMISLKLRQEGRLVNYKRVERLYCEQQLQVRRRTRKKVPLGERAPLLRP
FT                   TKANQVWSMDVVFDRTAEGRAIKCLVIVDDATHEAVAIDVERAISGHGVVRVLDRLAHS
FT                   RGLPKMIRTDNGKEFCGKAMVAWAHANRVQLRQIQPGKPNQNAYVESFNGRLRDECLNE
FT                   HWFPTLLHARTEIERWRREYNEHRPKKNNRRNDAGGLCPAVGQ"
FT   CDS_pept        complement(320033..320296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0297"
FT                   /product="ISXoo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67052"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67052"
FT                   /protein_id="BAE67052.1"
FT                   /translation="MKKRFSEEQIIGFLREAEAGMPIKDLCRRHGFSEASYYLWHSKFG
FT                   GMSVPDAKRLKDLEAENKRLKKLLAEQVFQNDLIKDALQKQW"
FT   CDS_pept        320556..320984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67053"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67053"
FT                   /protein_id="BAE67053.1"
FT                   /translation="MCILILRGPQADPAPLAPMQLPECAGRALRTLACADVDSLIAELH
FT                   AAGGDAEVELVLLDSGDLPLSERSCALALRAAVDALPTPYIELHTDSDQELEPWLHAQH
FT                   APLAVVITPHDALRAYAMSLGIAARCLPSMHAPLRVAA"
FT   CDS_pept        320995..321444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0299"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67054"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67054"
FT                   /protein_id="BAE67054.1"
FT                   /translation="MSIVIMRGPEAAMPLVRGPQPLPRAVIRQLVACAGDAGKTVALRA
FT                   CGSEQELLDALRVAGQARMEIALIDPGSCVDSARLHRVLRDLPYPYVETHDDSVDRPER
FT                   CLPNGLGHCIATVRGYCAQSYLLGLEIALEHLGCTEIQGDVHVGT"
FT   CDS_pept        321347..321652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67055"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67055"
FT                   /protein_id="BAE67055.1"
FT                   /translation="MATARRAICWGWRSRWNIWAARRFKAMSTSGPERRQLHYFADYEG
FT                   YCDGRPVLWGQLAHSVDVPADGELDAAGLVCALRRRAAEAHGLEAGQIRLCQVTRL"
FT   CDS_pept        complement(321960..323714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0301"
FT                   /product="polyvinylalcohol dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67056"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67056"
FT                   /protein_id="BAE67056.1"
FT                   /translation="MTNPKRRLRLRSLTLVPCLLVSAVAFAQSGATTAQQPVSSLDTEA
FT                   FARSGQVWRSFGQDLPFASPSNWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTT
FT                   GDISATPSVEGGTLYVPDWGGTLYSVDTQTGKPNWQAKLSDYTGNANSVTRNTPAISAK
FT                   SIIVGDQVAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNL
FT                   AANHTFSFRGSVVAVDLNTGKKVWQFYNVPEGYTGASVWGQVAIDPINRRLYFGTGNNY
FT                   NIPQDVGNCISNERSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYD
FT                   AWNLSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPGNGRLQQLVGAGQKSGIY
FT                   WAFDAKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNANTTYTLGPANVQT
FT                   HNGGSWAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTASPNLLYAGSMAGNMVAL
FT                   DADTGATVWNYDASGSVVSSPAIANGALYWGDGYGRFNFGTAATGNQLIKFVPDNTAAK
FT                   SAGSAGRQ"
FT   CDS_pept        324629..325075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0302"
FT                   /product="ISXoo12 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67057"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67057"
FT                   /protein_id="BAE67057.1"
FT                   /translation="MSRAIKLLGMEITPAQFALIEHCLPLQRGNVSMTNLQVVNALLYV
FT                   AEHGCKWRGLPERFGNWHTVYTRINRWAKSGVLDRMFAQLQTCQIVRIKIEAVSLDSTS
FT                   IKVHPDGTGALKKTAHNPSGNRATDGTPKFIWLPQMLEQPSRSD"
FT   CDS_pept        325072..325419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0303"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67058"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67058"
FT                   /protein_id="BAE67058.1"
FT                   /translation="MTPGNAHDAPAGRALLEHLGPVERPVHLLMDRAYEGNETRKLALD
FT                   LGFVPVVPPKSNRVDPWEYDKEMYKRRNEVERLFRRLKGYRRIFTRFEKLDVMFLGFLS
FT                   FVLVVDGLRMC"
FT   CDS_pept        complement(325472..325999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0304"
FT                   /product="gluconokinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67059"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67059"
FT                   /protein_id="BAE67059.1"
FT                   /translation="MGVSGSGKTTIAQALAAHYGFRFLDADDYHSVAARAQMAAGQPLT
FT                   DAMRLPWVELLSATLRDCVQAGESVVLAFSGLRSAHRQLLRNSGVPMRFVFLHAGPHVI
FT                   AARLSARAGHFMPPMLLDSQIQTLELPLDEADVVSVEVDASVAAVVQDAIAQLATIDPA
FT                   ALQHASRASERV"
FT   CDS_pept        326214..327596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0305"
FT                   /product="cation symporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67060"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67060"
FT                   /protein_id="BAE67060.1"
FT                   /translation="MTSSPATSPASARLRWREKLGYGAGDLGLNLYWANISAFLLIFYT
FT                   DTMHLPAAAVGTMILLTKIADAIADPAMGALADRTRSRLGTFRPYLLWGALPMAATGVL
FT                   AYTTPDLDQHGRMWWATITFLVMMLAYTVVSIPYSALSGVITADSQQRTGLISLRFIGA
FT                   FAGTTLVNYVTMDLVRWFGAGNDALGWQRTMMLYGAVALLLLVTVALTTRERVQPPPQQ
FT                   RTPIRRDIADLLQNKPWCVLFVLSLIIMITITMRGGAGVYYLKYYVQRADLVGLFLGSY
FT                   SVALGVGAAITPLLTRRWDKRQLMFWLMVLVGLLSCSMWFVPADAVWAVFVLNMLIGLA
FT                   LGPKSPLAFSMYADSADYTEWRTGRRATAMTFAAATFSQKLGGALASAGIAWVLAAMGY
FT                   VANTAQSIGSLTGIVLLLTVIPGAVALLAAWTMRFYPLDDGLLNRIQHELAARKRDEQE
FT                   HL"
FT   CDS_pept        327599..329998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0306"
FT                   /product="NdvB protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67061"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67061"
FT                   /protein_id="BAE67061.1"
FT                   /translation="MSATPLAGSDDLSTLLAPSADGARYALYSPTAMPNAGGFLWNRRM
FT                   MLQLTCRGYATGQFMQPEPSKYAHAPMLEARNFMMPEQPYYAHHPGRFFYLKDEDTGAL
FT                   YSVPHEPVRAQPQAFEFSAGKHDVRWRVRHDDIVVELCVSLPTDDAVELWECRVHNVSA
FT                   RARRLSLYAYFPVGYMSWMHQSGGYDPALGGIVCRSVAPYQKVDDYFRQRDFKDCTFLL
FT                   HEQTPVAWDAQQIAFEGEGGLHAPSAVQAEQLGNHAAHYETPAAALQYRLTLDADAVSV
FT                   HRFAFGPAKDDADIAALRARYLSEAGFAQAAREYAHYLQAGQGCVQIATPDAALDNLVN
FT                   HWLPRQVFYHGDVNRLTTDPQTRNYLQDHMGMAYLQPATARAALLHALSQQEPSGAMPD
FT                   GILLVEGAELKYINQVPHTDHCVWLPIFLSAYLAETGDASILDAIVETHDGQRLSVADR
FT                   LDAAMQWLLDARDARGLSFIAQGDWCDPMNMVGWRGKGVSGWLTVATAYALRLWSEICS
FT                   AQGRSAQGQTFGEAVAAINADANRELWDGNWYARGITDDGVRFGIAEDVEGRIYLNPQS
FT                   FALLAGTADAEQRAALLEAVREQLHTPYGPVMLAPAYTHMRDDVGRLTQKWPGAAENGA
FT                   VYNHAAAFYLYSLYQIGEADRAWEILRALLPGPTREDVLQRGHLPVSLPNYYRGAWHQY
FT                   PRTAGRSSQLFNTGTVAWVYRCVLEGLFGLVGEGDALAIRPQLPSHWPHARATRQFRGA
FT                   DFEVTLMREAGRTAMQVLVDGEVCPDRRIGNIVGGQVYRVEVRLPG"
FT   CDS_pept        complement(330102..332744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67062"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67062"
FT                   /protein_id="BAE67062.1"
FT                   /translation="MSVPARTQTSSIAPSRVRSLLIIAVGLFAADGVWACTTPVSVCER
FT                   DSAGAVALIRSEVPATVVVDASADPAVRSVADNFATDLQRVAGRNSGVTTDLASVRGTA
FT                   VIVGTLGQSPIIDTLIAAGKIDKRALLQRWEAYTQIVVDRPTAQIDRALVIVGADRRGA
FT                   VFGTYDVSEKIGVSPWYWFADVATAHRSNLFITRGSVSDAPKVRYRGFFINDEDPALKG
FT                   WAMKKFGGVNSKMYAHVFELGLRMKANYLWPAMWGKAFNVDDPNNMVLADQMGIVMGTS
FT                   HHEPMMRAQKEWHLKSIPNSGGAWDYTSNAANLRAFWKGGIARMMSKGGGQRYDSLVTV
FT                   GMRGDGDEPMAESTASHVLEQVVADQRAIIADVTKAPAAQTPQVWALYKEVQDYYDHGM
FT                   RVPDDVTLLFSDDNWGQIRRLPVADLQRTGGYGVYYHFDYVGAPRNYKWINTNQIEKIW
FT                   QQMDLAYQRGARQLWVVNVGDIKPMEYPLSFFLKMAWNPEAITPGALAAYPQQWAQASF
FT                   DAAHAARIGELITRYSMLVARRKPELVDQDSFALGEGAPATLDGGEFGAIVAEWQALEQ
FT                   RMLGVKACLPADQHDAYYQLIEYPIAAVSTLYQLYYAAAWNKRLAARNDARANVFADMV
FT                   ETTFERDKALTQRYHAINGGKWDGMMNQVHMSYVIWNDPTQQSMPSISRVGSDTPPDRI
FT                   ARSIAFAPPAAQTPGVIALEAPMFSRAIANKGLQWTAIPALGRTQGALVALPQGKPATT
FT                   AEDRVAVEYDVVVTTPGPATLGLYLAPTLDTSNRGPLRLGVSIDDGPVTTVSSDLQPAG
FT                   GAKNTPAEKAWATAVRDNAVFVSAQMGAVARGRHTIKVFRIDDNIVLEKLVLSTVPVPA
FT                   SYLGPAPTR"
FT   CDS_pept        333489..336941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0308"
FT                   /product="two-component system sensor protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67063"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67063"
FT                   /protein_id="BAE67063.1"
FT                   /translation="MLVSSWILLLVSIGYAALLFGVAWWGDRRPLYPERPWLRPAVYSL
FT                   ALAVYCSSWTFYGAVGSAVRNGIGYLPIYLGPLLLLLFGWRIIERLALIARAENTVSIA
FT                   DVISSRYGRSRRLAALVAVIALVGIIPYLALQYKAVAMSLEVLTGHSSAGRGIFADPAL
FT                   YVALLMALFATLFGTRQVDATEHHRGMMLAIALESVIKLVAIVAVGLFAWLWSSDHQPH
FT                   IADSARTLFEHTPSVGFISQTLLSFLAVICLPRQFHVAVVECSDVGDIRRARWLFGAYL
FT                   VIISAMVVPIASAGIALFGKGSAVVDDAVVLALPLSQGNTVLALVAYVGGFSAATGMVI
FT                   VASIALATMVSNDLVMPVLLRRRGSADARAAVASRVLWIRRVAILLLALTAYGYHRSVA
FT                   NDTTLAAFGLMAFAAVAQFAPGVIGGLYWRGASRKGVETGMVLGFMTWIYTLLLPAATR
FT                   AGWLQPEWLVDGPFGIAWLQPQQLFGMRGWDPLAHGTFWSLLINVGAMMLVSARWRPGV
FT                   DERLRAAPFLDPYAQRPAVAGDWPGHVRVADLQALAERVVGERHAHRAFVDQAALLERE
FT                   LQPSVVADRAWVQFTERLLAASIGAASARLVLTSLLRGSGMELGEVVAVLDEAGQELRF
FT                   NREILSTTLENISAAVSVVDPDMRLTAWNRRYQQLFGYPDGMLYVGRPVADLIRYNAER
FT                   GELGEGDIEDQIDRRIRHMRAGSPHVFERTRSDGKVIEMRGQALPGGGYVTSYNDITDY
FT                   KRAERALLDANENLEQRVADRSREAELAQQSKTRFLAAISHDVLQPLNAARLFASALRE
FT                   SHQNNEEQRHLAERVDASLRAAEELLDGLLDVSRLDAGGLRPTVEGFDASALMHELAAQ
FT                   YAPVAASRGLRLQVHSRPIWVRSDRRLLRRVMQNFLANALRYTRQGRIVLGMRGRGQQV
FT                   ELQVWDTGPGIPEHHMRQIFEEFRRYQQPFDWGEQGLGLGLSICQRISRLLDHDLSARS
FT                   QVGRGSMFSILLPRVAPVPVTLLLPATVARASPSGDSLAGLRVLCVDNDREILDGMRAL
FT                   LGRWQVEVITASTVDQALERAREQPDLMLVDYHLHDRMDGLDTLDAVQAAAPAPIAGAL
FT                   LTADGRDELKQLARERGYRLLTKPVKPASLRAFLSAHHDAKKR"
FT   CDS_pept        complement(337134..337718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67064"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67064"
FT                   /db_xref="GOA:Q2P8R3"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8R3"
FT                   /protein_id="BAE67064.1"
FT                   /translation="MSPFSIVLIGFAMSTDAFAAAIGKGAAMRKPQWRDALRAGLIFGC
FT                   IEAITPVIGWVLGRAASSYLSAYDHWIAFVLLGALGTHMMIAGLRNGPDDANDAEAKTP
FT                   KRHGLLGLATTGFATSIDAMAVGVSLAFLDVHIGVVAVVVGLCTFSMVTAGVMLGRALG
FT                   NLIGKRAEILGGLILVIVGSVILYEHLGAAT"
FT   CDS_pept        complement(338195..338971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0310"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67065"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67065"
FT                   /protein_id="BAE67065.1"
FT                   /translation="MSTEHAKYRAPALDKGLDILELLARDAHPMSMGAISQGVGRSRGE
FT                   IFRMLQVLEERGYLMRDADGDYVLSNRLFMLGMQQPQVQNVTEAALPVMRRLADAICQP
FT                   CHLVAPSGDQIVVIAQMDVPSDLGLVVRPGHRRPLAHSTSGLVLFAFQQPDVQARWLNA
FT                   LDTSDVAYDRARFLEDAQQTRNDGYAMHASEAVVGVVDLTAPILQDGSATYTLTVPFIE
FT                   RRPELVNPQAALQALCAATAEISEALMYHPPRALGH"
FT   CDS_pept        339152..340453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0311"
FT                   /product="fucose permease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67066"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67066"
FT                   /protein_id="BAE67066.1"
FT                   /translation="MHQSDIAASPRGNLARTAMVPLLLVVSLFFLWGMANNLNDILIKQ
FT                   FKKAFELTDLQAGLVQSAFYMGYFMFAMPAAMFMRRYSYKAAAVLGLLLYACGAFVFYP
FT                   AAQVHTYWLFLLALFVIASGLAFLETTANPLVTVLGPADGAARRLNLAQAFNPLGSITG
FT                   VLVGQHFIFSGVERTPAELAAMAPAAREAFFATESSAVQMPYLIIGAVVVLWAILIALV
FT                   RFPTSAPDADAGVAPKRARFSELLGNRLFVFSVVAQFFYVGAQVGIWSYLIRYLQDAVP
FT                   GTPEKTAATYLTISLVLFMAGRFIGTALLRYLAPAKLLASFAVINLILCAVAIALPGWT
FT                   GLYALVAASVFMSVMFPTIFALGLDGMHDDARKLGSSLLVMSIIGGALLTAVMGAVSDM
FT                   AGIHWALVVPGACFAVILLFALRARRAAPVIAGA"
FT   CDS_pept        340456..340815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67067"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67067"
FT                   /protein_id="BAE67067.1"
FT                   /translation="MPRLCYVLDLHDDAALIAEYERWHQPTEVWPEVVASLQQAGILEL
FT                   EIFRSGDRLVMLMDVSEHYDPAAKAARDAADPRIQAWEALMWRFQKPLPGSAPGEKWRH
FT                   AGKIFALSRAIEAQR"
FT   CDS_pept        341252..342733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0313"
FT                   /product="ISXoo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67068"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67068"
FT                   /protein_id="BAE67068.1"
FT                   /translation="MAHTQNADFFRQPLAEMIDPRHPLAVLARRLPWAQIEAVLAPHFA
FT                   RKVRAGRAVAQHDLFGPSVQVAGAGIAAAGRPRLPIRLMASLLDLKHAYKLSDEELVER
FT                   WAENVVWQHFSGMAFYEPRLPCDATQVGRFRAAIGEAGVEELLKATIDTAVSSKAIVPA
FT                   EFERLIVDTIVQEKAIAHPVDWRLMENARHKLVVAAKRAGIALKQTFAKETKTLRRKAG
FT                   GYAHARQFKRLRKVLKRQRTLLGIVLREVQRKIGQASQATAPAPALENLHTLMQRAERI
FT                   HAQQPNGKNKLYALHAPEVECIGKGKARKPYEFGVKVSVAITHKQGLMVGARSFTGTPY
FT                   DGHTLHEQLEQARILSEDTAGAPKQVVVDLGFRGVDAANPGVEIIHRGTFKRLTDEQRR
FT                   WLKRRQAEEPAIGHLKHDNGMDRCWLQGANGDALHAVLCAAGDNIRWLLRAMVRLGLKG
FT                   LFAPMVARLIMLATVLAMSLRARNTRPHRLAWCVW"
FT   CDS_pept        342893..343891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0314"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67069"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67069"
FT                   /protein_id="BAE67069.1"
FT                   /translation="MVGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRYLAETMWRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTLFTAESAC"
FT   CDS_pept        344718..346880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67070"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67070"
FT                   /protein_id="BAE67070.1"
FT                   /translation="MKPAASATPLNRTAPASPAGIHEIEEEASAHASPSHSPAQSEGAL
FT                   TMLSRRPSKRGKETADVTASAAQSASHLQSVELQVSQPAVSPNTGNASLVRLKEQLAAD
FT                   NLRPVEPELAAELINKTRPMKLADATGPQERAATHADLLGRIRETDAMAWYRAQGLSEN
FT                   EVANLRRSALLSGMPNPTGSFLNNAMQYIVSPWINYATHQPWAGAGFGFATAAIAAPMN
FT                   AAQQSAVVSLCESIREHGGHVIVPDKKQINDKHWLPALAKALESHIAEFSGCCDRFRAL
FT                   KDAADQNPAAQPTADFIAAAHQVLQAETRLHQAQHDFVMTQGAHERQWMGNRWQAVPRI
FT                   LRSPLSGTLGLLSKTGAMRALSPTAQTVGALLMSAVQHVAAGFDEQAKQDYNNKLNLLY
FT                   ADVLTDTGKAKLARGEPVAAEEIDQGKLRKLIQSPTQALVKRITSGLVAMEKELKAQVA
FT                   APRSPQATTGDDDLDLEAGHGAGPAKALKLLSQDLKALREGRLDELDPDGVAATLLLGA
FT                   EKSVVSDQLIGDIIKKYTSREFSAQTAQRIGQMFHLGVLGSAASSVIGKASSAARGGTR
FT                   NVPIPQALAISALSGGMAAVGALNQHTAITVKNNRREGDTDIGLKQQVLRGVMGGANEA
FT                   LSQRRATKASQAINALVQRSDVEALLSRAKALTQRSGATSSATHASPALTLPEAVEQLR
FT                   PGVASASQSHEVIVQIGEEDRALPPA"
FT   CDS_pept        complement(347007..349085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0316"
FT                   /product="peptidyl-dipeptidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67071"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67071"
FT                   /protein_id="BAE67071.1"
FT                   /translation="MPEKTTPAPAADAASNPLLTASTLPFQAPPFDKIKDADYLPAFEE
FT                   GMRLHLADIRKIADNPEAPTFDNTIEAMERGGETLTRVSRIFFGLVQADTSDARQKIQE
FT                   EIAPKLAAHQDEINLDPKLFARVKTIYDQRDTLNLDPEQKRLVERDYQQLVRAGAQLSD
FT                   ADKDSLRKLNVEETTLSTQFHTRLVAASAAGAVVVDDKAKLDGLSEADIAAAADAAKAR
FT                   KLDGKYVLSLQNTTQQPVLASLKNRELRAEVLKASETRAEKGDANDTRQTIQRLAQLRA
FT                   QKAKLLGFDNYAAYRLGDQMAKTPDVARKLLTDTVPAATAKARREAAEIQKVIDAQNGG
FT                   FKLAASDWDIYAEQVRKAKYDLDEAQIKPYFELNNVLKNGVFYAATQLYGITFKERTDI
FT                   PTYHADMKVYEVFDADGTSMALFYTDYFKRDSKSGGAWMDVFVEQDGLTGAKPVVYNVC
FT                   NFTKPAAGQPALLSFDDVTTLFHEFGHALHGMFSKVKYPSISGTSTSRDFVEFPSQFNE
FT                   HWASDPKVFANYAKHYQTGAPMPAELVEKIKKAKTFNSGYATTAYLSAALLDLAWHTQP
FT                   ADAPLQDVSKFEADALKRFKVDLADVPPRYRSSYFDHIWGGGYSAGYYAYFWSEVLDDD
FT                   AFEWFKENGGLTRKNGDTFRAKILSRGNTVDLTTLYRDFRGKDPSVKALLENRGLTE"
FT   CDS_pept        complement(349813..350442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0317"
FT                   /product="acyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67072"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67072"
FT                   /protein_id="BAE67072.1"
FT                   /translation="MSQPDPSLPPVTQANILLQPSPPRMPRAHGRFIRWFGRTALRLTG
FT                   WRLLGRLPDEPKLVMIVAPHSSNWDGFVGFAAKFALGFEVRVLGKSQLFWWPLGPLLRK
FT                   LGAIPLDRSLPQGTIGQAVRLIRNSEQMWYVITPEGTRKRVENWKAGFWKIASDSKVPI
FT                   LPVYFDYPSKTVGIGEPFWTGKDMAADIAAIRTWYRPWRGKHRDTL"
FT   CDS_pept        complement(350445..350876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0318"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67073"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67073"
FT                   /protein_id="BAE67073.1"
FT                   /translation="MASDPIQITPSLTIPPSELVERFVRASGAGGQNVNKVSTAVELRF
FT                   DVAGSPSLPEPLRARLLSRRDRRMTAEGVLVIDAQRFRTQDRNRGDARERLAEIISASL
FT                   SVPKRRVATKPSHGAKLRRLDAKRERSHIKRGRSASHWE"
FT   CDS_pept        350933..351511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67074"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67074"
FT                   /protein_id="BAE67074.1"
FT                   /translation="MLRQVPRSQNAPMTPTSSLAATRSLARRLLLAAMLAVAAPAALAQ
FT                   APSDADINRLLAASRAQTMLDTMLPQIEAMQQQQFAQLTAQRQLDADQQAQLQRIQERT
FT                   RQTVRKALSWSELRPTYVDIYKRSFSREDVLAMAEFYESSAGQSLLDKTPALTQNLMGA
FT                   IQQRMLPLFADLQKDLEKIVNAPAPAKKP"
FT   CDS_pept        complement(351607..352323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0320"
FT                   /product="pseudouridylate synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67075"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67075"
FT                   /protein_id="BAE67075.1"
FT                   /translation="MSIAPDPLQILYQDDVLAVVDKTAGLMVHDSKLARGEDDFLADRL
FT                   REQLGRPIFLVHRLDRATSGCLLLAFDRETASALGKALMSGDVQKDYLAVCRGWPAEPR
FT                   FTVDHDLDGGPGKPVKKPALTHFQRLATGELQVPSTGFATSRYALLRCQPQTGRFRQIR
FT                   RHLKHLSHHLIGDTSHGDGRHNRSFRMLGIHRMLLHAKRLAFPHPADGRRIRVTAPLDD
FT                   EFTKACALFGWDVAQL"
FT   CDS_pept        complement(352584..352973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67076"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67076"
FT                   /protein_id="BAE67076.1"
FT                   /translation="MGGRQKRALGDVFGLRNFGVNLTTLAPGARSALRHGHSLQDAFVY
FT                   IITGAPTLITNAGEQVLQPGMCVGFRAGDGDAHCLINRSEAVVTYLEVGDRSAGDSVAY
FT                   PDDDLMLVPLADGQRVYRHKDGTPY"
FT   CDS_pept        complement(353087..354760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0322"
FT                   /product="ubiquinone biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67077"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67077"
FT                   /db_xref="GOA:Q2P8Q0"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8Q0"
FT                   /protein_id="BAE67077.1"
FT                   /translation="MKAILRASRIGRVILRYRLDALLEGTPAERWLRLAKPFVPRASAE
FT                   IAVQSRGARLRLALQELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDGEAAR
FT                   LIVERALGLPVSVAFASFDTVPLASASIAQVHAATLPPDANGVRREVVVKVLRPEIERQ
FT                   IDADIALLHSLATLVERTHPRADKIRPREVVAEIEGTLSAELDLQREGANASVLRRFWE
FT                   GSDDLYVPEVIWSHTAERALTLERVYGIPSDDIAKLDAAGIDRKALAAKGVRVFYTQVF
FT                   RDNFFHADAHAGNIWVDSDPERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDY
FT                   RRMAELHVEAGWMPSNVRIDELEAAARSVCEPYFTRPLSEISLAQVLIKLFRVAQRYEL
FT                   TLQPQLILLQKTLLNIEGVGRQLDPKLDIWAVARPVLERILRERYSPRRVLRELSKRLP
FT                   EIMTHAPDMPRLVHSWLKQQVEGRHQIDIRSTELLALDLSLRKLQTRVVTAITGSGLLV
FT                   VAAVLYGLHPDGWYLGTVPVWSWISGGAGSAALLVAWLRR"
FT   CDS_pept        complement(354757..355401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67078"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67078"
FT                   /protein_id="BAE67078.1"
FT                   /translation="MPGSLFTSLKPLAGQALQAALNRALALDPDTRDALLPLEGQRIAL
FT                   TLDAPALALQIRVHARRLLVGPVDPAQEPDLAVRSSLAGLLGQLPLLANARRTGAPAGR
FT                   LKVSGDAELARQLQQLAGRFDPDWQLPFVAVFGEILGVQIASAVGAALQQARCSAVDLA
FT                   QSAAEFVTEESRDVLPRAELEAFHDDVDELRDDVERLAARVSRLRASGGAA"
FT   CDS_pept        355636..356739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0324"
FT                   /product="D-alanine-D-alanine ligase A"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67079"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67079"
FT                   /protein_id="BAE67079.1"
FT                   /translation="MRKIRVGLIFGGKSAEHEVSLQSARNILDALDPQRFEPVLIGIDK
FT                   QGQWHVNDPDSFLLHADDPARIALHRSGRGVALLPGAQQQQLRPIQPEQALAQIDVVFP
FT                   IVHGTLGEDGSLQGLLRMANLPFVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFVCFDR
FT                   HTAAHADVDTLIAQLGLPLFVKPANQGSSVGVSQVRTADAFAAALALALAYDHKVLVEA
FT                   AVAGREIECAVLGNAVPHASVCGEVVVHDAFYSYATKYISEHGAEIVIPADIDAQTQQR
FT                   IQQIAVQAYQALGCAGMARVDVFLCADGRIVINEVNTLPGFTRISMYPKLWQASGLDYR
FT                   GLITRLIELALERHTDDQLLRSAVELH"
FT   CDS_pept        complement(357233..357850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0325"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67080"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67080"
FT                   /protein_id="BAE67080.1"
FT                   /translation="MERAQRLLAQRPKDKQKLYALHAPEVDCMSKGKARQPYECGVKVG
FT                   IAVSARKGLIVGARSFPGHPYDGDTLAEQLEQARGLLQDVNVIPQVAIVDLGYRGRDVE
FT                   GVQILHRGKAKRLTRRQWRWIKRRQAVEPVIGHLKRDCRLNRCHLNGAQGDALHVLGCA
FT                   AGDNLRWRLRWIACLRAWLQVARARSSTRSSTMGPAHMALEV"
FT   CDS_pept        complement(357763..358587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0326"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67081"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67081"
FT                   /protein_id="BAE67081.1"
FT                   /translation="MRTRRPAAEQLHADELCRSRLENQIDLRHPLVQLSHRLPWSALEQ
FT                   ALSPQLPATTGTGGRPALPMRLIAGLLYLKHAYDLSDEAVCERWLENPYWQFFTGEVVF
FT                   QTCVPCDPSSLTRWRQRLGEAGMEALLAHTINTAHTMKAVDARELSRVIVDTTVQEKAI
FT                   AHPTDSRLLEVARKKLVLLAKRHGIALRQTYARQGPALRRKAGRYAHARQFKANARSWD
FT                   AYYAICNASWPSWNRRYVSASVSGWSAHNGCWHSVPRTNKNSTPCTRRKWTA"
FT   CDS_pept        complement(358693..359010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0327"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67082"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67082"
FT                   /protein_id="BAE67082.1"
FT                   /translation="MALQLRTGPSGLRCCEKGFAPDAQCTGWAARANSYVWRGVGTAKP
FT                   HLSGRRRHPARNAIASVPIDFSRKILAATTRQDAISCFLPGGEFLPAHPRKKRIAAISR
FT                   P"
FT   CDS_pept        359086..359370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67083"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67083"
FT                   /protein_id="BAE67083.1"
FT                   /translation="MNDYGSYRYLPADGWYATYPQAAEADEPRVFQRVALWRVAPHGKI
FT                   VGLISSPDNSQDESESQLLSAPRVLGVHYIHIDDLTADEREQIRRRRFS"
FT   CDS_pept        complement(359722..360198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0329"
FT                   /product="ISXo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67084"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67084"
FT                   /protein_id="BAE67084.1"
FT                   /translation="MIVDAQSVKNSDTAGQKGYDAGKKVSGIKRHIAVDTQGFPHAVAV
FT                   TTAEVTDRQGALEALKRCRSGLGRVKRLLCDSGYTGDPFAEGVRDILGKHVTVQIAKRS
FT                   ELHTFKVMPKRWSVERSFAWLEKNRRLWKNCERRLNTSLQFIHLAFLAMLLRRS"
FT   CDS_pept        complement(360164..360520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0330"
FT                   /product="ISXo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67085"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67085"
FT                   /protein_id="BAE67085.1"
FT                   /translation="MHKKNDPSDMSRERFEQIRPILEQARKRTKPVTVDMYEVWCAVLY
FT                   LLRAGCPWRALPSDFPKWRTVHSYFAKWSEVDDEGISLLERALKKSGWRGPRETGAQGL
FT                   QHVLDRGRAEREEQ"
FT   CDS_pept        complement(360580..360927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0331"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67086"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67086"
FT                   /protein_id="BAE67086.1"
FT                   /translation="MTPGNAHDAPAGRALLEHLGPVERPVHLLMDRAYEGNETRQLALD
FT                   LGFVPVVPPKSNRVDPWEYDKEMYKRRNEVERLFRRLKGYRRIFTRFEKLDVMFLGFLS
FT                   FVLVVDGLRMC"
FT   CDS_pept        complement(360924..361370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0332"
FT                   /product="ISXoo12 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67087"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67087"
FT                   /protein_id="BAE67087.1"
FT                   /translation="MSRAIKLLGMEITPAQFALIEHCLPLQRGNVSMTNLQVVNALLYV
FT                   AEHGCKWRGLPERFGNWHTVYTRINRWAKSGVLDRMFAQLQTCQIVRIKIEAVSLDSTS
FT                   IKVHPDGTGALKKTAHNPSGNRAADGTPKFIWLPQMLEQPSRSD"
FT   CDS_pept        362104..362496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0333"
FT                   /product="ISXoo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67088"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67088"
FT                   /protein_id="BAE67088.1"
FT                   /translation="MKKRFSEEQIIGFLREAEAGMPIKDLCRRHGFSEASYYLWRSKFG
FT                   GMSVPDAKRLKDLEAENTRLKKLLAEQVFQNDLIKDALQKNGERTGASCAGARVDRRWR
FT                   QRALRPGSDRHERQCAALSPARGPQR"
FT   CDS_pept        362659..363204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0334"
FT                   /product="ISXoo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67089"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67089"
FT                   /protein_id="BAE67089.1"
FT                   /translation="MPVGERAPLLRPTKANPVWSMDVVFDRTAEGRAIKSLVIVDDATH
FT                   QAVVIDVERAISGHGVARVLDRLAHSRGLPKMIRTDNGKEFCDKAMVAWAHANRVQLRQ
FT                   IQPGKPNQNAYVESFNGRLRDECLNEHWFPTLLHARTEIERWRREYNEHRPKKTIGGMT
FT                   PAAYAQQLANSEIINPGL"
FT   CDS_pept        363895..365214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0335"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67090"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67090"
FT                   /protein_id="BAE67090.1"
FT                   /translation="MLNRSLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPPLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVGVRSNTKVWWGSHQPAPMPPASPKGCRPRTRPMRDSAHAPISVHEVAQRLPARTYR
FT                   QVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTRPKQTP
FT                   VKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
FT                   KKNSVAFKMPAVSKSVRPRGSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        complement(366311..367189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0336"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67091"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67091"
FT                   /protein_id="BAE67091.1"
FT                   /translation="MLNRSLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPPLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVGVRSNTKVWWGSHQPAPMPPASPKGCRPRTRPMRDSAHAPISVHEVAQRLPARTYL
FT                   ISTIFQHSRSQ"
FT   CDS_pept        367354..368430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0337"
FT                   /product="ISXoo14 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67092"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67092"
FT                   /protein_id="BAE67092.1"
FT                   /translation="MFTVKRLEEFIPANHPLRPVREMVNEALRRLDGLFERMYAPNDKG
FT                   GRPSIAPEKLARAMLLQVFYSIRSERQLMEQVQYNLLFRWFIGLSMDDAVWVPTVFSKN
FT                   RERLIEHDVVVALFNEIVEIVEMADAKGWLSGEHFSVDGTLIQAWAGHKSFVRKDGDDN
FT                   GDGTDFRGTSRSNETHASTTDPHARLYRKGKTASELRYMGHTLADNRHGLIANARVTHA
FT                   DGHAEREAAKAMIGDARQANPDGALTLGADKGDDAAEFVEALKEIGVAPHIAQNTSNRR
FT                   SAVPDEVAARVGYAILQTKRKLIEQGFGWAKLTGTIGQVMVRGLEKVDQVFMVNMTAYN
FT                   LVRMRTLGQMCLQAGETA"
FT   CDS_pept        368573..369115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0338"
FT                   /product="ISXoo13 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67093"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67093"
FT                   /protein_id="BAE67093.1"
FT                   /translation="MTAKVFEAALGIGAPWSVGAVEFDEATKVLTVPVDFKPGTRFKVS
FT                   GQKGLHPVHDTVVKTYRHLNFFQHECYLKVRTPRVKLGDGSVRLVEPDFAGRLSGFTLL
FT                   FEALVLMLSQQMPFAAVARIVGESAYRCMQVCNRYVEMALEQADFSDVTSLAIDETSRA
FT                   RGHDYVTLAADAQARRV"
FT   CDS_pept        369135..369797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0339"
FT                   /product="ISXoo13 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67094"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67094"
FT                   /protein_id="BAE67094.1"
FT                   /translation="MKALAADLAAHGCPPEQITSVSIDMSPAFIKGVSDQLPNAQITFD
FT                   KFHVVGHANAAVDKTRRIEQRTEKSLKGMRWTLLKDVFSLKPTAGAALHGLITAPKLTR
FT                   TARAWLYKEQLREALDRKQINVMRERLKHWCVCVMRSKVEAMKEVAALVRRHMDGIVAW
FT                   AQTRQTNGFLEAINGLFQSAKRRARGFKRLSTIKTVIFLIAGKLDFQTFNPHARQPT"
FT   CDS_pept        complement(370224..371165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0340"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67095"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67095"
FT                   /protein_id="BAE67095.1"
FT                   /translation="MMHILILGAGGTGGYFGGRLAQAGVDVTFLVREARAAQLQADGLR
FT                   IRSPLGDAQLQVAHVTAQDLPALVAQRPFDLVILSCKAYDLDSAIDAIAQAVGEQTTVL
FT                   PILNGLRHYAALDERFNAARVLGGLCFISATKGEHGEILHLGKPAEMTFGERDGSVASA
FT                   RVQAFAAACTQAGIDHVASTQIAQEQWNKYSFLTALAAATCLMRAPVGAIVATDDGRAL
FT                   INGLYNECLWAADAAGQSIPEPARAKALQTLLQVDSPLKASMLRDLEAGQDVEAAQIVG
FT                   DMLRRVRETGRNAPLLMAANVHLQAYQVVRHS"
FT   CDS_pept        complement(371281..372030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67096"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67096"
FT                   /protein_id="BAE67096.1"
FT                   /translation="MRFSDYIVFVDESGDHGMANIDPAFPLFVLSCCLISKRDYMAAVV
FT                   PAIQRIKFATFGHDALVLHEREIRRDLGAFSVLRDREKKQAFIDALTDALASAPMTIFS
FT                   AVIDKRRLQDRQRGENPYEISMRFCLERMYYKLSKQGQVAQRGAALTTHVLCEARGHNE
FT                   DQDLELAFRRICGGDNFSGVEMPFDPVICDKKSNAIGLQLADLVARPIGMRQLRPDQPN
FT                   RAWDVIEQKLDKDATGRYLGYGLKCFP"
FT   CDS_pept        complement(372033..372845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0342"
FT                   /product="permease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67097"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67097"
FT                   /protein_id="BAE67097.1"
FT                   /translation="MSPSEPSMSATPATPRQRNWIALATIVRREVQRILRIWGQTLVPP
FT                   AITMTLYFLIFGGLIGSRVGEMGGYSYMQFIVPGLVMMSVIQNSYGNISSSFFGAKFGR
FT                   HVEELLVSPMPNWVILWGYVSGAVLRGVMVGAIVLIIAMFFTPVRIPHPIVTLTTVLLG
FT                   ATIFSLAGFVNAIYAKKFDDVAIVPTFILTPLTYLGGVFYSVKLLPGWAEAATHANPIF
FT                   YMVNAFRYGLLGSSDVPIWLAYALMLGFVAVLSALALWLLRRGVGLRS"
FT   CDS_pept        complement(372842..373837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0343"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67098"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67098"
FT                   /protein_id="BAE67098.1"
FT                   /translation="MNSPSPSAPALRVCDLRKTYDNGTQALKGVSLDVVPGDFFALLGP
FT                   NGAGKSTLIGIISSLVNLSGGQVEVFGTDLARHRSDAMRLIGLVPQEINFNLFEKPFDI
FT                   LVNYAGFYGMPRSQAQALAEVELRRAHLWEKAQVMSRTLSGGMKRRLMIARAMMTQPRL
FT                   LILDEPTAGVDIEIRRDMWRVLKDINAAGTTIILTTHYLEEAEHLCRNLAIINHGQIVT
FT                   HGPMRELLAKLDVEGFLFDIDGELPAQLPAIEGTTLTAIDSHTLDLDMPRAMDLNRVFA
FT                   TLGDAGIRVRSMRTKSNRLEELFVRLTGPGESPAAPPPAAAVPARPAGHP"
FT   CDS_pept        373979..374701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0344"
FT                   /product="phenol hydroxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67099"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67099"
FT                   /protein_id="BAE67099.1"
FT                   /translation="MIAPTVAHCQFVRDDGQPLDFQPGQFIQIHFDYADGTPTKRSYSL
FT                   ATIHDHALGPGEAVEIAVSFVPGGSATALFEGLEIGDQLQASGPYGRFCLQPGDHNQRY
FT                   VLIATGTGVTPYRSMLPLLAEAIATRGVQVVLLQGARNPTELLYGDDFRAFADAHPQFR
FT                   YVPCFSRDVPEQPHADVRHGYVQQHLAEFVPDAAHDIAYLCGNPDMVDICLEALKAAGL
FT                   PSAQIRREKYVSSTPPKV"
FT   CDS_pept        complement(374786..375787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0345"
FT                   /product="heavy metal transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67100"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67100"
FT                   /protein_id="BAE67100.1"
FT                   /translation="MSITHPAPHCAQSHTFASANPLAERSTRKAVILTVLMMVVEIVGG
FT                   WTLNSMALLADGWHMSSHALALGLALFAYRFARQHAGDVRFTFGTWKVEVLGGYTSAIL
FT                   LLGVAGLMAFQSLERLFTPEPIQYQEATVIAVIGLLVNLICAWWLRDSHGHGHGHGHDS
FT                   HGHTHTHEAHGHGHGHGHHHEAHSDLNLRAAYLHVVADAATSVLAIVALVAGMHWGVTW
FT                   LDPIMGIVGAVLVTVWAWGLLRSTGSVLLDAEMDAPLVAEVKQVIAELGHAIDIADLHV
FT                   WRVGSERYACVVSLVTAADIDAELVRRALQIHEELVHVTVELQRPALLNAAA"
FT   CDS_pept        375853..376125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67101"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67101"
FT                   /protein_id="BAE67101.1"
FT                   /translation="MAHLNQDKSKLLARVRRIRGQVEGLEKALAQDVECTALLTQVAAF
FT                   RGAAQGLMVELLSEHLKHHVAAPEALGARERAVDDISAILKTYLK"
FT   CDS_pept        376186..376407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0347"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67102"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67102"
FT                   /protein_id="BAE67102.1"
FT                   /translation="MRTLFHACTRMRQCAYKPLRMRPHQTLRAAAGHAARWIACMQWRA
FT                   DGVKKLRMSDRMHRATSASNADDANAAG"
FT   CDS_pept        376509..377198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67103"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67103"
FT                   /protein_id="BAE67103.1"
FT                   /translation="MQAAPHTATRRATSRRAIAQQSRSTGSHVAEALQMTSHKRRALQV
FT                   FCLGLCLLGIGLLGLCQVLPLNQYLAGISAGIGGWCMLLSVPMWLGRGNMCDTTRPALA
FT                   RRYHREFGVPMLLYVVVMLFWRYLLAHVGPNWARVLIALLPAVLVVLVIRAVARYVRDS
FT                   DEMQRRIELEAIAIAAGLVSGAYMTAGFLQAAELIEVPASAAMLWVFPLLCAIYGITKS
FT                   IHARRFE"
FT   CDS_pept        377195..377395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0349"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67104"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67104"
FT                   /protein_id="BAE67104.1"
FT                   /translation="MNSRVRELREASGWSQGELGERLGVSRQTINALETGKYDPSLPLA
FT                   FRIARLFGESIEHVFLYEDAQ"
FT   CDS_pept        377456..379057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0350"
FT                   /product="cysteine proteinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67105"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67105"
FT                   /protein_id="BAE67105.1"
FT                   /translation="MTMVKQSTMVAAMLIAMLAAGCQRAAAPAAAHDVAGKPTATAPGT
FT                   AVQRPASKTPPGNAAGHRFGTLLFTPCTLSAGGAAGNIEAQCASLRVPENPAAPSGRSI
FT                   ALKIAWLESEAGGGSTPDPVFFIAGGPGQSATEVAAIVDMGLHEVRKQRDIFLVDQRGT
FT                   GGSHPLECRDAAGKPLALENGSQATAEQLTAYAGQCAAGLRDDADPRYYTTSEAIGDLD
FT                   AVRAALGVQSLNLIGASYGTRVAQHYAARYRQHTRTVVIDGVAPNDLVIGGEFARTFED
FT                   AIALQSAQCRQQPACAKRFPVDTATQLRQVVERLRQAPVAVEYRDPRTGALRHEQVTAD
FT                   TVAGLAFGFSYAPETASLLPLVLDEAAAGRYASLMALAQMSASSMSDQMNRLMQWSVLC
FT                   SEDAGRYHPPAHQATTLLGNEVAEMFFAPCKVWPSTPAPAAESAPFRSTLPVLLLSGQL
FT                   DPVTPPRYAERVLQGLPNGRHVIAPGQGHGVFRLGCMPKVLSQFMQTADAKTLDTTCVA
FT                   SLNTVPAFTSFNGWEP"
FT   CDS_pept        378975..379835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0351"
FT                   /product="sodium ABC transporter ATP-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67106"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67106"
FT                   /protein_id="BAE67106.1"
FT                   /translation="MPRRWIPPALPASTPCPPSPRSTDGNHEPHRPRHGGARMIVVDTL
FT                   HKSFKTKAGLVKAVDGVSFGAADGQITGLLGPNGAGKTTTLRMLYTLMSPDQGSVTIDG
FT                   VDVARDPVTVRRALGVLPDARGVYKRLTARENIAYFGELHGMSRAQIAQRTALLSKALD
FT                   MDDILDRQTEGFSQGQRTKTAIARALVHDPRNVILDEPTNGLDVMTTRAMRGFLQQLRA
FT                   EGRCVIFSSHIMQEVAALCDRIVIIAKGTVVASGSADELRAATGEHNLEDAFVKAIGSD
FT                   EGLHA"
FT   CDS_pept        379832..381025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0352"
FT                   /product="ABC transporter sodium permease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67107"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67107"
FT                   /protein_id="BAE67107.1"
FT                   /translation="MSTTSLFSTLWTVLRKELRDISRDRRTLALALLLSPLLYPILILG
FT                   IGALSESRVRTQIDKPLDIPTLGRSNAPNLVRFLAAQGLNAVDAPADLTAAIRNQDVDV
FT                   ALRISDSYAEDWREGRPALVEIIKDSTRREADVPSMRLQAALSGYSQQVGALRLLARGI
FT                   DAQVSRPLEVAAQDLATAEAKRGQMMAMLLPVLLVITSFLGGASLILDATAGERERQSL
FT                   EPLLATPAPRSAIVSGKIAAACVIGMVSLLLTLLAFKLSAQLSTSNLGRQLNVGFVPML
FT                   QMLFILVPMLFVGTSLLTYLAAAAKSMKEAQAHMTWLLLLPMLPGYALMAYPLKTQLWH
FT                   FAVPFLAQNQMLLKVIRHETINVQTWAVYLLAGFGVAALLWYAAVRRYHQERLAISG"
FT   CDS_pept        complement(381435..382457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0353"
FT                   /product="TonB-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67108"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67108"
FT                   /protein_id="BAE67108.1"
FT                   /translation="MLDLTQGRMASRIAPVILLVGLAACSKQEDKAATTAPATGATPAA
FT                   LAPTPATAVSPQVQSMAADQLRASATKALQDNRMYAPAGDNAVEYYLALREKQPQDATV
FT                   NSALTDLLPYTLIAAEQSIGREEFHEAQRLIALIAQVDPQAPALPRLKSGLETSMKTAA
FT                   NHSEHDAEHDAEQAKKQVEVKAKQAAEQKRLGEQQTREAAAAQQIAAQQEAARQQTAEA
FT                   ERQAAARRQAEAPASTPAAPRPAPAAAAAAAPAAQSLRPISTPAPHYPPEALRAGTSGE
FT                   VLVELTVGTDGSITTSRVLRANPPRVFDREALIAVKHWRFEPVDAPVTTRRTLSFNPGD
FT                   "
FT   CDS_pept        complement(382597..384162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0354"
FT                   /product="tryptophan halogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67109"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67109"
FT                   /protein_id="BAE67109.1"
FT                   /translation="MPDTLPSDPQQRALRRVVIAGGGTAGWMAAAAMSKLLGRHLQITL
FT                   VESDEIGTVGVGEATIPSLVTFHRLLEIDEAAFMAATQATIKLGIAFEHWRDVDRHYIH
FT                   SFGHAGTDQWSAGFQHFWLKGQQRGVARDFGDYCLELRAAQEGRFAHLPNGGMNYAYHL
FT                   DAGLYARFLRRFSEGFGVTRIEGRIGQVETDAESGFLTALTLQDGTRVEGDLFLDCTGL
FT                   AGLLIGKTLGVGSDDWSRWLFADSALAVQTEAVGPPVTYTRSRADQAGWMWRIPLQHRV
FT                   GNGIVYSSRYMDQDSARAVLERNLTGRALTEPRPLRVTPNQRHRVWEKNCVALGLASGF
FT                   LEPLESTNIHLIQRGIIRLLQTFPQVINAVDIAEYNRQAAQEITHIRDFVILHYHATDR
FT                   RDTPFWRDCAAMDIPDSLRHRVELFRQSGRVFHQANELFAENSWVQVMLGQGIVPQQHH
FT                   PVADLMGDAELSRFLDTIHTRVEAALVRLPAHADFLQRYCPAPPPPEPAARLPAPPVMA
FT                   PPAG"
FT   CDS_pept        complement(384173..385186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0355"
FT                   /product="Pass1-related protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67110"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67110"
FT                   /protein_id="BAE67110.1"
FT                   /translation="MPAEPRVIEECHGLDPQQLDTAILRSTTPLVLRGLVRAWPLAQAG
FT                   ARSAQAAAAYLRGFDRGEAVVAQVGPPDIGGRFFYNADMSGFNFRRERVPLGVVLDTLL
FT                   RDLDNAQPPAIYVGSTTLDTYLPGLRAHNPIALPQSEPLASIWMGNRTRIPAHQDLPDN
FT                   LACVVAGRRRFTLFPPEQLANLYIGPLDLTPAGQPVSLVDIAAPDLLRFPRYAQALEHA
FT                   LVAELLPGDALFIPSMWWHHVEALESFNVLVNFWWRQSPAYMDSPMNALMLALLTIRDL
FT                   PAEQRATWQEVFRHYVFEADGTTTAHLPDAARGVLAPMDDARARSLRARLLQRLNR"
FT   CDS_pept        complement(385176..385877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0356"
FT                   /product="SapC protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67111"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67111"
FT                   /protein_id="BAE67111.1"
FT                   /translation="MTNAVLLNNLDHRDLRVITAHGAAYGDEVVSAATFPQEFRQLQAQ
FT                   YPIVFHRSGERSFQPLALLGLRLGENLFLDGARWDAPYIPLSIQRQPFLIGEQPDGPMV
FT                   HIDLDSPRISSAEGELLFREHGGTTDFLDRISQVLRTLHDGLAASDAFVERVLRYDLLE
FT                   PFVFEATLNNGLECRLAGLYVVHEERLRALDEAALLELHRHGDLEPLYMAVASIAQFRH
FT                   LLERMNRRHAR"
FT   CDS_pept        complement(386061..389075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0357"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67112"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67112"
FT                   /protein_id="BAE67112.1"
FT                   /translation="MRETRTLPRTRRLTSALLFAMSTPLAAQTAPAPQSASTVPGSSQA
FT                   DPATLDTVQVSGIRGSLTSSMNVKRDAQGIVDGIVAEDIGKFPDTNLAESLQRISGVSI
FT                   DRSLGEGSRVTVRGVGPDFNLVLLNGRQMPGASIEESNASNSRAFDFANLASESISGIE
FT                   VFKTSRASTPTGGIGATINIKTARPLDNPGMHANVGLKGVHDASNENLPGRLQGDWLTP
FT                   EISGIFSNTSADGRFGVSLSGSYQERDFGYSQVGVPNGWRAFRGDSTAYGTIPQPGAPG
FT                   SENIVNRPGPNDIYSVPQNLNDRVVGVERQRTNGQLTLQYKPLDNITATLDYTYSENKI
FT                   QQQRNEMSVWFNYGPSASSWTQGPVSGPITYSEIVNPPTSDLATAGSNAATRNQNKSLG
FT                   FNVDWAVSDQFKLNVDIHRSTAEAGADSPYGSSNSLGVSGFYRGTSVVDFSKDFPVLQQ
FT                   QLGFGLNGLDPSRTLVTGSAFRNSYMKSEIDQAQVNGDFTFENYSQLTFGIGSTEVKNR
FT                   SAFSNVQRNTWGGNGTAADYPDDLWIPSSFAQYFDAIDGSGNPQQFNQLYLFDFERVRQ
FT                   AAAHAAGDESLYRISPVFTTDRRVIEKSKNAYLQWNNSWDDLRVPISLAAGVRYEETKV
FT                   QAQALVPVAVGIDWVANNELPIRLSDSAFAGGSGKYKYWLPSLDLSFKLREDLVLRGSY
FT                   GETIGRPGWGDIQGGQTLNQIGRIEGGSGQEGNPGLKPLLSHNIDLSLEWYYGEESYAS
FT                   VGFFRKNIDNYVGVTTRNDTSLGLHTPVGGAYWNQALANGCATAELTCIRNYIFRNFSG
FT                   QPGVVRGTDDTNGNATGTISGQPGDPVANFSITAPANQRSASLDGWEFNVQHMFGQSGF
FT                   GVSANYTKVNSGLTYDNYVIGEQFALEGLSDSANLVGFYDKDKWQVRAAYNWRDEFLAA
FT                   RFDGSGLPNPVYTEAYGQLDLSIGYQWTETLSLSLEAINLTNEIQRQHGRQKNEIIYAT
FT                   QTGPRYMLGLRYTFW"
FT   CDS_pept        389222..389668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0358"
FT                   /product="ISXoo12 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67113"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67113"
FT                   /protein_id="BAE67113.1"
FT                   /translation="MSRAIKLLGMEITPAQFALIEHCLPLQRGNVSMTNLQVVNALLYV
FT                   AEHGCKWRGLPERFGNWHTVYTRINRWAKSGVLDRMFAQLQTCQIVRIKIEAVSLDSTS
FT                   IKVHPDGTGALKKTAHNPSGNRAADGTPKFIWLPQMLEQPSRSD"
FT   CDS_pept        389626..390012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0359"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67114"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67114"
FT                   /protein_id="BAE67114.1"
FT                   /translation="MVAADARTAITFGLTPGNAPDAPAGRALLEHLGPVERPVHLLMDR
FT                   AYEGNETRQLALDLGFVPVVPPKSNRVDPWEYDKEMYKRRNEVERLFRRLKGYRRIFTR
FT                   FEKLDVMFLGFLSFVLVVDGLRMC"
FT   CDS_pept        390281..390970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0360"
FT                   /product="glutathione S-transferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67115"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67115"
FT                   /protein_id="BAE67115.1"
FT                   /translation="MIDLYYWPTPNGHKVTLFLEEAGLKYTVKPVNIGKGEQFEPAFLQ
FT                   ISPNNKMPAIVDHAPVDGGGAQSVFESGAILLYLAERTGRFLPRDARGRIAALEWLFWQ
FT                   MGGLGPMSGQMGHFNVYAPEKIPYAIERYTAEVRRLHGVLDKRLADHAFLAGNDYGIAD
FT                   MASYPWIEVYGDLQPDYSAFPHLKRWHDAIAARPATQRAYALKDQVNPNAGKPLSDEER
FT                   KHLFGKR"
FT   CDS_pept        391395..393632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0361"
FT                   /product="dipeptidyl peptidase IV"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67116"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67116"
FT                   /protein_id="BAE67116.1"
FT                   /translation="MRALFAALALMLSIVPMAYAEKLTLEAITGPLPLAGPTLMKPKVA
FT                   PDGSRVTFLRGKDGDRNQLDLWEYDIASGQTRLLVDSKVVLPGIEVLSDVEKARRERQR
FT                   IAALTGIVDYQWAPDAHALLFPLGGELYLYDLRKTGAAAVRKLTHGEGFATDAKLSPKG
FT                   GFVSFVRERNVWVIDLASGNALQLTHDGSETIGNGMAEFVADEEMDRHTGYWWAPDDSA
FT                   IAFARIDESHVPVQKRPEVYADHTEVISQRYPQAGQPNVAVQLGVIAPRAKAAARWIDL
FT                   GKNPDIYLARVDWRDAQRLTFQRQSRDQKTLELIETTLASGAQRTLITETSPTWVPLSN
FT                   DLRFLKDGRFLWNSERSGYAHVYLASEDGRTLTSLTSGNWVVDGLLAVDETAGMVYFAA
FT                   SKDGPTQTHIYAVPLAGGAIEKRSVTNGTHAASFANNASVYVDTWSNTTTPPQIALFRA
FT                   SGEKIATLLKNDLSDPQHPYANYRDAQRPIAFGTLTAADGKTPLHYRLTKPDNFDPAKR
FT                   YPVIVYVYGGPAAQTVLDAWPSRGDALFDQYLAQRGYVVFSLDNRGTPRRGREFGGALY
FT                   GRQGTVEVDDQLQGVAWLKRQPWVDAKRIGVQGWSNGGYMTLMLLAKHSDAFACGVAGA
FT                   PVTDWGLYDTHYTERYMGLPAGNAAGYRDARIATHLDGLRAKLLLIHGMADDNVLFTNS
FT                   TALMSALQQRGTPFELMTYPGAKHGLSGATALHRYKTAEAFLQRCLMPVHD"
FT   CDS_pept        393802..395631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67117"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67117"
FT                   /protein_id="BAE67117.1"
FT                   /translation="MGRVALPNSRICLMKPLVLAVALALGSSLPLQAQTGKTAPTQPAR
FT                   PAWVQTSNRYAQILLNAQAPFQPEYASFFGVPGYDDQVVDLGPDNAARYRDAMRKARAT
FT                   LQTKLATERDANVRQDLQIMIGAAEQNIEGSELNERYLLPWSDAPEAVFSGLNGLLSDQ
FT                   TVPERRAKALDRLKRYVGLVPGSTPTTTLARQRYEEKLSNTALLQPTQREVEQALANVD
FT                   TYVAGIGELFAKYKIAGADDALKAMSTQLKDYAAWTRSTVLPKARKDTRLPEPLYAFQL
FT                   KQVGIDIASQQLIQRAQLEFMETRSAMRQLAPLVAKAKGVQGGDYVQVIRALKGNKIAD
FT                   DQLETHYRGVIDQIDPIIRQQRIVDVPKRPMQMRLGSAAESAAQPAPHFLPAPLIGNTG
FT                   QQGQFVLPLGNPTADGAKKEPYDDFNFGSAAWTLSAHEGRPGHELQFTAMVERGVSLAR
FT                   SMFAFNSVNVEGWALYAEAEMVPYEPLDGQLIALQFRLLRAARAMLDPMLNLGLIDSER
FT                   ARQLLEDDVGLSPAMTRQELDRYTVRAPGQAGSYFYGYTRILELRMRTELALGKKFDRL
FT                   AFNNFLLDQGLLPPDQLAKAVETQFIPAQQAKR"
FT   CDS_pept        complement(395731..396189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67118"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67118"
FT                   /protein_id="BAE67118.1"
FT                   /translation="MHKQSLIRNVAIATLLAGCASSSKVMLGQARAPIDPAQVRVYSKA
FT                   PVGSVEIAQLESTSAAGFGTQGQTDAAVQRLKREAAKLGANGVVIVGVGSQRSGGGLSV
FT                   GGGSYGGRVGGGLGIGIPTTQKRAAGVAIWVPAAAQQRPAPDVPPATR"
FT   CDS_pept        396385..396942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67119"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67119"
FT                   /protein_id="BAE67119.1"
FT                   /translation="MRLISLLWGIVALLRMVLAFIPLLGCGNWFLIPFAAVGALIAAIA
FT                   LLFTSAGNRGRAKTGLVLNGLVIVVGVLRLTLDGGIIESAFDKAAMHACVCMRWVRVSG
FT                   GGISLASAPCPTSRQQHASNSPRAVAALRHCVAARPAQDGGRKLMRCLQEPCHGPPALS
FT                   SPPHAPRCVFAPVDARKHADHR"
FT   CDS_pept        396854..397846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0365"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67120"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67120"
FT                   /protein_id="BAE67120.1"
FT                   /translation="MAHPHYRPRRMRHDAFSRRLMRENTLTTDDLIWPVFVHALSGRAP
FT                   IASMPGVERLSLEELLREAENALELGIPVMDLFPVIDPAGKSLDAAEAWNPDGLAQRAV
FT                   RALKSRFPELGVMTDVALDPYTTHGQDGIIDDKGYVLNEITVEALVKQSLSHAHAGVDI
FT                   ISPSDMMDGRIGAIRRALDADDHLNVRIMAYSAKYASAFYGPFRDAVGSAGNLGKADKT
FT                   TYQMDPANGDEALREIALDLEEGADMVMVKPGMPYLDVLRRVKEQFRVPTFAYQVSGEY
FT                   AMLKAASANGWLDERKCVLEALMAFKRAGADGVLTYFAPQVARWLRETR"
FT   CDS_pept        complement(398034..398468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67121"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67121"
FT                   /protein_id="BAE67121.1"
FT                   /translation="MTLPSAPGVGHQWAYLPDVAQCMLRLRQRRDTLPAFARLHMAGHW
FT                   DADGTQMAAAIGQAVVRHGGAQPTLRRFPWWAIPLVSPVVPLARALREVRQLWSNPLRL
FT                   RNTRLLEILGEEPHTPPDAAVEATLTGSGCLPTPLSAPAH"
FT   CDS_pept        complement(398538..399026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67122"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67122"
FT                   /protein_id="BAE67122.1"
FT                   /translation="MTQTAIALVLGASGGIGGERARQLRDAGWQVRALQRGLAATAEQR
FT                   DGIDWRRGDAMQRHDVLQATRGCTLIVHAANPPGYRRWSELVLPMLDNSIAAARAEGAT
FT                   LVLPGTVYNDGPDAYPSPDEDAPQTPTSRKGAIRVEMEQRLQAATAHDARVLIVRAGD"
FT   CDS_pept        399119..400033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0368"
FT                   /product="transcriptional regulator lysR family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67123"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67123"
FT                   /protein_id="BAE67123.1"
FT                   /translation="MADTISWERYRSFLAVLEEGSLSAASRALGLTQPTVGRHVAALEE
FT                   LLAVPLFVRSQTGLIPTDAAQALRGHARAMADIAAALQRAAGRHGDALQGTVRISASEV
FT                   VGAGILPPILATLRHVQPQLRTALVLSNRVQDLLQRQADVAVRMIRPQQDLLVARCVGE
FT                   IAFGLYAHPDDVDRHGVPQRPDELTQHALVGFDTDTPFLRGACKGFPFWEHAAFALRAD
FT                   SDLAQLALIRAGCGIGVCQAALPQRTPRLLPVVPQQVGVVLDVWVTMHQDLRASAACSA
FT                   VFAAWATGLSAHCATPEIGTGIN"
FT   CDS_pept        complement(400161..400913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0369"
FT                   /product="endonuclease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67124"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67124"
FT                   /protein_id="BAE67124.1"
FT                   /translation="MSFLLRGCVALAVLCTTSVTVAAIRCPTLYANGTPPAVGSATTRT
FT                   TEVCHTEYVLLASGVTKEPVYSAEHLTDQQVAGAEAVGRVGSFHDETGIPAADRSKSSD
FT                   YTNTGYDRGHMTPAGDASTERSEKETFSMANVVPQDHKLNIGEWAYIEKQVRQLAKQHG
FT                   ELYVVTGPAFDSGTAPTIGTDKVAVPAYVWKAIYEPGVGAGAYLCVNDSSINCDVVSIN
FT                   DLIMMTNVDPFPSLSASVKSQAIALVLP"
FT   CDS_pept        401015..403681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0370"
FT                   /product="iron-uptake factor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67125"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67125"
FT                   /protein_id="BAE67125.1"
FT                   /translation="MKQGWPFPRELNDTLRQDAISRCRVGCQTHCHLQWASVLFRVQVL
FT                   IKSLLFQLHWLLGITAGLVLSVMGLTGASMSFENEIVRMANPASAQLAQRHAAGERPLP
FT                   VDALLQRLALAPTGAGQKHAVTRLLIDPTGARPSAARLSGKGGGLVYFDPYTGERVAPP
FT                   RLSAAFAFIEDLHRNLTAGKRGQAVTGACALILLFFCASGLYLRWPRRWWSPRTWWVVE
FT                   WRRQGRSFLWSLHAVFGTWCLLVYLLVALTGLTWSYTWYRDGMLALLGAAPAIRGDNGD
FT                   NRPATIDVARVQRTLDGIPATRSAALDLRIPTRAGQPLNVRFLPDNPAHDRAYNSLDIA
FT                   PDSGALLQRQDYALLPRGQQLAVSMFPLHSGSFFGLPGRIVVMLASLGMSVFFVTGWML
FT                   YLDRRRKKRELRAARVVLQGAVPASQAAPWVIAFASQSGFAERLAWQAAAHLQAAGLPV
FT                   QVRPLAQLDAQALQRTRHALFVISTFGDGEPPDAARGFERGLLRQRLELPHLTYAVLAL
FT                   GDRQYAQFCGFSRRVEQWLDAQGARALFPAVELDNVDPQALAQWHAQLGQIAGAPVSAV
FT                   PLARPTLTEWTLSSRTHLNPGSDGAPIWRIDLQPPAEAQWQAGDILEVQPAHAEGQVQA
FT                   CLAAWGLSPDALVHVDAQLLPLQQAAAERVLPEPPATPLDHAADPQTWLDACAWLPTRD
FT                   YSLASVPADGSAMAVVRLTARADGSPGLGSGWLICHAGIGTPVRARLRTNPGFHRVETM
FT                   PMVLIGNGTGIAGLRALLREAEVAGVHGHWLLFGERHAAHDRLFADELQTWQATGHLQQ
FT                   LEWVFSRGQPQKRYVQHHLREAGDTLRHWIDRGAVVYVCGSLDSMAREVDVTLRELLGD
FT                   TRLESLTAAGRYRRDVY"
FT   CDS_pept        complement(404338..405219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67126"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67126"
FT                   /protein_id="BAE67126.1"
FT                   /translation="MHDRWTLLTLAASLLCVPSASGLAEFGIEGMGVVSTPANEARATL
FT                   SPDGQRIVWASDRAGGAGGWDLWQAQLRGGRWQNALPLPINTAQDETTPTFSADGRWLL
FT                   FASTRPGGAGGSDLYRAPVDAQGVVGAVQSVGTAINSAGNERAPTLSLDGMRLLFASDG
FT                   HGGAGGMDLFVAHWDGKAFSQPVALVDINSAADELDAAWLGDGRALVWTRGKTDGPSQL
FT                   LLATCKDGHFAQGLPLPLSFNGPQERTFGAVVDTAKPGELLVTGSAHAPRAGQLDIYRM
FT                   KAPAADGDASCR"
FT   CDS_pept        405272..406123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0372"
FT                   /product="shikimate dehydrogenase"
FT                   /note="AroE"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67127"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67127"
FT                   /db_xref="GOA:Q2P8K0"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8K0"
FT                   /protein_id="BAE67127.1"
FT                   /translation="MPVSRYAVFGHPVAHSLSPAIHADFGKQTGIVLDYTAIDAPPEDF
FT                   SAALQRFADGGGKGANVTLPLKEAACALASSLSDRARLAGAVNTLVRHEGQWQGENTDG
FT                   IGLVRDLTDRHGLDLRGRRVLLLGAGGAARGVAPALLQAGITEMVVVNRSPERADALCD
FT                   TLGEPGRVVSRYIEDLRDLGDFELIVNATAAGRDRDAGAFAMPLGLVNSLTAAVDLNYG
FT                   ATAIAFLAWARSAQCRYAIDGLGMLVEQAAESFALWHGVRPDTDPVYAALRAREAVLVS
FT                   AD"
FT   CDS_pept        406125..406511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67128"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67128"
FT                   /protein_id="BAE67128.1"
FT                   /translation="MNSPDATAILLTLVTSLLSRVPMLIAVLLGLVLLWRAPHSPLRRA
FT                   GLAALWLLLGCLFAEVAVQAIPMLLLQQGNVRQISMVVSIAHFVLMAIQAIGIGVVVWT
FT                   LAASLQRLAPANGPRPGSRSKLSR"
FT   CDS_pept        406546..406695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67129"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67129"
FT                   /protein_id="BAE67129.1"
FT                   /translation="MHAAAPQTLAAVNRGGLLYARFGPNGVGVVMLLIGIAMAAIGLVW
FT                   ARYG"
FT   CDS_pept        406688..409105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0375"
FT                   /product="putative damage-inducible protein G"
FT                   /note="DinG"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67130"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67130"
FT                   /protein_id="BAE67130.1"
FT                   /translation="MGSHRARSAADEANGSCLRIAGSEVLGRPPSRDLVDPSRWPSLAG
FT                   ADRTSEPCGMPCSVRSRYSVGRTIAQHTQTRSAAQHAGRRRCAGPCENSAMSEVAPPSA
FT                   PSAPVSTQRSLTDPIKASIRDAYARLQANTPGFATRRAQSQMIGLVSRALATSGGIGIA
FT                   EAPTGVGKSLGYLTAGVPIALATKKKLVISTGTVALQSQLVERDIPAFLKATGLEASVA
FT                   LAKGRTRYLCTRNAAELEGDTSQNAMFEDEQALYDRPLSPVDADLAKRLAKAYAARTWN
FT                   GDLDDAPEQVSVPLRMRITTPASGCAGRRCSYAAQCPVLKARTDVREAQIVVTNHALLL
FT                   SSLSLGDAENGQPLIAPPADMLLVLDEGHHIAGVAIDQGAANLPLDDMARRTGRMQILI
FT                   AAAYRAVDKDKLGNLLPNEAIEVAARVSRLLKAFHADVERVWKPEPGERDPLWRAANGK
FT                   LPPQWGPAIEELGEETRALFNWVHAAHSAIAKGKQDDSAREGLQRSLGLALEMAEQQHN
FT                   LWSGWRREDKEGQPPMARWITLSRDGDLICHCSPVSAAQVLRTMIWNEVDSVVMTSATL
FT                   TGGGDFQSFAIDNGLPDHAEMASLASPFDLPNQAELIVPNFPVTPDDREGHPKEVANYL
FT                   VRELDWTAKGSIVLFTSRWKMEKVADLMPLAQRNRVLVQGEGNKSQLITEHLRRIAAGE
FT                   GSVLFGLNSFGEGLDLPGEACTTVVITQVPFAVPTDPQTSTLSEWLESRGHNAFNLIAI
FT                   PHALRTLTQFSGRLIRSSSDHGRVIILDSRLLTRRYGKRIIDAMPPFKRVIG"
FT   CDS_pept        409379..409645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0376"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67131"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67131"
FT                   /protein_id="BAE67131.1"
FT                   /translation="MFWLLCLGSFTRHEAVNGALVPDRGLLTLAPLTAGIVSNACVAEG
FT                   ATLRAGTPILEISGEQDSTSLGDTQAWVISQLEIKGGRLNADS"
FT   CDS_pept        409695..410693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0377"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67132"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67132"
FT                   /protein_id="BAE67132.1"
FT                   /translation="MVGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRSLAETMRRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTLFTAESAC"
FT   CDS_pept        410856..411326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67133"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67133"
FT                   /protein_id="BAE67133.1"
FT                   /translation="MTAAEKGILTKVQLLQQQDIAIQNQGQLEELQKHALDLRVEHSQL
FT                   QLQLEQTPATLEAKRNDIARQIADVAQSLSETGVRRSVVLRAPTDGMVTNLLVHAGQPV
FT                   GAQQPLITLLSKDIALRAELWVPSKAVGFVTCGDRVLLRYQCLQHGGPRRVH"
FT   CDS_pept        412017..413540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0379"
FT                   /product="monofunctional catalase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67134"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67134"
FT                   /protein_id="BAE67134.1"
FT                   /translation="MRPGSLMVLALLAPTLIAPPVFAQSVLTRDNGAKVGDNQNSQTAG
FT                   PNGPTLLQDVQLIQKLQRFDRERIPERVVHARGTGVKGEFTATADVSKLTKAKVFSAGE
FT                   RTPVFVRFSSVVHGNHSPETLRDPHGFATKFYTSEGNWDLVGNNFPTFFIRDAIKFPDM
FT                   VHAFKPDPRTNLDDDSRRFDFFSHVPEATRTLTLLYSNEGTPAGYRFMDGNGVHAYKLV
FT                   NAQGEVHYVKFHWKTLQGIKNLDPKQVAAVQAKDYSHLTNDLVAAIKKGDYPKWDLYVQ
FT                   VLKPEDLAKFDFDPLDATKIWPDVPEQKVGQMVLNKNVDNFFQETEQVAMAPANLVPGI
FT                   EPSEDRLLQGRIFSYADTQLYRIGANGLSLPVNRPRVAVNNGNQDGQGNIGQTTSGVNY
FT                   EPSRLQPRPQDASARYSELPLSGTTQQAKITREQNFKQAGELYRSYSKKDRADLVQSFG
FT                   ESLADTDTESKHRMLSFLYKADPEYGSGVTRVAKGDLSRVKQLASSLQD"
FT   CDS_pept        413599..414174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0380"
FT                   /product="ankyrin-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67135"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67135"
FT                   /protein_id="BAE67135.1"
FT                   /translation="MRTLLFLMLGSLSAVANAASPASTPAANATATATPEQIKLQLRAY
FT                   FFDAAREGRQDMLAEFIRSHYDLNTRDEKGYTALILAAYHGQRPAVEQLLSAGADPCAQ
FT                   DKRGNTALMGAIFKGELGIAKRLMQAGCAPDQRNNAGQTAAMYAALFQRTDVLKDLAAK
FT                   GADLSLKDGQGNDVSKLQRGEFTTAPAR"
FT   CDS_pept        complement(414197..414877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67136"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67136"
FT                   /protein_id="BAE67136.1"
FT                   /translation="MRCDSCSIGVPGAFLNCFSALFSGNFEQVSKHSVFCQSLGAQGLV
FT                   CRKTPDAPAKKSPPAPAFQCGRGGKPTGLHEAICGVSQVRFPSCAGCSSSGRCSGVPRW
FT                   KITAKVRSHRQAQATTCRSPAWRCASRRLPGPGCPDAGSTKPPMWSRVGDALPGNGATC
FT                   RRPGGCTRVCQCCVESDKSSQAAAYMSHSGQQRPDASRAGILQHAAEYRGAWTPMTRAR
FT                   RARA"
FT   CDS_pept        414925..415119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67137"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67137"
FT                   /protein_id="BAE67137.1"
FT                   /translation="MSLLAMVLCTATAVVALVFGQVHVLAKSWSFYTVLGTALITLVAS
FT                   YHALGKPLSAEERVGVRNP"
FT   CDS_pept        415583..416587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67138"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67138"
FT                   /protein_id="BAE67138.1"
FT                   /translation="MTASADRYAASLRLSVAPMMDWTDRHCRVFHRLLAPSARLYTEMV
FT                   HANAVIHGDRARLLGFDAVEHPLALQLGGSDPALLAQAAAIAQEWGFDEINLNCGCPSD
FT                   RVQAGRFGACLMREPALVAECVAAMCTATHVPITVKCRLGVDDDDDYALFARFVDQVVA
FT                   AGAAMVVVHARNAWLKGLSPKENREVPPLRYDWAYRLNQERPGLPVVLNGGIVAVDAAM
FT                   AHLQHTDGVMLGRAAYHDPYVLHCLDAALNQRPEQPRESLLRALQPYVASQLAQGLALK
FT                   HMTRHVLGLFHGQPGGRSFRQVLSEGAHRPGAGWELVEQALQRTDTRSWRVVA"
FT   CDS_pept        416867..417226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67139"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67139"
FT                   /protein_id="BAE67139.1"
FT                   /translation="MTRLPCRARQIALVALSVAMAAPLAWGQGYPMVQSGRETLPPSAR
FT                   GNSRTLSDTIRHVQRSTGGQILGAERVPFDGGNLNRVKYMKDGRVHTVYEPEQTQAAPL
FT                   QNLPPPDAPPRDDNR"
FT   CDS_pept        417298..417981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0385"
FT                   /product="two-component system regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67140"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67140"
FT                   /protein_id="BAE67140.1"
FT                   /translation="MRILLVEDEAPLRETLAARLKREGFAVDAAQDGEEGLYMGREVPF
FT                   DVGIIDLGLPKMSGMELIKALRDEGKKFPVLILTARSSWQDKVEGLKQGADDYLVKPFH
FT                   VEELLARVNALLRRAAGWSKPTLECGPVALDLAAQTVSVNGANVDLTSYEYKVLEYLMM
FT                   HAGELVSKADLTEHIYQQDFDRDSNVLEVFIGRLRKKLDPDGELKPIETVRGRGYRFAI
FT                   PRTEG"
FT   CDS_pept        418011..419426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0386"
FT                   /product="two-component system sensor protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67141"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67141"
FT                   /protein_id="BAE67141.1"
FT                   /translation="MPGRSKWYRRWRPRSLQARQLLAASLSLVAFLALAGYALDVAFAD
FT                   TAEKNLRERLKNYASAYAANIDFVRDGSLYIGGQPPDPRFDVPGGGLYVEVVRPDESWT
FT                   SMSAEGPNIPHGRMLEPRQEEFIGPLEMTQIDGSLGQLYRYGLGVSYVEREHGGEIPYT
FT                   IYVMEDARSMGAQLRVFRGAVWFYLGSAGVVLLVLQAFILQWSLRPLRRVINELTKVQR
FT                   GEIQRMSEQHPRELEPLTDSINAFIESERDNLERQRNTLADLAHSLKTPIAVLRTQLDS
FT                   GASERDLHEEMDVQLRRMNDLVSYQLARAASSGHKLFAAPLPIEPTAEEIVRGLEKVYS
FT                   VKGVLCEFDISPEARFHGEPGDLQELLGNLLENGFKWALSRVLLTAQPGPTTGSRRAGL
FT                   ILSVEDDGPGIAPEDVAKILQRGVRGDERVQGHGIGMSIVQDLIKAYRGELQVVRSQEL
FT                   GGARFDVTMPPGL"
FT   CDS_pept        419535..421136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67142"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67142"
FT                   /protein_id="BAE67142.1"
FT                   /translation="MEGRMFERVSQAGCMETRVVRAQQWRGRRALPLLIGSVWVLNCTA
FT                   AEAPLTSTQTRWLQRATYGVDANSATQLTQLGPKRFGALLLQPSDDAALPAPVRVQLQR
FT                   FDGLHTTLVDLLTQYEADKVRLQAMPDGDEKVALKKDWQARGGQMLVQARQAQLLRAVY
FT                   APDQLREQLVWFWLNHFSVYADKARVKWMAADYMENAIRPNATGKFVDLVMATLESPAM
FT                   LEYLDNAKSAKGKVNENYARELMELHTLGVHGGYSQQDVQQLALILTGAGLVPIKANGA
FT                   PPLPAAAPGQTQVVRKGLFEFNPARHQPGDKMLLGQRIAGGGLDEIERAVQLLVRQPAC
FT                   AHFISQRLAEYFVSDTPPAALVTRMANTFQRSDGDIAQVMQTMLASPEFAQAQPRKFKD
FT                   PNRFVVSAMRVAYEDQPVINAAPMASWVQQLGEPLFGRITPDGWSLQSQAWTSSGQLAR
FT                   RFEVARSIGGGPKQLFRLDGDNDTPIPAVTRIDTRPAYRWLAPSLSAATQQALDQARSP
FT                   AEWNGFLLSSPDFNYR"
FT   CDS_pept        421256..422440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67143"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67143"
FT                   /protein_id="BAE67143.1"
FT                   /translation="MQRRQFLLASAAAASMPWAGRLFAAPRDSARMLVVFLRGGYDSNN
FT                   LLVPHDSDFYYHSRPSLAIARPDPANPNSAVALNAQWGLNPVMRDALLPFWERKQLAFV
FT                   PFAGTDDLSRSHFETQDDIESGQAGKHRDYRSGFMARLSGVLSGVSAIAFTDSLPLTFQ
FT                   GGSDLPNVSLRSIGKDGLDARQAQILSQMYDSTPLAAAARDGLALRQQVTVQLRDEMEQ
FT                   AARGAASARTFADETRRMATWMRERYRLGFVDVGGWDTHANQGSVAGGLANNLRNLGEG
FT                   LAAYADALGPAWNDTVVVVISEFGRTFRENGSKGTDHGHGTTYWVLGGGVHGGRIAGEQ
FT                   VAVEQAQLLQNRDYPVLNNYRSLFGGVLTRMWGLSPAQVERVFPGATPRDLGLV"
FT   CDS_pept        complement(422593..423228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67144"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67144"
FT                   /protein_id="BAE67144.1"
FT                   /translation="MTAQFLHQKTISPVDGLQLQPSDALMLAATCCLPLLEIGAAGWRG
FT                   WSQLMVYPDAFRVQRTHMDAAGVMHAWDDTLIGEAWEQGPLIVSWADVQADLDDPQAGF
FT                   NVIVHEMTHKLDALDGALDGSPPLPRSAQRTWARDFQHAYDLFCQRVDAGEDTEIDPYA
FT                   AEAPEEFFAVVSEYHFSAPHLLARAMPQVAAHLERFYGPSPFAASVQR"
FT   CDS_pept        424026..424991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0390"
FT                   /product="biotin acetyl-CoA-carboxylase synthetase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67145"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67145"
FT                   /protein_id="BAE67145.1"
FT                   /translation="MDDRALLAKLASGRLSGDALARDAGLTRAAVWKRIQNLRAAGVDI
FT                   EGRAGDGYRLATPLDLLDAACIRAGMAPDAAAGLAALDVAWTLESSNTTLLAQSAPEQG
FT                   VAVLLAERQTGGRGRRGRQWTSPLGAHIYLSASRRFSGGLGQLAGLSLAVGVAVAEALR
FT                   GCGFADVGLKWPNDLLARERKLGGLLIEGGGEMTGNARAVIGLGLNVHMPAAAAASIDQ
FT                   PWIDLDTLAGRPVSRDQVVAAVLSALLPALDLFEAQGLVPFLGRYADLDVLSGRAVQVE
FT                   EAGTRHRGVALGLAADGALRVRLGDTVRLFHCGEVSVRPA"
FT   CDS_pept        424988..425716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0391"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67146"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67146"
FT                   /db_xref="GOA:Q2P8I1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8I1"
FT                   /protein_id="BAE67146.1"
FT                   /translation="MSEWLFDLGNSRFKYAPLHGNRAGQVQAWAHGAEAMDAAALAALP
FT                   SGQIAHVASVAAPALTQRMIACLQERFTQVRIVRTAAECAGIRIAYADPSRFGVDRFLA
FT                   LLGARGDAPVLVAGVGTALTIDVLGADGLHHGGCIAASPTTMREALHARAVQLPASGGD
FT                   YVELAIDTDDALTSGCDGAAVALIERSLQHAQRSLGAPVRLLVHGGGAPPLLPLLPGAT
FT                   FRAALVLDGLATWATAAASP"
FT   CDS_pept        425726..426646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67147"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67147"
FT                   /protein_id="BAE67147.1"
FT                   /translation="MYVRALIVVLIVLNAGVALWWALQPPPAPPPAPPQPTGVARLELL
FT                   PTLPGVGGAALTGAAAATGSASAAESESTASATPATPASTPVSAAVPAPTPAAVVSTST
FT                   STPASTTSASAVAAETPHAAAEPSVTTKTAAKPADSVAATATKPSPTTPSPAPERCASL
FT                   GPFVARADADAALARVRGQASRASVREDKDAGVSTFRVMLPNVGDRAAAQALVKRIAAA
FT                   GMGDYYVIAQGEDNTVALGQYQSRERAERRQASLVGAGFPAQLVPSGSGQSRWWIDVRS
FT                   SAATSALQGAAGAARQRSLDCAALR"
FT   tRNA            426679..426754
FT                   /gene="XOOr06"
FT                   /product="tRNA-Thr"
FT                   /note="Found by tRNAscan-SE"
FT   CDS_pept        complement(427450..428133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0393"
FT                   /product="thymidylate kinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67148"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67148"
FT                   /db_xref="GOA:Q2P8H9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8H9"
FT                   /protein_id="BAE67148.1"
FT                   /translation="MTIELKPGGLLIAIEGIDGAGKTTLARRLTTTLEAAGARVVLSKE
FT                   PTNGPWGTKLRQSAATGRLSADEEAELLIRDRHEHVDTLIAPALARGDIVILDRYFPSM
FT                   VAYQGAAGLPLDELLELNAFAPRPDVLLLLDLPPPTGLARIRARGDAPNHFETQDNLER
FT                   CRTIFAGLELPGKHVVDASADADSVLRQAHAIIVAALADRLSGDGAPADTGKAALELLS
FT                   AGRPA"
FT   CDS_pept        complement(428613..428909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67149"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67149"
FT                   /protein_id="BAE67149.1"
FT                   /translation="MCDGALGVIVLTNARDPQTLNATLALLGEFTQIAPDASLAVGITM
FT                   TDEVEAFLVPPFRDALVAEGFRIPVMRVDARSATQITFLVKSLLSYRYTSATS"
FT   CDS_pept        complement(428916..429155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67150"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67150"
FT                   /protein_id="BAE67150.1"
FT                   /translation="MSLPANTLVFVGGMGAGKTTAVRAISDVEPVDTEMPLSQDADGDK
FT                   TYTTVALDCSLIELEDGELLHVYGVPGQKYLDFM"
FT   CDS_pept        complement(429152..429826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67151"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67151"
FT                   /protein_id="BAE67151.1"
FT                   /translation="MPNNAVNQVVKAAVGEVPRALHFENLQRIEHTVAQTIEREPGIGM
FT                   LMLSTADGRAITEQSSLDVDGRRLAALAEVIATLDRLGWHAVPDLAATALPQRLSCEAL
FT                   FFALPEHLRPALPAVEPSHALQLRQWPELSAETSSPAQLLAVAHLPARPWRPWRPQALA
FT                   SACKLPVQTVECLFAAALASGRAQTAESPVPATQRRPDSGNTRFFSWVARRFGLSLFQT
FT                   QS"
FT   CDS_pept        430148..431071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0397"
FT                   /product="arginase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67152"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67152"
FT                   /protein_id="BAE67152.1"
FT                   /translation="MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLHEALVGRGV
FT                   EVRDLGNLDGPRNPWQAPQAGYRHLDEVVAWNQALMGASYAELRAGRMPIMLGGDHCLG
FT                   IGSITAVAKYCREQGRPLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPETLTHL
FT                   GGSAPALLPEQVRQIGIRSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQDMSA
FT                   DTHLHVSFDVDFLDPSIAPGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVL
FT                   DNRNATAELAVDLVESLFGKSTLMRD"
FT   CDS_pept        431179..431331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0398"
FT                   /product="entericidin A"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67153"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67153"
FT                   /protein_id="BAE67153.1"
FT                   /translation="MKRLLTLMVLGLFSAGVMTGCNTVAGAGKDLQGAGGKVEKTAEKC
FT                   SDGKC"
FT   CDS_pept        431395..431529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0399"
FT                   /product="entericidin A"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67154"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67154"
FT                   /protein_id="BAE67154.1"
FT                   /translation="MKRAIVLLVLSMLSVGLLSGCNTVAGAGKDVKGAGEKVEDAARK"
FT   CDS_pept        431773..431982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67155"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67155"
FT                   /protein_id="BAE67155.1"
FT                   /translation="MNTDIISGKWTQLKGKAQAKWGDLTDDDFKVAEGNAQYLQGKLQE
FT                   RYGWDRDRAQTEVRAFEKSLRDDT"
FT   CDS_pept        432151..433440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0401"
FT                   /product="Tryptophanyl-tRNA synthetase"
FT                   /note="Tryptophanyl-tRNA synthetase (Tryptophan-tRNA
FT                   ligase) (TrpRS)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67156"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67156"
FT                   /protein_id="BAE67156.1"
FT                   /translation="MTTRVLTGITTSGTPHLGNYVGAIRPAIQASAGADTESFYFLADL
FT                   HSLIKAQDPARTQRSTLEIAATWLACGLDPDKVWFYRQSDVPETTELMWLLTCVAGKGI
FT                   LNRAHAYKAAVDKNCADGEDEDAGVTAGLFMYPVLMAADILIFNAHKVPVGRDQIQHIE
FT                   MARDFAQRFNHVYGREFFTLPEGVIDEQVSTLPGLDGRKMSKSYSNTIPLFAPREELRK
FT                   LVFSILTDSRAPGEAKDTQGSALFQLYQAFAAPQESAAFAQAFADGISWGDAKQQLFDR
FT                   IDQDIAPLRARYEALMAEPAKIEAMLRAGGARLRARYATPLLAELRDAVGLRDLSRQAG
FT                   AAVSAVGERIALPVFKQYRESDGQFYFKLNDGAGTLLLQSDGFASPRDAGQLIARLKQA
FT                   AQASDLQLPGVHAHMDADVILAAMHALREA"
FT   CDS_pept        433499..434515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0402"
FT                   /product="beta-lactamase related protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67157"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67157"
FT                   /protein_id="BAE67157.1"
FT                   /translation="MATCITATQCLGLHCSLYNRRGVRMTVTAEFNIHTIDTGFGGVQF
FT                   DAAYLIVQAQRGALIDCGTSLSVPQMLAAVQAAGLAPAQIEWLILTHVHLDHAGGAGTL
FT                   LQHLPNAQALVHPRGAPHLIDPTRLIAGATAVYGEAEMARSYGVIAPVPAERVVEAVDG
FT                   YTVMLGARALRTIDTPGHARHHLCVWDARSRSWFTGDTFGLSYRQLDSARGAFILPTSS
FT                   PVQFEPEAMLQSMTRLMDAAPEAMYLTHYGRVTSPAPLAQALGEQIHAMTEIALGCAQR
FT                   PDRHRCMVAALTELYLERARQHGCRLDDAAVEQLLATDIELNAQGLGFWLDRAARPS"
FT   CDS_pept        435020..436630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0403"
FT                   /product="peptidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67158"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67158"
FT                   /protein_id="BAE67158.1"
FT                   /translation="MAQAANDLPGGGINAEALSRHVRLLASDEFEGRAPASAGEQRTVD
FT                   YLVEQFKAAGLEPGGEQGGWTQAVPLVRAQVDGPVRASVRVGGKTQALVNGNDVILQSL
FT                   RPQKAVALKNAPLVFVGYGISAPERQWDDYKGVDLRGKIAVVLINDADFESPQPGAFDG
FT                   KAVTYYGRWTYKYEEAARRGAAGVLIVHETAPAAYGWATVQSSGMSPLFDIERSDADAR
FT                   AQHVPVRGWMQRALAVSLFKQAGLDFEQAKARAQQRDFAPVALGDATLSVDFKLKRERV
FT                   VTHNVVAKLTGSQHPDETVIFSAHWDAFGIGKADASGETIRRGAVDNATGVASVLELAR
FT                   VFAAGPKPQRSLYFIALTAEEKGLLGANYYAAHPLAPLDKTVAVLNMEMFSPDGLTRDI
FT                   ASWGRGRVSLEGDLEAAAKARGRSYSPDPNLEAGFFYRADHFAFARMGVPAITVGPGLD
FT                   MVNGGITAGKALRDTYFANCYHQPCDIWTPQWDASGHAADTTLVYDVGVALANGRQWPS
FT                   WQDGSEFKAIRAKSDAARK"
FT   CDS_pept        complement(437131..437550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67159"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67159"
FT                   /protein_id="BAE67159.1"
FT                   /translation="MQRRLFWLALAALSALSTTTAARTPEPWELSGSKLIDAGLDGSLA
FT                   PEITAPEQAELKVMLSANRAGAYLLGVASASYCSQWCMPVGKAGMPDLQAIIADIGALP
FT                   DARQAQAAPDLIVQALAKRYPCGSVAQHKRAASGT"
FT   CDS_pept        437676..438074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67160"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67160"
FT                   /protein_id="BAE67160.1"
FT                   /translation="MSSSHDAAAPARSGLVVLAVLLVYVVWGSTYLAIRVALESGAQPL
FT                   TMVSGIRFIVAGSVLYSVLRWRSVAAPTRAQWKNVALMGAALLLLGNGMVVSAGRSVSS
FT                   GLAATAVATVPSVHCAGSMPAAANGWAL"
FT   CDS_pept        438071..438550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67161"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67161"
FT                   /protein_id="BAE67161.1"
FT                   /translation="MIGFVGMVWFNASTRLTATPGGLVLLLIAPIGWAFGSVWSCGRDL
FT                   PSPFMTAAGQMLCGGVLLVSTGLLIGERPQAWPSPQGVLAVAYRWVFGAIVAFTAYVGL
FT                   LHHVRPALAGSYAYPVIAVSLGAWLGQERFRAQDIAAMAVILAGVLVVIFAKARR"
FT   CDS_pept        438547..439455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67162"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67162"
FT                   /protein_id="BAE67162.1"
FT                   /translation="MSTVSPQEARRGLLITASTFVLWGLVPLYWHLLKAVPSLQIIAHR
FT                   IVWSTVLVVVWLLASLGLRWWRSIAAQPRALWMLAGSSVAIAFNWGLYIWAINAGHVIE
FT                   ASLGYFINPLLSVLLGVLVLKERLRRIQWVAVVCAAVGVLWLTIVAGAPPWIALGLAVS
FT                   FGIYGLLRKLVAVDPVAGLGVESVYLFVPALLLAAWGEQGHGGAFLSGWSLRTDAMLIF
FT                   GGVVTALPLIGFAYGVRRIPLSLVGILQYIAPSLQLLLGVWFFHEPFDQGRAMGFAAIW
FT                   VGLLLFVGDSVLRSRQPVAAR"
FT   CDS_pept        complement(439535..440650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67163"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67163"
FT                   /protein_id="BAE67163.1"
FT                   /translation="MTRLLLLVCACLWLAGCSSPSTSLSERLVAPGGTSPLLDEERIAA
FT                   TIATVPNRSGHVLTRDGVPIFWRAIDPGQYAMQYRYMGQRNDPAHALDVDFSFKVPTAV
FT                   PPTPRGTVVVLHGWMMDGDSLLPWSLQLAQAGYRVVTIDLRNHGHSGGGPSGYGTRESD
FT                   DVIDVIDALQPRGEIRGPLYLFGISYGAATALFTADKLGPRVTGVVAMESFANAGRGIR
FT                   DMVPHMLSSQPHGWRGRAVAAYARWRYADQNIDAVIAAADTQLKLDLDHVDVAHALADT
FT                   RSCVLLLHGDADQHIPVTHGRALALASARAHYVELAGENHLSLPLRLDLLGGPIDQWLA
FT                   QVQEDPSHCPAPQTLPASTLAVASPLAVPQS"
FT   CDS_pept        complement(441351..441884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0409"
FT                   /product="cytochrome B561"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67164"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67164"
FT                   /protein_id="BAE67164.1"
FT                   /translation="MSRRTHFNLPARVLHWLMAAMILTMLFVGVGMVASVTQRPWLIDL
FT                   HRPLGIAILILAVLRLINRLRHRPPPLPADLPAWQKAAAIASHWLLYALMLGMPLIGWA
FT                   MLSAGGYPIVLWPGANLPAIAPHDPALYAWLRSAHGWLAYLLFATVLGHLSAALFHAWV
FT                   RRDGVFSSMALGER"
FT   CDS_pept        complement(441881..442972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0410"
FT                   /product="catalase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67165"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67165"
FT                   /protein_id="BAE67165.1"
FT                   /translation="MTLPPPSPPRARSPVLPLLGIAAIAGGVALAFAWTAGWIGSDRLT
FT                   AARMTDTIESSGPPHPGFRRAHTKGVCVSGHFQSSGKATWLSSARIFSQPSTPVLGRMS
FT                   IGGGDPHGPDGQARVRSMALLLRSDDGQQWRTAMNSFPFFVVATPAGFQALNVASKPDP
FT                   ATGKPDPEKLAAFGKQYPEAAKFQQWAKTAPWSDSWANTQYNGVNAFRAIAGDGRERYI
FT                   RWSMRPQTPFKELSAEQRKQADGDFLATDLDARLTQGPLRWDMVLTIAEPGDAVDDPSQ
FT                   PWPDSRKQIVAGTLLIERAQPQATGPCRDLNYDPLILPKGLAASNDPILAARSSVYSQS
FT                   FNRREREIADGQGSAATGQGARQ"
FT   CDS_pept        443137..443652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0411"
FT                   /product="ECF sigma factor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67166"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67166"
FT                   /protein_id="BAE67166.1"
FT                   /translation="MDALDDDQLRAMLPALRRFARSLSGDPASADDLVQATLERALRRW
FT                   RTRHTADALQPWLFAILYRQFLDGQRRVARWQRVVGLFAPQQPSQSASAEQVHDGRAML
FT                   ARLALLPPEQRALLLLVSVEGFSDRQVADTLGIPISTVISRLSRARERLRAVNEGHVNH
FT                   APASRILK"
FT   CDS_pept        443649..444401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0412"
FT                   /product="transmembrane regulator protein prtR"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67167"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67167"
FT                   /protein_id="BAE67167.1"
FT                   /translation="MTIAPPDEHALHAYVDGRLAPQQHAAVAAWLQAHPAPAARVAGWL
FT                   EARCRSATCRACRPCTGDGRHALTPAAIRRGLQQRRRAVFAVAASCVLALGLGTGLGWQ
FT                   LHASRVASQRVPMAAAVAAYRLFADAGTQQGVALDVQRRAELQPWLRTYFGNAGVVPDL
FT                   RAQGHTLRGGQLLFMLEGAAAMLVYSVPIARIGLYLRPRSGPMPTGERRDGRLLAQYWA
FT                   EGDTAFALIGPATQTRMRTIAPLLRNQG"
FT   CDS_pept        complement(444455..445825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0413"
FT                   /product="leucine aminopeptidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67168"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67168"
FT                   /protein_id="BAE67168.1"
FT                   /translation="MSHLTGFIDSNAAALPLYVLDRESFTRWCAQQPTGVLSWAQAQRF
FT                   EAAPGSVLLLPGDNGLAGAILGIGDRADAYAYAHAPMALPPASRWTLANPLSDAEQALL
FT                   HLGWGLGAYRFARYRKVPRAPAELAATPSAQTRALIEACLQVRDWVNTPTEDMGPQHLE
FT                   DATRAVGQAHGAQVDAIVGEALLAQNFPTIHTVGRASHRAPRLIELQWGDTAHPHLVLV
FT                   GKGVCFDTGGLDLKPADGMRNMKKDMGGAAHALALAGLVMAQQLPVRLTLLIAAVENAV
FT                   GPDAFRPGEVITTRAGVTVEVDNTDAEGRLVLCDALSYATEQRPDLILDFATLTGAARI
FT                   ALGPDLPALFANDDALAQAWINAGEQTRDPVWRMPLWRPYLRYLNSHVADMANAGSRMA
FT                   GAVTAALYLERFVAPGQPWAHLDVYAWNDSDRPGRPAGGEALALRSAFAMLQQRYGS"
FT   CDS_pept        complement(445866..446603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0414"
FT                   /product="hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67169"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67169"
FT                   /protein_id="BAE67169.1"
FT                   /translation="MSFHIRAITLDLDDTLWPFAPIGARIDQMLYDWMREHSPVTAERF
FT                   PVEAMRALCERSFADNPHLHHDLSALRRLTLEMALRESGGDLALLEPAYEVFYAARNQV
FT                   ECYPDVLDALARIAAHVPVAALSNGNADLQRIGLMHHFAFQLGSREHGSAKPDPSIFLA
FT                   ACGRLEVSPAHVLHVGDHVRTDVLGALDAGLRACWINREGAVWSHPTQQPDLEFDSMTG
FT                   LADWLDAQPPHPGPAHAGITLPA"
FT   CDS_pept        complement(446735..447841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0415"
FT                   /product="transport protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67170"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67170"
FT                   /protein_id="BAE67170.1"
FT                   /translation="MSLSVDSSDAATAADSLPPAPAHRPRAPASMVVLATLAVGYTLWA
FT                   AQTIILPIMLAVFFALIGNPILRGLRKLYIPRFLGALLILCLGLAGTVTLAVQLAGPAA
FT                   EWAQQAPQHMQQIAHDVRNLTKPVMQANQAAENFARAAGGEGQRGVQIVRTQMDDPYKA
FT                   LVRTPKLAASVLAVVLLTFFFMVYGESLQRHAIALLPNRQQQRFTTEIMLDIEREVSRY
FT                   VLTISVINTLVGLVFAGILYVLKIPLPEAILWGTVVGLLNFAPYVGPLIGVMLMLLMGF
FT                   VEFRTTLSSLLPAILYLALHTIEGQVVTPIVLGRRMAISPLMLILGLMLFGWLWGMVGL
FT                   LLAVPLLVCIKMVLSRVDVMQRWARLLE"
FT   CDS_pept        447945..448247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67171"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67171"
FT                   /protein_id="BAE67171.1"
FT                   /translation="MVAWRTRPRAHWCSFQGSGRHAMWRRRRRWDRSASIPLPMLTTDR
FT                   HAGVLIAELGGCLPAASMLSLFAAGRQPSASRSVCQLRADCRTLAYPGRRVGRCR"
FT   tRNA            complement(448446..448522)
FT                   /gene="XOOr07"
FT                   /product="tRNA-Arg"
FT                   /note="Found by tRNAscan-SE"
FT   CDS_pept        448977..449876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0417"
FT                   /product="hydroxybenzoate octaprenyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67172"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67172"
FT                   /db_xref="GOA:Q2P8F5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8F5"
FT                   /protein_id="BAE67172.1"
FT                   /translation="MSKHDVERLPAACGLTCPQRLGQYWQLVRGDRPIGSLLLLWPTWW
FT                   ALWLAADGLPPLWTLFVFTAGVWLTRSAGCVINDYADRWLDPHVERTKSRPLATGAVSG
FT                   REALWVFVVLMLVAFALVFTLNWLTVLLSVPGVFLAASYPYLKRHTHLPQVYLGMAFGW
FT                   GIPMAFAAVQGSVPVLGWLLYAANILWATAYDTWYAMVDRDDDIRMGSKSTAILFGRFD
FT                   LVAQGILYALMFAVLALVDLRADLGAAYWAGLGVAALLVAYEFRIARHRERGPCFRAFL
FT                   HNNWVGLAIFVGIAVAGR"
FT   CDS_pept        complement(450132..450863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0418"
FT                   /product="competence protein F"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67173"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67173"
FT                   /protein_id="BAE67173.1"
FT                   /translation="MSMGDAVNVNQVRSVYRWPQRVFRLLLPSLCLVCAEAGTADGDLC
FT                   PSCRAALPDHGHACLCCATQLFASDGVALCGQCLQEPPPLQRVHACFTYRWPVDGLLRR
FT                   FKFHQDLAAGRLLSELMARRCVELPRPQALVPVSLHRQRLRQRGYDQALELARPLGRAL
FT                   QLPCLPLLRRVRATAPQSELDAVERQRNLRDAFVARGPLPAHVALVDDVMTTGATLHAA
FT                   AKALRKAGVQRVDAWVCARVP"
FT   CDS_pept        450907..451941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0419"
FT                   /product="biotin synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67174"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67174"
FT                   /db_xref="GOA:Q2P8F3"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8F3"
FT                   /protein_id="BAE67174.1"
FT                   /translation="MSVVVRHDWDHKELQALFDLPFPELLHRAASVHRAHFDPAEVQVS
FT                   TLLSVKTGGCPEDCAYCPQAQRYDTGVTAQKLLETEEVVAKARQAKAAGASRFCMGAAW
FT                   RSPKERDIPKVAAMIREVKAMGLETCATLGMLDAGQARALKDAGLDYYNHNLDTAPDYY
FT                   DTIIHTRQYQDRLNTLEHVRDVGLKTCCGGIVGMGETRDHRIGLLLALATLPAHPDSVP
FT                   INQLVQVPGTPLHGTQQLDPFEFVRMIAVARIAMPKSMVRLSAGREAMSDELQALCFLA
FT                   GANSIFYGEKLLTTGNPDTERDQTLFQRLGLRPMQITVDAAEHDHPATVHAEITRSAAC
FT                   EHTA"
FT   CDS_pept        452033..453238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0420"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67175"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67175"
FT                   /db_xref="GOA:Q2P8F2"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8F2"
FT                   /protein_id="BAE67175.1"
FT                   /translation="MARPDLHGRISSLRKLHVAQDRVRVRRQVGRRDGVRLEIDGRWLT
FT                   GFCSNDYLGLSQQFEVIAALQDAAARDGAGATASHLICGHHTAHETLEREIAEWLGYPS
FT                   ALLFGNGFIANLAVQQALLSEEDDVCVQDRLNHASLLDATRLAGCRLRRYPHLDVEGAM
FT                   RQLKGAPEGAAMLASDAVFSMDGDVAPLRALSLVARMQDALFYVDDAHGVGVLGPQGRG
FT                   CVADAGLGVAEVPLQLVTLGKALGGYGAVVVGDDALVRHLAETARPYIYTTALPPAQVA
FT                   ATLAAVRLARRDDWRRARLVELIAAFRDGARKHGFELMASDTPIQPLLCGEEATVMAMS
FT                   AALEQAGFMVGAIRPPTVPEGKARLRVTLSALHTPQQVQALIDAIVQARDVVSRQPLRA
FT                   SA"
FT   CDS_pept        453663..454637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0421"
FT                   /product="ISXoo2 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67176"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67176"
FT                   /protein_id="BAE67176.1"
FT                   /translation="MSTSAVQPSIKKRDGRLVSRAALEEMRLMALQRMGEGESPAEVAA
FT                   SFGFHRGWAYKVLARAQEGGAGALMTRKGSGRPRTLTPAQERQVFGWVNGKNPGQHGFD
FT                   FGLWTRQVVRELIEKKFAARLSLASVGTLLARLGLSPQKPLQHAYQRDPLAVAQWEKQT
FT                   YPAIVKHAKREKAEIDFWDASGFRADAVQGRTWAVKGVTLVVAVPGQRQSISAASAVNS
FT                   KGGFWFAVYSGGLNGELFVDLLKRMMKGRRRPIHLVLDGLPAHKTRGVRDDVDSLKGRL
FT                   TLHFLPGYAPDLNPDEIGMELHQAHRRGAQPAEQWREAGRSGA"
FT   CDS_pept        454877..455638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0422"
FT                   /product="3-oxoacyl-[ACP] reductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67177"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67177"
FT                   /protein_id="BAE67177.1"
FT                   /translation="MRGSIEISMSTSIPQRRALVTGGSGDLGGAICGHLAAQGRHVIVH
FT                   ANRNLVRAREVVAAIVANGGSAQAVAFDVADAQASLAAVEALLEVGPIQIVVNNAGIHD
FT                   DAPMAGMNVEQWHRVIDVSLHGFFHVTQPLLLPMARTRWGRIVSVSSVAAVLGNRGQTN
FT                   YAAAKAALHGASKSLSREMASRGIAVNVVAPGVIASDMVGDSFAPEVIKQLVPAGRVGK
FT                   PDEVAALVAFLCSEAAGYINGQVIGVNGGMG"
FT   CDS_pept        complement(455742..456077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67178"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67178"
FT                   /protein_id="BAE67178.1"
FT                   /translation="MYRTLHALAAVATLSLAASNAAAQDIVQYTHEPLLMNGSDLVPVC
FT                   QRAAENHYLAQGASISNWTASYHDRGNGLYVDGRLRVNGNTASVHCTAARGSRERELTM
FT                   KIDETGG"
FT   CDS_pept        complement(456167..457789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0424"
FT                   /product="halogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67179"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67179"
FT                   /protein_id="BAE67179.1"
FT                   /translation="MNTQRADVVITGGGLAGLSLALQLKQRDPALAITVLERRAHPVRE
FT                   AAFKVGESTVEIGAHYFTHVLGLREHLETEQIRKFGFRFFFSDQRHDIDRCTELGVSKI
FT                   LPTPSWQIDRGRFKNFLGARARAQGIAFVDSCSVKSVELSEDDTDHAVRFERDGTPGTL
FT                   SARWVVDASGRAGLLKRKLGLTQDNDHNANAVWWRVEGLIDPNGWSQDSNWLQRCTPPD
FT                   RWRSTNHMCGPGYWFWLIPLSSGAHSLGIVCDADMHPLEGMNTHEKAMTWLRTHQPQVA
FT                   ATLDQADYRLQDFLFLRNFSYGCKQVFSPQRWALTGEAGVFLDPFYSPGSDFIAISNTY
FT                   ICELIGRDRAGKSLSPYVELYQQLYFSFYENTLTLYQDQYALFGDEQVMPVKVIWDYTY
FT                   YWSLLAPLFCSGRIANLSLLSRMKNDFLFARDMNLAMQQVLHDWGVRNTAQAIATGSGR
FT                   LLDQYLIGWFNDLNGALNDTLEDDAFVARIHGNVAQMAVLAREILHQTRQRYPDLPDHG
FT                   LDALTADANGEAILTAPWYADAA"
FT   CDS_pept        complement(457786..458607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0425"
FT                   /product="dolichyl-phosphate mannose synthase related
FT                   protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67180"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67180"
FT                   /protein_id="BAE67180.1"
FT                   /translation="MSRQPLSRDDTAILVPALNEALRIREVVTDALTYCAHVIVIDDGS
FT                   DDGTAECIAGMPVTLIRHPQRMGKGAALRSGFAEAQRLGMRAVMTMDGDGQHKASDFPR
FT                   LLAAANRHPGCVIIGARMRKRATQPTIRRIGNDFGDWGIAWGCGFRLVDSQSGQRLYPA
FT                   SVFTLPDVPGEGFVFEAQLLISAARQAGARVVAVPIETRYAGTSPGTFRKSHFRLVRDL
FT                   WHITSHVVKQVWAYGHVWREYRRVRANPVIVDDADGEFATVPAIIRSNQSP"
FT   CDS_pept        complement(458604..459377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67181"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67181"
FT                   /protein_id="BAE67181.1"
FT                   /translation="MLTATIEGIGFWTQGLPNWEAASAFVRGGALQETPTRPAPQLLAA
FT                   NERRRAPDTVAVSLEAALAACTAAGRDPASLPSIFTSTYGDLAISDYMCTTLASDPLAI
FT                   SPTKFHNSVHNAAAGYWTIGAGAMTPATAMSASLGSFAQGLLEALVQRAAGAEAVLLAS
FT                   YDARSVGPLGRVAPSQGLLGSALVLGAPGQSGRPQLHAQLEDGTPSPGDGALSRHIAGN
FT                   AMAPMLPLFDLLAGSGDSVALYAAPGRVLRVEIQR"
FT   CDS_pept        complement(459377..460576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0427"
FT                   /product="beta-ketoacyl-[ACP] synthase II"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67182"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67182"
FT                   /protein_id="BAE67182.1"
FT                   /translation="MAPVAVTAFTSTTALGAGLATQAAALTARRSGLRRNDFGPQPLLP
FT                   CWVGRVDGVEDVVLPDALQDWDCRNNRLAWLALQQDGMAQAVQAAAQRYGAERVAVIIG
FT                   TSTSSIGASEEAYTRLVDDADGARFPEDLNRPIVHTPHSLGDFVQHATGLRGPCVTVAT
FT                   ACSSSAKVFAQAARLMDARVIDAALVGGVDTLCGSVLFGFNALQVVAPEMCQPFDARRV
FT                   GLSLGEAGGFALLERPAAAPDAALWLCGYGESSDAHHMSAPHPQGLGAQLAMRGALERG
FT                   GLEPGAVGYLNLHGTATPANDSVEAAAVAAIFPGSLHASSTKAWTGHTLGAAGIVESVI
FT                   ALLALRDDVLPGTLNSEVPDPACGPQIRFDNAHARIDYAMNNSFGFGGNNCSLLFGRAR
FT                   "
FT   CDS_pept        460795..461055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67183"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67183"
FT                   /db_xref="InterPro:IPR027354"
FT                   /db_xref="InterPro:IPR038068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8E4"
FT                   /protein_id="BAE67183.1"
FT                   /translation="MHAYVYKSQRKQDTFVYLATRDDFSGLPAEVQAQLAPFSFVLEVA
FT                   LTPERRLAQADVATVREALGKHGFYLQLPKTRVLAGECDYD"
FT   CDS_pept        461048..464368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0429"
FT                   /product="ankyrin-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67184"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67184"
FT                   /protein_id="BAE67184.1"
FT                   /translation="MTEPARGARMRAAALAGAAGVVLCLLSGVGGVVAALSLWLAQPAL
FT                   ALAVSWARGTRTVPSQPRAIAQTLPPLLAIWGVGLLALAALISWPLTALRDSGSLAAAL
FT                   ALSVAVSAALLGLWRTWPLWGEVERDGGALAPRWQALATQELHAWRGLLAAVLVLAMCT
FT                   LAVVLAWPGWLSGGLRWGLAVAAAVLLPAAHLLLQRSAAPMRSAAPPARRAADFFSEAA
FT                   AEPCPLEPVAQHQLVPELFEAARSGRVDRALQLLEAGADPQALPLPEWRDQRSLPALAA
FT                   VLPDLRLLRELIVRRVDVNQPHRGMTPLLAATRDSWHGRPDAVMTLLANGADPRSSDND
FT                   GNTPLHHAVRSSDPGVAALLRDAAAELDALNNEGHSPLAMACQVGNWRLAKFLLERGAH
FT                   SEPEGGAPVLLAAAATEEDDPAGVQLLLKHKARVDARDRQRRSALHEAALAGHGDIVET
FT                   LLSAGANLEARDLLGRTPWLDAARQARSAVLERLVARKADVLAIDGDGRNALMLACAAD
FT                   NVSPALIRRLLDLQVPADSVDAHGRRAVDVAAEAGRWAIVQLLDPSYPLPAVVSDAQGD
FT                   APGVAVLPDRPPLVLLREGLQFGQRDGLVALARLCAPEELGGLLHDAHLALNAEAVDWL
FT                   LRHGADAEVRDACGDVPMFALLARGVEAVPALQALLRHGVSPAGAGGLTRLLSACVQHD
FT                   AASRGLEQFALELLERGADPFAASAADDPPLSLAVRLGWLRLQQWLLEHGVDREARDSH
FT                   GMTALHLATALGRDASLKLLVKHGASPEARAADGQTPLGVALSIGRRDLAGWLDWRIWS
FT                   LPRRTLREADVPAAAMTGDTDAVRRLIDLGLPVDALDAQGCTALLRAAGGGHLGVVTHL
FT                   LGRGADPQRAANSGATPLSAAVSMRQTEIVAALLQAGAQIEHRLPGGVTVLMLACSLGL
FT                   PDIVARLLTAAADVHATDEQGLAPLHCAALYGFSARDKNRLLALLDTLLLAGADPEHLA
FT                   GGRVSPLLLLLGARAEPGTACDEQVVLAGVERLLDEDVSLDVADQRGFGPLHLAALHGL
FT                   PLLVQRLLRAGADADRRDALNRTPREIAIMRGFIDVAGQFEPALPGVSSMARFLREGR"
FT   CDS_pept        464788..466125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67185"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67185"
FT                   /protein_id="BAE67185.1"
FT                   /translation="MSVRIEDHAMLGNCHSAALVDHRGTIDWLCLPRFDSDAVFASLLG
FT                   ADQHGQWALSPAADFRTERAYEDDSLVLCTRMITDSGTVELVDFMVASENTEVHQHLVR
FT                   LVRCVQGSVPMHMRLTFRFNYGRTVPWVTRIVDGIRAIAGPDQLALRSPQTLRGQDMGT
FT                   EADFTLREGGSTWFLLSHGASHLETPPLIDAEQALQRTTAFWHGWARRCTDVGPWTEQV
FT                   RRSLVVLKGLSYLPTGGIVAAPTAALPEHLGGTRNWDYRYCWLRDSVFTLIALLQAGYR
FT                   DEAAAFRDWVHRTIAGSPDQLQALYGIAGERRLQEWEASWLPGYEDSGPVRIGNGAVDQ
FT                   FQLDVYGELIGAFHYASEKGVGPPSDDDGSSASLLENILDTLETLWREPDEGIWEIRDE
FT                   RRHFVHSKVMAWLAFDCGARDGITNADAEKRAHWGRIADQIRAEVL"
FT   CDS_pept        466153..466587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67186"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67186"
FT                   /protein_id="BAE67186.1"
FT                   /translation="MQSYGSDRLDASLLLIPIVGFLPPDDPRIAATADAIARDLTIDGL
FT                   IERYRADDSADGLPAGEGTFLACSFWLVENYALIGRTDQARALLERLLGLCNDVGLLAE
FT                   EYDPRSKRMLGNFPQGYSHVALVNAALRLHGRMGEKETHP"
FT   CDS_pept        466584..468380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0432"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67187"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67187"
FT                   /protein_id="BAE67187.1"
FT                   /translation="MSEQATTPPCIIVVFGARGDLTKRLVMPALYNLRRAGALGEQFAI
FT                   VGMDHGDISERAWRSNMGQSMTQLLSSRDAEFQAGEFDTAPWDWLRERMHYLCGDFTDL
FT                   GAYQALGGLLDKLHKRYGTQGNVLFYLATAARFFEPVLLNLGEAGLVKQRENDGWRRVI
FT                   VEKPFGHDLPSAKHLNATVAKVLHEDQVFRIDHFLGKETVQNILAFRFANGLFEPVWNR
FT                   DRIDHVQITAAETIGVEGRGRFYDPTGCLRDMVPNHLFQLLAMIAMEPPAAFTTEAMHR
FT                   RRAEVIEAVRPIKPEDVVRGQYASGAVSRSAVPGYREEDTVPEDSETETYVAMKLQVDT
FT                   WRWAGVPFYLRTGKRLRERTTEIAIRFKPAPLAPFRSTEVGGYGPDWLVLHIQPDEGIS
FT                   LQFDVKRPGAQVALAPVRMDFRYRDWFPKEYTVGYERLLQDCMNGEAGLFQDAAMVEGA
FT                   WRIVQPILDAWKQPPSDFPNYAAGSAGPSAADALLAMNGGHAWRALTPGRKPPPRRPPE
FT                   TRAGAATPVKKAVKKAANKPSKVPAKRTTSAAAAASNVAQTAPKRVAKTGATPAKAVGK
FT                   PAAGRSGAKKSVRKSTAPKSRS"
FT   CDS_pept        468861..470180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0433"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67188"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67188"
FT                   /protein_id="BAE67188.1"
FT                   /translation="MLNRTLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPPLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQSLPARTYR
FT                   QVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTRPKQTP
FT                   VKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
FT                   KKNSVAFKMPAVSKSVRPRRSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        complement(470280..472097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0434"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67189"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67189"
FT                   /protein_id="BAE67189.1"
FT                   /translation="MHSGGLELALVLMLAAIVAVPVFKRFGLGAVLAYLVAGVVLGPDG
FT                   VGVVQDAERISGAAEIGVVMLLFVIGLELSPALLKVMRHSVFGAGATQVLVTAVILGGL
FT                   LMAARLGWKSALIVGVALALSSTAVGLQLLAERKALNSDYGRLAFAILLFQDLIAIPLL
FT                   ASIPLLGGSKNDALEWQDVAKAIAALALVIVCGRFVLRHLFNVVARTRMPEVFTASALL
FT                   VVLGTAWIMQEAGLGASLGAFIAGVLLADSEFRHELESQIEPFEGLLLGLFFISVGMGI
FT                   DLHRVVAEPWVIAAGVAILLVVKFSLLVGIGSVAKLPLRSSLMLGSVLWLGGEFAFVVF
FT                   NEADRVGLLEPANHDRLVAIVGVSMALTPLLLLGMQRILNRPLRVRVPKTDRPFDTIDA
FT                   QTPKVLVAGMGRFGQVVARLLTSRHVPFVALEHNPHTVEDLRRFGSQLYYGDPTRPELL
FT                   RAAGADRIKVFVIAVDDPESNIKTVRLIRRLYPQATVLARARNRQHAWKLMDLGAEPFR
FT                   EVFASSLELSERVLTSLGLGEALAHDHVKRFRQHDEDLLRRQHLVYDDEAKVIQTSRDA
FT                   RADLMNLFEADVKADVDGDDQTVAATREK"
FT   CDS_pept        472775..474142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0435"
FT                   /product="Mg++ transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67190"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67190"
FT                   /protein_id="BAE67190.1"
FT                   /translation="MYDETLRLAEGVDALTAPLAELNTADAVEYLNTLDRDEAAQVLAA
FT                   LAQPRAVKLLEQPELHDASALIAQLPAEQAASLLGQMADDRATDIFHGLDAEQRQPLLW
FT                   LLSAEARLSIQALMRYPPNTAGALMTTEFVAVPSDWTVGRTLQHIREVERSRETVYAIY
FT                   LLDPHTRVLQQVVTMRRLITGAPEAPILDVAQVNPPVTVDPALDQEEVARLIRRHDLLA
FT                   IPVVDRRGHVLGIVTVDDVLDALIAESTEDVHKFGGMEALDKPYMQIGFGQMIKKRAGW
FT                   LSVLFLGEMLTASAMQHFEDELSKAVVLTLFIPLIMSSGGNSGSQATSLLIRSLALREL
FT                   RLGDWWKVALRELPTGLTLGAILGVLAIVRITIWQTAGLYDYGPHWQMVALTIGAALIG
FT                   IVTFGSLSGSMLPFVLQRFGFDPASASAPFVATLVDVTGLVIYFSIAALILSGTLL"
FT   CDS_pept        474175..474828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67191"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67191"
FT                   /protein_id="BAE67191.1"
FT                   /translation="MRGRVLWGVVWTGMLLIAIAQAGRAEPAQPAACSYDRTAMLALDQ
FT                   DAFDQDLQGGWRTIADRPGCTLAAADLLRDYRQAHAITGGIVVWHEGQMRAEAGQTAQA
FT                   IALFEKSYKPAAEDLAGWNRYVDAMIAFLKRDRAGLDAARARLAVVPYPKGEGMPPLQD
FT                   GYRVLPATAGHPEIRARWPPNLDVVDGLIKCYDASYSVAYGAQRCRTSTSTLSK"
FT   CDS_pept        475115..477823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67192"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67192"
FT                   /protein_id="BAE67192.1"
FT                   /translation="MSTYHLQQVFRPGTVAVVGGSPRDRSAGRAVVRNLRAAGFPGQIG
FT                   WVSPRYSEIDGVRTVARLTDLPWVPDLVVITAPARIVPRIVSIAARRGVAAAIILTAGL
FT                   GRGPGSPAARMEAAARAKGMRILGPHCLGVIAPHARLNASIAAHCPQAGDLALISESSA
FT                   IAAALVEWGVARSVGFSAVVSLGDTLDVDFGDLLDYFATDYRTRAILLYVERIGDARKF
FT                   MSAARAAARAKPVVVVKSGRQFRINPNADTHAQALAGSDAVYGAAFARAGLLRVGALDE
FT                   LFAAAETLGRLGSFPGRRLAILSNGGGVGQLAVDQLVLRGGTLAGLSPKTLEKLDQSLP
FT                   EGWSRSNPVDIIVDADGARYAAAIESLLDDPENDALLVVNVPTAFTSSADAAKALTRAL
FT                   DQRNRYQRDKPVFAVWLGQDDAAIAALNAARVPTYATESDAVRGFTHLVRYREAQAALM
FT                   ETPPSLPEDFVVDAGIARAVVDEALTAGRRWLDPVATNRLLAAYGIPIVPLQVAATVNE
FT                   AALLADPLLAVGRTVTLKVLSSEIAHKSDVGGVRLNFSSVAAVREAATGILARARGAHP
FT                   SAVIEGLIVQPTVLRPKARELIAGIADDPVFGPAIVFGRGGTAVEVINDRELALPPLDL
FT                   RLAHELIGRTRVSRILKAYRDVPAADERAVALVLVKLAQLAADIPEITELDINPLLADR
FT                   DGVIALDARVAVAPARKLHKGRGHPRFAIFPYPKEWERQIGLGDGTHALVRPVRPEDDA
FT                   LFRAFFARVTDEDLRLRFFQSVKHFSHEFIARLTQLDYARSIALVAIAPKTGDMLGAVR
FT                   LHADADYERGEYGILIRSDLKGHGIGWQLMRIMIEYARWLGLKQIEGQVLRENRTMLAM
FT                   CQSLGFGVRPDPDDATLMAVTLPIMGEPRPA"
FT   CDS_pept        477930..478973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0438"
FT                   /product="integral membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67193"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67193"
FT                   /protein_id="BAE67193.1"
FT                   /translation="MFREFRMSLLVAAVCLGVAAWWGHTTALGLWQALWLCLVLSVLEV
FT                   SLSFDNAVVNAGVLKHMNAFWQKLFLTVGILIAVFGMRLVFPIVIVSVATGMGLVPVMQ
FT                   MALKEPERYSQVLTDNYPSIAAFGGMFLLLVFLNFLFDQERKLHWLGPVERLVGKLGKA
FT                   DAMSVIVAVSVLLGTKLFLPEGIFQSVLFAGLGGILLYLLVGSVDALFEAEESEDGGMG
FT                   PAKRSGIAAFLYLEVLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSMTVYLVHK
FT                   GTLDEFVFLEHGAHYAIGVLAIIMLVGTVHHVPEVLTGLIGVAFIAASVWSSIRYRKRH
FT                   HLGPTEI"
FT   CDS_pept        479528..482026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0439"
FT                   /product="ribonucleoside-diphosphate reductase alpha chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67194"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67194"
FT                   /protein_id="BAE67194.1"
FT                   /translation="MTTNDTLAAIAAGTATPTSVPASVAAPACGAPELTDPSDIVPPPR
FT                   QAIAMHAQTIEEQNVSTWITKEAGNRKIPFEPERLERAIDQIHAEFPQLDVADYKRSVF
FT                   GFVERKDSVNADDLVDHLIREAEARVDLTTPEWEHFAARLYLRRLYKRASRNRFYDASQ
FT                   KYGSFVGLQESLADRNVYSNDILRRYSKDELIEAGKMIEPERDKLFAYNGLYLLATRYL
FT                   ATDSSRGVFELPQERWLTIALYLMQDEIGTGKGSRERRMQLVGEAYWALSNLYMTVATP
FT                   TLANAGKVGGQLSSCFIDTVDDSLQGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIR
FT                   GVSNSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIFHRDIEAFLDLRLNNGDQRL
FT                   RAHDVFTSVCIPDLFMEAVERRGDWYLFDPHEVKRVKGWYLQDFYDEKKGDANSSFRRK
FT                   YEEVVADERITRKTVKAIEIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHEGMVYSSNL
FT                   CTEILQNMSPTRMMQEIISGNQIVTTKKAGDFVVCNLSSINLGRAITVQADQADLLGAD
FT                   VLERLIPIQVRMLDNVIDLNQLPVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNAKE
FT                   AEDYSDELYERINYLTIQASMELAKEKGTYSVFRGSDWHNGEYFRARDYNSPQWLELSA
FT                   QVAVNGVRNAWMLAVAPNMSTAQIAGSTASIDPIYSAFYYEEKKDFRRPVAAPGLSLDT
FT                   WPYYEKGAYKVDQFASVRQNARRQRHVDQSISFNFYVPSTIRASTLLDLHMTAWREGLK
FT                   TTYYVRSNDIDISECEWCSS"
FT   CDS_pept        482203..483246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0440"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67195"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67195"
FT                   /protein_id="BAE67195.1"
FT                   /translation="MSATPLERIKILEPRHPNRSTSIINGQTSGILNWNDIPYPSFYRA
FT                   YKELSTNFWIPDEVDMKGDARQYNELSAREKNAYDSIIGLLATLDSPQTRFIYNVAEYI
FT                   TDPAAHANAAIIGQQEVIHNESYSYVLASITGLADQNRVFEIARTHPTIIKRNAPIMGA
FT                   YEDFMREKTAETLIRSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDEL
FT                   AHSKFISELIRAIIGENQALQGDELTDYVHKAFEHAIDLETQWTAEVLDGIDGIDVDEM
FT                   IRYVKYRANKMAGMLGIEKLYEGANDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNS
FT                   DNGFDDL"
FT   CDS_pept        483297..484136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67196"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67196"
FT                   /protein_id="BAE67196.1"
FT                   /translation="MSKRLDPRILSSRMRLQNPYAHMEEIEECWRQGGDDQSRYRFARS
FT                   YGKPFSKKRSHSFESIEAQAKELQRAIWKKRTDLGLSQNVHPINVLDPQLAAELLGFDL
FT                   TFHSSLGEMASGRRRVSVAGLIDQSARSIKIATDADPRVMRFTAAHEIGHAILHPDQTG
FT                   LHRDQPLNEVRQVRIRTELEADKFATYFLLPEKLLTEEFKSRFLGVFALDEQTAFALLS
FT                   KPIFEVIEALPTLRDVSRRLASSTYYNGSHFVSLSESFGVSIEAMAIRLEELKLVIE"
FT   CDS_pept        484150..484644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67197"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67197"
FT                   /protein_id="BAE67197.1"
FT                   /translation="MRILLAHTSLSGNTRDVARAIHARCEELGHAVTWIDADIQTLAQA
FT                   CPNGAEHDLYILGSWSINAGRTPPEMKRFIEQLVKAVGKPERLAVFGTGETQWGEENYC
FT                   GAARRMAAFFGTRYPRLEIEQMPHGERDATKIQRWTDHILALTDTPFENIPHADAPRHH
FT                   P"
FT   CDS_pept        484616..484942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0443"
FT                   /product="thioredoxin"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67198"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67198"
FT                   /protein_id="BAE67198.1"
FT                   /translation="MQTLHATTPDDYAAALAAHPRLLVDYYKDNCPGCKMLDMSLTKFA
FT                   ASEDAAGVALLKVKLEVVGEEFFRDLGLRQTPTLALFKDGAEVVRLPGFQSPAQVEAAV
FT                   RSGL"
FT   CDS_pept        485156..485419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0444"
FT                   /product="ISXoo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67199"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67199"
FT                   /protein_id="BAE67199.1"
FT                   /translation="MKKRFSEEQIIGFLREAEAGMPIKDLCRRHGFSEASYYLWRSKFG
FT                   GMSVPDAKRLKDLEAENTRLKKLLAEQVFQNDLIKDALQKQW"
FT   CDS_pept        485443..486258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0445"
FT                   /product="ISXoo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67200"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67200"
FT                   /protein_id="BAE67200.1"
FT                   /translation="MREWIAGGASERCALAAIGMSASALRYRPREDRNVELCERILALA
FT                   HRHRRYGVGMISLKLRQEGRLVNYKRVERLYCEQQLQVRRRTRKKVPVGERAPLLRPTK
FT                   ANPVWSMDVVFDRTAEGRAIKSLVIVDDATHQAVVIDVERAISGHGVARVLDRLAHSRG
FT                   LPKVIRTDNGKEFCGKAMVAWAHANRVQLRQIQPGKPNQNAYVESFNGRLRDECLNEHW
FT                   FPTLLHARTEIERWRREYNQHRPKKAIGAMTPATYAQQLANSEIITPGL"
FT   CDS_pept        complement(486422..486730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0446"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67201"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67201"
FT                   /protein_id="BAE67201.1"
FT                   /translation="MRACSARKTSSSVAPGGVVCARSAANRIGQPVAALTCSRVVPGCS
FT                   DVTVSSRVTGSGSITHRSVTTTVGPAPGKPARTRASPPYRCPTVVMKSSVGTKLRVD"
FT   CDS_pept        486770..487978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0447"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67202"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67202"
FT                   /protein_id="BAE67202.1"
FT                   /translation="MSDVYLIDGIRTPIGRYGGALSSVRADDLGAVPIAALLVRHPQME
FT                   PAAIDDVYLGCANQAGEDNRNVARMSLLLAGVPSSVPGSTLNRLCGSGLDAVGTVARGI
FT                   RAGELDLAIAGGVESMSRAPWVMGKADSAFARNQQLEDTTMGWRFINPRLQAAYGTELM
FT                   GETAENLAQLHAIAREDQDAFALRSQQRVAAAQAAGFFDGEITSVAVAGRKGGDASTVE
FT                   YDEAPRPNTTAEMLAKLKPVFRQPGTVTAGNASGLNDGAAALLLASAQAVQAHRLTPRA
FT                   RVLGFASAGVEPAYMGIGPVPATQRLLARLHLRIAQFDAIELNEAFAAQALACTRAFGL
FT                   ADDAAHVNANGGAIALGHPLGMSGARLALTLLRQLEASNGRLGLASMCIGVGQGVALAI
FT                   ERL"
FT   CDS_pept        488057..488785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0448"
FT                   /product="protocatechuate 3,4-dioxygenase beta chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67203"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67203"
FT                   /protein_id="BAE67203.1"
FT                   /translation="MRDPTSDEAAIAADPLLGYRRSRPGAQPPYLHPAYASTRLRGPTR
FT                   DPIDLPVTLLEVTGPRLDRLTLGEHAADLTAGSSGAPLGERIIVSGRVLDENGRPVRNS
FT                   VVEVWQCNAAGRYQHAGDQHDAPLDPNFRGTGQVLTDEHGRYRFKTIKPGAYPWRNAWR
FT                   PAHIHFSLHGDGIGQRLVTQMYFPGDPLLAHDPIFNCVDDALARERMVSRFDWENAVSE
FT                   YALAYRFDIVLRGRKQTVWQ"
FT   CDS_pept        488790..489353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0449"
FT                   /product="protocatechuate 3,4-dioxygenase alpha chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67204"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67204"
FT                   /protein_id="BAE67204.1"
FT                   /translation="MSLHATPSQTVGPYYRLGLEPLYRQQIAPAQAAGTHVQISGCIFD
FT                   GAGAPVADAVLEVWQADAAGIYAHAADARYEAHDPSFDGCGRVPTDGHGRFSFSTIKPG
FT                   RVAGPQGKRQAAHLTVLVFMRGLLRGASTRLYFADAPQLGSDPILALVPAERRATLLAQ
FT                   PGAGGVYIWDIPMQGDAETVFFRY"
FT   CDS_pept        489384..489677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0450"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67205"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67205"
FT                   /protein_id="BAE67205.1"
FT                   /translation="MPERCAVLSARSCVKSRRRQLRRSPHLQRHHGVGCGRWAVARHAH
FT                   ASMTARILANTRMCLERLTNRLRSPPGGRGRCLESAWTTRPLRFLSAPSAPT"
FT   CDS_pept        489854..491146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0451"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67206"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67206"
FT                   /protein_id="BAE67206.1"
FT                   /translation="MSATSSLLGSLFGEPACDALFDDAARVQAMLQFESALARAQAQCG
FT                   VIPTEAAQAIAAACDVRHHDLAALAQATALAGNPAIPLVKALTAQVAAHDSAAARWVHW
FT                   GATSQDVLDTGTVLQLRAALDLLLPRLHALCAGLATLAERERDTGLPGRTLLQQAVPVT
FT                   FGLKVAAWLDALQRAHQRLQAMEHDALVLHFGGAAGTLASLQERGLEVAQALASTLELP
FT                   LPALPWHTARDRIVEVGCAFGLLAGTLGKIGGDVVLLMQSEVGEAFEPAAAGKGGLSAM
FT                   PHKRNPVSSVAAVAAATRVPGLVATLFSAMAQPHERAAGQWHAEWDTLPQIVCLTAGSL
FT                   AQMQQCLSGLELDRARMRIHLDSHGRLLYAEAAVFALAPQLGKPQAHALVQQAALRAQA
FT                   QQRHLREVLGEDAQVSAVLTHAQLQAVFDSR"
FT   CDS_pept        491218..492000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0452"
FT                   /product="b-ketoadipate enol-lactone hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67207"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67207"
FT                   /protein_id="BAE67207.1"
FT                   /translation="MAYLRLPTHRLHYRLDGTEGRPWLTFCNSLGTDLHLWDVQIEAFA
FT                   PHYRILRYDRRGHGDSETPPGPYSVADLGQDVLALWDALEIAQSDFCGLSIGGLTGQWL
FT                   GLHVPHRLRRLVVCATAKKIGSAATWESRIEQVRSEGLPVLIDATLQRWFTPEFAISHA
FT                   QRLDMIAAAFVSTSPAGYIACCQALADADFRGALDGLSVPLLALAGDDDPVCPPSDLRE
FT                   IAYAAPDGHYAQVPGRHICNLESPAAFNDAVLGFLQAD"
FT   CDS_pept        492026..492439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0453"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67208"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67208"
FT                   /protein_id="BAE67208.1"
FT                   /translation="MHEDERYQAGMRERRRLLGDAHVDRALAARSDFTEEFQDLITRYA
FT                   WGSIWTRDGLPAHTRSLLTLAMMVALGHDEEFKLHVRAARNNGVTPAQIKEVLLQAAIH
FT                   CGVPAANHAFALARPILEEQAAEAGAAPAASPG"
FT   CDS_pept        492710..493549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0454"
FT                   /product="hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67209"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67209"
FT                   /protein_id="BAE67209.1"
FT                   /translation="MSQVRADDGQMLAVWSRVPAKPRGTIVLVHGRTWSALPNFDLQVP
FT                   GEPGDTRSVLAALAQAGYAAYAVDLRGYGGSARERTGWNTPTRAVADVRNVLAWVAQTH
FT                   PGLPPPALLGYSNGARVALLLAQQQPQAMSAFVLFGFPDDVDAPPAPAVAADRPLRAPT
FT                   TAAAAGEDFITANAAPPAVRAAYVAQALASDPVRTDWRAMEQFAFRPEQVATLPVLLLR
FT                   GVDDPIATQADSAHPYARLRSEDRSWVTLPHADHVAQVEDSHAAWVDAVVSFLRRPR"
FT   CDS_pept        complement(493897..494568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0455"
FT                   /product="transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67210"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67210"
FT                   /protein_id="BAE67210.1"
FT                   /translation="MSQISLETGISRAAVRRVLHTLAKLGYVGEQGRGYVLPPRVLGIG
FT                   GAYAASSSMTAAAQPVLDGLRDQLHESCSLGVLDGDDLLYVARSETVRIMSIGLRPGTR
FT                   LPAYCTSMGRVLLAALPADTLQAYLERTTLRPPTDRTVTQAAALLEVLARTRRGGMCLT
FT                   DQELEIGLRSIAVPVRNLRGEVIAALNVGAQAGRVSLQTMQTQLLEPLKQAAQRLGTLL
FT                   S"
FT   CDS_pept        494906..495766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67211"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67211"
FT                   /protein_id="BAE67211.1"
FT                   /translation="MKTPNGLQPLIDDGVIDDVLRPLKSGKEASVYVVSAGAEILCAKV
FT                   YKDMAQRSFQARVQYQEGRKVRGSRQARAMGKATKFGRKEAETAWKNTEADALYQLVDA
FT                   GVHVPTPRGYFHGVLLMDLVTDEAGHSAPRLGEVELEPEQARVFHASLIGDVVKMLSLG
FT                   LVHGDLSEYNVLVSPEGPVVIDFPQVVSAAGNNAARDMLLRDVHNLRDCLGRFAPDLLE
FT                   THYGEEMWALFEKGALRPDSVLTGRFKFDTRRADVRAIRASIEDARQENLIRQQGRKAA
FT                   AEDED"
FT   CDS_pept        496008..496475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0457"
FT                   /product="IS1112 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67212"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67212"
FT                   /protein_id="BAE67212.1"
FT                   /translation="MSSSRLNLSERYRLHALYETGMSMRVIADAVARAPSTISRELRRN
FT                   RHAAKYRPDHAQRISAHRRTQASRRPRIDAERIGQSEVLLREDVSLEQIAGRTGLASHA
FT                   WIYRHIDADQKRGGRLFMHLRKRRRNRRRRGVRDGRGQLTHPTCSSYPHRR"
FT   CDS_pept        complement(496734..497489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0458"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67213"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67213"
FT                   /protein_id="BAE67213.1"
FT                   /translation="MSKTVLITGATSGFGSAAVRRFAAGGWKVIATGRRAERLQALAAE
FT                   LPAGQVHTAAFDMRDAHALSAAIDALPAAFADIDVLVNNAGLALGTAPAQQADLAQWQQ
FT                   MIDTNVTALVTLTHRLLPALIARRGAIINIASVAATYPYTGGNVYGGTKAFVQQFSLGL
FT                   RADLHGTGVRVTSIEPGMAETEFTLVRTGGNQAASDTLYRGATPMTADDIAEQIFYVAS
FT                   LPAHLNINRLEIMPVTQSFAGFQVARDAQ"
FT   CDS_pept        complement(497584..498048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67214"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67214"
FT                   /protein_id="BAE67214.1"
FT                   /translation="MIQRIAGVLLSVLAWAGPAHATNQLPDLIQIDGQQATLLAEPLSG
FT                   PLDDPATWKRFVAHAGSALGSCSANWRGYRADWRLDGQRLLLDRGVLGACNAAPPTLPM
FT                   DVLFPGQASPVPAVWVDGELIVELPATATTAAPAPATYVLLRLRRGRARP"
FT   CDS_pept        complement(498055..498936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67215"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67215"
FT                   /protein_id="BAE67215.1"
FT                   /translation="MAARRGKSQARRNTSNGTPGWVWLVAGVAIAAVVFLAAPNLFKKD
FT                   GDGFLRVGPRANPDAQPEPVADADVDTPAELPKPSAQQPKPQAKPGAAQTQYDFYTLLP
FT                   GKEVQMSDAELAASARAEEAARARAALEGKPVAPAPGASVAAATPAASGPMPLKETGAS
FT                   APKPLPETVTARPAATPATASTAALTTPTAAAPKPTATAAAATATTAAPAVADNTRYIL
FT                   QAGSFGASGDAESTKAKLAMMGLAARVESADISGKTVYRVRMGPYGSASELAEAKQKLT
FT                   GSGLSAIAIKAQ"
FT   CDS_pept        complement(499116..500804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0461"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67216"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67216"
FT                   /db_xref="GOA:Q2P8B1"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8B1"
FT                   /protein_id="BAE67216.1"
FT                   /translation="MKALLRALIGQGIEALRANGTLPGDTLPPDFVVERPKTREHGDFA
FT                   TNAAMLLAKAARSNPRALAQALLTALPDSNDVTKVEIAGPGFINFHLAPTAYQREVAHV
FT                   IKQGHDYGRGLAGNGRSVGVEYVSANPTGPLHVGHGRAAAIGDSLARVLDANGWNVKRE
FT                   FYYNDAGVQIENLALSVQARAQGLTPDSAGWPENGYRGDYIADVANAYLAGDTVDMEGH
FT                   LVTGTKDPADLESIRRFAVAYLRNEQNHDLAAFRVDFDIYFLESSLYKDGKVEEAVQKL
FT                   IASGHTYEEGGALWLKSTDFGDDKDRVMRKSDGTYTYFVPDVAYHLTKWQRGYERAITE
FT                   LGADHHGSLTRVRAGLQAMELGIPQGWPEYVLHQMVTVMRDGEEVKLGKRAGGYVTLRD
FT                   LIEETSADAVRWFLIARKPDSQLTFDIDLARAQSNDNPVFYVQYAHARVCSVLRQAQEK
FT                   GYKYDQVHGLAELARLDDEHSLAVMLELSRYPEVVEIAGQTLEPYQIAQYLRELAHAFH
FT                   TWYHNSKVLVDDAAERDAKLTLAVATQQVLANGLELLGVSAPEKM"
FT   CDS_pept        complement(500892..501569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0462"
FT                   /product="DNA repair protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67217"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67217"
FT                   /db_xref="GOA:Q2P8B0"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8B0"
FT                   /protein_id="BAE67217.1"
FT                   /translation="MHIHDWPTNERPREKLLARGATALSDAELLAIFVGSGLRGQDAVQ
FT                   TARDLLHRHGPLRPLLDRPAKALERLPGLGPASACKLAAALELAHRHLMSALERGEALS
FT                   DPPSVGRYFSQRLRARAYEVFAVLFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALL
FT                   HNAAAVIVGHNHPSGNPEPSEADRAVTKRLLDSLELVDIRLLDHFVIGDGRPVSLAERG
FT                   WLE"
FT   CDS_pept        501666..502940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0463"
FT                   /product="DNA-pantothenate metabolism flavoprotein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67218"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67218"
FT                   /protein_id="BAE67218.1"
FT                   /translation="MIGSTQARPLDGQRLLLCVGGGIAAYKSLELVRRLRDAGAQVQVA
FT                   MTSGAQQFVTPLSFQALSGQPTRTTLWDSAAEQAMGHIELARWAERVIVAPATADLLAR
FT                   LAHGLADDLVTTLCLATTAPLTVAPAMNHRMWLHPATQANIATLRTRGVKVVGPDDGPL
FT                   AEGESGPGRLAEPAAIIAALVDGIAVASAAPAGAKSTAAPMFVSSSAQLDGLRIVISAG
FT                   PTFEDLDPVRYVGNRSSGKMGYALAAAAARQGADVVLVSGPVHQTTPAGVQRIDVRSAA
FT                   QMRDAVLGAFPADIYIGAAAVADYTPKRVVSQKIKKTGETLTLELVRTPDILAEVAAQT
FT                   GALKLVVGFAAETHDVEHYARGKLAAKRLDLIIANQVGIEGGGFESDNNAATAYWPGGE
FT                   RAFPSSSKTELADQLLALIAERLQA"
FT   CDS_pept        502937..503404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0464"
FT                   /product="dUTPase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67219"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67219"
FT                   /db_xref="GOA:Q2P8A8"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P8A8"
FT                   /protein_id="BAE67219.1"
FT                   /translation="MSTPTQSLQVKLLDPRFGDLWPLPAYATESSAGMDLRAALEAPMT
FT                   LQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRHGIVLGNGTGLIDADYQGPLLIST
FT                   WNRGREAFTIEPGDRIAQLVILPIVRAGLQVVDTFVDSARGAGGFGHTGVR"
FT   CDS_pept        504363..505766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0465"
FT                   /product="phosphomannomutase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67220"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67220"
FT                   /protein_id="BAE67220.1"
FT                   /translation="MPAVQIATEMFRAYDIRGVVGKDLNPGVAALIGQAIGSVMQAQGL
FT                   RHVVVGRDGRLSGPELTNGLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTG
FT                   SHNPPDYNGFKIVIGGETLSGTTIAELHQRINEGRLHTAATPGELEQRDISDAYIQRIA
FT                   DDVQLDRPIKVVVDAGNGVAGEIAPRLLEAIGAKVVPLYCDIDGTFPNHHPDPSEPHNL
FT                   DDLVRMVQRFDADIGVAFDGDADRLGVVTKEGTVVFPDRLLMLFAADVLQRNPGALVIY
FT                   DVKCTGKLSDYVLRNGGSPLMWKTGHSLIKSKMRETDAELAGEMSGHFFFKERWYGFDD
FT                   GIYAAARLLEILAQSEQTPSEVLDALPESVSTPEIKVPVEGDVHALVARFVERAQTGGE
FT                   SPFESARLSTIDGLRADFVDGWGLIRASNTTPILVLRFEADSEAALQRIRTLFREELQA
FT                   LVPAHPLAF"
FT   CDS_pept        complement(505874..506377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67221"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67221"
FT                   /protein_id="BAE67221.1"
FT                   /translation="MPTLEAAYWHLRLLTHENVPLFADWRCARAAAASLASPRHWQGAQ
FT                   LLCWVLLPDAWCGLLQAPSKAVLLQVAATARRIAAGAVNRARGRGGTVWQPQMEVSALP
FT                   LQGDHRQFARTLVALPLRAGLAEQIGGYPYWDAVWLLPEDHHAVPIHAPHGPAERTGTR
FT                   RTRW"
FT   CDS_pept        complement(506840..507181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67222"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67222"
FT                   /protein_id="BAE67222.1"
FT                   /translation="MDPSFLDQPLTWLYWTGIHVTGWKLIGYVGALMFGGRWLVQFVAS
FT                   KRAGKPVIPRLFWYMSVVGSLMTLSYFVFSAKQDSVGVLQNLFPAFTAFYSLYLDVKHR
FT                   GWKRDRAGH"
FT   CDS_pept        complement(507181..507903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0468"
FT                   /product="dolichol-phosphate mannosyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67223"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67223"
FT                   /protein_id="BAE67223.1"
FT                   /translation="MSQPQLSVVVPVFNERDNVATLVGEIVSALRSVVAFEIVYVDDHS
FT                   RDDTLAVLQGLKRTTPELRVLHHVTQSGQSTAVRSGVKAARASWIATLDGDGQNDPADI
FT                   PKLLIARSQAEPQVKLFAGWRVNRQDSGSKRWASKWANAIRSRMLRDNTPDTGCGIKLF
FT                   EREAFLDLPYFDHMHRYLPALMQRAGWRTVSVPVNHRHRTAGVSKYNNLNRALVGIRDL
FT                   RGVAWLITRSKRTVVQER"
FT   CDS_pept        complement(508258..509223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0469"
FT                   /product="nucleotide sugar epimerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67224"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67224"
FT                   /protein_id="BAE67224.1"
FT                   /translation="MTILVTGAAGFIGAYTCRALAARSEAVVGLDNYNRYYDPQLKHDR
FT                   VAALCPGVDIRTLDLTDRDGLAALFDEIQPTRVVHLAAQAGVRYSLENPSAYVDSNLVG
FT                   FVNMLELCRHRGVQHLVYASSSSVYGDSATPPFSEDQRVDQPRSLYAATKAANELMGYT
FT                   YAQLYGLRATGLRFFTVYGPWGRPDMAPLIFSRAVLAGRPIEVFNHGKMQRDFTFIEDI
FT                   VAGVLGALDTPSSEPVPHRVFNLGNHTPVELEYFIDVIAQAAGRPAEKVYRPMQPGDMI
FT                   RTMADTQRAQAAFGFDPATPVERGLPQVVNWCRQYFGKRA"
FT   CDS_pept        complement(509428..509736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0470"
FT                   /product="mitomycin resistance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67225"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67225"
FT                   /protein_id="BAE67225.1"
FT                   /translation="MNPAKVDRQHLLQLTDLPNVGPACEKDLHLIGIRVPAQLRGRDAY
FT                   DMHAQLCLRTGVLHAPCVIDVFLSILRFMDGEAAQPWWKFSAERKAKLASEAPLALR"
FT   CDS_pept        complement(509772..510701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0471"
FT                   /product="chromosome partitioning protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67226"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67226"
FT                   /protein_id="BAE67226.1"
FT                   /translation="MNKPMPAKKRGLGRGLEALLGPKGAAAAAAPSAASEDALQPGDSL
FT                   RQLPVTQLQPGKYQPRREMDEVKLSELAESIKAQGVIQPIVARALAPGQFEIVAGERRW
FT                   RASQLAGLTEVPVVVRELDDRTVIAMALIENIQREDLNPLEEAQALQRLIDEFSLTHAE
FT                   AAGAVGRSRASVSNLLRLLELPVAIRVLLETRRLEMGHARALLTLAPELASKLAQEAAD
FT                   QGWSVREVEHRAQQFAAGKVPSALRKGKPAPVAPQADIASLETELSESLGTKVVFNHGR
FT                   GGKGKLVIHYTDLDTLDGVLERLRMQRS"
FT   CDS_pept        complement(510701..511498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0472"
FT                   /product="chromosome partitioning protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67227"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67227"
FT                   /protein_id="BAE67227.1"
FT                   /translation="MARIIAIANQKGGVGKTTTAVNLAAGLARVPKRVLLVDLDSQGNA
FT                   TMGSGIDKRDVAASTCDLLLGENTAAQIRVTAPEGFDLLPGNIDLTAAEIQLMHQGERE
FT                   QRLKRALTPIRDEYDFILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLET
FT                   IEALRGNLNPALEIEGVLRTMFDIRNNLANAVSAELTAHFGDKVFRTIVPRNVRLAEAP
FT                   SHGQSIVGYDRTSRGGVAYLGLAGEIVRRQNDHNKAVRPVETV"
FT   CDS_pept        complement(511612..512292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67228"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67228"
FT                   /protein_id="BAE67228.1"
FT                   /translation="MMPIHTRLALLAAVSAAVAAPFAVAPPASARDKAADRKLYCWNQN
FT                   GARVCSDTLPPEAVNQARDEFNVKSGMRSAEVQRTMSSDERAAAAASEQQRQADLAAEQ
FT                   MRQRTDQAMLMSYQSEDDLRRVFNERIAIVDNNIHTARFNVTSLREGLASLLRSAGDRE
FT                   LAGQAVADKLAANIQQRHRDLMEQLRLQISFEQQRVALDGEIADILQRYRAMKEPPGGA
FT                   SPTG"
FT   CDS_pept        complement(512315..512974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0474"
FT                   /product="orotate phosphoribosyl transferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67229"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67229"
FT                   /db_xref="GOA:Q2P898"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P898"
FT                   /protein_id="BAE67229.1"
FT                   /translation="MTDHRTRFLQLALGADALRFGQFTLKSGRLSPYFFNAGRFDSGTK
FT                   TAQLAQCYADAIDAAGVDFDLLFGPAYKGIPLATALACAYAGRGRDLPLAFNRKEAKDH
FT                   GEGGTLIGAPLAGHKVLIVDDVITAGTAIREALGIIRAAGGVPSGIVVALDRQEIASEQ
FT                   DRRSAAQAVATEAGIPVIAVANLSDLLAFAAENADLVDFREPLLAYRGRYGTDTTG"
FT   CDS_pept        513102..513902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0475"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67230"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67230"
FT                   /protein_id="BAE67230.1"
FT                   /translation="MRIISFNANGLRSAASKGFFAWFAAQDADVLCVQETKAQEHQLAG
FT                   PDFLPTGYKAWFRDASTKKGYSGVAIYSRHEPDEVRTALGWPEFDEEGRYIEARFGNRS
FT                   VVSFYIPSGSSGELRQGYKFQVMQWLRPILDEWLASGRQYVLCGDWNIVRTALDIKNWK
FT                   SNQKNSGCLPPERDWLNGLCADVPEDANAAEGRGWVDSYRVLHPQGQDYTWWSNRGAAR
FT                   TNNVGWRIDYQLVTPGLRDTLRACSIYREERFSDHAPYIVDYAQ"
FT   CDS_pept        514297..515517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0476"
FT                   /product="signal transducer"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67231"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67231"
FT                   /protein_id="BAE67231.1"
FT                   /translation="MALLGFGSGLPFLLIASQTLSVRLRDVGLDLQDIGFISLASFFYL
FT                   LKFLWAPLIDRYAFPLTAFLGRRRSWLLVAQIGVTIGLLALAFSRPDLSVIGLVGWVLF
FT                   ASFWGATQDSVVDAYRIEVAPDSAQAALAATYTLGYRIGLILGGAGALYMAEYLGWTWA
FT                   YVGMAALMLVPIVTTLLCREPDRAEATVVRRVDVSGAFWQPISSFFSSNGLALGIALLL
FT                   FVGLYRFPDQVIGVMAGPFYLDSGFTKADIATVSKLFGVWIGIVGAFAGGAAIAAFGFR
FT                   RMLLVAALGVALSNLAFLLMAHNPGKLWAFYAALSADNLFQGFAASVLVAFMSSLTDRN
FT                   FTATQYALLASLANLPGKLAGGVSGSVINATSYSTFFILSALTVIPTLMLLAWLWPRLL
FT                   AHDRRPD"
FT   CDS_pept        515576..515803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67232"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67232"
FT                   /protein_id="BAE67232.1"
FT                   /translation="MTDLVLRDIDPVLVDRIRRISVARGWTQHKTVVHLLEQGLFSSEY
FT                   EVTGGLQHPEVDALAEAIAALKALPAGHNP"
FT   CDS_pept        complement(515841..516974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67233"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67233"
FT                   /db_xref="GOA:Q2P894"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P894"
FT                   /protein_id="BAE67233.1"
FT                   /translation="MPVLEHVDSLLYLGLMSGTSADGIDAALVRFAEDTHRRCELVAGT
FT                   TVAWEPQLRETLVALGQGAETVAIDALGQLDAQVGLAFAAAANQLIRDSGVERRRIRAI
FT                   GSHGQTIRHRPEADPAFTWQIGDASRIAEHTGITTVADFRRRDVAAGGQGAPLMPAFHL
FT                   AMLGAGDQDSAVLNLGGIGNLTLIPRDGAVLGFDTGPANALLDSWCQRHHGTPFDAEGA
FT                   FAASGRVDAALLQALLADPWFALPPPKSTGREQFHLDWVLQAMGSARLDAADVQATLLE
FT                   LTAASVADALLRLQPSTRRVLVCGGGVRNPVLLARLAARLPGVVVESSARYGLDPDYLE
FT                   AMGFAWLAAELLAGRAANLPSVTGAAGPRLLGAIYPA"
FT   CDS_pept        complement(517345..518763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67234"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67234"
FT                   /protein_id="BAE67234.1"
FT                   /translation="MQHSEQGRARKRRFQERLHVLHHTALHRKLKAHLPAAFNDRWTRR
FT                   HWIHASLFATIGALVATIVPGFSNAIDKPLSSHSTLALPLPPLVPSRKQLAPSTDWEIL
FT                   QVKPGQTLSTLFGELGIPTTLMYQVLAHPGTKEALTKLRPGAEIAFDMPTPGQLRALRF
FT                   DRDESHRVELRLLGDSVRENVTERATTTRTVVASGEINSSLYASAGKSGLSPAAVAIMT
FT                   DEIFKYDIDFDKDLQPGDRFSVVMDETWREGERISTGDILAATFTTGGKTYTGFRFERA
FT                   GKPAEYYDISGRPLKKSFIRMPVAYSRISSTFGARMHPVLGTMRMHKGVDYAAASGTPI
FT                   MAAGDARVVFVGTQRGYGNVVILDHGKNYSTLYGHMSRFGKIKVGQHINQGTVIGYVGM
FT                   TGMATGPHLHYEFRVDGQQRNPMSVTMPPPEPLQGAELAAFRAQTAPALARIEGMEKLI
FT                   YADAGKPAKGKSGG"
FT   CDS_pept        518935..520146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0480"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67235"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67235"
FT                   /db_xref="GOA:Q2P892"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P892"
FT                   /protein_id="BAE67235.1"
FT                   /translation="MTTLDESLALIGRGAEEILKLDQLEARLTSGVPLRVKAGFDPTAP
FT                   DLHLGHTVLLNKMRQFQQLGHQVIFLIGDFTGMIGDPSGKNATRKPLSREDVLANARTY
FT                   EEQVFKILDRERTEVRFNSEWFGQMSAADMIKLSAQHTVARMLERDDFAKRFGSQQPIA
FT                   IHEFLYPLVQGYDSVALRADVELGGTDQKFNLLMGRGLQEHYGQAPQIVLTMPLLEGLE
FT                   GVAKMSKSLGNYIGINEPAIDIVTKTMKIGDELTWRWIDLLSLDISVAEAVRLKEQVTS
FT                   GELHPREVKLRLARELATRFHDAATAEQAIAGWHAVVTGQGDTSLLPLQEVVVPAEGLR
FT                   IASLLTAAGLTPSNSEATRKLKERAVKIDGEVLEDATRVFTQGFEGVIQVGKRNFARVS
FT                   LVIG"
FT   rRNA            520867..522416
FT                   /gene="XOOr08"
FT                   /product="16S ribosomal RNA"
FT   tRNA            522510..522585
FT                   /gene="XOOr09"
FT                   /product="tRNA-Ala"
FT                   /note="Found by tRNAscan-SE"
FT   tRNA            522605..522681
FT                   /gene="XOOr10"
FT                   /product="tRNA-Ile"
FT                   /note="Found by tRNAscan-SE"
FT   rRNA            522909..525831
FT                   /gene="XOOr11"
FT                   /product="23S ribosomal RNA"
FT   rRNA            525963..526081
FT                   /gene="XOOr12"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(527041..527304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0481"
FT                   /product="ISXoo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67236"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67236"
FT                   /protein_id="BAE67236.1"
FT                   /translation="MKKRFSEEQIIGFLREAEAGMPIKDLCRRHGFSEASYYLWHSKFG
FT                   GMSVPDAKRLKDLEAENTRLKKLLAEQVFQNDLIKDALQKKW"
FT   CDS_pept        complement(527799..530108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0482"
FT                   /product="two-component system sensor protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67237"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67237"
FT                   /protein_id="BAE67237.1"
FT                   /translation="MTAQTGGLRAWCIAATLAALTAALAACLQWSSLQGPWRAITAVAA
FT                   VLAVVCGICAAAAAYRAAPAQHALAQRLEEAERARERLQQELQRHGELEQELLRAKQAA
FT                   EAAMLAKGEFLATMSHEIRTPLNGIIPMLELISSGQLSLDQRDMLQTATSSSLQLLRIV
FT                   DDILDYSKLEANKLELEITTFNLRELLDGVVQLLQRTAEGRQLRLSLDIEPSVRLLVRG
FT                   DPIRLRQVLGNLIGNAIKFTERGSVDIQLRRLGETRAQHLLRFQVRDTGIGIAPDQQTR
FT                   LFRSFAQADASTTRLYGGTGLGLAICKRIIDLMGGRIGVESEPGRGSTFWFEIPLLKVI
FT                   GDLQQATRADAVRVMVISSDARLSQRLKRLLDSWGVSHVLMETTQEALERVRRHSDTEG
FT                   FRCVIADHDTLRYSARAVHRALARPENANSARLIWLYGEEPVPAELRDHATLVPRQSPD
FT                   ETLRPLVLPPDPKPVPTATLASAMIPEPLPPPMANAREVRILLVEDNPVNLLVAQKLLA
FT                   VLGFEADTATDGETALTRMESIRYDMVFMDCQMPVLDGYAATRRWRAMETESGSRPLPI
FT                   VAMTANAMACDHERCLAAGMDDYLSKPVAREQLDACLQRWLPRQALLPGPSTAGQFTHD
FT                   PESASAGAQACALPILDNSVIDELYEVAGADTITILQLFLEDAPPIIEQLEAAAANRDS
FT                   MQLRDLAHTLKSSSANVGAQAVSNAARRIELAARTGTIERPSAMVALVIAEYARARLAL
FT                   LGQVARLQAAASTPNP"
FT   CDS_pept        complement(530109..532079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0483"
FT                   /product="two-component system regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67238"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67238"
FT                   /protein_id="BAE67238.1"
FT                   /translation="MAARDPVVSTTRDDTATRNRPLRAETPPADHWRRWADEAAATSDD
FT                   VAPVSATIIPAPAVAAALRSAAPVAAPRAAAAVGRARAASASAPTAPPTSTAAPRDGDD
FT                   NVAADAPYRVLIVEDDRSQALFAQSVLHGAGMHAQVEMTPASVPQAIQDYHPDLILMDL
FT                   HMPELDGIRLTTLIRQQPGQQLLPIVFLTGDPDPERQFEVLDSGADDFLTKPIRPRHLI
FT                   AAVSNRIRRARQQALQQVGEQISVRSNPETGLPTHGHVMNLLADALERKQSGGLFFIEI
FT                   ASALDLRERYGYAAYERLMTQAGHRLASAAQPYPLARLNDNSFLLLAVGMPEASLEQQA
FT                   LEIRQRLSANAFQVREEESVHVRCAVGVAPLGLGFDDTGSALEAVERTALQARLRSDGV
FT                   QTYLAPSQAEQQEQLRLVEGQLELAYQPIVAVAGGDTAQYQVLLRLPQADGTLLSAGQV
FT                   IPATEAAGRIADLDQQVMDHALGLLHLYQHASPPLRLFVSQSPRTLARDAFADWLLKAL
FT                   PERGVAGQSLIVDLRLDDALIHAVTVQQFCAKLMPAGVQFCLSQFEPGDEANALLAQLP
FT                   LSFVRMANRFADAHGNAAVRDELRDVVDIAHQRGLLIIGQRIEDPQAAAAMWMSGVDFI
FT                   QGNLVQTVGKELDFDFTSAVL"
FT   CDS_pept        complement(532118..532744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67239"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67239"
FT                   /protein_id="BAE67239.1"
FT                   /translation="MSDAHLFVIGILLAWLAGIRVYLTVFGVGLAGLLGWIDLPPALHP
FT                   AQSWWVLDTSGALAVAEFFADKIPGVDSGWDLLQTLARVPAGAFLAAATLSPDGDLGAG
FT                   ALAAGAGVALTSHTLKAGTRALLNTSPEPASNWVASLAEDTVVTTALALALAQPWLALS
FT                   VAVGSSLLAALVVWWVWRLLWRGMRRLVAPMHSSATPAARNSPLS"
FT   CDS_pept        533008..533640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67240"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67240"
FT                   /protein_id="BAE67240.1"
FT                   /translation="MATRTAAPRLVEAEAALQQAQRSQAQQRRQIEQLQQRQVNLAMSD
FT                   KISRAANIEVQASLAERDEQIAALRADVAFYERLVGSTAQRKGLNAHSVQFTAEAGGTW
FT                   NYSVVLTQNLNRGAISQGQLRFVVEGVRAGKLVTVSWNELHQKPNAAGQPYSFRYFQQL
FT                   DGSVILPKDFTPQRVNISLSGDGAPVNQTFDWKVAGNGAGGVAHVRE"
FT   CDS_pept        533627..533854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67241"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67241"
FT                   /protein_id="BAE67241.1"
FT                   /translation="MFGNKSNRGAQTVVDTLIGPQVVIRGDLLFSGGLYVEGRILGKVI
FT                   AEEGTSATLTVAEQGSIEGEVRAPVVIING"
FT   CDS_pept        533867..534076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67242"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67242"
FT                   /protein_id="BAE67242.1"
FT                   /translation="MHAAQRVELAANARVQGNVHYQVVEMSVGAQLTGRLIHAATAAAT
FT                   AASPAPETSRAEPFTALQAEIADV"
FT   CDS_pept        534149..534535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67243"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67243"
FT                   /db_xref="GOA:Q2P884"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P884"
FT                   /protein_id="BAE67243.1"
FT                   /translation="MSTLVSLPTAAPAPDYQSIDRPLHFSVAAAAKVRELIQEEGNADL
FT                   ALRVYIQGGGCSGFQYGFEFDENRAEDDLAVVTDGVTLLVDPLSLQYLMGAEVDYTESL
FT                   TGAQFVIRNPNAKTTCGCGSSFSV"
FT   CDS_pept        complement(535114..535377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0489"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67244"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67244"
FT                   /protein_id="BAE67244.1"
FT                   /translation="MRENLGVVTAPPFEIDARHGMRGRHRIAPGRGASAWTSGKAWTKR
FT                   ASRDARGEHACSMRHIDLRTTAHSRSRRARRERCNAQTLVAR"
FT   CDS_pept        535462..536742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67245"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67245"
FT                   /protein_id="BAE67245.1"
FT                   /translation="MLHINSRSAFGLAAMLGIASAVLAPSAQAAPARGTLLTSNFLTSY
FT                   TRDAISAMLASGSQPASGSQPEQAKCNVRVAEFTYATIGVEGEPATASGVLLIPGGERC
FT                   SGPYPLLGWGHPTEALRAQEQAKEIRDAKGDDPLVTRLASQGYVVVGSDYLGLGKSNYA
FT                   YHPYLHSASEASATIDAMRAARSVLQHLKTPLSGKVMLSGYSQGGHTAMATQREIEAHL
FT                   SKEFHLVASAPISGPYALEQTFLDSWSGSNAVGENTFGILLGSYAIVAMQHTYKNIYLE
FT                   PGQVFQDPWAAKVEPLFPGKQSLTDMFLNDTLPSIDKVKSYFQPGFYSDFPSNPANPFR
FT                   QDLARNNLLEWAPQTPTLLCGSSNDATVPLKNAQTAIASFQQRGSNQVALVDTGTGNAS
FT                   DNSAFAHMLTKESCIVVVRDQLLDKQR"
FT   CDS_pept        537049..537939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0491"
FT                   /product="NADH pyrophosphatase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67246"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67246"
FT                   /protein_id="BAE67246.1"
FT                   /translation="MSGSLFSPSDVAFTHAPLDRGDVLRDDPDALARLWPHGRVLLIDA
FT                   KGAALADANGQPLLLDGAKLGDGLEVAIFLGLRDAVGWFCLPADIVPVQAPQRIDLRQA
FT                   AADWPAEIATAFAYARAMLHWQSRTRFCGVCGGAIAFRRAGFIAHCTHCQTEHYPRVDP
FT                   AIIVAVSDGARLLLGRQASWAPGRYSVIAGFVEPGESLEQTVAREVFEETRVHVQDCRY
FT                   LGAQPWPFPGALMLGFTARAPATEVPQVTSELEDARWVSHAEVSAALAGEADIGLPPRI
FT                   SIARALIEHWHRTHG"
FT   CDS_pept        538013..538903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0492"
FT                   /product="transmembrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67247"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67247"
FT                   /protein_id="BAE67247.1"
FT                   /translation="MFTTLVAVVVALTLGHLVPTQVARLRTFAWFGQWLRRLDSYAAGR
FT                   GAWQGRCGVLLAVLPALLVLLVQWLLDDVWHGFLDLLFGVAVLAWTWGPRDLDRDVEAV
FT                   IDADEPHARREAISHLQAAGGSMHEDAPSLVEAVVVNGLRRWFAVLWWFLLLGPFGAVL
FT                   YRLTALAVESPLAVLLPPRNLAGARWLLAVLEWPVAQLMTMSMALVGNFDTVFRAWREA
FT                   HGNRWLLEPHFLGAVARASVSAELREEAHDYTDSGLVPVWRRLPEVRDAMSLIWRVLLL
FT                   WLVVLALLVIAGWVR"
FT   CDS_pept        complement(539225..539632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67248"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67248"
FT                   /protein_id="BAE67248.1"
FT                   /translation="MSKRLLQLSLAPAALAAGAGVWIFWKFDPNLPGNPFPPCIFHALT
FT                   GFYCAGCGMTRALHALAHGDLVTATRMNAFAVGLLLLLPWAVLWHLGWQPRRLMPLARL
FT                   FGSPWLWGTLLPGFWIARNLPWFPFTWLAPG"
FT   CDS_pept        complement(539635..540015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0494"
FT                   /product="transmembrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67249"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67249"
FT                   /protein_id="BAE67249.1"
FT                   /translation="MSAIPPPIHPQPSVGPPPVQPIRNHLAWSITMTVLCLVICCSCWT
FT                   IPGIITGIVAIIFAAKVNPLLNAGDIPAAIKASSTAKILAWVTTCIFVLGLLLWIVSIA
FT                   SVGVGGYKVRIIKMQQQIEHSR"
FT   CDS_pept        complement(540070..540420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0495"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67250"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67250"
FT                   /protein_id="BAE67250.1"
FT                   /translation="MHALPPRPPNGRGRSYQRDVLVLNIIAPEVPAVIGGRRSLQRLAV
FT                   MPAAMRMAMRAMTAWARGCRSLARANIQHDAALPTSTDADTWLAAHAHANVRFSTIRPV
FT                   PARAAAAQQGAR"
FT   CDS_pept        complement(540476..542398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0496"
FT                   /product="2-acylglycerophosphoethanolamine acyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67251"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67251"
FT                   /protein_id="BAE67251.1"
FT                   /translation="MSGHSQFALLRQRRFLPFFAVQALGAFNDNVYRQTIIGLLFYIGI
FT                   DAAQRTLYTNLAPAVFILPYFLFSALAGQIAEKLEKQKLIVITTTMEIAIMSLAAVGFI
FT                   TGNMVILLIALFCTGLQSTLFGPVKYSILPSVLKPEELTGGNGLVEMGTSISILCGMIF
FT                   GGLIFQIAGSHGPEAAATAVIAIAVTGNLVARLVPRVDAGAPELTINWNPIPESRAIMR
FT                   LTRRTLAVRNSVLGVSWFWFIGTVLTAQLPTYAQLNLGGQQDLYVFALALFSIGTGVGS
FT                   LLCERLSGRTVEIGLVPLGAFGISAFLLDLYFARPDAAPVTGLLIGQFVQQPGSVRLIV
FT                   DLVGIGLFTGLFVVPLFALIQSRTPKAELSRVIAGLNIQNSLFIVAAAVIGIVLQLPQV
FT                   VLFGVRIPLPGLSIPQVLLALAIANTLVALWIFTLVPEFLMRFLSWVLVSVLYRLRARN
FT                   IDAHVPDEGAALLVCNHVSYMDALILLAVIPRPVRFVMYYKIFRVPVMRWIFRTAKAIP
FT                   IAGAREDPALMQQAFDRIDAALADGELVFIFPEGALTKDGEIAPFRSGVEKILRRRSVP
FT                   VIPMALRGMWSSMWSRRDTRLGRMRVPRRMRAQIEVVAGEAIAGDQTSAELLEQQVRAL
FT                   RQDQS"
FT   CDS_pept        542454..543068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67252"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67252"
FT                   /protein_id="BAE67252.1"
FT                   /translation="MAAAFSGPDVPAPWGAGQLGTQQGDEGARGRAGVGPPHRVGQTPV
FT                   TLFQRERDHAAHGAGHGLRDDAHTQVGSDQFAHQIGMGHFVMLALPQAGLGKGSIEDAA
FT                   HAGTGNQPGHRFIVQLGQCHPFARGKAVAGGHDQGQRLFMQQQALRRHRDLWTHADQSD
FT                   IQPGLRPDRAARPRAWRCTGARPHAHARCGTDAVTPAAARW"
FT   CDS_pept        complement(543043..543558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67253"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67253"
FT                   /protein_id="BAE67253.1"
FT                   /translation="MLATASPVAAAISSTRRRGKGGWVLGSVRMAIAWSRNVRSVGSRP
FT                   ASFQCIVFTTAIVLRDCMPTLRQLELAVAVAEEGGFTAAARRRNTVQSALSHQVAKIEE
FT                   TFGACLFERGTRQVRPTTADEVFLHNARQTLRAAERLHEEMAQALGTVRGRLALAQISS
FT                   LTTVQLPG"
FT   CDS_pept        543718..544659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0499"
FT                   /product="arabinose efflux permease"
FT                   /note="Permeases of the major facilitator superfamily"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67254"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67254"
FT                   /protein_id="BAE67254.1"
FT                   /translation="MGLFVLSALGLLVRASSHSFAMLLVGTIVTGASSVAVQILVPFAA
FT                   TLAAPNERGRVIGTVMSGLLLGILLARAVAGVLAGVGGWHTVYWIASGALLLTAGLLWR
FT                   GLPRHPVNAQLAYPQLVASVLRLLRDDAVLRSRSVLGGLIFAGFSMFWTTLAFLLSGPS
FT                   YGYGTAVIGLFGLIGAAGALAANRSGHWSDHGHGDRVSCGGLVMLLLSWGLLAFAPHSI
FT                   ALLIVGVLLDIAVQGVHIANQSVIYQRNPTARNRITSAYITCYFIGGAVGSTLGTAAYA
FT                   QAGWMGVVIVGAVLAAAALGWVALSVARKQWK"
FT   CDS_pept        complement(544790..547003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67255"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67255"
FT                   /protein_id="BAE67255.1"
FT                   /translation="MATPSFETRLSRLWAHEKASYGLRVFIALAVAMGVCWHWQQLTAV
FT                   PALFLGAIASAIAETDDNWLGRIKSVLLSLLCFAAAATAVVLLFPYPLPFVIGMALATF
FT                   SLTLLGALGERYASISQATVALSIYAMIGMDQHGSHHPSIAWHGAALLLIGATWYGVLS
FT                   ILWTILFANRPVRERLSRLFFELGRYLKLKADLFEPVRQSDLHVRRLALAEQNAKVVGA
FT                   LNAAKTAIMSRFGRSGRPGVQSGLYFRLYYMAQEFHERASSSHYPYEALTDAFFHSDVL
FT                   YRCQRLLALQGKACAALGEAIRLRHPFDYGDNSRLATEDLRQSLDYLHARADPALTRLL
FT                   GALELLVTNLQSIERRLSEAAQSDSTSDNLDTRLRDSSPHTLREMGARLVQQLTPGSVL
FT                   FRHGLRMAIALLVGYAIMQSIHADNGYWILLTTAFVCRPNYGATRLRLVQRIAGTLIGL
FT                   VATWALMQLFPGTEVQLLLALAAALVFFITRTDRYMLATAGITVMALFCFNLLGNGFVL
FT                   IWPRLIDTLIGCAIAAAASFLILPDWQGRRLNQVMATVLTSCARYLTQVLEQYASGMRD
FT                   DLPYRIARRDMHNADAALSVALSNMLREPGRYRRNLDAGFRFLALSNTLLGYLSALGAH
FT                   RAALEGEHDAAIAQAGEYLQRALSEIASAVGQRQPLPVHDESEELATAEALEQHAVQLP
FT                   PKQRLVRDQLALTLRLLPKLRAAALAVTTAPAENPPRVAIHKA"
FT   CDS_pept        complement(547229..547810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67256"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67256"
FT                   /protein_id="BAE67256.1"
FT                   /translation="MRELVFLLEEHSARAMLESLLPRILSNDIQYRLIAFEGKQDLEKQ
FT                   LERRIRGYQNSLARFVILRDLDSHPDCRAVKKNLLGICRLSGKIQFCLVRIACTELETF
FT                   YLADLAAVGMALQMSRLASHQNNRKFRSPDAIGNPSKELKLITGNRYQKVAGSREIGKY
FT                   LQLDNARSASFRNLVTGVRRMETELLAIPV"
FT   CDS_pept        complement(547807..549000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67257"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67257"
FT                   /protein_id="BAE67257.1"
FT                   /translation="MKIESIRLRNFKAFRDVHLKDMPSFLVVVGANGSGKSTLFDVFGF
FT                   LHDCLKGNVRQALDKRGRFREVLSRGCDPTVDSILIELQYRMEITGVERLVTYSIEIGE
FT                   ENGAPIVQSELLRYKRGRYGSPYHFLNFSKGVGYAITNEEDFKKPDEELDRESQKVAPD
FT                   TLAIKGLGQFERFKAANAFRQLIENWHVSDFHINAARGRKEATGDSEHLSESGDNLPLV
FT                   AQYMNERHQQVFRRILDIMARRVPGVASVEPKLMDDGYLTLRFQDGSFKTPFLDRYVSD
FT                   GTIKMFAYLVLLYDPSPHPLLCVEEPENQLYPQLMTELAEEFRMYAARGGQVLVSTHSP
FT                   DFLNSAELDEACWLVKRNGCTEVHRARDNQQISSYVKEGDQLGYLWKQGFFDGVDPQ"
FT   CDS_pept        complement(549153..550442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0503"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /note="Phosphoribosylamine-glycine ligase (GARS)
FT                   (Glycinamide ribonucleotide synthetase)
FT                   (Phosphoribosylglycinamide synthetase)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67258"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67258"
FT                   /protein_id="BAE67258.1"
FT                   /translation="MKILVIGSGGREHALAWKIAQSAHVSEVLVAPGNAGTATEAKCHN
FT                   VAVKVNDLEGLLALAQREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGS
FT                   KAFAKDFLARHGIPTAYYAVHTDVDAALAYVREKGAPIVVKADGLAAGKGVIVATTLAE
FT                   AEDAVRDMLSGNAFGDAGARVVIEEFLDGEEASFISMVDGTHALPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTPEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGA
FT                   PKVIEFNVRFGDPETQPVMLRLQSDLVDLLNAAIDGKLDSAQAQWDPRPSLGVVIAAKP
FT                   YPETPVTGEVITGLDAVPASAKVFHAGTALNAAGEVVSAGGRVLCVAALGDSVHDAQRT
FT                   AYAGLQPIHWPSAFQRSDIGWRAIARERDQ"
FT   CDS_pept        complement(550463..551077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67259"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67259"
FT                   /protein_id="BAE67259.1"
FT                   /translation="MGANHLEILVEEPSMENFLHALLPRMIPADKTYAIKTFQGKSDLL
FT                   AKAEARLRGYANYIPEDWRIIIVVDRDEDDCKELRSNLEKIAKESGLISKSTGSAQWNF
FT                   VTRIVVEELEAWYFGDWQAVKAVFPRVASTVDKQKAYRKPDSIRGGTWEAFERIMKRYG
FT                   YFAEGLPKINAARLIGAKIDPGRNISESFNAFIGAVRSAID"
FT   CDS_pept        complement(551077..552312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67260"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67260"
FT                   /protein_id="BAE67260.1"
FT                   /translation="MANELIARKVARIEYLKIQNFRAIRDLELRDITPLTVLLGPNGSG
FT                   KSTVFDVFAFLAECFELGLRRAWDKRGRARELKTRGSEGPITIEIKYREPGYPLITYHL
FT                   SVDERNSSPVVIEEWLQWRRSERGRPFRFLEYREGIGKAASGERPDDQDKRIDTPLKSA
FT                   DLLAVNALGQFAEHPRVAALRDFITGWYVSYLSADSSRGQPEAGPQDRLSRTGDNLANV
FT                   IQFLAEQHPNRLEDVFSALRERIPRVERVLAETMPDGRLLLQIKDAPFSHPVLARFASD
FT                   GTLKMLAYLVLLYDPAPPPFIGIEEPENFLHPRLLPELAEECRKSSAQTQLLVTSHSPF
FT                   FLNSLRPEEVRVLWRDDQGYTQTRRAADLLGIREFIKHGALLGHLWMEGQLGVGDPLTN
FT                   QGAPASPLPEKT"
FT   CDS_pept        complement(552362..553945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0506"
FT                   /product="bifunctional purine biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67261"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67261"
FT                   /db_xref="GOA:Q2P866"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P866"
FT                   /protein_id="BAE67261.1"
FT                   /translation="MASDFLPVRRALLSVSDKTGLIDLARALVARNVELLSTGGTAKAI
FT                   REAGLPVKDVAELTGFPEMMDGRVKTLHPLVHGGLLGRAGIDEAVMAEHGIAPIDLLVL
FT                   NLYPFESVTVKTDCTLADAVENIDIGGPAMLRSAAKNFARVAVATDPAQYADLLAELEA
FT                   NNGQLSAAKRFALSVAAFNRVAQYDAAISNYLSAVADSAETVPTRNPFPAQINSNFVKV
FT                   MDLRYGENPHQSGAFYRDLYPVPGTLATFQQLQGKELSYNNLADADAAWECVRQFDAPA
FT                   CVIVKHANPCGVAVGAGCGDAYELAYATDPTSAFGSILAFNKTLDAATAKAILDRQFVE
FT                   VLIAPDYDAGALDYATKKANVRVLKIPHGNGLNNYDTKRIGSGLLMQSADNRGMSLGEL
FT                   SVVTQRAPSEAELGDLLFAWRVAKYVKSNAIVYAKDSRTIGVGAGQMSRVVSAKIAALK
FT                   AEEAKLTVVGSVMASDAFFPFRDGIDAAASAGIQAVIQPGGSMRDGEVIAAADEHGIAM
FT                   VFTGVRHFRH"
FT   CDS_pept        554311..554637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67262"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67262"
FT                   /protein_id="BAE67262.1"
FT                   /translation="MVADAALYLSLLGVPGVSAHWLWVFALLAALTEYAGVLGLMVGAS
FT                   RRYDGPMGKRDRAFVIGVLGVGLASGLLGARGVTWVAIVLSLACMATVGRRVRADLAEA
FT                   PAGA"
FT   CDS_pept        554763..555164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67263"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67263"
FT                   /protein_id="BAE67263.1"
FT                   /translation="MVRRCFNGIGRCTMPRLPARPRRWCCCIAAMSTSAGDASAEELDM
FT                   PDAQFFAWDARGNGRSPGVRGDAPGFEALVRDLDGFIAHLGATHGIAVQDMVVIAQSVG
FT                   AVVAATWVHDYAPPLRALVLASPAFKVTL"
FT   CDS_pept        555485..556483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67264"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67264"
FT                   /protein_id="BAE67264.1"
FT                   /translation="MPGFFHDTLGERDRAIAITQIRQFVQARFAQPPVRAALRDAHRAG
FT                   PSFEEAERLAWPPQRNSLQDLRWRGVRAGLRLGGRLSEGIALGLQTGFDSGSALDYIYR
FT                   NQARGRGPLGRMIDRNYLNAIGWRCIRIRGSHLGELLRDAAARLRGAGKPVRVLDAAAG
FT                   HGRYVLKALGSGAQRADAIMLRDFSLLNVTQGTALIQTLGAGDSARFEQGDAFDPDALA
FT                   AVQPAPTLAVVSGLYELFADNDQIARSLAGLAAAVQPGGYLLYTGQPWHPQLEFIARAL
FT                   TSHRDGVAWVMRRRRQQEMDALVEAAGFRKVAQRIDAFGIFTVSMAQRIDA"
FT   CDS_pept        556480..556878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67265"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67265"
FT                   /protein_id="BAE67265.1"
FT                   /translation="MSPAARPFGRAALWLALLGPFFFLSYGLANTLDGRATQVPSVVFG
FT                   WAHGMPFWPWTIVPYWSIDLFYAASLFVCRTRRELDTHALRLLSAQLICVGCFVVLPLR
FT                   YSFVRPQTDGVFGWLFAVLLGFHKPFPD"
FT   CDS_pept        complement(557058..557873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0511"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67266"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67266"
FT                   /protein_id="BAE67266.1"
FT                   /translation="MVGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGA"
FT   CDS_pept        complement(558525..558797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0512"
FT                   /product="DNA-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67267"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67267"
FT                   /protein_id="BAE67267.1"
FT                   /translation="MNAAPSRPDSSRGAPKSPLREHVAQSVRRYLRDLDGSDADDVYEI
FT                   VLREMEIPLFVEVLNHCEGNQSRAAAMLGIHRATLRKKLKEYGMT"
FT   CDS_pept        complement(558904..559599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67268"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67268"
FT                   /protein_id="BAE67268.1"
FT                   /translation="MADTTDSLSHADRPASHPEPAAATDRAATSTAAGDDAQAGARIAA
FT                   DHVSTPHFQPLPVPALAAPAFARRGIARPPLRASGRHWALLAALVGLLGLQIVIADRAH
FT                   LATNPRWRPLVSAACTLARCTLPAWREPEALTMLNRDVRPMPGVAGGLQIQASFRNDAR
FT                   WAQAWPWLQLSLSDADGRVIGTRVLSPQEYLSQSPAAQDTLAPGQAVQVAFRVREPAAS
FT                   TAAFSFEFR"
FT   CDS_pept        complement(560459..560836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0514"
FT                   /product="transcriptional regulator pbsX family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67269"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67269"
FT                   /protein_id="BAE67269.1"
FT                   /translation="MSKLYERVREARSLTKLTQEALAGELGVTRSAVAQWEMAEGTAPS
FT                   VENLIGLAKRSGMAFEYLATGRGDRVFGPPVSAIAEEPAQYRRLDDQQRVLLTRFDTLA
FT                   PRQRSGLLDLLLAEGKTRRRR"
FT   CDS_pept        560986..561495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67270"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67270"
FT                   /protein_id="BAE67270.1"
FT                   /translation="MVEPADPKPDPCGRITPPSAAPAPAPAPWPAHSPVDPAANRFRGA
FT                   ARYLIWRRGAEWTAVAEGPQWSAALAPRLWALRERHWWLLALSAPMVAVAGAVALAGAQ
FT                   AWSPVAWAALLVVEVVLRVCVARRAGQWRTAALQRTGWQPVTRLRAISRADAVTTAQIR
FT                   AGRPQR"
FT   CDS_pept        complement(561642..562583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0516"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67271"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67271"
FT                   /db_xref="GOA:Q2P856"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P856"
FT                   /protein_id="BAE67271.1"
FT                   /translation="MPFLELTLSCSEVTLPRFQNALDDVGAMAVTMLDANADTSNERAL
FT                   LEPGVGEMPLWDRLTMTALFDGGSDALVVLAALEAFDPGLDWSQVGFRMVEDSDWIRAW
FT                   IDLFKSMQFGARTFIVPWNQDVPEAANAPDAAVVRLDPGLAFGSGTHQTTALCLRWLDS
FT                   LAVSGELQGRSVLDFGCGSGILAIAALKLGASHAVGVDYDPQALLATADNAHRNALEAQ
FT                   LAVYMPQDEPVQTYQVVVANILASALSTLADTLAARVVPGGRIALSGILHGQEDELLER
FT                   YAPWFEQLRCERDDEWMRIEGVRRAASGTQNG"
FT   CDS_pept        563529..563993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67272"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67272"
FT                   /protein_id="BAE67272.1"
FT                   /translation="MPLARARHLWLLLAPAALAAAAWWDVRAQPAEHAADRAVPVVADV
FT                   TQVGATAPPPHAAKEHGTALQLPHRDAVEAQPDLYRYAQQLQQQVRAGDAQAGWRLSRV
FT                   YDYCAPYAASPSGYAADSAWIAAQHAPGVVAMHAARAWRSAAPALHPPTG"
FT   CDS_pept        564002..564454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67273"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67273"
FT                   /protein_id="BAE67273.1"
FT                   /translation="MVAQQRQAAARAGSLAAEAAMLALGEPLHVSPGYKRALVQRVLAS
FT                   RDPEAYLALAPAMGARASGDDSLQGCVAGDQFAELARQVAACRLGLDCSADSTLVTSYC
FT                   ANAGICSRDSAQDFVSFVFDAAVPRQGADKVDELVDTLVSDPGAQS"
FT   CDS_pept        564451..564816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67274"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67274"
FT                   /protein_id="BAE67274.1"
FT                   /translation="MNYRRLVHGAKFWLWVVLFVAYSAAAVSIVMIDTADHRYQPLSVK
FT                   STSVTADEQQRRHGASQVAAVYRASSAMPFSTLPAGSTFQVVWPNGSTETMTVVDPSSA
FT                   NGIVPVPGRQQAPAPRR"
FT   CDS_pept        complement(564955..566322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0520"
FT                   /product="biotin carboxylase subunit of acetyl CoA
FT                   carboxylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67275"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67275"
FT                   /protein_id="BAE67275.1"
FT                   /translation="MLDKVVIANRGEIALRILRACHTLGIRTVAVHSTVDRNLKHVAMA
FT                   DESVCIGPAASSDSYLNIPALIAAAEVTDAQAIHPGYGFLSENADFAERVEQSGFIFIG
FT                   PKADTIRLMGDKVEAIRAMKAAGVPCVPGSGGPLGEDIVANTKIAREIGYPVIIKAAGG
FT                   GGGRGMRVVHSEAALKAAIETTKSEAKAAFSNDQVYMEKFLENPRHVEIQVLADGQGGA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEELRNQIGKVCVDACIRIGYRGAGTFEFLFEN
FT                   GSFYFIEMNTRIQVEHPVTERITGIDLVCEQLRIAAGHKLSIKQSDIVLRGHAIECRIN
FT                   AEDPETFMPNPGLITAFHPPGGPGVRVDTHIYAGYKVPPNYDSMIGKLIVHGPDRETAI
FT                   ARMRVALSEMVVDGIKTNIPLQQRIMRDKGFQAGGQNIHYLEKRLAERKNKSIALT"
FT   CDS_pept        complement(566358..566765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67276"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67276"
FT                   /protein_id="BAE67276.1"
FT                   /translation="MRLWKSRDSQERPHERLTVWRDAMSLVEAIYRRSHDFPDSERFGL
FT                   TAQMRRAAISIPSNIAEGAARRSTAECLRCLAMARGALAELDTQLQIATGLPFTLPDVA
FT                   IADLLNRTFAKLNALIRTSDASRHLREPSAF"
FT   CDS_pept        complement(566798..567283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0522"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxilase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67277"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67277"
FT                   /protein_id="BAE67277.1"
FT                   /translation="MDLRKIKKLIDLLEESNLAEIEIKEGEESVRLARVPKGTAMMSAP
FT                   VQQYAPAPAAQAPAAATMPMQSPTEASTGGAKQAAALPEGHVLRAPMVGTFYTSPSPDK
FT                   PAFVTVGQQVKVGDTLAIIEAMKMFNPIEADAAGTIVAILGDTGQPVEFDQPLFVIG"
FT   CDS_pept        complement(567382..567828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0523"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /note="3-dehydroquinate dehydratase (3-dehydroquinase)
FT                   (Type II DHQase)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67278"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67278"
FT                   /db_xref="GOA:Q2P849"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P849"
FT                   /protein_id="BAE67278.1"
FT                   /translation="MAHLLLLHGPNLNLLGTREPEVYGRTTLAQIDAALVDRAQAAGHA
FT                   LDCLQSNAEHVLVERIHAAREDGTAYILINPAAFTHTSLALRDALLGVGLPFVEIHLSN
FT                   PHAREPFRHHSYLSDKADGVICGFGADSYRLALEAVIARLECDA"
FT   CDS_pept        complement(568662..570986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0524"
FT                   /product="C-type cytochrome biogenesis protein"
FT                   /note="C-type cytochrome biogenesis protein (copper
FT                   tolerance)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67279"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67279"
FT                   /protein_id="BAE67279.1"
FT                   /translation="MKSLSRWIARCALLAAPVFAASLVLSPAPAQAAVTEADLLPVDQA
FT                   FVLSATADSRDRIALNWKIAPGYYLYRHRISVKSAQGFAAGELALPEGESKHDEFFGQV
FT                   QTYRKQLRASLAGKADPAVQTAVLQVQYQGCADAGVCYPPQRREIRVNLPAAEAAGTPG
FT                   AAPQRENLGALVPRSAAGPRLFGTPGQTAGVDALPLPAEQAFNFEAIVGDGNSLLLRFT
FT                   PAPGYYIYRDRTSLALEGTGGVRTGLPRWPQGKAHRDEHFGDVVVYFDQAEVTLPLLRD
FT                   KPDPAHATLVATFQGCQTDGICYPPMTRRVTLDVPAGTVSPQNQAQAAPLMISPLAAGQ
FT                   VPVDPAPAAAPASAAGPVADASAGNPERTSPPHTDKGLLGMLVLALLGGLVLNLMPCVL
FT                   PILSLKVLGLAHSGESRGHARSHAIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQ
FT                   QPWFVAALAYLMFAVGLSLSGVFTLGTNLGGIGQSLATRNGPLGDFFTGVLACVVASPC
FT                   IAPFMGTALAYAFTAPALLAMLVFLALGLGLALPFLLIGFVPSLARRLPTPGAWMETLK
FT                   QVLAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWCFERSRWKSHRLGMGLA
FT                   TVMLVLALVPVVAVTRLSLPAATAAEGGVAFSPQLLDRMRADNRVVFVNMTADWCVTCK
FT                   ANEKNVLSSAEFRDALRRVDAVYMKGDWTNVDPAISTFLDQHQAVGVPLYVVYGPGAPP
FT                   AILPTVLTGAITEDALLRAAR"
FT   CDS_pept        complement(570992..571324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0525"
FT                   /product="periplasmic divalent cation tolerance protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67280"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67280"
FT                   /protein_id="BAE67280.1"
FT                   /translation="MSAPSLHLLFSTCPDAESAERIAHALLEERLAACVTQLPGAQSLY
FT                   RWNGAIERSTEVQLLIKTWDDCLPDAIARLQALHPYELPEAVAVQASAGLPAYLDWVRA
FT                   DTRKES"
FT   CDS_pept        complement(571508..572506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0526"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67281"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67281"
FT                   /protein_id="BAE67281.1"
FT                   /translation="MLGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRYLAETMWRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTMFTAESAC"
FT   CDS_pept        complement(572941..574260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0527"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67282"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67282"
FT                   /protein_id="BAE67282.1"
FT                   /translation="MLNRSLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPPLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQRLPARTYR
FT                   QVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTLPKQTP
FT                   VKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
FT                   KKNSVAFKMPAVSKSVRPRRSGPNATSPSQLDCHADLRTG"
FT   CDS_pept        complement(574790..575305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67283"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67283"
FT                   /protein_id="BAE67283.1"
FT                   /translation="MDLAIELGNGKYRMKAKLSNDPTGCAALYAWLCTHAQPDSWVVME
FT                   ATGIYHQALAEFLYAHGYRVCVLNPAQVALDARSQLQRGKTDRSDAKLIASYISRTGSA
FT                   RLRAGLYMPALVAMRHHPVVTALKQPLHARGKHGKQIVCAAMRKLLHLAYGVLKSSTAF
FT                   DPQKALAT"
FT   CDS_pept        complement(575708..577930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0529"
FT                   /product="primosomal protein N'"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67284"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67284"
FT                   /protein_id="BAE67284.1"
FT                   /translation="MSSTVATLRVALPVPLPQLFDYLPPADAPLADPVRVGCRVRVPFG
FT                   PRELIGVVVEIGQLPTADGLRPALAWCDQAPLLVDELARSLQWLARYTHAPLGEAQASA
FT                   LPGPLRRGEPLADTHAWAWQLTEAGRSGAASLRTGSRPALLAALLLTGAVGEEQLDPLL
FT                   PQWREAARSLAKRNYTERVAVPADTISPRPGSGPQLNEEQQAAAAAIRAHRGFATYLLD
FT                   GVTGSGKTEVYLQAIADCLAAGRQALVLVPEIGLTPQTLGRFRARLGVPVHALHSGLSD
FT                   GERARVWAAAWRGEAKLIVGTRSAVFTPLPNAGLIVIDEEHDGSYKQQDGIRYHARDFA
FT                   LVRGKALDVPVILGSATPSLESLHNAYSGRYQHLRLSRRAGEARPPRVRVLDVRKRPLK
FT                   DGLSPEVLAGIGATLARGEQVLVFKNRRGYAPVLLCHDCGWTAACQRCSTPLHQTPMTV
FT                   HAGGRRLQCHHCGARQPAPLACPACASLALQPQGIGTERLEERLTEAFPDVPVVRIDRS
FT                   TTQRRDALETQLARLGTEAGILVGTQILAKGHDLPRLTMVVVVGIDEGLFSADFRAAEK
FT                   LAQQLIQVAGRAGRADRPGEVWLQTHHPEHPLLQTLVNGGYHAFADAELQQREAAGFPP
FT                   FAHLALFRAEAKDVAAANHFLLAVRGLTSTDPSTQSPAFAAVECYGPMPAPMPRRAGFQ
FT                   RTQLLLSAQQRSALHRLLDTQLPAIHALPQARRVRWSLDVDPIDLY"
FT   CDS_pept        578396..579421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67285"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67285"
FT                   /protein_id="BAE67285.1"
FT                   /translation="MTVVPDAPVTPAALSAFLRGVERRGLVLAQLQCGDVAAAERALAA
FT                   ALRAFSSQAAGRPMAGWPMRFWSLLATAPPLRREPMPGTWLPPFTALGRMQTADRLALL
FT                   LRIVAGLEEEAASEVQGIEAADYRQSLAGACPRDAAGNPDAQAWRALAEAAQMELRDLT
FT                   PAQLTRLSQLRDSALAGMSLQTAAPAPAPQRPAAARTRPRRQWQWPQLERRHAGMALGV
FT                   LALALLLAVLGWWWTHRRPALPPEPVSQAPAGVLHVTDAAPVLVEELPAADLSDAVAKP
FT                   GMDPRDQAMLADPDLELVRSADFYAWYAAGHPVPVDESGAHASAVEQPSAPLETVDDEA
FT                   N"
FT   CDS_pept        579474..580007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67286"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67286"
FT                   /protein_id="BAE67286.1"
FT                   /translation="MPMPLEEASAAPSASTPAAPVSSTTPSAAQQRARWEAMTPAQQAE
FT                   LRARYAAWKGLTATDRVVLRHARERLQALPEDQQRALHTQFGAMDRLHRDGWRLGSQVG
FT                   AFYAQLQPLIGYVPPAQRDAMLAALRSLDAGQLEQLAVLAQRTPSQERDGLRDAFLVQA
FT                   PATRSTWLKRQLAR"
FT   CDS_pept        complement(580338..580814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67287"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67287"
FT                   /protein_id="BAE67287.1"
FT                   /translation="MPRLPSNPQLLHHAFFAAVPSALLVLVPLFALLLRVFYVRSGQVY
FT                   LEHLVVALYSHAFLCLNLLVQLLLSLLSDALAHVASPITWSIGLVQLGLTVWMPVYLLW
FT                   MQRCVYAQSWPVTGLTYIGLSGVYLVFVTVAAALLMVASPARLCCGADVDATER"
FT   CDS_pept        581807..583183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0533"
FT                   /product="multidrug efflux protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67288"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67288"
FT                   /protein_id="BAE67288.1"
FT                   /translation="MSVSSAPPSATPGFASEVRTTGLLALPLVLGHVSTGLIGFVDNVI
FT                   AGHHGTATLAAVTIGTSLLWLPMLVPIGTLISLTTSVSQLMGAGREREIGPLFRQALWL
FT                   SLGLSALMFVFLSVVPPLLPTFGIAPDIVPGATDFLHTVRWGVPALTFYFCMRYLSEGM
FT                   HWTLPTMLLGFGGLLVLAPTGYALTYGKFGFAEHGAEGLGMASAITLWVQASVFALYLW
FT                   RARRFAHLQLFTHLEGPRWRAIGELLRTGLPIGITVLMEGGLFIVTALLIGRLGSTEAA
FT                   AHQIAINVAQLCFMIPMGVAEATTVRVGHAVGRGDPLGMRRAAWAGYAIVLGTQALSAS
FT                   ALLLGHDAIVGVYTDDVAVAALASVLLLFAATFQFPDGIQVLSAGALRGLKDTHVPMFL
FT                   AMFSYWGVGMPIGAGLGLGLGWGPQGMWVGLILGLTVASLLMGLRFRQTSRRVTATATP
FT                   "
FT   CDS_pept        583268..585169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0534"
FT                   /product="protease IV"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67289"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67289"
FT                   /protein_id="BAE67289.1"
FT                   /translation="MNHPVRRSPIASFFVGLWDVMNFTRRLIFNLVFFGFLFMLLLVFV
FT                   VALARGDGTKPLAERTTLVINPEGTLVEQFSADPVSRSLAKAVGDKSAQEVQLRDLVRV
FT                   IEAAGKDRKIERVLLNLDKFQPSGFASQREVAAALQKLRASGKQIVAFSESMSQGQYLL
FT                   AAQANEVYLDPMGSVLLEGLGRYRQYFREGLQDKLGVDVHLFRVGEYKSAAEPYILDAA
FT                   SADAKEADLFWMNDVWQRYLADVVTARKLSPAQLTAGIDTLPEGVAAAGGDLAKFALQQ
FT                   KLVDGLKTREEVDALLVKRGVADSDADSGFRNIGFNDYLSQLQAQDSPMDSRPQVAVVV
FT                   ATGEISGGEQPAGRIGGESTAALLRQARDDEKVKAVVLRVDSPGGEVFASEQIRREVVA
FT                   LKQAGKPVVVSMGDLAASGGYWISMNADRIYADPSTISGSIGIFGMVPNLTRALDKIGV
FT                   HTDGVGTTRFAGAFDITRPLDPAAGQVIQAVINKGYADFTGKVAQARHQSVDAIDKVAR
FT                   GRVWSGAQAKERGLVDAFGGMSEAVADAADRAKLSRGKFRVRYVEKPATPFSQFMNGFA
FT                   GSRMGAWMLSDSGMARALVARALPEVDTQLRFVESAVHDSKAGGTPVKSLAYCFCGF"
FT   CDS_pept        complement(585355..585570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67290"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67290"
FT                   /protein_id="BAE67290.1"
FT                   /translation="MKMHWMLAAGLALSLSACQRPQPAPTEQKPDPQATALRDHIQEPL
FT                   NKAHAVQASTDQAAEEQRKAIDAATQ"
FT   CDS_pept        585677..586453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0536"
FT                   /product="tropinone reductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67291"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67291"
FT                   /protein_id="BAE67291.1"
FT                   /translation="MTTHRWRLDGQTALITGASAGIGLAIARELLGFGADLLMVARDAD
FT                   ALAQARDELAEEFPQRELHGLAADVSDDEERRAILDWVEDHADGLHLLINNAGGNVSRA
FT                   AIDYTEDEWRGIFETNVFSAFELSRYAHPLLTQHAASAIVNVGSVSGITHVRSGAPYGM
FT                   TKAALQQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLSDPDYYEQVIERTPMRRIG
FT                   EPEEVAAAVGFLCLPAASYITGECIAVDGGFLRYGF"
FT   CDS_pept        complement(586615..587289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67292"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67292"
FT                   /protein_id="BAE67292.1"
FT                   /translation="MRRWRLLGMMALSVTAMGSLADAQEVAIYRCTDPTGALTVQNMPC
FT                   PKGMQQQKKLMTAPAAVPFAPGGATASPARATPAPQQRVAAPAVASAPVAPTTPVAPPA
FT                   PALTSTSTLPPPPLFECTTHDNGRYFTEDREPATRCLPMQTTNLAGGPATGGGSACEVV
FT                   TDRCAPVPDQSLCEAWRKRAEQAESTWRFSDEAQATERKERFDQMRRVLDESRCANPTA
FT                   TP"
FT   CDS_pept        complement(587286..588059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67293"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67293"
FT                   /protein_id="BAE67293.1"
FT                   /translation="MRTVLTLLLLAAALPASAATPASKPDPNVRVYRCVSSTGTVALQD
FT                   APCSSGRQQVLDMQRPQDPPPRPARAEPPAQVAAAPAREVRIVTVQPPQPMYECTTEDG
FT                   NRYTSDSPEGNPRWVPTWGPAYVGNGIGRPVNGGGIQRPPISVSPRPAISVQGGSGRGS
FT                   IRGSASIGVDTDQGGYQGGYNDGGYGGTVIVPYGNVQIRDECHALPAQEVCARLADRRW
FT                   ELIRRYNSALQSEREDLSREQRGIEARQQRDCGGA"
FT   CDS_pept        complement(588283..588846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67294"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67294"
FT                   /db_xref="GOA:Q2P833"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P833"
FT                   /protein_id="BAE67294.1"
FT                   /translation="MTHILTLDNAVATLTQGGVIAYPTEAVWGLGCDPRQEAAVLRLLE
FT                   IKRRPVDKGVIVVTSRVDVLRDWVDIDALAPARRQDVLASWPGPHTWILPVTARAPRWV
FT                   TGEHDGLAVRISAHPVVAALCAAWGAPLVSTSANLAGEPPARSRAALEPALLATIDGVV
FT                   DGEVGALAQPTRIRDARSGQILRD"
FT   CDS_pept        complement(588857..591349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0540"
FT                   /product="DNA topoisomerase I"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67295"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67295"
FT                   /protein_id="BAE67295.1"
FT                   /translation="MPKHLLIVESPAKAKTINKYLGKDFTVLASYGHVRDLVPKEGAVD
FT                   PDNSFAMRYDLIEKNEKHVEAIARAAKGADDIFLATDPDREGEAISWHIAEILKERGLL
FT                   KDKPMQRVVFTEITPRAIKEAMLKPRAIAADLVDAQQARRALDYLVGFNLSPVLWRKVQ
FT                   RGLSAGRVQSPALRMIVEREEEIEAFIAREYWSIDAHCRHPSQAFNARLIKLDGQKFEQ
FT                   FTVTDGDTAEAARLRIQQAAQGVLHVTDVASKERKRRPAPPFTTSTLQQEASRKLGFTT
FT                   RKTMQVAQKLYEGVALGDEGSVGLISYMRTDSVNLSQDALSEIRDVIARDYGTASLPDQ
FT                   PNAYTTKSKNAQEAHEAVRPTSALRTPAQVARFLSDDERRLYELIWRRAVACQMIPATL
FT                   NTVSVDLSAGSEHVFRASGTTVVVPGFLAVYEEGKDTKSSEDEDEGRKLPLMKAGDNIP
FT                   LDRIVTDQHFTQPPPRFTEAALVKALEEYGIGRPSTYASIIQTLQFRKYVEMEGRSFRP
FT                   TDVGRAVSKFLSGHFTRYVDYDFTAKLEDDLDAVSRGEAEWIPLMEKFWGPFKELVEDK
FT                   KDSLDKTDAGSVRVLGTDPVSGKEVSARIGRFGPMVQIGSVEDEDKPTFASLRPGQSIY
FT                   SISIEDALELFKMPRALGQDKDQDVSVGIGRFGPFARRGSVYASLKKEDDPYTIDLARA
FT                   VFLIEEKEEIARNRVIKDFEGSDIQVLNGRFGPYISDGKLNGKIPRDREPASLTFEEVQ
FT                   QLLADTGKPVRKGFGAKKATLKKNAVKDSAPKKPAAKKTATKTAASKTAAKKAPAKKAA
FT                   AEKGTKRVVKKTVSKAAD"
FT   CDS_pept        complement(591532..592806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67296"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67296"
FT                   /protein_id="BAE67296.1"
FT                   /translation="MTQWYYADAQRQRQGPVDTDTLRRRLSQGIIDRSSLVWREGLAQW
FT                   VALHEVAAELGLDSAVWATTEASGPTPADVPSEAPLSIAHSGDSASATASPAATSQPHD
FT                   HAAETSPWPPAVTGGGIASVNDAAATDRADDHQTVDSPGHLPRDQGPSSDASAWSTAPI
FT                   DAAATPLTSGPTPITAQDATSTPGYTPAAAPAPLPSAWDAPALAAPTASVALQDAPVVY
FT                   AGLWRRVAASILDSLITTVAVYLIVIPLVFVVALVTTRGDWGSALDAGSALGIAILVMS
FT                   CGIVLAIPTLYFAWMQSSRHQASLGKLACGIKLVRADSHGGRVGFWRNVLRYLAYKLIS
FT                   VLTLGIGVIVAAFMAGMTERKQAPHDKVCDTLVVDRWAFTEYPERQSRGLDTVSIVVLA
FT                   IYAVIQVLSVVAVAFMLAAIGMSRS"
FT   CDS_pept        complement(592848..593264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0542"
FT                   /product="fimbrial protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67297"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67297"
FT                   /protein_id="BAE67297.1"
FT                   /translation="MLGAVVGVFVLVGVIGMLAAIAFPAYHDYLGRAKLAEVMAELTPL
FT                   KPQIAEFLASEGRCPVNGDPGFKPPEQYASERLSSLRIGRFDSSECGIEALIHAPRSAK
FT                   IDGKALWLELDADAGSWHCSSEIDDTQLPPNCRG"
FT   CDS_pept        complement(593598..594071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0543"
FT                   /product="Smg protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67298"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67298"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P829"
FT                   /protein_id="BAE67298.1"
FT                   /translation="MKESILDVLLYLFEHYFSEDADLVRDRDSLQNGLIQAGFSPAEIS
FT                   KAFDWLDALSEQRPSVARPHVDGPVRIYHGQELDKLDVDCRGFLLFLEQHRILDADQRE
FT                   LVLDRAMALDQDELDLDDLKWVVLMVLFNQPGAEAAYAWMETQMFLDEPEPVH"
FT   CDS_pept        complement(594114..595256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0544"
FT                   /product="DNA processing chain A"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67299"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67299"
FT                   /protein_id="BAE67299.1"
FT                   /translation="MALIAPDVRALLILLLAGGRTPPRRKMLNSFRSAVESLAAGPEAW
FT                   RFAGCDEAQSALLQTPDPHALDAALRWCEQPGHHLIGWHDPDYPALLRHIANPPMALFV
FT                   DGDPNALWHPGVAVVGSRSATAGGRDHTRAFASSLASAGLSIVSGMAAGVDAIAHEAAL
FT                   AQRDCITVAVVGTGTDVAYPERHQGLRDRIAESGGAVVSEYLPGTAPVAAHFPARNRII
FT                   AGLALGTLVVEAAMRSGALITARLAAEAGREVFALPGSLHNPLARGCHHLIRQGATLAQ
FT                   EPAQVIEGLGQLSGELASALRERLAAPTELPRKTTAGAGPARSDPDYQRLWQALGHDPT
FT                   PMDSLVQRTELTAAALSSMLLIMELEGDVVTEHGRYTRNP"
FT   CDS_pept        complement(595328..596464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67300"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67300"
FT                   /protein_id="BAE67300.1"
FT                   /translation="MLIRLRTVVAAAMLTVATYAAAQAVGEHPDTYVVRKGDTLWDIAG
FT                   RFLQKPWLWPEIWQANPQIQNPHQIYPGDVISLAYLDRVGKGTIQPGPRQEAPINAIPL
FT                   ADVEPFLKNLRVVDDFDRLPYVVGLEGGRSRATTGQVAYVVGLENAQPGQRFAVVRPTV
FT                   KFSLPKHNEDLDAAGNITAGSGNIWKSFIAPSKRREFLGYELAQVNIGTITRSAAGGNS
FT                   KAATLLLQDSGREVRAGDRIVAVEAQPYDLQFIPHPPSEQALQTELRVLAISDAFIVGG
FT                   SRDVIAISGGAREGINNGTVFSIWRKGRTVSDRVKHSRFSRTDDDFSGPSGSTVGLPDE
FT                   YASHAMVFRTFDKVSYALVMESVKPTGLGYFVKHPDAQ"
FT   CDS_pept        596597..597109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0546"
FT                   /product="polypeptide deformylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67301"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67301"
FT                   /protein_id="BAE67301.1"
FT                   /translation="MVLLPILEFPDPRLRTKALPVDSAELASQAFQALLDDMFQTMYEA
FT                   PGIGLAASQVDVHKRFMVIDVSDEKNLPQVFVNPEIVSKQGEQLCQEGCLSVPGIYADV
FT                   SRADAITVRYLDRQGQAQELHADGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLA
FT                   KQRKHVA"
FT   CDS_pept        597503..598426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0547"
FT                   /product="Methionyl-tRNA formyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67302"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67302"
FT                   /db_xref="GOA:Q2P825"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P825"
FT                   /protein_id="BAE67302.1"
FT                   /translation="MRIIFAGTPDFAVASLRAAAQRHEVVAVYTQPDRPAGRGRGLTPS
FT                   PVKIEAIARGIAVFQPQTLRSPEALATLRSLNADLMVVVAYGLILPNAVLAVPTHGCWN
FT                   VHASLLPRWRGAAPIQRAIEAGDTETGVCLMQMEAGLDIGPVLLSQRIEIGEQETGGQL
FT                   HDRLAALGAQVLSDGLGLLRAGIRPVAQPQPAEGVTYAHKLDKAQARLDWAQPAQELAR
FT                   RVRAFNPWPVAEAILAGERVRLHGAVALELAHQQPPGSLLAASKQGIDIACGQGALRVR
FT                   VLQREGGKAITAADYLNARRDLLALR"
FT   CDS_pept        598426..599739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0548"
FT                   /product="Sun protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67303"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67303"
FT                   /protein_id="BAE67303.1"
FT                   /translation="MSAETSTAAGIASRLAAARVLTAVFDQGRSLKAELAATLPGIGDP
FT                   RDRALVEAICFAVIRRRPAYDVALRQWLERPLPPRDAELKALLMVGFAQLDVLQLPAHA
FT                   ALSATVDACRALGRPRQAGMVNAILRRAQREGFPAVSDDAGWPSWLRKQVRADWGERAE
FT                   GIFIASAQMAPMWLRVQHSRIDPAAYVARLAELGISAQTDVVLPDAVRLHSAVPVSQLP
FT                   GFADGDVSVQDGSAQQVADALTLAPSARVLDACAAPGGKAAHLLERHPGLQLAALDVDA
FT                   RRLERVQQTLQRSVPSAQVALQAADAADTDAWWDGQPFDAVLLDAPCSATGVVRRQPDV
FT                   LLHRRADDIDALCALQARLLDATWRTLRPGGQLLYTTCSLLARENQTQVDAFLQRTPDA
FT                   QAQPLGAQFGHAAGPGRQRFPGEQHCDGFFYALLLKAS"
FT   CDS_pept        599790..601511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67304"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67304"
FT                   /protein_id="BAE67304.1"
FT                   /translation="MLKNRASNDVCLLAMTAVLLIGAGLGLRDPWPADEPRFALVAKQM
FT                   VLSGDWLFPHRGNELYSDKPPMLMWLQALFYTLLGNWRVAFLLPSLLAALGTLACVYDL
FT                   GRRLWTRRVGLYAAWMLLFTLHFTFQAKKAQIDPLVVFWITLANYGLLRHLLIGPAWRW
FT                   WTLGWFAAGLGVITKVVGIIALLMLIPAGMAAARGWPGVRVHVRDRRFWLGPLFFFVAI
FT                   ALWFVPMMVTALTAGQPEYRVYLNDILLRQTAKRYASSWDHAQPVWYHLQSMATMWLPT
FT                   ILLLPWAIPAWRRRLKRRDPRYLLPLVWWLLVLVFFTIPSGKRDVYILPALPMVCLALA
FT                   PLVPGLLRRAGVQRLLFGFGLLLAAVFSAGGAAMLIGHPGFEQKIMDSRGVGNEATDPL
FT                   GWLLLAVGTWGIASLLLMRMRRSAFAVVSLLGAWWVAFGLVCYPIFNDSSSAGAVMRQA
FT                   GRRIGPDAQLGLVAWKEQNLLMADRPAQTFGFKVPWETQLQRGVAWQAEQPGQRWLMAQ
FT                   ETALLACVDRSRSQLVGVANRRRWWLVPADAVRGECVASSSERAVEAKEQGNLDTE"
FT   CDS_pept        601676..602953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67305"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67305"
FT                   /protein_id="BAE67305.1"
FT                   /translation="MNSLPTQPASLSPSAPTTSRAGVRIAELGAFALTALVVSMPSGLL
FT                   PFGLCLLLGSLVGGRHLRDGIAARDWSLRAVGWLTVAVIAISLLSIALFEHGLRDVGNR
FT                   SRFLVLPWAALWAYALQPRQIWLWRGALVGVFAAMLIALLQVMNGAGRAEGFTNAIVFA
FT                   DIALMLLVVGVFCRPDGNVRWLLGAAIATVVVIVLSGSRGVLLSLLATLGVLIWGAPWR
FT                   SARVRLLTFIGGPVLAVGVALSVPALTDQMRLGELQSDLQRYEVGDTDSSAGARIERLH
FT                   VAWDTLKAHPLTGVGVGRFDDAMHDLPACAADPSLFRCQLGHAHNDLAEWSATQGVPGL
FT                   LLLIAVYGVPLWVFARLHRRSGQQQFRGPAAAGVMLVISYALCGLTQSMFAHQVAASFY
FT                   TAMVGVLVGLAARQAQQTELSVASSR"
FT   CDS_pept        complement(603151..603975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0551"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67306"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67306"
FT                   /protein_id="BAE67306.1"
FT                   /translation="MSSSTAPNERPRISACIIAFNEADRLRNCLTSLAFCDEIVVVDSG
FT                   STDATAAIASAHGARVLQRAFDGYRSQKAFCVAQASHDWVLCLDADERVSDALRASIIA
FT                   ARDAGFTTAAGYRFARLSDYFGRFLRHGNAYPDRVLRLFDRRRGGWRGKREIHEAASVD
FT                   GAVATLAGDLIHYPYRSLMQQLAKTQRYAQMMAEHEHARGKRATWSKLVLAPAWRFWRG
FT                   YLLRGGFRDGWHGLIYAYVRANYVRQKTIMLWLLQHNQPVQDPARATDQRSE"
FT   CDS_pept        603979..605034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67307"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67307"
FT                   /protein_id="BAE67307.1"
FT                   /translation="MAEYLLFATERYALPILAPLAQALQACGHAVSAWFEGGARGLALP
FT                   GVREVGLRDALVLRPRAVFSAANWVPPFVSGAKVQLFHGFNVQKREDNRGHFRVRGLFD
FT                   LYCTQGPATTAPFRALAQREGHFAVVETGWPKLDPVFRDDGGRSAALRAPANGRPVILF
FT                   GSTFTERLSAGPALLDEIAADIARGAHYWLLTLHPKCAPALFDRYRALAGANARFIEPE
FT                   EVMAAQRAAEVLLSDTSSIVSEFVVQHKPVVTFRNRVPQPHMLDFQQAEQLPQQLVRAL
FT                   APDAALRSALASYADAIHPYRDGQSSERVIAATEDFIAGKLGGLRRKPLGAVWRGLQIR
FT                   RELGYWGPAQR"
FT   CDS_pept        complement(605200..606666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67308"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67308"
FT                   /protein_id="BAE67308.1"
FT                   /translation="MSAIEHPGNDEQRLHPLSWVFVLLQQIRQFLIPLAALVLFGSREG
FT                   RSDFADQIATGVVVAVLVAISVLRYVTYRYRIGSDGVAIGSGLLERCRRDIPFARIHNV
FT                   VVHQSLLHRLAGVAEVRLESAGGHKPEAEMRVLRLDQALALEDLIRRRATGADATAPQI
FT                   DEDSGSLLRLPMAEVIRLGLISNRGMVVVAASFGVIYQMIPRRTVSTFVEHNGELAYRY
FT                   VSQIHPGVAVTATLVTIATLAVLLAMRALSVALAVTQYHGFHLSESERRLTVERGLLTR
FT                   IRSSVALRRIQSWTLYEGLLHRLFGRRQLRVDTAVAGTADNEGSALKELAPIADPQHCD
FT                   ALLQRLLPGIAWPPAQWQSIATHCWWRLSLPTALVLLPLVAGLAWQFGSQALWLLAWLP
FT                   WSAFKAQRQVQRMAYAVDARFVAVRGGWWKRWWRVAELDKLQALQLQRSPLDRLTGTAT
FT                   LWLDTAGANATGPALQAQLGAALARRKLRW"
FT   CDS_pept        complement(606663..607199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67309"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67309"
FT                   /protein_id="BAE67309.1"
FT                   /translation="MHDAPPPHPAVIVEPDSAEPPAASQWQSLPRRGAYVAAVNGTLGG
FT                   GCAGLIAGGVTVAWLHAWHQWPAVLGVTALIALLGAWFAVKRHRLTHWKLDQHGLALQR
FT                   GHLWQSDTRVPISRVQHVDLRRGPIERATRLTTLVVHTAGSRLNAVALSGLDQDDAERL
FT                   RDRLARQLDHDDDAL"
FT   CDS_pept        complement(607276..608409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0555"
FT                   /product="riboflavin biosynthesis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67310"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67310"
FT                   /protein_id="BAE67310.1"
FT                   /translation="MSRPIPSPSAQSFGDPAAIRCERAASELRAGRPVLLTAADGQARA
FT                   VLALDSSTAQSHTAFARAAQARHYLFVTPTRAQVLGLRAPQGARVRLSDHSYDQIAALA
FT                   YLRDTTVPTQWTAGDALDAGGVEIARLGLLLPALLAVELRDVHDHAAFAGCQSLALGDL
FT                   SRGCATSAAAGYELVTRTPVPLRGLGMSEFVVFRGGVAQRDQLAILVGQPDLMSAVPVR
FT                   VHSSCLTGDLFGSLKCDCGDQLRHGLAKLKELGGGVLLYLDQEGRGTGIAAKMRAYGYQ
FT                   HAGLDTIDADAQLGFGPDERRYGSAVAMLQGLGIGRIRLLTNNPAKAERLRAAGIAVED
FT                   RIAITGDITAENEQYLRTKAARAGHALDVDALILAAQ"
FT   CDS_pept        608652..609173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0556"
FT                   /product="phosphinothricin acetyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67311"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67311"
FT                   /protein_id="BAE67311.1"
FT                   /translation="MHIVDCSQARHASAILDIFNEAIATSNALYDYRPRPPESMVGWFA
FT                   TKQAGGFPVIGVEDADGTLMGFASYGTFRAWPAFKYSVEHSIYVHCDHRGKGLGRLLLQ
FT                   ALIAAAQARGVHVLVGGIDASNQASIALHEQFGFTHAGTVREAGFKFGRWLDLAFYQRI
FT                   LATPADPHDD"
FT   CDS_pept        complement(609373..610287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0557"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67312"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67312"
FT                   /protein_id="BAE67312.1"
FT                   /translation="MTPDVRARLLYATAATVGRLPWPLLKRLADRLAWSWRKLNARESR
FT                   VARRNLELAYPELSAEQRAQLHAKILQSTARQTLEVLRTWTHPPAENLARLQRNGQELY
FT                   DAALASGRGVIVAAPHFGNWELLNQWLSERGPIAIVYRPPESEAVDGFLHLARGGDNVR
FT                   QVRAEGPAVRQLFKVLKDGGAVGILPDQQPKMGDGVFAPFFGIPALTMTLVNRLAERTG
FT                   AIVLYGWCERAGDDLQFALHVQPADPAVADADPVRAASALNAGIEQIARRDPAQYQWTY
FT                   KRYTLRPPGSGEANPYATERHPH"
FT   CDS_pept        610388..610828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67313"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67313"
FT                   /db_xref="GOA:Q2P814"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P814"
FT                   /protein_id="BAE67313.1"
FT                   /translation="MLALIQRVTRASVTVDDRIVGQIGPGLLALIGVEPGDRDAQTRRL
FT                   AERLLSYRVFSDDAGKMNRSLTDTNGGLLLVSQFTLAADTSSGNRPGFSTAAPPEEAER
FT                   AFNQLVDICREKHRGGVETGRFGAHMVVDLVNDGPVTFLLRP"
FT   CDS_pept        610937..612811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0559"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67314"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67314"
FT                   /protein_id="BAE67314.1"
FT                   /translation="MANERPAQQSDIKLLISKGLEQGYLTYAEVNDHLPDDLVDPEQIE
FT                   DIISMINGMGIDVHEVAPDAETLLLNDGNTGNREVDDTAAEEAAAALTALDTEGGRTTD
FT                   PVRMYMREMGTVELLTREGEIAIAKRIEEGLSQVQAALGVFPLSTEMLLADYEAHKEGK
FT                   KRLAEIVVGFNDLIEEADAAAAALAAAGPVAVDEDALDEDDDEDGDDAAAEEEVGPTGP
FT                   DPVEVATRMQNLANEYAKFKKVYAKNGAEHKLVVKAREDMAAIFTTLKLPLPLTDALVT
FT                   QLRGVVNGIKDHERKVLHLATTVARMPRKDFIRSWEGNQTNLEWVEDALKRKQKWSSAL
FT                   RDVKDQIISEQQGSMEMEKASYLTLGEIKEISRAMAYGEAKARKAKKEMVEANLRLVIS
FT                   IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQAR
FT                   TIRIPVHMIETINKLNRISRQMLQQFGREATPEELAKEMDMPEDKIRKVMKIAKEPISM
FT                   ETPIGDDEDSHLGDFIEDTNVESPIDNTTNINLSETVRDVLAGLTPREAKVLRMRFGID
FT                   MNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEQLRSFLDID"
FT   CDS_pept        613004..613324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67315"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67315"
FT                   /protein_id="BAE67315.1"
FT                   /translation="MFLQTSRHVLTTTSTLADEWKRDRLMSRQRRFETTTYHEHEIRVR
FT                   VEQASPDANWTLWVDVYALGGRRQPRIAGRGPGYETYQEAIAHGFRAGRQLVDGQFETT
FT                   DA"
FT   tRNA            613808..613883
FT                   /gene="XOOr13"
FT                   /product="tRNA-Met"
FT                   /note="Found by tRNAscan-SE"
FT   CDS_pept        complement(613953..615140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0561"
FT                   /product="phage-related integrase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67316"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67316"
FT                   /protein_id="BAE67316.1"
FT                   /translation="MARGRKRRFNPNIPGHIEQEALPKGIYWENGRWYMHEDHPDGGRQ
FT                   VKRTVAFRSARLSELHAIAESRLRGDVRGTLRYLFDRFHEASEFKELQHDTQKDYRRYA
FT                   DTLANYVRKDGSKLGGVQLEHITTPVVQRLLETFANGRPATRLQQALPPTPSKANHLYR
FT                   YLRRTLAWGVRHGYCKENPAIGVLQAKEAKAFRMPTPDAFEAVLQFARERGALKPHTKG
FT                   SFPSYLPPVMVLAYSARLRGIEVCSLTDAHRLEHGVHASRRKGSRDTLTTWDAHMTEAW
FT                   EALLARRSEICNKPGRNFPIPMKPEERFFLIEQTGNPIVKSSLDSAWQRFIPAAIRDGV
FT                   IKSEERFSLHGLKHRGVTDTEGNRGDKQDAAGHVSSSMTDRYDHELPVVKPPRRR"
FT   CDS_pept        complement(615361..615567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67317"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67317"
FT                   /protein_id="BAE67317.1"
FT                   /translation="MSDEAMEVHRLQCEARHWLQQGYTDARSVSLLQQMIAAKRGAQAA
FT                   QDLRDEMRQQWKTRRQWQQEQLL"
FT   CDS_pept        complement(615564..615836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67318"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67318"
FT                   /protein_id="BAE67318.1"
FT                   /translation="MTQREISHPEPLPAYRDGHAGRHIADGRRLQAGGGHVIECPCGRT
FT                   KKHAAFDQALAEWKRMHRIRVPRQAAPADSNVVQLGLRLRGGTSQ"
FT   CDS_pept        complement(615833..616078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67319"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67319"
FT                   /protein_id="BAE67319.1"
FT                   /translation="MNLDRVIAVSRAAQAYDDPGPLSTGEALTAALVLNRHDWLADMDY
FT                   TIAQALDRIDEDSIAHLRQAERAIGNGAGATEENPA"
FT   CDS_pept        complement(616075..616191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0565"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67320"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67320"
FT                   /protein_id="BAE67320.1"
FT                   /translation="MLANDKALAERTAQRMRIQTVAIAEACVPVGAAWRMPR"
FT   CDS_pept        complement(616222..616350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67321"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67321"
FT                   /protein_id="BAE67321.1"
FT                   /translation="MAESILVYGPMASGKTLNAEAICQACGLKRVVELDERLQRKG"
FT   CDS_pept        616675..617172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0567"
FT                   /product="ISXoo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67322"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67322"
FT                   /protein_id="BAE67322.1"
FT                   /translation="MAQQVRRHERARCQAVQGPGGREHATEEVAGRAGVSERPDQGCAA
FT                   KTMVSAPARRTLVREWIEGGASERCALAAIGMSASALRYRPGEDRNVELRERILALAHR
FT                   HRRYGVGMISLKLRQEGRLVNYKRVERLYCEQQLQVRRRTRKKVPVGERAPLLRPTKAN
FT                   PV"
FT   CDS_pept        617176..617661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0568"
FT                   /product="ISXoo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67323"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67323"
FT                   /protein_id="BAE67323.1"
FT                   /translation="MDVVFDRTAEGRAIKCLVIVDDTTHEAVAIDVERAISGHGVVRVL
FT                   DRLAHSRGLPKMIRTDNGKEFCGKAMVAWAHANGVQLRQIQPGKPNQNAYVESFNGRLR
FT                   DECLNEHWFPTLLHARTEIERWRREYNEHRPKKTIGAMTPAAYAQQLANSDIITPGL"
FT   CDS_pept        complement(618014..619249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0569"
FT                   /product="ISXoo13 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67324"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67324"
FT                   /protein_id="BAE67324.1"
FT                   /translation="MTAKVFEAALGIGAPWSVGAVEFDEATKVLTVPVDFKPGTRFKVS
FT                   GQKGLHPVHDTVVKTYRHLNFFQHECYLKVRTPRVKLGDGSVRLVEPDFAGRLSGFTLL
FT                   FEALVLMLSQQMPFAAVARIVGESAYRCMQVCNRYVEMALERADFSDVTSLAIDETSRA
FT                   RGHDYVTLAADAQARRVIFVTEGRDAKAVKALADDLAAHGCPPEQITSVSIDMSPAFIK
FT                   GVSDQLPNAQITFDKFHVVGHANAAVDKTRRIEQRTEKSLKGMRWTLLKDVFSLKPTAG
FT                   AALHGLITAPKLTRTARAWLYKEQLREALDRKQINVMREMLKHWCVCVMRSKVEAMKEV
FT                   AALVRRHMDGIVAWAQTRQTNGFLEAINGLFQSAKRRARGFKRLSTIKTVIFLIAGKLD
FT                   FQTFNPHARQPT"
FT   CDS_pept        619318..619707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0570"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67325"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67325"
FT                   /protein_id="BAE67325.1"
FT                   /translation="MEGLGLAAPGIYGSVSTLIAALGGMVALAEKMGPRVTIIEVAKAG
FT                   TKTEMFAVLSAVSASIYLGAAVGSAAVASGRTLSCGTSLSDVLAYSSRNGLSSDSVRTV
FT                   LITRREIYDYKRPGRRYYASLAAAV"
FT   CDS_pept        complement(620030..621028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0571"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67326"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67326"
FT                   /protein_id="BAE67326.1"
FT                   /translation="MVGPSLHRDQIMAMNRVQFQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRYLAETMWRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTMFTAESAC"
FT   CDS_pept        complement(621218..621619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0572"
FT                   /product="ISXoo15 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67327"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67327"
FT                   /protein_id="BAE67327.1"
FT                   /translation="MLQIERGRGQSVRAISRILGRSPSTLSRELAKQDSTTYCARSAGK
FT                   RYRARRQLSVRQRRLTPGTPLFQLVRDHLVLWRWSPQQIAAKLSHMYPDDPAQRVSHET
FT                   IYASIYAHPRGGLKKELVQALRQHKPKRG"
FT   CDS_pept        622234..622956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0573"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67328"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67328"
FT                   /protein_id="BAE67328.1"
FT                   /translation="MTPAISICDLHVGYRGRAVLQGLTLDVAPGTVYALLGGNGAGKSS
FT                   TLSTLLGFVKPTSGSLRVDGVDPVADPGKARARLAYLPENVALYEHLSALENADYLLAL
FT                   AGQRRSQATIGEAFAAAGLQRDAWAQRLAGFSKGMRQKVAIAVATLRQVPVLLLDEPTS
FT                   GLDPRAIADFNRLVSSVRERGGAVLMVTHDLLGAVDVADRLGFLENGRIADDIGAGDSG
FT                   FDVRTLHARFARPQDEAA"
FT   CDS_pept        622943..624403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67329"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67329"
FT                   /protein_id="BAE67329.1"
FT                   /translation="MRLREVVRMSPVLLVAREELRYMARNRSAAIGVVLLMLLTLVAAL
FT                   TAAHHQCEVADFRARQQQAAQQAFEAQPDRHPHRMVHYGHFIYRRLPALAAFDSGVDAF
FT                   TGNSMFLEGHRQNTANFGDVRQSSLLVRFGQLTPAFVLQVLAPLLLVFLGYGAVAREQE
FT                   TGTLRALLLQGATRRQLLGGKYLALAAVAGACLLPALVCLAPIALLPGHAVLVALLVLA
FT                   YSVYLLVWCALVLAISMLCRRGRDALLVQLAVWVWLALLVPRVAPDVASAAYRLPTRLE
FT                   TDVAIQRDLRTVGDSHNPDDPHFAQFKQQTLARYGVQRVEDLPVNYKGLLALEGERLTA
FT                   SLFERYAGRDASIQQQQNLLVRAFVLLSPTVALREVSMTLAETDLRAHLRFLAQAEHYR
FT                   YTLVQHLNQLQTDAVSMADDTAQDAGADRRKRISSEHWHEIPVFAFQPATTTEVIGTAG
FT                   AALGLIGAWLLAALCMLVAAGRRVGVVR"
FT   CDS_pept        624403..625671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67330"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67330"
FT                   /protein_id="BAE67330.1"
FT                   /translation="MVLWKYELLLLLRARAALAGLLLLAMLTVCSLLSGQYVIAAQRDN
FT                   IAKIAALQREDSAAVEDYVARSNDAGSAAYYSSYPTWDRPSPLAFAAVGMRDVSPYILR
FT                   VRALGLEAQIHDGDSYNPELALAGRFDYAFVLVFLLPLFVIALLFDLRSGEREAGRARM
FT                   LAALPGARTALLVRRVVVRAAAVLLCVSVPFVIFATLNAVPLLQQLAVLALGAGYLLFW
FT                   VMLAVLVGRIQWRPAAHATALATCWVMLALVAPALAHVAINQTVPVNQGTEIARLQREA
FT                   VNHAWDIPRQDTMRAFYARNPQWADSAPLTTAFHYKWYFAFHENGDQQVAPQVAAYRNG
FT                   LQRREALAQRVASVLPPVALQAALTRLADTDLQAQLAYQDRIRAYHRALRTFYYGYLFR
FT                   DRPFTRDDFGRAPRFDATADPAS"
FT   CDS_pept        625761..627902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0576"
FT                   /product="ferrichrome-iron receptor 3"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67331"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67331"
FT                   /protein_id="BAE67331.1"
FT                   /translation="MPVFSRRRMRHTLPLLSLLAWACSIACAQADALRARELDAVQVRS
FT                   QYTPYRELSITGATKTDAPLRDLPISARVLDRTLLDDAGVTDLAGALELASGITKANNL
FT                   GGLWDSYSMRGFTGDPNFSSDYMVNGFNASRGYNGLRDAANTQSIEVIKGPASALYGRG
FT                   EPGGVVNIITKKPLFQPQNSVDVSAGRFDSYRAAIDSTGPLSESVAYRLNVMHKDQHSF
FT                   RDTVDSDNTLLAPSLLWMPTPETTVSYELEAVRIHAPFDRGVTAIDGDANRLPASRFLG
FT                   EPRDGDIDLHSTGHQLFVVHGLNQTWSLQGGATYRESGMRGFSTEPWTLQADQRTLRRE
FT                   RRYRDYQGRDIAARAELLGSLQAGRVTHNVLLGIDGNRFDDSRFQQRARSAATPYSIDV
FT                   LAPRYGVAQPGQLAAITDTEERQQVWGAYAQDQIDLGARWKALLGLRYDHYEQDLDNHL
FT                   RGTTQRASDGVVSPRAGLTFLVDDALSLYASAAAGFRPNSGVGANGQSFAPEKSRSLET
FT                   GLKYVQPGDGLEATVAAFRIDKKNVLSLDPADTSFSLPVGEMRSQGVELDLLGRLTPHL
FT                   AASVGLAYTDPQVTRSSAAAAGTGLAEGRRFPNVSRFSGNAFLNYEQPLTGKRSAAIGM
FT                   GVSHTGERLGSVDSNTDFVLPAYTVWRVVGHYDLSDRLRLYAKVENLTDRRYAAFSYSE
FT                   QWVYPGAPRSWTVGVHLRF"
FT   CDS_pept        complement(627987..628652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67332"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67332"
FT                   /protein_id="BAE67332.1"
FT                   /translation="MSKPALSARTQLQRWRSQGADQLDPVRFHLMESLAARADAQADAV
FT                   REVLEHTLGALVDGYATALKQVTRRRGGRAAATSSTPASSPSSALAALTAQMAGHAALM
FT                   EVDSRKTASADAMLFPELPALDDFRRTWTTVRTASQVRQSLQDAPKDAGPLNSSVLVHR
FT                   CITLMRECSPGYLQHFLGYVDALSWLEQLHSGGALANEAAAQTAPGKKHGKRPSKRRG"
FT   CDS_pept        complement(628649..629323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67333"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67333"
FT                   /protein_id="BAE67333.1"
FT                   /translation="MSEEIENDGELGTPIWAAFGDLMSVLLGAFVLILVGVIGVQLQLS
FT                   SRLDEAVKQRQAEAQRRQTLEQALAAPLAAGRVTLVDGRIGIRGNVLFAFNSDELQPEG
FT                   REVLKSLAAPLAQYLRAREEILMVSGFTDDRPVLGGNRRYADNWELSAQRALTVTRALI
FT                   AEGVPASSVFAAAFGSQQPVDSNADEARRAKNRRVEIAPIARPSSSRAAASKQPATAAA
FT                   PR"
FT   CDS_pept        complement(629320..631977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67334"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67334"
FT                   /protein_id="BAE67334.1"
FT                   /translation="MFRTLVHVCVFLVGLLGVCWVGIGYLGSNPLGACVAAVIGACYVA
FT                   GALELYRYRQATATLEAAVDGLTTAPSALSDWLQAVHPGLHHAVRLRIKGERVALPAPV
FT                   LTPYLVGLLVLLGMLGTLLGMMATLKGTGVALQSATDLQAIRGSLAAPVEGLAFAFGTS
FT                   IAGVATSAMLGLLSALCRRERLQAVQRLDLKIASELHPHSNAYQRGEAFKLQQQQSALM
FT                   PALIDRLQALMHNIEQHSIAADERVAAQQADFHAKSEAAYARLATSMEQSLQAGVAESA
FT                   RAVGVALQPAMDATMASIARDTAALQAHVTQAVQQQLDGITQGVQTSASTAAAHWKTAL
FT                   AAQERAQQTHNAQLQITLEQIAGHSVALQESVSSAVQQQLHGVSAAIEQSARTAAEHWQ
FT                   VALAAQERTQHTLTEQLQGTLEHIDQRSVAVQDSVTQAVQQQLSALNDGFARSTAATAD
FT                   TLAAVLAEQQRATAALSTQLQATLEQLGQQTSALHEGVQQAVQQQLDGLRSGFATSTAT
FT                   AAATWTAAVAEQQRTNHALTQALQGTLTQFASTFEARSAALVDAVSQRMEQSRSDTASA
FT                   WSDALAQQQQASATLSSQHHSALAAATASFDAHAAALVGTLQQLHTDLQAALEARDTER
FT                   LALWSERLGAMSTALTTQWEQTGERVARQQQAICDTLASTASALSTQAQAQASATITEV
FT                   SRLMQIASEAPKAAADVVAELRQHLSESMVRDTAMLEERSKLLATLDTLLNAVNHASTE
FT                   QREAVDALVTTSADLLQRVGSQLTEQIGSETGKLGEVAAHVSGSAVEVASLGEAFGMAV
FT                   QLFSGATSELNERLQHLATALDASLARSDDQLAYYVAQAREVVDLSMLSQKQIIEELRQ
FT                   LDRGRGDTAEAETV"
FT   CDS_pept        complement(631988..632698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67335"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67335"
FT                   /protein_id="BAE67335.1"
FT                   /translation="MSGPAFIRLLARLSDTHIAQCNHALADRLSQWIDWTRAVAVSKAL
FT                   DGKLPDTDDLPEPRPLDAEACARARAGLATSSVAELDALVVRVRAETRNAALADAPVAA
FT                   PDYAPFRQHYLAMQRAMRTATGDLRGRLRDLLALVSTDMARLAEVDAVMELTLSPREQS
FT                   LLNTVPGLLGAHFERLRETAHAHQPPAGDDAAPRAVSDGWLDVFRKDMQSVLLAELDVR
FT                   FHPIEGLLAALRTR"
FT   CDS_pept        633064..633276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67336"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67336"
FT                   /protein_id="BAE67336.1"
FT                   /translation="MDRSDIQVSDLLVLELQGFHDAYGNGPDFWDAYQRIMGIAALAGG
FT                   NMIALANEMASLAQGLGATKRAQLL"
FT   CDS_pept        complement(633697..633918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67337"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67337"
FT                   /protein_id="BAE67337.1"
FT                   /translation="MNNSRRQSMTFSNQPGKPRLSEQRLAADLDAFQQSGGAIERLGDT
FT                   PLRQEKKRVTPEAAPATAVKPVVEADAE"
FT   CDS_pept        complement(633928..634179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67338"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67338"
FT                   /protein_id="BAE67338.1"
FT                   /translation="MVDPSDRIPQHLTSVTPQGWHVMARDEQGWCVAIDAARMCCSIYE
FT                   TRPAICRRFVMSGPYCRDVRATYDDQRRRGIPLTLYNA"
FT   CDS_pept        634634..634798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67339"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67339"
FT                   /protein_id="BAE67339.1"
FT                   /translation="MRTSNQIPSPPDHANGHDQDHDKTKQDALQDDAVEETFPASDAVS
FT                   PFVPAKPLD"
FT   CDS_pept        complement(634883..635569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0585"
FT                   /product="putative Zn-dependent alcohol dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67340"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67340"
FT                   /protein_id="BAE67340.1"
FT                   /translation="MHDEQVLFLSDILPTGYQAVIDAGITQGSTVAIFGAGPVGLMAAA
FT                   CCRMLGAERIFMVDRHAYRLDFACKIHGVIPINFDEVDDPADVIVSQTDGRGVDASIEA
FT                   VGFKAEDSALETALTNLKLEGSSGVAIRQCIAATRRCGVVSVPGVYAGFIHAFLFGDAF
FT                   DKGLTFKMGQTHVQKHMPHLLECIGNGRLKPSSIISHRMPLTDAARGYALFDKKQDDCR
FT                   KVVLTP"
FT   CDS_pept        complement(635886..636362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0586"
FT                   /product="ISXo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67341"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67341"
FT                   /protein_id="BAE67341.1"
FT                   /translation="MIVDAQSVKNSDTAGQKGYDAGKKVSGIKRHIAVDTQGFPHAVAV
FT                   TTAEVTDRQGALEALKRCRSGLGRVKRLLCDSGYTGDPFAEGVQDILGKHVTVQIAKRS
FT                   ELHTFKVMPKRWSVERSFAWLEKNRRLWKNCERRLNTSLQFIHLAFLALLLRRS"
FT   CDS_pept        complement(636328..636684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0587"
FT                   /product="ISXo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67342"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67342"
FT                   /protein_id="BAE67342.1"
FT                   /translation="MREKNDPSDVSRERFEQIRPILEQARKRTKPVTVDMYEVWCAVLY
FT                   LLRTGCPWRALPSDFPKWRTVHSYFAKWSEVDDEGMSLLERALKKSGWRGPRETGAQGL
FT                   QHVLDRGRAEREEQ"
FT   CDS_pept        complement(636769..637785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0588"
FT                   /product="cyanide insensitive terminal oxidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67343"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67343"
FT                   /protein_id="BAE67343.1"
FT                   /translation="MELSDWLPVVWFGVIGFGVLMYVVLDGFVLGLGMLAPFARDEQEV
FT                   DLMMNTAAPIWDGNETWLVLGGAGLFAAFPTAYAVILSGLYLPVLSMVMALVFRGVAFE
FT                   FRFKAQRSRRLWTLSFIAGSIMTAFAQGIILGALVEGIPLENGRYVGGVFGWFSPFTIL
FT                   TGAALVSGYALLGSTWLILKTEGRTHTLARQLTKPLVGVVVTFVLLVSAWLPFLSSHVM
FT                   ARWFEHGNFWWLSPIPLMTAVVALALWRSSDISRSDASPFLLTLAIFVLGFIGLVLGMW
FT                   PYLVPPSYTIWQAASPPSSQIFPMVGLVILLPLVLGYTVWSYRVFRGKIAADVGYHH"
FT   CDS_pept        complement(637776..639185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0589"
FT                   /product="cyanide insensitive terminal oxidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67344"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67344"
FT                   /protein_id="BAE67344.1"
FT                   /translation="MEALLLSRIQFAFVISFHVLFPAFTIGLANLLGFLEWRWLRTHDD
FT                   AWKRLYFFWLRIFAVSFGMGVVSGIVMAFQFGANWPELSRIVGSVIGPLLSYEVLTAFF
FT                   LEASFLGVMLFGWGRVSEQLHFFATCMVAIGTLVSTFWILSSNSWLHTPRGYAMVNGIV
FT                   QPVSWMQIIFNPSFPYRLVHMALGSFITTCFVVGGVGAYYVRKGLHVDAGARMLRLSVA
FT                   FAAIVLPIQIVVGDQHGLNTLEHQPLKVAAMEAHWHSEGNGAGVPLVVFALPNAEAQRN
FT                   DYEMAIARLGSLILTHSADGDITPLTSVPRDQRPPVAPVFFAFRIRVGLGMAMLLLAWI
FT                   SAIAWWRGRLHATPLILVWNVMLPAGFIALVAGWFVTEIGRQPWVVYGLLRTADAVGPQ
FT                   SPVTVAVSLLVYVLGYAFVFGFGIFYLTKLVRAGPQASRDGPDVAGGEHTPARPLSAAD
FT                   TSLEQENTPWN"
FT   CDS_pept        640302..641582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0590"
FT                   /product="transcriptional regulator NtrC family"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67345"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67345"
FT                   /protein_id="BAE67345.1"
FT                   /translation="MDRLSCAIIDDDVEFCDQVVELATDSGFRAKGIHTLGEASRWLDS
FT                   NFPDLLVVDVGLPDGSGFDLIERLDPDHTPQIVVVSGDYARETQGRAQQFGVSEFLTKP
FT                   FAPERLERVLGGLREAQQGNLGIVGKSDSIVMLRKDIVRVAPTDLNVLVTGETGTGKDL
FT                   VARAIHRVSGRSGRFVPVNCGAIPEELLASQLFGHERGSFTGADRRHAGFLEQAAGGTL
FT                   FLDEIGEMPKRLQVYLLRAIESRSFMRVGGNEEIVLDARVVAATHQHVQREQAVLREDL
FT                   FYRLNEYPIQVPPLRERRGDARLLGLRVIDELNVKYGKRKLPTKSLLRYLACHVWPGNV
FT                   RELRSFIHYLYLRSDGDLLSAPDVEQAVPQADEDGLLIPAGWTMRQAEDAMIESALART
FT                   RFNKKAAARELGISVRTLHNRLSDKDA"
FT   CDS_pept        641582..641848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67346"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67346"
FT                   /protein_id="BAE67346.1"
FT                   /translation="MTDAPRGQRRELLHELRNRLNVMGFALYALRNETSKPLETLRTAH
FT                   QSAVELLNQLGEAERALQQAGERPGDTAPAKTPISDWPARSGG"
FT   CDS_pept        complement(641817..642197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0592"
FT                   /product="regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67347"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67347"
FT                   /protein_id="BAE67347.1"
FT                   /translation="MHETALTGRRILVVEDDLLLAESLNDLLVEAGVRVLGPVGNVPDA
FT                   LSLVASGQAIDGALLDVNVRGHAVFPVADALMERGVPFSFCSGYDRYTLPARFAHLSYC
FT                   MKPYNPLTITTLLSHQTEPANH"
FT   CDS_pept        642318..643805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0593"
FT                   /product="putative methyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67348"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67348"
FT                   /protein_id="BAE67348.1"
FT                   /translation="MHTGVGRQVLHGGLPCFEQSSPIAPELSVANDSAAMTDDEISSTE
FT                   TAPDIATQPPLFVLGVGAARLDAGRLAELLDAVAGAANLAIMLLLRDRQLLDEAHLRAL
FT                   LGKQATLLSVPFDGEKLQPGRFYLPPADTVVTLEEGRIRLRALPNGESDHGLIDSFFVS
FT                   MAHDQDGNVIGLIMGRFDGDGTLGTAAIKECGGLALAVDDASLHGLDLRSANNPAAITD
FT                   DILPLPQVAARIAAHMQRHHGFGHPGPLGLCNGSESDKLSQIAAILRNTTGHDFHGYKR
FT                   ATFLRRVQQRMQVAQVEMLEQYLHILRYRFDEPLQLFNDLLIGVTKFFRDRRGFELLEQ
FT                   QVIPRLFQGKHTDDSMRVWVLGCSTGEEAYSLAMLLREHAETLDSAPRIQIFASDIDGR
FT                   ALATARVGRYASSIVGEVALERLRRWFVKEGDTYVVNKELRELCVFSQHSIVKDPPFSR
FT                   LDLVSCRNLLIYLDAELQNRVIPIFHFGIRPGGYLFS"
FT   CDS_pept        complement(644502..645716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0594"
FT                   /product="D-amino acid oxidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67349"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67349"
FT                   /protein_id="BAE67349.1"
FT                   /translation="MHRRHFLRSAGVALAAASTASRAATDKALAIASTAQPQTPPGTSP
FT                   APFAAMPPLAPMRASVDRIIAINGCTRPFRAQGPRIEAERIGRKTMVHNYGHGGSGWSL
FT                   SWGAAEQALRLVHAADPAARELAVIGCGAIGLTTALVAQRAGLRVRIYARERLPDVRSF
FT                   YATGVWSPDSRVCTSEYATADFKTRWEQMARTSFRRYQTLLGLPGEPIEWRDGYVLSDV
FT                   PFDQPIASTEAHEPDYPPLERELIDDLGPGSQPVAAGSHPFPVPFVRRYSQLTFNISAY
FT                   ARILMEDFLQAGGELYTREFEHPRQFGDLHEKILINATGYGARALLGDESVIPVRGQTA
FT                   RLIPQPEVTYGLVWRAHNLNVVPRRDGLLVQAQGAHDFNNADGTPDRAASEAAVRELAK
FT                   LFATS"
FT   CDS_pept        645991..647322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67350"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67350"
FT                   /protein_id="BAE67350.1"
FT                   /translation="MLAASHPNALPSVSASVFLIVRIVFVWAAALVVAGLMWAQLFGVI
FT                   GPIFALACMVLLTLALMSSITHVRRVRLIADRLDHTTLSTRQRRQIEVPLDVQASFAVT
FT                   EEAVRALPRVQDIECAPGSLLIRAKVRRIDPYEGRQLSRWNLFARFAITHNQILATIAP
FT                   GQGTSSVTVLCEPDAGAWVDLFAVDEGSNYENAEAINRAVVRRVGEQRRDAQAAAEQSV
FT                   MEKELAVARLNLLHAQVEPHFLYNTLASAHVLARTDPPRAEIMIGDLIQYLRRSLPSAD
FT                   GAIATLGEELERTQAYLEILRIRMGTRLALQVEVPYALRALPLPSMMLQTLVENAITHG
FT                   LEAKPGGGTVWILARRHDDHATLTVADDGQGLNTHSQGTGIGLKNLRERLKLIYADKAT
FT                   FAIVSTFPSGVAATTSLPLPAQLVAAPSPPPMPTVAAHAPQVQA"
FT   CDS_pept        647319..647816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67351"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67351"
FT                   /protein_id="BAE67351.1"
FT                   /translation="MSALRAVVAEDEALLRQSLLTLLAEVCPQLQIVGDCEDGASALEV
FT                   IATQQPDVAFLDSRMPGLTGIEVARAMRQVGPRSQVVFVTAYDQYAIDAFEHGAVDYLL
FT                   KPISHERLQAAWQRVQHAPLLASRMARCWRPCCSVCRHARRRPVLRRRWPGSPPAAAAR
FT                   RA"
FT   CDS_pept        647723..648103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67352"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67352"
FT                   /protein_id="BAE67352.1"
FT                   /translation="MLQRLSARPAAASAAPPLAWLTASSGRETRLIALEEVAYFQADQK
FT                   YTTVMTAAGEAVLRTPLRELLDVLDPQVFKQIHRSTIVNMKAVASVVRDDTGKGRLAVR
FT                   GRSETLTVSQPFMSLFRGMQVR"
FT   CDS_pept        648277..648546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67353"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67353"
FT                   /protein_id="BAE67353.1"
FT                   /translation="MRLIASLVYCLLALAGCHERNGTTSITRATRDVIFSKTLTTATTT
FT                   NVHCLASDSGHCYYLIYEEQCAPRRAGTPPARRPAPARHWTVLR"
FT   CDS_pept        648802..650397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0599"
FT                   /product="amino acid transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67354"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67354"
FT                   /protein_id="BAE67354.1"
FT                   /translation="MSEHALRRDVGPFALMLTGLGSIIGSGWLFGAWRAAGLAGPDAVW
FT                   AWVLGAAIITTIAVSYAELGAMFPESGGMVRYSHYSHGSLVGFIAGWANWIAIVSVIPV
FT                   EAEASVQYMASWPWAWAQGLYAQAPGGAGELSVPGLLISAVLVLVYFLLNFWSVKLFAR
FT                   SNTLITVFKLAVPAATGVALIASGFHSENFSVGVHGDAQVLDLAAVLTAVATAGIVFSF
FT                   NGFQSPVNLAGEARNPGRSIPFAVLGSIALATVVYVILQVAYIGAVPPDLLAKAGWHGI
FT                   DFRSPFAELAIIVNLQWLAMLLYIDAFVSPSGTGITYTATTARMVYGMEKNGTMPAALG
FT                   KLHPVWGVPRMAMFFNLAVSFVFLFFFRGWGTLAAVISVATIISYLTGPISAMALRRHA
FT                   PELHRPLRIAALPVLAGVAFVMATELLYWARWPLTGEIILLIVVALPVYCYYQARQGWP
FT                   DLRRNLKGAAWMICYLPMIALLSWAGSSKFGGHGYLSYGTDLAMVAAVGVVFYIWGVRS
FT                   GWRTPSVEKPVAQA"
FT   CDS_pept        complement(650729..651610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67355"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67355"
FT                   /protein_id="BAE67355.1"
FT                   /translation="MAAASGVQCSKIGDGAQAGVGGSALNPPEFSNLCARAQHGVVTAA
FT                   PGALPCTAKVLELRPSCTHCIASACRTHQGTGRGQCSKSFVPAIRQELVMIALFQGLGL
FT                   LLQDNALHRLPFDEQVAHWRDKTDAQLDEELTLLKVAKKQWVIASIIGWQAISLVLLGV
FT                   ITHQLWQNDYHLTFSRIVIIFTSWTSILFVMWYIADLFDHSAGFERWLRAFNSRARVTP
FT                   DADSVECVADALDMTRRYPEVLRYKQEVSSRRELRHEDIINMREMGRLRRYTELLRELD
FT                   RFDGAPRLVVNS"
FT   CDS_pept        651945..652802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67356"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67356"
FT                   /protein_id="BAE67356.1"
FT                   /translation="MLDAFPRGQSTIEYDQPLGDPGIFGPDSITWRIHSEFPGMLSGGL
FT                   CALMLQLLHPRALAGVYDHSDFRTDLIGRLRRTTNFVAGTTYAPRAEAEQLIARVRNIH
FT                   SHIRGRTADGVPYDANDPQLLTWVHVTEAYGFLQGCRRYCRDVPADIADRYYDQARRVA
FT                   EALGAADVPASEAQVDAYFASVLGELRMDARARSARHPHQHPAAGARGRPVAPRVSRCW
FT                   HGLVAQLGWRHARPQHHATRAGARIGTIATQHVAAVSHGLARRTVCARVPAHGVAASHV
FT                   AGVA"
FT   CDS_pept        complement(653141..655246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0602"
FT                   /product="metallopeptidase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67357"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67357"
FT                   /protein_id="BAE67357.1"
FT                   /translation="MAALHRPVLIAVMSAALLTTAACHRDGATPAASTHPTPPPSKPKL
FT                   GDFGFDMAGMDRSVAPGEDFFDYANGNWVKTTQIPQDRSSFNSFVSIAIETERHSRDII
FT                   EGAAANDRVTGEDKQIGDYYAAYMDEASIEAKGVRPVQPELDAIAQLDDKQALARTLGG
FT                   QLRADVDLLNSTNFYTDRLFGLWVSQDLHHPGRYVPYLVQGGLGMPERSFYLDGGRMAQ
FT                   LRAAYRAHIVTLLELAGISDAPAKAERVLALEVAMARVHATPEQTNNVQAGANAWKQSD
FT                   FTHNAPGLDWALFFDAAGLSAQQDFIVWQPRAVSGLAALVQSEPLQTWKDYLSFRALDR
FT                   ASPYLSKAFADERFAFYGTTLEGTPQQRQRWRRGIDATNAALGQAVGKRYVQKYVRAQT
FT                   KTRAEEMVKNIITAFGKRIDALEWMTAETKQHAKAKIAGLTVAIGYPDTWRDYSGLDVR
FT                   RDDALGNVERAQLFEYRRNLAKLGKAVDHREWYMLPQEVNALNVPLENRLIFPAAILQP
FT                   PFFDPAADDAVNYGAIGEVIGHEISHSFDNMGALFDEHGELHNWWTPQDLKKFESAGNA
FT                   LAAQFSAYKPFDDLSVNGKLTLDENIADVAGLATAYDAYQLSLQGKHPQTIDGFSPDQR
FT                   FFLGFAQAWRGKYRDAALRNVVLTDVHAPGRFRAQTVRNLDAWYPAFDVTQGQQLYLPP
FT                   EQRVKIW"
FT   CDS_pept        complement(655361..656056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67358"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67358"
FT                   /protein_id="BAE67358.1"
FT                   /translation="MLSFVIPAHDEAALIGDTLQCLHACAQAMQLDYEVIVVADACEDA
FT                   TADIARSHGAQVLEVKLRHIAATRNAGAQAAQGERLLFLDADTLINPHVVGAALAALDA
FT                   GAVGGGAQVHLQGKRVWSERVAQALFGWFFRVSGIAPGCFLYCTRVAFVSAGGFDTRYY
FT                   AGEDVALSRALARCGRFVILRQTVHTSDRKLRSFSKREHLGLLLRFLWRGRRMLQTRDA
FT                   LGFWYQRRR"
FT   CDS_pept        complement(656297..657292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0604"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67359"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67359"
FT                   /protein_id="BAE67359.1"
FT                   /translation="MQIRTLGRSGPTVSALGLGCMGMSAFYGDRSDEAASIAVIHRALD
FT                   RGISLLDTADMYGPHTNEVLVGKAIASRRHEVFLASKFGIKLDPDDPSVRGIDGSPAYV
FT                   QSACEASLRRLGVEHIDLYYQHRVDPNVPIEDTVGAMARLVEQGKVRFLGVSEAAAATI
FT                   RRAHAVHPITAVQTEYSLWSREPEDNGVFATVRELGIGFVPYSPLGRGFLTGAFSSPDE
FT                   FDADDYRRHSPRFQGDNFTRNLQLVEQVKAIAAAKGITPGQLALAWVLAQGQDLVPIPG
FT                   TKRLAYLEENIAALDVALMPDELARIDAIFPAQAAAGTRYPEAMMGAVNR"
FT   CDS_pept        complement(657432..658007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0605"
FT                   /product="tryptophan repressor binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67360"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67360"
FT                   /protein_id="BAE67360.1"
FT                   /translation="MSMSKIAIVYFSGYGHTVKQAEAVHAGAASVGEATLYRIDQDGNL
FT                   PDDAWEAISAADAIIYGSPTYMGGPAWQFKKFADASSKPWFAQAWKDKVAAGFTNSASA
FT                   NGDKATTIQYLWTLSQQHGQIWVGTGLPPANTKAHGPQDVNWTGGWGGALAISPSDASA
FT                   DEAPPSGDLETAKLFGKRVAEFAAKLKR"
FT   CDS_pept        658117..658395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0606"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67361"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67361"
FT                   /protein_id="BAE67361.1"
FT                   /translation="MRVPKVLRISLGALFLVHGLTTLLVFTPAGTVACFQSLGLPAALA
FT                   YVSMTLELGLAVSLLLGVPLLLGTIVTVHGANGFGVSNPGGGREYPA"
FT   CDS_pept        658493..659311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67362"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67362"
FT                   /protein_id="BAE67362.1"
FT                   /translation="MTRLPSLYISHGSPMTALQPGQVGERLADLRQALPRPRAIVVASA
FT                   HWLGRRPLVSGAVRPPTIHDVGGFPAPLYELDYPAPGEPALAQQIMRRLEQAGLHPHLD
FT                   PQRGFDHGVWVPLRLLYPDADIPVVSLSIQPELGPAHQFAVGRALAPLRDDGVLVIGSG
FT                   SITHNLHDFRHGYSTEREAPYVRPFIEWTERTLLDNDIPALLDYRRQAPHAERAHPSDE
FT                   HFLPLYVAMGAAGDDRLGAQRIDAGIDAGFLAMDLYRFDGNAAVADPVAA"
FT   CDS_pept        659509..660753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67363"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67363"
FT                   /protein_id="BAE67363.1"
FT                   /translation="MKILDKLAVLADAAKYDASCASSGANKRHSLGTGGIGSTEGMGIC
FT                   HSYTPDGRCVSLLKILLTNFCIFDCAYCVNRVSSNVRRARFTPEEVVTLTLDFYKRNYI
FT                   EGLFLSSGIIRNSDYTMEQLVEVARQLREVHHFAGYIHLKTIPDATPELLAAAGRYADR
FT                   LSINVELPTEQGLTLLAPEKSVGGIRSAMGELRWRIEENQLERKAETVRRAKPPRFAPA
FT                   GQSTQMIVGADDADDRSILDTSHNLYGNYRMRRVYYSAFSPIPDASSKLPLQAPPLQRE
FT                   HRLYQADWLLRFYEFSVEEIAPAQSSGMLDLDVDPKLAWALRNPERFPVDLNAAPREML
FT                   LRVPGLGTRNVERLLLSRRHARLRVGDLARLRVPMKKLLPFVSVLDHHPRQRLDDPVRL
FT                   RAQLAPAPRQASLFD"
FT   CDS_pept        660760..662208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0609"
FT                   /product="DNA polymerase related protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67364"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67364"
FT                   /protein_id="BAE67364.1"
FT                   /translation="MFSAEVEPPWSFEAWRALARAGWCAQAEPDDVAWNGGAQGGLLMG
FT                   QGLLELPAVVPPPRVSADFMQLAASVLCHRDPQRHAVLYRLLWRVACGEKALLERATDV
FT                   DVHRLRQWQKAVQRDTHKMKAFVRFRRLPGEEEDFVAWFEPEHWIVDRVAPFFARRFAG
FT                   MRWAILTPYRSVRWDGEALSFGAGAGRTQVPADDAQEALWRTYYAHIFNPARLNQTMMR
FT                   QEMPQKYWKNLPEAASLPELIREAGVRVREMAERAPEPVRRRVPAAPAPQPDTTTHSLA
FT                   QLRSAARDCRRCELWQPATQTVFGEGPDDASVMVIGEQPGDEEDLSGRPFVGPAGRLFT
FT                   MALGELGVDRQRFYVTNAVKHFRFEQRGKRRLHRNPERAHLQACSGWLQAERTQLRPAQ
FT                   IVCLGATAAQAVLGRSGFRLMQERGQWQRLDDGTPVLTTVHPSWVLRQPSTDAREEGYR
FT                   GFVEDLRQLLNPPQPRERSFERER"
FT   CDS_pept        complement(662848..663405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67365"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67365"
FT                   /protein_id="BAE67365.1"
FT                   /translation="MKTSFQSLAAATAIALTSAMAPAYAASNPMVGGAPMLATKDIVDN
FT                   AVNSKDHTTLVAAVKAAGLVETLKGPGPFTVFAPTNAAFSALPAGTVDTLLKPESKATL
FT                   TKVLTYHVVPGKVDAASLIAKIKAGGGSATLTTVQGEPLTAKLNGKKVTITDAKGNTAN
FT                   VTIADVMQSNGVIHVVDKVLMP"
FT   CDS_pept        664019..664438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0611"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67366"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67366"
FT                   /protein_id="BAE67366.1"
FT                   /translation="MKIPNHGGGSWVPMQVILLTYSYKNIGFDDSANDKDGGPSTLAFS
FT                   KAHIDVSDANDADNRGTGNYPVRIKLVEDAHGQRVGQEMMGAQWPYSFKKKVKAVKVTV
FT                   RHYDSKLKLHDAIFLVPVEGARQSTPHAHRHLSHR"
FT   CDS_pept        664801..666543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0612"
FT                   /product="Na+:H+ antiporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67367"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67367"
FT                   /protein_id="BAE67367.1"
FT                   /translation="MVSSPVATRYGPVSALLCVAICDAARAAALSFRVFMHSIDVVLAM
FT                   LLAVAASGYLIRILPFSLPLPLVQIALGAVVSGVFDAGHELEPELFFLLFLPPLLFLDG
FT                   WRIPKQGLFRDKAAILELALGLVIFTVIGAGVFIHWLIPAMPLAVAFALAAIISPTDPV
FT                   AVSSIASKVPIPKRLMHILEGESLLNDASGLVCFQFAVAAVLTGTFSVTAASLTFLWVA
FT                   LAGLALGVATTFGLSRIQAWIWRHFGEEPGSAILVNLLTPFAAYLLAEAFHASGILAAV
FT                   AAGITMSYVEMAGNAPGNMRLQRSAVWDTVQFTFNGIIFVLLGEQLPGILDGAVRSVQE
FT                   AGHLNPWWLAVYVATISASLMALRFVWVFLSLRWNIFKAQRRGEAHVSPPWRIVVAVSL
FT                   AGVRGAITLAGVLTLPLMLEDGSPFPARQLAIFLAASVILVSLLVASVALPRLLRGLEL
FT                   PEEEDEQLKEDLAAKAASQAALDAVEKLRQRLVDGSKHAERYNAAANQVSQRYQRKLGS
FT                   VDMAETDPEEAVAYEKALRQFRHAALVAERNELFKLARRREISDELSRRLVRNLDLIES
FT                   RKRA"
FT   CDS_pept        666790..667734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0613"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67368"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67368"
FT                   /protein_id="BAE67368.1"
FT                   /translation="MTSIVAIHGLSKTYAGGCQALKQVDLEIQRGEIFALLGPNGAGKT
FT                   TLISIICGLINPSTGTVLADGHDIVRDYRAARASIGLVPQELATDAFETVWATVRFSRG
FT                   LFGKPANPQYLETILRELSLWEKRNNKISTLSGGMKRRVLIAKALAHEPRILFLDEPTA
FT                   GVDVELRHDMWQMVRRLREQGTTIILTTHYIEEAEDMADRVGVINRGELVLVEDKRTLM
FT                   RKLGNKQLTLSLQAPLQALPAAVADLPLELAADGNRLIYTFDTQAEQTGIGALLRRLNA
FT                   QGIDFKDLHSSESSLEEIFVNLVHGARQQEVRA"
FT   CDS_pept        667737..668492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0614"
FT                   /product="ABC-2 type transporter"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67369"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67369"
FT                   /protein_id="BAE67369.1"
FT                   /translation="MHAIAAIYRFEMARAFRTLTQSIASPVLSTSLYFVVFGAAIGARM
FT                   GDIDGISYGAFIIPGLVMLSLLNESISNASFGIYMPRWAGTIYEVQSAPVAWWEIVIGY
FT                   VGAAATKSVMLGLLILLTARLFVPYQIAHPVWMLGFLVLTALTFSLFGFIIGIWADGFE
FT                   KLQVIPLMVVTPLTFLGGSFYSINMLPPLWQKVTLFNPVVYLISGFRWSFYGKADVHIA
FT                   VSAGMTFLFLVVCLGVAAAIFRSGYWLNA"
FT   CDS_pept        668500..668763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67370"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67370"
FT                   /protein_id="BAE67370.1"
FT                   /translation="MQWFCRPHPGGCRREFRSNAAWVACAVPSPLAGHAVTPSLGLDGG
FT                   IHAANGSAIGKDTAPDGFLAALLKALHTDQRDRTLPAHRRGT"
FT   CDS_pept        complement(668906..669172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67371"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67371"
FT                   /protein_id="BAE67371.1"
FT                   /translation="MSDTPPDHLAIDARSPFHNADALNRGVGVRFNGVERDNVEEYSVS
FT                   EGWIKVQVGKARDRRGNPMTMKIKGEVAAYYLDTKNGAKPAAE"
FT   CDS_pept        669338..669874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67372"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67372"
FT                   /protein_id="BAE67372.1"
FT                   /translation="MPDNSADYDEPDDLSADNDDDPDTHQGLVWNLLLLINPGDEETAL
FT                   RQFDAYRESAGETDGDAWLWALKDAIDWSSGFYVDGSDSETLISAIDELAARWNLRIDW
FT                   GGDMDDDDFLVANDTAALLTVAYDRLREYGYTLWCWDTGSDDRAGWMALSRNDEDMQRL
FT                   AAILGADLRPGSDPF"
FT   CDS_pept        complement(670003..671910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0618"
FT                   /product="protease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67373"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67373"
FT                   /protein_id="BAE67373.1"
FT                   /translation="MNIASPPLRTLLLSAVLATAPFQLHAANDPLEQRGLVDSPVPDGS
FT                   PAAGRLIVKYRPSIGSDALRASILSSAARRANLLPPSSNAARSAPMAARVLRTSGTGAS
FT                   VLRLTGHLTTAEQTRLLTELRADPAVEYAQLDRMMQPVLDLVGSAALPAQARATAQHTD
FT                   PAVPNDKFYAKYQWHMQDSAGGIRAPKAWETSTGGGVVVAVIDTGILPDHPDLKNNDHI
FT                   LQGYDFITNASVSRRATDGRVPGALDYGDWIDDDNTCLQRARASSWHGTHTAGTIGELT
FT                   NNGIGGVGAAHDAQILPIRALGHCGGMSSDIADAIVWASGGHVDGVPDNTHPAEVISMS
FT                   LGGFGSCDSNTQQAINTAVANGSTVVVAAGNDAIDAAQFTPASCSNVITVGATRITGGI
FT                   TFYSNFGSVVDLSGPGGGQDQDTGNGGWDGLVLSTGYSGKTTPTSGQYKYLGYAGTSMA
FT                   SPHVAAVAALVQSSLASTGKTPLNPSQLQAVLKQTARAFPVPPPTATPIGTGIVDATAA
FT                   MDYVRTNCSGSSCKPVSTALSNRTPVTAQSAGVDEEHLYSFTATAGTPLNVLSYGGSGN
FT                   VALYLTFGAEPTTRSYDLRSVRPGNTQTLRLPSPQAGTYFIKLVGGDGGFNNVSLMARQ
FT                   "
FT   CDS_pept        complement(671957..674809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0620"
FT                   /product="outer membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67374"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67374"
FT                   /protein_id="BAE67374.1"
FT                   /translation="MLTLLFLASRLATAHTATPAPEATSPTSQASTADTTAQDNATTPP
FT                   DAADDIGKHLQIVGGSDPAEDVGAFAAEPYAVAIGEASNALGEGGIALGAGATVTAKHA
FT                   IATGYAAAASGESAVAIGGTTEIFDYNDAGEIIGSHQDSTEASQFGAVALGGGAKATAA
FT                   LATAVGSGSEARNVQSTALGYRARAFEDGATAVGGLSVASGYLSTANGYFARATGTSSV
FT                   ALGNTALASGIDSVAIGGVSTAAAAAGNSSSLTAATGVGSVALGAGAVTQSNYAIALGY
FT                   NANVFPNLPGNTDAVAIGHSAGSFAPNTVSLGAYALASNQDGIAVGHNSWALSANSVVL
FT                   GSGAISSWFNPNSTALGAATRTDGVDATSIGYGAKVGNWVDDAWNRAPVSAVALGAFSH
FT                   ATRSYSVAVGDLASGLTRQITSVAAGTEATDAVNKGQLDALAADVQATSGVLQANGEGT
FT                   ASATGKHSTAAGAGASASGARSAAVAAGSRASAAGASALGVDSSANGVNSTTMGYNSFV
FT                   RQSGVNGVALGANAGASGADSVALGSGSRTYEANTVSVGSGNGHGGPATRRIVNLGAGA
FT                   IADGSSEAITGGQLFQSLSNAASVLGGGAAIGAQGVFVAPTYVIQGASYTNVGAALTAL
FT                   DSKVSALDGRLGGTTSSRTAALRSAGVAAGLAPATSAIATAEASAPGLKGTPTPAVAST
FT                   STVAATSTATGSAAVANDVTGTAIGGSAYAHGPNDTAIGSNARVNADGSTAVGANTQIA
FT                   AVATNAVAMGEGAQVSAASATAIGQGARATAQGAVAVGQGAVADRANTVSVGSVGAERQ
FT                   ITNVAAGRSDTDAANLAQVSAGDARTLSSATSYTDSRVSALSDSFSQLHDDSMRRFQNM
FT                   DRRIDRLGAMSAAMLNMAINAAGTQSERGRISVGAGFQSSEHALSIGYARKIGERASFS
FT                   LGGAFSGNDSSAGLGFGVDL"
FT   CDS_pept        674808..676505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67375"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67375"
FT                   /protein_id="BAE67375.1"
FT                   /translation="MARVSGRRGGGAMQAVLPAGRAAARRARCWPVTWSGRRLIGVPRT
FT                   WWAERLAPTELQGIPLSMRSCVGEHEVRQKLVTQIPGCHQTTIASTHHRCEHPALSRSP
FT                   AASSVKFISVLPWLQPPTSASASDHRHAAFLQVLLAAIVLYTAGDIGLFLYVAGAARLL
FT                   SHTDLLFALVGSVLTAVGAALGVWRVRRGDNAGAVRTYVAATLIGVVVTYVRVDIYDLL
FT                   TNPMPLLALVLAGMVLGSRALWRVFLLLAAAALLGVLAQVIWPVPWRSVRGNIGLGLVT
FT                   VGAYLLITLSLDRTIAALRDSLLESEHRRRELEQLNRRLLQEMAERERVQEQLIHIQKM
FT                   EALGRLAAGVAHDFDNLINVIIGYAQRRDALEGYGEAPLLKTLENIETASRRALTVSRR
FT                   ILNFGRAEPDLPTLFDARAALRDAEPTLRQLFGHDIRLECIAAGPPLWVLMDRDDLELV
FT                   LLNIAANARDAMEEQGVFRIEGELREATVCLRFCDTGPGIAPHLLARILEPFYTTKPVG
FT                   KGTGLGLSVVQSIIAAAGGQVAACNGPQGGACLCLQLPLAAAPQSASR"
FT   CDS_pept        complement(676487..677215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67376"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67376"
FT                   /protein_id="BAE67376.1"
FT                   /translation="MSIRASLPDADSLLSVAVLEDDALLREDILIPGLREFGFRVSGAG
FT                   TAGELYRLMLQQAFDLVVLDLGLPDESGLSVVTYLRSLFAGLGIVVLTGNRGRSDHARA
FT                   LHGGADAFLRKPTDPEILALTLRNLAQRLRTAHISVTTPSQAWRLQSDGWCLLAPDGTV
FT                   MVLTSLERCLMRCLDAQRGQAIERETLVSALEAATGDFDLHRLEMLIHRLRRKAARISS
FT                   DRTPALPLLSSRGMGYLLAD"
FT   CDS_pept        complement(677391..677675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0622"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67377"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67377"
FT                   /protein_id="BAE67377.1"
FT                   /translation="MAVYVDDAVHLWRDQRWAHLLGDTLDELHAMAARLGIPRRAFQNK
FT                   LSGAHYDVPAPLRLEAIALGAIAISRHTDRTLLKALIANARAQARGEHA"
FT   CDS_pept        complement(677684..678250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67378"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67378"
FT                   /protein_id="BAE67378.1"
FT                   /translation="MSRNSKAKRDKRKKQQPKRPFARLGQAPQVTNHAVLQDAEGRVVA
FT                   AIGLQGGSEWMLSIGGQTMGSADNPVPMLALLKHLANLQQAEGKTIWLEYSTQLQQMID
FT                   DLAADEGQTAEEYLNTLVAEFQNADADEDGDADAEDAADAAGTDAVAEDAAAENATAST
FT                   DDSAADAEASDDAESDSAGKKARKA"
FT   CDS_pept        complement(678637..679794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0624"
FT                   /product="chemotaxis MotB protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67379"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67379"
FT                   /protein_id="BAE67379.1"
FT                   /translation="MAEAKSTVIIRRVKKVQGGGHHGGAWKVAFADFVTAMMAFFLVLW
FT                   LMAATTKEQRAAISEYFRNPSPLSGKSMAPSPGMNGPGGASTSMIKLGGTADMAKGQKD
FT                   EMGRKRDNAADTTEDSRSKDKKRLETLMQELKEAIDKSQALEPFKDQLLLDLTPDGLRI
FT                   QIVDKQNRPMFDIGRDQLKPYTVEILHELSNFINQVPNHISITGHTDTTAYSSDAGYTN
FT                   WELSADRANAARRALVGGGMSDAKVTRVVGLSSSVLFDKTDPQNPINRRISIVVMTQDA
FT                   ESAALTGAGQGVALGTSVHDADTQVPDLSGAAATGTATVGTPVKQAAPTAASPVAATAA
FT                   PVPAAAPPAAGAAAARPAGPRMSSSAQVDSAKALAKAAEAAVEKQ"
FT   CDS_pept        complement(679805..680659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0625"
FT                   /product="chemotaxis protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67380"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67380"
FT                   /protein_id="BAE67380.1"
FT                   /translation="MLIIVGFIVVIVSVLGGYVLSHGKLGALWQPYELMIIGGAALGAF
FT                   LVSTPGKIVKETLSGIMGVFKGPQYKSEDYKDTLSLIYELLNKARRDGFMALEDHVEKP
FT                   QDSTIFGNYPKVVADHHLLDFITDCLRLMIGSNIEPHELEPLLELELEKHHHEALAPSH
FT                   ALSKVSDGLPGFGIVAAVLGIVITMGSIGGPIEEIGHHVGAALVGTFLGILLAYGFVSP
FT                   LSAAMEARAEQDGRIYEAVKTALLACLRGYNPKIALEFARKTLPSNVRPSFGDFETHLK
FT                   TIK"
FT   CDS_pept        complement(680757..681248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0626"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67381"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67381"
FT                   /protein_id="BAE67381.1"
FT                   /translation="MHTSSSLMLTGLLATALAGCSAGSPPPTTEAAKPAGTEPATANSA
FT                   DARPPAVGTDASVAGPLPRPGRTPAHTAPAAAPALPAQAVGWRCGQRMIATRFDSAADA
FT                   LELTLEDRRLILVSAQAASGTRFADAQGNQFWEHAGEATLSLAGGEALKCVHEATTTIG
FT                   "
FT   CDS_pept        complement(681554..682018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67382"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67382"
FT                   /protein_id="BAE67382.1"
FT                   /translation="MSQFDLTPPSPAQRDALIAGLSDEEQRVLLQHGTEAPFCGVFLDN
FT                   KLDGVYTCRLCGLPLFRSSAKFESGTGWPSFFAPYDPAHVREIRDTSYGMIRTEIVCAR
FT                   CDSHLGHVFPDGPPPTGERHCLNSVSLGFTENGQALPNPLHREGAEAQSA"
FT   CDS_pept        682287..682724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0628"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67383"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67383"
FT                   /protein_id="BAE67383.1"
FT                   /translation="MVPVMAIHPSTRRILLCVLLTMAAAAAAQSATTTHSSTHLQPITT
FT                   PTPVQPPVTPRALQPAPAAAPVPSQLGQRLVAPTIPTRGPAQTPVAPAGSQVAPTKPMV
FT                   YDRNGRLLQGMQPAGANRVLDTKTGRYDDAVPAGDGMRVVR"
FT   CDS_pept        complement(682776..683255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0629"
FT                   /product="leucine responsive regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67384"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67384"
FT                   /protein_id="BAE67384.1"
FT                   /translation="MTSRARELDKIDRKILRILQQEERISFTELGERVGLSTTPCTERV
FT                   RQLERDGAITGYYARLDPHYLKASLLVFVEISLAYKSGDIFEQFRRTALKLPNVLECHL
FT                   VSGDFDYLLKARISEMASYRKLLGSTVLTMPHVRESKSYIVMEEVKETLALPIAD"
FT   CDS_pept        683404..684693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0630"
FT                   /product="D-amino acid dehydrogenase subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67385"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67385"
FT                   /protein_id="BAE67385.1"
FT                   /translation="MRVLILGSGVIGVTSAWYLAQAGCEVTVVDRQPAAALETSYANAG
FT                   QLSFGYTSPWAAPGVPGKAVKWLFEQHAPLSIRPTRDLRQLAWLSQMLRNCTAERYAVN
FT                   KARMVRMSDYSRDCLNALRAETGIEFEGRQLGTTQLFRTQQQLDAAAQDIEVLAQYGVP
FT                   YELLSPAQIAQFEPGLAGGGAQMAGALRLPEDQTGDCRLFTQRLAELAAQAGVTFRYGY
FT                   QIEWLEHAGGQVTGVQIDGRIETADRYVLALGSYSADLLLSLGLHLPVYPLKGYSLTIP
FT                   IVDAQRAPTSTVLDESYKIALTRFDDRIRVGGMAEVAGFDMSLNPRRRATLEMVVNDLF
FT                   PGGGDLAQAEFWTGLRPATPDGTPVVGATPYANLFLNTGHGTLGWTMACGSGRYLADLM
FT                   QGRTPEIDTDGLDIFRYLSPRSARPQREAA"
FT   CDS_pept        684693..685793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0631"
FT                   /product="alanine racemase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67386"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67386"
FT                   /db_xref="GOA:Q2P7U1"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7U1"
FT                   /protein_id="BAE67386.1"
FT                   /translation="MRPAQASIDLEALRHNYRLAKRLGGSKALAVVKADAYGHGAVPCA
FT                   QALEPEADGFAVACIEEALELRQAGIRAPILLLEGFFEHDELRLIAEHDLWTVAATPQQ
FT                   VRALAAFQSPRPLRVWLKMDSGMHRLGLSPEDFRAAWLRLRGLPQIASLVLMTHLARAD
FT                   ELDCSRTDEQAVAFALTAGGMRAETSLRNSPGLLGWPALRNDWSRPGLMLYGANPFPQD
FT                   TENTAQLRPVMTLRSRIILVRDLPVGEPVGYGARFVAERPTRVGVVAMGYADGYPQFAP
FT                   NGTPVLVDGQVCPLIGRVSMDMLTVDLTDHPQADIGATVQLWGQAPRVGPLATQCNVSA
FT                   YQLLCGLKRVPRTYVASAAVGEVAAR"
FT   CDS_pept        complement(686196..686777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67387"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67387"
FT                   /protein_id="BAE67387.1"
FT                   /translation="MKLSNLFGASLLLAGWLAATGAQAWGRNVTDPDAPRALSSDGKVK
FT                   VDVRWTDPAQFSEVRFSGNRWEAQRGDWVTQLATHFQQSAARQLPDGQHLSVTITDIRR
FT                   AGQYEPWHGPRMQDVRVVKDIYPPRISFTYTLTGADGRVIDQGERKLVDSAFLMSGPRF
FT                   TDSDPLRFEKAMIDDWVRKQFRSDHRTAGL"
FT   CDS_pept        686975..687472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0633"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67388"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67388"
FT                   /protein_id="BAE67388.1"
FT                   /translation="MDTPSFRTKSASSAPAHLPSDVRLQFIDWAKQHGHNLASGAAAFV
FT                   ALHSEVALDLATRALQLEPGADPRAALREHLAALARQVDVAVQFPPVYTYTAANGLEYR
FT                   YSLMLVIAEDCVEWTGRVWQDLDYQGMLTGRGQGPRANYTQLARMALEHELDQERPRYV
FT                   QA"
FT   CDS_pept        687459..687767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0634"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67389"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67389"
FT                   /protein_id="BAE67389.1"
FT                   /translation="MSRHELELQLPVGAQIASGEDGFSQRCRDDCAEMGASRARLLLLD
FT                   SDSARSTAWRADAQRWMDEQLRREGEWVLRGVIAGIVVLATCIGFAATTLWRVWNWQ"
FT   CDS_pept        687995..689890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0635"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67390"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67390"
FT                   /protein_id="BAE67390.1"
FT                   /translation="MVFDGEQAVDYLIRTTNGAFERYTGLSTNALNISIRDLLPEHEQE
FT                   WFDRYGLVARTGNRIHFEMQAKALKRWYSVDAFRVGRPDQGRVAVLFMDITERKRVERE
FT                   LAESEARFSALADGLPMPVWVLDAQGVVRFVNSAYGEFFGLDISSGTVSAWSELLHPDD
FT                   LPTFQFELAASLQEQRGLRALVRARRHDGQWRWIEMTATPRYSADGRFIGLAGSSPDVT
FT                   EQREIELAREQLLESERSARNEAESMARLKDEFLATLSHELRTPLTTILGWSELLLQRV
FT                   EEGHTTYKGLSVIASSARAQKRLISDMLDLSSMLLGKVQLEVESLDLAEQVREALNTQE
FT                   LAAEGKDQILKLHVPPTPCLVLGDATRLQQVVWNLLSNAIKFTPAHGRIDVSIERDDGH
FT                   LVVSVCDSGDGIAAEFLPHLFGRFRQADGTTTRQHGGLGLGLAIVQQLVEMHGGQVGAT
FT                   SGGRGKGATFTVRLPEHIPDQAKRPRRELRRRLMSEQIVEARALNGLRLLAVEDQPDML
FT                   DYLRRLLEEQGAEVVTAGSATDALALLDHRGHARFDLMLTDIGMPGMDGYGLIRTVREN
FT                   LGLDATALPAVAVTALAREDDRNRALESGFQEHLAKPYSVAQLVAAVRAARDAVE"
FT   CDS_pept        690375..690683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67391"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67391"
FT                   /protein_id="BAE67391.1"
FT                   /translation="MPKYAPHVYSEQVQIATLEPWVSLLDGQERVRIELDDGSMISGTV
FT                   AVRPSLQTYLDEHRKEGVNGQLRLDQLDASQEPQWIWMDRIVAVHPMPLGADPHVMP"
FT   CDS_pept        690772..692109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0637"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67392"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67392"
FT                   /protein_id="BAE67392.1"
FT                   /translation="MNAPVLTFARWPLSLMALAVLAACGDTATLAIEQGTGPNPQLPEP
FT                   VKRLIPTVKIAPVKRWAANAKPIAADDLQVAAFARDLDHPRWIYVLPNGDVLVAETAEP
FT                   PKPEDAETGGGLRKKVQGAMMKKAGAAVASANRITLLRDADGDGVAEVRTQFVSGLFSS
FT                   FGMALIGDRFYVANADALVSFPYKPGDTHITAKPTFVANLPGGINHHWTKSLLASPDGS
FT                   KLYVGVGSNSNVAENGMEAELNRAAILEIDPATGNSRVFASGLRNPVGTAWEPQSKSLW
FT                   VVVNERDEIGSDLVPDYLTSVRDGGFYGWPYSYYGQHLDERVKPQNAELVAKAIKPDYA
FT                   LGPHTASLGLTFANGSVLPERFRQGAFIGQHGSWNRDPPSGYKVLFVPFANGKPTGTPI
FT                   TVLDGFLDAEGNAQGRPVGVASDHSGALLVADDVGNVIWRVTPKAR"
FT   CDS_pept        complement(691967..692530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0638"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67393"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67393"
FT                   /protein_id="BAE67393.1"
FT                   /translation="MAEGCFAHFFQADDGKYRWSRCVAREATRGATADSLPTHSKPGPS
FT                   AHPPLRSTFPLYRGGGRCTDGRRDVHGDRGGLPGDVTSAQADCRPARRAANRTTALTAR
FT                   RDEPGARNRHGPRVHCGSERAVRAHLAATGDVLLTVLNAPSALPARSHCPRRRPPAVRR
FT                   YGRTPRRRGGPAHCLRHPGIHPAP"
FT   CDS_pept        complement(692663..692950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0639"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67394"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67394"
FT                   /protein_id="BAE67394.1"
FT                   /translation="MRALFVGGVVDNSEMDLDDTPPPMHYPENTGAGRPLYRLHQVGER
FT                   DDGTVAYAVYGAPEMADDDISRITEERGYARRFSASPEAPRQVDSSGGAS"
FT   CDS_pept        693099..694166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0640"
FT                   /product="ribosomal RNA small subunit methyltransferase C"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67395"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67395"
FT                   /protein_id="BAE67395.1"
FT                   /translation="MAGPHDAPLQALFLPFAQGVLPWSEGPVLFLRARDGFPLREQAVA
FT                   ETLTCEQSFRPFAEALERNGWNVREESEIEADSTRYALVLVLPPRQREEARALFARAVA
FT                   LTAPGGRVVACQSNNEGARSGEADLRQLTGLAGSLTKHHCRTYWTAPLPADTDATLQAR
FT                   WAALDAPRKILDGRFVSRPGVFAWDRIDPASALLVEHLPTTLAGHGADLGAGFGYLSAE
FT                   VLARCPKVTVLDLYEAQARALTLARRNLQGITHPAQLHYHWRDVTAGLVAHYDFIVSNP
FT                   PFHTPSRADRPDIGQRFIAVAAQALRPGGQLLLVANRHLPYEQVLNESFGQVRVAAERD
FT                   GFKLISAIRGRGARA"
FT   CDS_pept        694163..694876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0641"
FT                   /product="ribosomal small subunit pseudouridylate synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67396"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67396"
FT                   /protein_id="BAE67396.1"
FT                   /translation="MKLVKHIANLGYGSRKQVTQLFRQGAVTDAQGEVLYADDQVEHDA
FT                   IRIDGEPLDPPPGFSLLLHKPGGYTCSTKDTGRLIYELLPPRFRSRAPVLAPVGRLDRE
FT                   TSGMLLMTDDGALLHRIISPKSALDKVYDITLAEELRGDEAALFASGSLLLEGETKPLL
FT                   PAELEVLGPREARLTLHEGRYHQVRRMFAAAGNHVVALHRSRIGGLSLDGLPSGQWRAL
FT                   EASDLEVLFGRGAAA"
FT   CDS_pept        694873..695553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67397"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67397"
FT                   /protein_id="BAE67397.1"
FT                   /translation="MTQIAALSFRPQAVIFDMDGLMLDSERAITACLVQAADEQGLQIE
FT                   PAFWLRMVGTGDVACRLLLGERIGDASAEATLAHAQRLYAAAVERGIPHRPGIIALLEY
FT                   LAAQGMPRAVATSTQRPLALRKLEAADLLWRFDAVCTASDVVHPKPAPDIYLLAARALA
FT                   VDPTLCLVLEDSPIGVRAALAAGMTPIQIPDLLEPDAAVRALGHRILPSLGDAQRLLEA
FT                   CLSG"
FT   CDS_pept        complement(695689..696495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0643"
FT                   /product="oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67398"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67398"
FT                   /protein_id="BAE67398.1"
FT                   /translation="MALTPAISAWTPSPLQGRVVVITGGAQGIGRGIAQAVLGAGGSVM
FT                   IGDLDADAGRACLQEWALPRHSAFVRCDAAREAQAARLITTALKRFGRIDGLVNNAGVP
FT                   DPHSAALSQLDWDEWNRRLSSLHGAFLCSKHALPALTQAPGGGAIVNIASTRAWQSAPH
FT                   SEAYAAAKGGLVALTHALALSEGPQVRVNSISPGWISTDAWRAPQRRRAPKLSRRDHAQ
FT                   HPAGRVGTPEDIAQLAVYLLAPQLSGFVTGQDVIVDGGMSRKMQYV"
FT   CDS_pept        complement(696917..697477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0644"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67399"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67399"
FT                   /protein_id="BAE67399.1"
FT                   /translation="MTTTPATPDPIAATRKWIERAVIGLNLCPFAKAVYVKDQVRLVLS
FT                   DASTPEALLEQLAEELVLLRDTPAEQIDTTLIVHPDVLTDFLDYNDFLDNADAAVDALD
FT                   LQGVLQVASFHPDYQFAGAALDDVANFTNRSPFPTLHLLREDSVERAVAAFPDPDVIVE
FT                   RNIQTLERLGSDGWQRVLNGAEH"
FT   CDS_pept        complement(697636..698487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0645"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67400"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67400"
FT                   /protein_id="BAE67400.1"
FT                   /translation="MHAPELKPGNAARCHWQHAADIRTPLALLYLHGVSTSTSEAGARP
FT                   EQMADALAANADVHRWPGHGLSTPDAMQGLTAAVLQTSALEALAQAQRMGQRIAIIGSS
FT                   MGATLGLWLGLWLGLWLAAQRPDAVAAVVAWSPGIQPADPALLDQVCAAQAPLTDPRPR
FT                   TPAAHAFWAETIHPDRFRALRSLFQVVATDPPWPRVRCPVLLGDDRATDGREDATASVQ
FT                   AMLDMFVALGTAPAHKQAIAFYSGAHAIGSPHKTPLADAVAQASVAFLQEQLGAAPQTG
FT                   NA"
FT   CDS_pept        complement(698701..699915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67401"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67401"
FT                   /protein_id="BAE67401.1"
FT                   /translation="MAAAAFADAFVVEIEHAIASCTLGDAGTPQAQALQQIHSLKNTIS
FT                   LTGVQQVLNACDQSRDAASRHALGDTLAQRFTAVAKAAGLLVKHYRRTLPSDNADPHAS
FT                   HSQRRKARPDPGRQAVAQRQTGAVFESFLEYRACVGRVIVQTIVTAWCLGGLYGPQPML
FT                   VTHAHHVFPTAVGLWALSVVWMLLVRRRIVPPSEWLDAMGVAMNVLFIGVQTYLAFILL
FT                   MPLNAFLPCITIAIAAVARYGQRAIFPVLLTTVVLMLLTAPAGYRLSRPAYFVYAVALI
FT                   IVLPLLAARIVRAMQEVALQALASRDAQNRFISTMRHQLRTPLNALINCAQLIDTEQMP
FT                   AQQRELLQAVTVSACPTIRRPISSPRSRSSVQVSVASKAAWAWGCTSHWRCPMRCSASA
FT                   RRRLT"
FT   CDS_pept        complement(700211..700696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0647"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67402"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67402"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7S5"
FT                   /protein_id="BAE67402.1"
FT                   /translation="MPSFDVVSEVNKHELTNAVDQANRELDTRFDFKGVQAKFELEDGK
FT                   VINQSAPSDFQVKQMTDILRARLLARGIDVRCLEFGDMETNLAGARQKVTVKQGIEQKQ
FT                   AKQLVAKLKEAKLKVEAQINGDKLRITGKKRDDLQDAIALLKKADFELPLQFDNFRD"
FT   CDS_pept        700804..701700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67403"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67403"
FT                   /protein_id="BAE67403.1"
FT                   /translation="MPTTRSPLPAIAWMVVAVACFSLMDAGMKLLSAHYPPLQVTLLRG
FT                   AASLPFVLVWVFATAGPRAIVPVRWGLHLLRGALGMVMIGCFVYGLKRMPLSTAYTLYF
FT                   VAPLLVAALSVPLLGEHVGPRRWAAIGIGLVGVIVVLRPGVDGLISLPGLMVLLAATAY
FT                   AVAAITVSLLTRTDTPQAMVVWFLLFMAIGAGLLAIPGWVPLHAGHAGLIAGMGLAGAL
FT                   GQVALTQAFMRGEASMIAPLEYTALVWVIGWDWLLWQTLPDSWTWTGAGIIVASGLYLL
FT                   RREPIRRADRPPPLDRP"
FT   CDS_pept        701819..702826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0649"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67404"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67404"
FT                   /db_xref="GOA:Q2P7S3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7S3"
FT                   /protein_id="BAE67404.1"
FT                   /translation="MIEFQRLHKSYSVDGRQIVALHPLDLRIGPGEVFGIIGHSGAGKS
FT                   TLIRLINRLEEPSGGRLLIGDEDVTALDSQGLRALRRRIGMIFQHFNLLSSRTVAGNVA
FT                   FPLELVGTPRAEIDARVAELLARVGLQEQANQYPAQLSGGQKQRVGIARALATGPQILL
FT                   CDEATSALDPQTTASVLQLLAQINRELGLTIVLITHEMDVIRRVCDRVAVLDAGKLVET
FT                   GPVTEVFLHPKHVTTRRFVSEAEHLDEAELHRDFAAVGGRIVRLTFLGNGTYEPVLGRI
FT                   ARDTGVDYNILSGRVDRIKDTPYGQLIVALTGGDQTAARAGFVAAGVQVEDLRV"
FT   CDS_pept        702823..703518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0650"
FT                   /product="ABC transporter permease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67405"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67405"
FT                   /protein_id="BAE67405.1"
FT                   /translation="MNPIVAAAGGFFRNLDAAKWGDIGQATLDTLLMLAGALPLTLLIG
FT                   LPLGVALFLCGAPQLRRRPLLYGALAALINLLRSVPFIILMIAMIPLTLMLMGTSLGVR
FT                   GAILPLVVGAAPFYARLVETALREVDRGIIEASQAMGASTRQLVLRVLLPEARPGLIAG
FT                   ATVTTIALIGFTAMGGAIGSGGLGDVAYREGYLRSHSDVALITVIALLVLVQVLQMLGD
FT                   RLVAYYSRR"
FT   CDS_pept        703613..704413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0651"
FT                   /product="outer membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67406"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67406"
FT                   /protein_id="BAE67406.1"
FT                   /translation="MSTFAFRSLLAAATLALASCGGGGSSGGDTLTVAATAVPHAEILE
FT                   VVEPLLAKQGVKLDVRVFNDYVQPNDQVVQKQIDVNYFQTEPYLDAYNRDRKSQLVTVV
FT                   GVHIEPFGAYSRHFKALADLPNGADVVIPNDPSNSSRALILLDKAGVIKLKDPGNALSS
FT                   QRDIVENPKQLKFRELDSAMLPRVLDQVDLALINTNYALDAGLNPTRDALAIESKDSPY
FT                   VNFLVARADNKDDPRVQKLAKALTSPEVKAFIERKYKGAVLPAF"
FT   CDS_pept        704790..705347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67407"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67407"
FT                   /protein_id="BAE67407.1"
FT                   /translation="MPLLLAIPLAVIIALAVFVVLFPLSLLQRFRMGTAPRQARGWLLM
FT                   INLVSAGMSSVLFLIFSLVAAAFWPGAISHAAFGWACGLALGVLALRLTRFERTTQGLF
FT                   YRPNLWLMLALTALVVVRVIAGMVHGWRSAWQGAAWPTEGWLSHASLLSAAGVLLGDAL
FT                   AYATLLWWRWRSARLRGSVYWR"
FT   CDS_pept        complement(705632..706318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0653"
FT                   /product="outer membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67408"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67408"
FT                   /protein_id="BAE67408.1"
FT                   /translation="MRSISILSLAAVSALAIAPSAFAQDTTYTGDASSTSSSTMSSNGD
FT                   TASGKHWAVVGGVALLNPKNNPAPGLDVDGGPAPTLSASYYVNDNWAVELWGAADKINH
FT                   RVNADGVGKVGTVDQQPIAISGQYHFGEADNVFRPFVGVGYYESNFSNEKIDAASTSGD
FT                   HVGLSTAKGVIGTAGVDMNINSTWFARADARYMRSRPELRVAGQGTGSELKLDPWTVGF
FT                   GIGARF"
FT   CDS_pept        706460..707020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67409"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67409"
FT                   /protein_id="BAE67409.1"
FT                   /translation="MQPEKDIHADAIAVTKKRVNQGLPAHIRSDCRVLLLGSMPGVASL
FT                   EAARYYAHPRNRFWPLMHALLGLDAAASYASRLQALLDHRVGVWDVIGQCERRGSLDTS
FT                   IVAASIVVNPLPALLVTLPQLRLVACNGAAAAQAWRRHVQPLLSAKLRALPVVALPSTS
FT                   PANAAWSLPRLATAWQPVCDAVR"
FT   CDS_pept        707202..707960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0655"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67410"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67410"
FT                   /protein_id="BAE67410.1"
FT                   /translation="MTIKPAITMAARVLLGLLGAVSAASADDTHCEVSSDDDLTLNPRS
FT                   LILIRESGTPQRLVMRQGVLCVDDRWVEPKADDRTRLIQFERQIRDGVPLAQAVGRAAA
FT                   DIAITALGEVAAGFSRNPEATRAQLANVREKIDIRLKQSFSKSQLTLVEIDDAIGALVA
FT                   ELLPQLIGDVVAGAVQSAITGNDVQLRSLDGLEARIERLVEPQARALRPRAQQWCRRLE
FT                   ALDGLDNALAYRLPSGEPLQLLRVDRRTVK"
FT   CDS_pept        708090..709883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0656"
FT                   /product="dihydrolipoamide acetyltranferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67411"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67411"
FT                   /protein_id="BAE67411.1"
FT                   /translation="MAEIKEALVPDIGDYSDVPVIEVLVSVGDTVSKDQSLVTLESDKA
FT                   TMEVPSSVSGVVKEIKVKLGDSLSQGALVALIEVADAGVDAGAAAAAKPAAAAAAPAAP
FT                   AKAAPASAPAPAAKAEAAAPAASSNGGLTEARVPDIGDYTDIPVIEVLVAVGDTVAKDQ
FT                   SLVTLESDKATMEVPSSAAGVVKELKVKVGDLLSQGSVVAIIAASDGGAGAAQSSVKPT
FT                   TDTAETAGKVEPVAVPAEPDKLAQREIAQVQGARSGAAAQSAQVSQPSAGNPSSPPVTF
FT                   DADSVLPSKVPYASPVVRVFARELGVDLNQLKGSEKGGRITREDVQRFVKAALSGGAPA
FT                   AAGAVPAGGANGLNLLAWPKVDFSKFGETETQPLSRIKKISGANLARNWAMIPHVTQFE
FT                   SADITDLEALRVALNKENEKAGIKLTMLAFLVKASAAALKTFPEFNASLDAAGENLTLK
FT                   KYINIGFAADTPNGLVVPVIRDVDKKGVLQIAQESGELAKKARDGKLGPADMSGGCFSI
FT                   SSLGGIGGTAFTPIINAPEVAILGVSKSAMQPVWNGKEFVPKLMLPLSLSYDHRVIDGA
FT                   LAARFTTYLSQVLADMRRVLL"
FT   CDS_pept        709880..710527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0657"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67412"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67412"
FT                   /protein_id="BAE67412.1"
FT                   /translation="MRAALLTIAVLGVLPWTTAVARECGSTLGRGWPPAVGNDGTAVTT
FT                   LLDGSTQPALALLTLPTRGVESAVSLVPGKDGADRTLRHSRADERVYNWVSQTDRGSVQ
FT                   FRTEQPPETVEIPILAALAKRLVSNWTNTLTQLAPIGRTAPVSEGEVLSFQVDGVRYSG
FT                   ARPSCGGGALLLQQAALLIEASEGNEKKRDKRWTQIESSLDELQQTLAGTAG"
FT   CDS_pept        710544..712367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0658"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67413"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67413"
FT                   /protein_id="BAE67413.1"
FT                   /translation="MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVAKDQGLVTLESDKAT
FT                   LEVPSSAAGVVKELKVKVGDILSEGALVLLLETEGEAAAPAKAETKAAPAAVAPAAAPG
FT                   SKPPVTPSHRAPAEPAPSKPALASDKPADIACKMVVLGAGPGGYTAAFRAADLGLDTVL
FT                   IERYASLGGVCLNVGCIPSKALLHAAAVIDEVAHAGDFGVDFGQPKITLGTLREYKEKV
FT                   VGKLTGGLASMAKQRKVRTVTGVATFVSPNELEIVGDDGKTQLLRFEHCIIAAGSQAVK
FT                   LPNFPWDDKRVMDSTDALELHDIPKTLLVVGGGIIGLEMATVYSALGSKVTVVEFMDQL
FT                   MPGADKDLVKPLADRLKKQGVDVHLKTKATDVTAGKKGITVSFEAAVEGDKPGLQATAY
FT                   DRVLVAVGRSPNGKKIGADKAGVTVTERGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHK
FT                   ATHEGKLAAEVAAGEKKEWVARVIPSVAYTNPEIAWVGVTETEAKAKGLKVGVAKFPWA
FT                   ASGRAIGIGRTEGFTKLIFDEETHRVIGGAIVGVHAGDLLAEIGLAIEMGAEAEDIGHT
FT                   IHAHPTLSESVGMAAEVYDGTITDLYIPKKK"
FT   CDS_pept        712414..712719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0659"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67414"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67414"
FT                   /protein_id="BAE67414.1"
FT                   /translation="MLTRRMEVAVWWGGNLCPELQALLQRELAIGNRIAEPTRRSDGTH
FT                   AGSVAVSLKRDLRSDVASLPATVPHAICTDPHHGWHDECDCITHQHLLVAGATKPP"
FT   CDS_pept        complement(712858..713670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0660"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67415"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67415"
FT                   /protein_id="BAE67415.1"
FT                   /translation="MKHLLALAIPCVLAAAYAAPAHAEDTDDRFQIRLGAMNVDNDNTI
FT                   RGNTLLAGNDVSVNEDFKLGGKEWEPRVDGVFRISTRQRLIFDYFKYDKDRRETLTQDL
FT                   SAGGVTVPSGSFIKGELKYQVATFLYDYSVVDSPEFSLGLQIGAEYAKVQANAYADLGS
FT                   MFTGNVVDESDDGAAPVVGIRFTARPSEHWLFNVQGQYLNTSWGDFSHYDGDLSRANAI
FT                   AEYRFTKNFGIFAGYDWFKLDVDKSSSDGLIGLKQEFKGPVAGVTFAF"
FT   CDS_pept        714203..714568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0661"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67416"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67416"
FT                   /protein_id="BAE67416.1"
FT                   /translation="MLNSVDAGRRLMLRAAVYPLAAVAITSLGLLLVGPGYSAGLALTG
FT                   FATVLGGWVAARTALGGGIQTAGIAMVRLILAMVLKWVLVFVALALGFGLWRLPPLALL
FT                   AGIAIGLIFQVLALARR"
FT   CDS_pept        714594..715394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0662"
FT                   /product="ATP synthase A chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67417"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67417"
FT                   /protein_id="BAE67417.1"
FT                   /translation="MAGEAATPTSYIQHHLHNLILPVRDGGGTFWTIHLDTLIMAVLMG
FT                   LVMVLAFWTATRNATSGVPGKWQAFVEICLEFVDRQAKDTYHGSSKLVTPIAITIFFWI
FT                   LLMNLIKMIPADFIAIPLSWVGVHAWKPVPTADVNATLGMSISVFFLMIVFSLRSKGVG
FT                   GMTKEFLTAPFGKWMMPFNLLLNIVEWLSKPISLAMRLFGNMFGGEIVFLLIWVLGGAG
FT                   IAGMVAGGVFGLGWMLFHLLVIPLQAFIFMMLSIVYLSLAEDSH"
FT   CDS_pept        715467..715769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0663"
FT                   /product="ATP synthase C chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67418"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67418"
FT                   /protein_id="BAE67418.1"
FT                   /translation="MNLAVLTNLAQVQSSTVLAVGIMIGLAALGAGLGLAIMAGKFLES
FT                   AARQPELIPVLQVRMFITAGLIDAAFIISVAVGLLFAFANPLAQVFIERLSQAAG"
FT   CDS_pept        715884..716354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0664"
FT                   /product="ATP synthase B chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67419"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67419"
FT                   /db_xref="GOA:Q2P7Q8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7Q8"
FT                   /protein_id="BAE67419.1"
FT                   /translation="MDITLTIFAQALAFAGLIWIVATKIWPPLLQAIEERQQKIAEGLA
FT                   AADRSQKDLAQAQEKVNEVLKDARTKANEIIDQAHARANQIIEAAKLEAIAEANRQKEL
FT                   AQTEIDASATRAREELRKQVSVLAVSGAEKLLKREIDANAHKALLDELAAEI"
FT   CDS_pept        716358..716885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0665"
FT                   /product="ATP synthase delta chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67420"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67420"
FT                   /db_xref="GOA:Q2P7Q7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7Q7"
FT                   /protein_id="BAE67420.1"
FT                   /translation="MSQALTLARPYGRAAFAIAREGGTFAPWSDALAFSAQVAGDPRVA
FT                   ALLLNPALGQEQAVTLLAPPQAGEDYLRFLGVLADAQRLSLLPEVAGLYEHLRAEAEHV
FT                   VKATVTSAAAMSQTELDTIAAALKKRFGRDVDITTAVDASLIGGAVIDTGDVVIDGSLK
FT                   GKLARLQSSLAH"
FT   CDS_pept        716933..718480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0666"
FT                   /product="ATP synthase alpha chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67421"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67421"
FT                   /db_xref="GOA:Q2P7Q6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7Q6"
FT                   /protein_id="BAE67421.1"
FT                   /translation="MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFG
FT                   LADVMQGEMIELPNNTFALALNLERDSVGAVVLGDYENLREGDVAKTTGRILEVPVGPE
FT                   LLGRVVNALGEPIDGKGPLGATQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGR
FT                   GQRELVIGDRQTGKTALAIDAVINQKGTGIKCVYVAIGQKASTVANIVRKLEENGALAH
FT                   TVVVAATASESAAMQYISPYAGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKR
FT                   PPGREAYPGDVFYLHSRLLERAARVSEDYVEKFTNGAVTGKTGSLTALPIIETQAGDVS
FT                   AFVPTNVISITDGQIFLETDLFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISL
FT                   AQYRELAAFAQFASDLDEATRKQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYL
FT                   DDVPVNKLLAFEEGLHAHFANTQGELVSKINSTGGWDNDIEASFKKGIQEFKTTGTW"
FT   CDS_pept        718674..719537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0667"
FT                   /product="ATP synthase gamma chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67422"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67422"
FT                   /db_xref="GOA:Q2P7Q5"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7Q5"
FT                   /protein_id="BAE67422.1"
FT                   /translation="MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPY
FT                   AQAMKQVIGHLAQASTDFQHPFLIEREQVKRVGYIVISSDRGLAGGLNNNLFRKMLGEV
FT                   RPWQGTGAEIDVVTIGQKASAFFRRIKVNMVGSVTHLGDSPQVEQLIGVIKVMIDAFIE
FT                   GKVDRVYLVYNRFVNTMTQKASFDQLLPLPAAEHKVAHHDWDYLYEPDAASVLEHVMTR
FT                   YIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAITQEISEIV
FT                   SGAAAV"
FT   CDS_pept        719682..721088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0668"
FT                   /product="ATP synthase beta chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67423"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67423"
FT                   /db_xref="GOA:Q2P7Q4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7Q4"
FT                   /protein_id="BAE67423.1"
FT                   /translation="MSQGKIVQIIGAVVDVEFPRNEVPKVYHALKVEGTEITLEVQQQL
FT                   GDGVVRTIALGSTDGLKRNLLATNTERAISVPVGAGTLGRIMDVLGRPIDEAGDVQASD
FT                   HWEIHRGAPSYEDQSSSTELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTG
FT                   LTMAEYFRDEKDANGKGKDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMG
FT                   VLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFAHLDSTVTLSRNIASLGIYPAVD
FT                   PLDSTSRQMDPLVIGHEHYDTAQRVQQTLQKYKELKDIIAILGMDELSEEDKQSVSRAR
FT                   KIERFFSQPFHVAEVFTGSPGKYVSLKDTIRGFKAICDGEYDHLPEQAFYMVGSIEEAV
FT                   EKANKMSAKA"
FT   CDS_pept        721232..721654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0669"
FT                   /product="ATP synthase epsilon chain"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67424"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67424"
FT                   /db_xref="GOA:Q2P7Q3"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7Q3"
FT                   /protein_id="BAE67424.1"
FT                   /translation="MSTIRCDIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRL
FT                   KPGKVVVTTANGEHLDFAISGGILEVQPQVVTILVDTAVRAQDIEEAAVRKVKEEAERL
FT                   LANRGNTVDVAEAQRRLTEATVQLQALERLRRNLKH"
FT   CDS_pept        721886..722455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0670"
FT                   /product="chorismate mutase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67425"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67425"
FT                   /protein_id="BAE67425.1"
FT                   /translation="MARSIDGIRAYIVTGLLAAGLLGCALPARSQPPLDLLMDRIVQRN
FT                   AIGDAVALSKWDSGKPVLDQAREAAVLQRVRDQAPAHGLDADDAARFFGQQIEANKSVQ
FT                   YALLNRWHERGRAPDTARPDLAALRTRLDQLQGELLDALADVASARSAPDCPASTARAA
FT                   SHYAKQWQLDALHHAALVRGLGDFCH"
FT   CDS_pept        722744..723067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0671"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67426"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67426"
FT                   /protein_id="BAE67426.1"
FT                   /translation="MTESHVHQPTRLALARLPAQDLARYGCRVRAYKDGLATDQHVRRC
FT                   SYSAAAYLRASGAPLGVMSPDSRTTAGCVRMPRSAVHHMPAQEERHDRQAAFDQRFCQP
FT                   RLA"
FT   CDS_pept        complement(722978..723361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0672"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67427"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67427"
FT                   /protein_id="BAE67427.1"
FT                   /translation="MSLFRQGSQFMMIGALQLAVDCSIFIAATAAGMPAVPANLLGRIG
FT                   GAMLGFWLNGRYTFAQQGNARLGWQRFRRFALMWLLLSVISTWLLSTTVDLLGLRQAWL
FT                   AKPLVEGGLAIVSFFLGRHVVYR"
FT   CDS_pept        723506..724870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0673"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67428"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67428"
FT                   /db_xref="GOA:Q2P7P9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7P9"
FT                   /protein_id="BAE67428.1"
FT                   /translation="MTLPLHVVILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQL
FT                   QPAAIHIVYGHGSDQVQAAFADQSDLQWAAQREQLGTGHAVQQAMPAIPDAARVLVLYG
FT                   DVPLIRSESLLQLLHAPGRMAVLVAELANPTGYGRILRDAEGKVAAIVEQKDANDEQRR
FT                   IRTINTGILTAESTALRRWLGGLSNDNAQGEFYLTDVFASAAADFTPADMVHVADPQDV
FT                   EGANDPWQLAQLERAWQLRAARALSLQGVRMADPARVEQRGSVQVGRDVQLDIDVILEG
FT                   EVTLGDDVVIGPFVRLRDVTLGAGTQVRAHSDLEGVITEGAVQIGPFARLRPGTVLADG
FT                   VHIGNFVETKKVTMGVDSKANHLTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDG
FT                   AFVGSNSALVAPIEIGANSTIGAGSVVTRDAPAGQLTVTRARQTVIEGWERPTKK"
FT   CDS_pept        complement(725596..726594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0674"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67429"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67429"
FT                   /protein_id="BAE67429.1"
FT                   /translation="MLGPSLHRDQIMAMNRVQLQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLGVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRALEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRYLAETMWRFNRRFDLTRLVPGLLAAAAASKPWSERALRDVTMFTAESAC"
FT   CDS_pept        726887..727234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0675"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67430"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67430"
FT                   /protein_id="BAE67430.1"
FT                   /translation="MTPGNAHDAPAGRALLEHLGPVERPVHLLMDRAYEGNETRQLALD
FT                   LGFVPVVPPKSNRVDPWEYDKEMYKRRNEVERLFRRLKGYRRIFTRFEKLDVMFLGFLS
FT                   FVLVVDGLRMC"
FT   CDS_pept        727548..728087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0676"
FT                   /product="ISXoo13 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67431"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67431"
FT                   /protein_id="BAE67431.1"
FT                   /translation="MTAKVFEAALGIGAPWSVGAVEFDEATKVLTVPVDFKPGTRFKVS
FT                   GQKGLHPVHDTVVKTYRHLNFFQHECYLKVRTPRVKLGDGSVRLVEPDFAGRLSGFTLL
FT                   FEALVLMLSQQMPFAAVARIVGESAYRCMQVCTRYVEMPLEQADFSDVTSLAIDETSRA
FT                   RGHDYVTWLPTPRRDA"
FT   CDS_pept        complement(728969..730240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0677"
FT                   /product="ABC transporter permease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67432"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67432"
FT                   /protein_id="BAE67432.1"
FT                   /translation="MIRDTSAQDQVLRAPARSTQWRRWLWPGLAAVAVLAGIGWAVTAW
FT                   SAGSRSFDASRVRIATVSQGDLVRDIAADGRVIAANSPVLYAISAGTVTLSVVAGDVVK
FT                   QGQELARIDSPELRSKLAQEQATLAGLEAESSRAALDATLARANASKLTDQAKVDRQAA
FT                   ARDLERYQRGYDSGAVPQVELAKAQDTLKKTDIDLQHAQRDAALKSQGADLDARNKRLL
FT                   ADRQRAVVAEVQRQVDALTLLSPFDGQVGQVQAVQHTQVAANAPILGVIDLSKFEVEIK
FT                   VPESFARDLAIGMPAQLTSGSGEPFPGAMSAVSPEVVNGEVTARIRFTDKQPPGLRQSQ
FT                   RMSARVVMDTRRNVLKVERGPFVEQSGGSYAYVMDGNTAVRRPVRIGVSSLGDVQVLSG
FT                   LQVGDRVVVSGADNFGDTPRVTVH"
FT   CDS_pept        730448..732277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0678"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /note="Glucosamine-fructose-6-phosphate aminotransferase
FT                   [isomerizing] (Hexosephosphate aminotransferase)
FT                   (D-fructose-6-phosphate amidotransferase) (GFAT)
FT                   (L-glutamine-D-fructose-6-phosphate amidotransferase)
FT                   (Glucosamine-6-phosphate synthase)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67433"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67433"
FT                   /protein_id="BAE67433.1"
FT                   /translation="MCGIVGAIAGRDVVPVLIEGLKRLEYRGYDSSGIAVLDGAQVRRV
FT                   RRTGRVAEMAQAAQAEQFGATLGIGHTRWATHGGVTEANAHPHISAGVALVHNGIIENH
FT                   EEQREKLRALGYTFESQTDTEVIAHLIHHHLGSAGDLLTALQRTVKELTGAYALAVMSQ
FT                   AEPERFVCARMGCPLLIGVGEGESFVASDVSAIVQATRQVIFLEEGDTAELRRDGVRIF
FT                   DGNNAPIERPLHLSDVSLASLELGPFRHFMQKEIHEQPRALADTIEAAIDAKGFPSSLF
FT                   GANAEVVLRDIEGVQILACGTSYYAGMTARYWIEAIAGLPCSVEIASEYRYRAAYANPQ
FT                   HLIVTISQSGETLDTMEALKYAKSLGHLHTLSICNVPESAIPRASELVCYTRAGAEIGV
FT                   ASTKAFTTQLAVLFQLAMVLGKLQGRISDAEEAQSLEQLRFLPGSVQHALNLEPQIMAW
FT                   AERFSPKENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVDAGMPV
FT                   VVIAPNDRLLEKVKSNMQEVRARGGELFVFADQDSHFSESEGVHVIRTPRHAGVLSPVT
FT                   HTIPVQLLAYHTALARGTDVDKPRNLAKSVTVE"
FT   CDS_pept        732659..733132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0679"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67434"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67434"
FT                   /protein_id="BAE67434.1"
FT                   /translation="MHESFKQGAPAELWQALVREAGQRTARPLDESREHYLVFVLLRFQ
FT                   RDAHLLSRTQALAWLHAQDQIGSVRADALRDVGDGCLLIAGLFPGVAQRRRLSVDYFID
FT                   LGRGAYSEVADTRCSDAGLFAQLAESYRDLVRTLAALRTPRDWQPSAGGILHA"
FT   CDS_pept        733364..733939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0680"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67435"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67435"
FT                   /protein_id="BAE67435.1"
FT                   /translation="MKTCIAAVLLALPGLAVAQDVPLGYAVQGGMTLQEIDPAIYAYHY
FT                   DHGFVGEDALGWDPALQFAWSRIAAAKVCAQQSPSDALIGKLVEQYGKDAVVHRINGIG
FT                   FHEAQMRAAGTFCTPARVAEATAVAPAFAAGDFSKATAYAAVAEAGTLMVATQPTVISG
FT                   GAGSAALSLPADWSLLLPIHSRTVAMAC"
FT   CDS_pept        733945..734391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0681"
FT                   /product="ISXoo12 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67436"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67436"
FT                   /protein_id="BAE67436.1"
FT                   /translation="MSRAIKLLGMEITPAQFALIEHCLPLQRGNVSMTNLQVVNALLYV
FT                   AEHGCKWRGLPERFGNWHTVYTRINRWAKSGVLDRMFAQLQTCQIVRIKIEAVSLDSTS
FT                   IKVHPDGTGALKKTAHNPSGNRAADGTPKFIWLPQMLEQPSRSD"
FT   CDS_pept        734388..734735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0682"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67437"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67437"
FT                   /protein_id="BAE67437.1"
FT                   /translation="MTPGNAHDAPAGRALLEHLGPVERPVHLLMDRAYEGNETRQLALD
FT                   LGFVPVVAPKSNRVDPWEYDKEMYKRRNEVERLFRRLKGYRRIFTRFEKLDVMFLGLLS
FT                   FVLVVDGLRMC"
FT   CDS_pept        734851..735885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0683"
FT                   /product="ISXo7 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67438"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67438"
FT                   /protein_id="BAE67438.1"
FT                   /translation="MEATDMRSLSRDARHERRVQVIRLRKAGQTYDEIAAQTGLSRTGV
FT                   FDICKRHDVAGAKALRDAPSGRRSGDGRLLDAAQEALVRKLITDKTPDQLKMPYALWTR
FT                   AAVSQLIEQRFGIRLPVRTMGLYLARWGFTPQKPMKKAYEQSPAAVRKWLDEDYPVIAA
FT                   RAKAEGAEIHWGDESGLRSDDVRGRGFAPKGQTPVIRVNSKRHGLSVISTVTNKGQMRW
FT                   RIFDGALNTNILIDFLRRLIKGASKKLFLILDNLRVHHAKPVKAWLAEHADAIEVFYLP
FT                   SYSPELNPDEMANADIKQAVTTLAPARTKLQLVKATARHLRSVQRQPERIRKYFEHGPV
FT                   RYAA"
FT   CDS_pept        complement(736102..736626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0684"
FT                   /product="lactoylglutathione lyase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67439"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67439"
FT                   /protein_id="BAE67439.1"
FT                   /translation="MALNDLQHVPGAIAAPAETHGFVFNHTMLRVKDAKQSLDFYTRVL
FT                   GFRLLDARDFADATFSLYFLALLPEGTAIPDDDAQRRLWMAGIPGVLELTHNHGTDTQD
FT                   GPVYHDGNSDPRGFGHICVSVPDIHAACARFDSLNVPYQKRLEDGRMKHLAFIKDPDGY
FT                   WVEIISNTPLA"
FT   CDS_pept        complement(736783..737889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0685"
FT                   /product="copper resistance protein B precursor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67440"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67440"
FT                   /protein_id="BAE67440.1"
FT                   /translation="MSRFRTQAWLAAALLASASAVAQEHQHDAMQDAPQDMQDHAMQMT
FT                   DGAQKAPSSSQAAHMDHAHMSHAAMETGTTEQEAMKHGSMDDAAMSHQAMDHSKMDHMQ
FT                   STNAAQIPASPTNTTITGNLADTRSTALPRTPIPTPTAEEIAAAFAPLQAHTMHSAGIN
FT                   HYVLLDRMEASKTERGSGQAWESRAWIGGDIDRLWLRSEGERHDGRTEPASLETFYGHA
FT                   ISPWWDLLVGARQYIGTGDHRSWAAFGVQGLAPYKFETEATLYVGDGSRAALRLAGEYE
FT                   VLLTNRLILQPHVEADIALTDDNRRGMSRGLEETELGLRLRYEITRRFAPYIGWVHRRR
FT                   FGDSAARAAMEDAPARDSRLVAGVRLWF"
FT   CDS_pept        complement(737886..739712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0686"
FT                   /product="copper resistance protein A precursor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67441"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67441"
FT                   /protein_id="BAE67441.1"
FT                   /translation="MSFDSPCSDASSSNGLSRRRFVQGLALGGIAVAGGLWRRDARAAT
FT                   PANTPVLRGSSQSLQIGRMPVDFTGRTRPAITVNQRLPAPILRWREGDTVSVRVRNALT
FT                   DQPTSVHWHGLLLPANMDGVPGMSFDGIAPGQEYHYRFALRQSGTYWYHSHSMFQEQAG
FT                   LYGAIVIDPLTPPPYRHDREHVVLLSDWTDLDPAALFRRLKQMPSHDNDAQRTVGDFLR
FT                   DARDDGLRATLADRGMWGRMRMTPTDLSDVNANTYTYLLNGVAPAGNWTGLFKPGEKVL
FT                   LRFINGSSMTYFDIRIPGLRMTVVAADGQYVHPVSVDQLRIAAAETFDVIVEPLGQDAF
FT                   TLFAQDMGRTGFACGTLAVQHGLQAPIPALDPRAILTMQDIGHGDGMGHGDHAMHGDGT
FT                   TQGDGTTQGDAHAAHAMAMPMPEMHGHGGGNTQTKTPHQPASEDGNPLIDMRSNATAPR
FT                   LDDPGVGLRDNGRRVLCYADLHSVFDDPDGREPGREIELHLTGHMEKFAWSFDGIAFAS
FT                   AEPLRLQYGERLRIVLVNDTMMQHPIHLHGMWSDLEDADGNFQVRKHTIDMPPGTRRTY
FT                   RVLADALGRWAYHCHLLYHMEAGMMREVRVEA"
FT   CDS_pept        complement(739820..740236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67442"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67442"
FT                   /protein_id="BAE67442.1"
FT                   /translation="MLHRLLRLLLCLCLVANTATGAWASVGMAMPVMASGAMPAAAMVS
FT                   SVSTMHAAMPAAMPCHDATPPPTFAQLPDKATHAHAHDCCKLGSCDCLQHCSLALLTLP
FT                   AVPQGQFGQLALPATLADGRSSPLPDQPVRPPIA"
FT   CDS_pept        740372..741475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0688"
FT                   /product="cysteine synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67443"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67443"
FT                   /protein_id="BAE67443.1"
FT                   /translation="MSQRQWVAAAIQKIEADFNRSADTHLIPMDLQGYPGIDLYFKDES
FT                   SHPTGSLKHRLARSLFLYALTNGWLRAGRPVIEASSGSTAISEAYFARLLGVPFIAVMP
FT                   ASTSPEKIAAIEFQGGRCHLVARACDLDSASHQLAHETGGHFMDQFTYAERATDWRANN
FT                   NIAESIFKQLAEEPHPIPDWIVCSPGTGGTSATLGRYVRYRRHATRILCADPEVSVFFD
FT                   GYCRTVDGHCPKELAITGGSRIEGIGRPRVESSFIASCVDVMIKVPDALSLAAMRHVSA
FT                   TLGRRVGGSTGTNFVGVLHAARRMRDEGRQGSIVTILCDAGERYAHSYYDPAWYVAREI
FT                   DVSDNDAAIALAVNGGDLPALPCAALE"
FT   CDS_pept        741519..743543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0689"
FT                   /product="oligopeptidase A"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67444"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67444"
FT                   /protein_id="BAE67444.1"
FT                   /translation="MTNPLLDLSGLPSFDAIRPEHVGPAIDQLLAEAEAAVKAAEQVSP
FT                   VRWDSFVTPLDDATERLWRAWAQVGHLQAVVNTPELREAYNSNLPKVSRFGSALGQNLA
FT                   LYAQYKALAQSPEAAHFDEARRKVLENALRDFRLGGAELDDAAKARFAQIQEELSALAA
FT                   KFLQNVLDATDAWCYLTEDDTQLSGLTAEVIAAARAAAEQDRVPGWKFTLQMPCYLPVQ
FT                   TDADSRELRALLYRANAERASEFGDAALDNSANIDRILALRAELAQLLGFASYADYSVA
FT                   TKMAQSPDEVMGFLRDLAVRAKPHAQRDRAELEAFARDELGLHDLHAWDLAYASEKLKQ
FT                   ARYSFSEQEVKQYFTEPKVLAGLFDVIHSLYGLTVKPDSAPVWHPDVRFYRLEDAQGAL
FT                   VGQFYLDLYAREGKRGGAWMDDCRNRRTTANGVQTPLVYLVCNFGRGSGNAPATFRHGE
FT                   VTTLFHEMGHGLHQLLTRIGELGVAGINGVEWDAVELPSQFMENFCWEWERVQAMTAHV
FT                   QTGEPLPRNLFDRLLAARNFQSGMFTVRQLEFALFDMQLHSNFDPSRDSLLQLIERVRD
FT                   EVAVNRPPAWNRFPHQFSHIFAGGYAAGYYSYKWAEVLSADAYAAFEEAPEQVADTGAR
FT                   FRHEVLSRGGSRSAADNFRAFRGRAPSIDALLRHSGMAG"
FT   CDS_pept        743969..744538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0690"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67445"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67445"
FT                   /protein_id="BAE67445.1"
FT                   /translation="MLDAAASGLSMAASRLSAAPRTAGLTGTVSGALWAGGAAINQLGN
FT                   VPANALVSGANAVGAAAGVLSAVAPSLTGSDNTSVAYASAAAWAVNGGANLLRAANDAG
FT                   RALPSRVLQGVSGAANMAAAGLAAAATAASQQNAPLKAVNLGTASSVAWGIGAFAALGS
FT                   AWTAAPRDDASVEAAPAQLQRSDAAV"
FT   CDS_pept        complement(744652..745860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0691"
FT                   /product="beta-ketoacyl-[ACP] synthase I"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67446"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67446"
FT                   /protein_id="BAE67446.1"
FT                   /translation="MRRVVITGMGINSCLGNDLDTVSSALREGRSGITALPDHAEAGLR
FT                   SQVGGAVALDLDSLIDRKLKRFMGDASAYAYLAMRDAIADAGLDAEHVSGLRTGVIAGS
FT                   GGGSSQWQVETADLLRNRGVRKVGPYMVPRTMCSAVSASLATAFKIRGLSYSLSAACAT
FT                   SAHCIGAAADLIRHGAQDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDA
FT                   QRDGFVIGSGGGMLVLEDYDHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMRM
FT                   AIQGLDRPIDYLNTHGTSTPLGDVTELGAVREVFGDNVPPLSSTKGLSGHSLGAASVHE
FT                   AVYSLLMLRDGFMAGSAHIEELDPRAEGFPILRQTQEATLNTVMSNSFGFGGTNGALVF
FT                   GRV"
FT   CDS_pept        complement(745860..746375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0692"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /note="3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
FT                   (Beta-hydroxydecanoyl thioester dehydrase)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67447"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67447"
FT                   /db_xref="GOA:Q2P7N0"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7N0"
FT                   /protein_id="BAE67447.1"
FT                   /translation="MTRQSAYSRDQLLASARGELFAPDSGRLPNDPMLMFDRITEISDT
FT                   GGAHGKGVIRAELDIRPDLWFFGCHFIGDPVMPGCLGLDAMWQLTGFFLTWIGAQGRGR
FT                   ALGCGEVKFTGQVLPSAQLVRYEIDVSRVINRKLVMAQTDARMLVDGREIYVAKDLRVG
FT                   MFTSTENF"
FT   CDS_pept        746721..747800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0693"
FT                   /product="DNA polymerase IV"
FT                   /note="DNA polymerase IV (Pol IV)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67448"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67448"
FT                   /db_xref="GOA:Q2P7M9"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7M9"
FT                   /protein_id="BAE67448.1"
FT                   /translation="MRKIVHVDMDAFYASVEQRDDPGLRGKPVVVAWRGARSVVCAASY
FT                   EARTFGIRSAMPAVRAERLCPNAIFVPPDFVRYKAVSRQVREIFHRHTDLVEPLSLDEA
FT                   YLDVTQAKTGMQLATEIAQLIRTQIREETELTASAGIAPNKFLAKIASDWRKPDGQFVI
FT                   APSRIDAFLLPLKVNRIPGVGKVMDGKLAALGIVTVADLRLRPLEELQAHFGSFGQSLY
FT                   RRARGIDERPVEPDQDVQSVSSEDTFSEDLALDALDTHILRLAEKTWLATRRTERIGRT
FT                   VVLKLKTSNFRILTRSCTPEQPPVSQEALAQIALALTRRVELPAQTRYRLVGVGLSGFS
FT                   NVEEGAVQGQLFGEIPQAE"
FT   CDS_pept        747942..748592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0694"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67449"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67449"
FT                   /protein_id="BAE67449.1"
FT                   /translation="MFPYSLVIFDLDGTLVDSAPNIAEALNGTLQELGLQQFSEARIRS
FT                   WIGEGVHVLLATALRDVGSTRNVDAAMPVMMRHYEASLLHNPPLYPGVAEALAGLRDAG
FT                   ATLALCTNKPSRFIAPLLDHLGIAAHFSSVLGGDSLPQRKPDPAPLLQLARHFQRSPQH
FT                   CLMVGDSATDAAAANAANMPLAMVRYGYLRGFDVQTSGAVAIIDDMRELLALK"
FT   CDS_pept        complement(748904..749302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0695"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67450"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67450"
FT                   /protein_id="BAE67450.1"
FT                   /translation="MTTERMRNIGPKSAAWLRQVGLRTRQDLQEVGAVGAFVKVRRAGF
FT                   KPSLNLLYSLEGALADCHWQDVPEARRHALLAEYEAASALLPVRGRAVGGPVETVHYAR
FT                   ADNDDTHGDADTTPDFDDVADADQARDD"
FT   CDS_pept        complement(749299..749781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0696"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67451"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67451"
FT                   /protein_id="BAE67451.1"
FT                   /translation="MFATSSLTGSKPEQYAQLTAQAQALVHGEPDRIANAANLAALIFH
FT                   SLPSLNWAGFYFYDGRELVVGPFQGLPACVRIPLDKGVCGAAASTRQSQRIADVDAFPG
FT                   HIACDSASRSELVIPLVKGDTLIGVLDLDSPELDRFDADDQRGLEAIAQLFVDALA"
FT   CDS_pept        750106..750780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0697"
FT                   /product="dethiobiotin synthetase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67452"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67452"
FT                   /db_xref="GOA:Q2P7M5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7M5"
FT                   /protein_id="BAE67452.1"
FT                   /translation="MQPPAFYVTGTDTGIGKTMGSTALLHALRARGHTAVGMKPVASGC
FT                   ERTPQGWRNEDALALQAASNPQPAYATLNPYALPAPLAPELAAADVGVTLSLEPITQAF
FT                   AQLRAQAEVVVVEGVGGWAAPLSATLDQADLVRALQLPVVLVVGVRLGCINHARLTAAA
FT                   IAADGLQCIGWIANEVDPQMERVEENIGMLRQRLAMPCWGRIPWRPDAEAAAQAQGLQL
FT                   PR"
FT   CDS_pept        complement(750895..751230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0698"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67453"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67453"
FT                   /protein_id="BAE67453.1"
FT                   /translation="MSAQFENRFTSQFASAAARANQLAFETLEQNINATSSFFGEFAQA
FT                   RDLGAYQMLWPKGLQVARDNLERLASVNQEVVGLGLKMSSELGQFTKQQFDTGSETAGA
FT                   AGKTRRK"
FT   CDS_pept        complement(751423..751785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0699"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67454"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67454"
FT                   /protein_id="BAE67454.1"
FT                   /translation="MPRMDIFKVFTLEAAHRLPNVPPGHKCARLHGHSFRVELHVSGEP
FT                   GAETGWIMDFGDIKAAFQPIYDRLDHHYLNDIEGLENPTSERLAIWIWQQLKPTLPQLS
FT                   EIVVHETCTSGCRYRG"
FT   CDS_pept        complement(752189..753571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0700"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67455"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67455"
FT                   /protein_id="BAE67455.1"
FT                   /translation="MSFESLGLAPFLLRALAEQGYETPTAIQQQAIPLVLAGHDLLAGA
FT                   QTGTGKTAAFGLPLLQHLGTSPQPVNGPRKPRALILTPTRELATQVHDSLRGYSKYLRI
FT                   PSAVIYGGVGMGNQLDTLRRGVDLLIACPGRLIDHIERRSVDLSGIEVLILDEADRMLD
FT                   MGFLPSIKRILTKLPRQDRQTLLFSATFEENIKQLALEFMRNPMQIQVTPSNTVAESIT
FT                   HRVHPVDGARKRDLLLHLLAQDSREQTLVFARTKHGSDKLALFLEKSGIKTAAIHGNKS
FT                   QGQRMRALSDFKAGRVTVLVATDIAARGIDIDQLPKVINYDLPMVAEDYVHRIGRTGRN
FT                   GSTGEAISLVAQDEAKLLRQIVRMLGRDVEIRDVPGYEPQTPIRWGNSAPGRAEQPGGD
FT                   RAPRKSHARRPHGDAPRQAHAHAGPKKPGGQRSGGPRQANAGPGAGRRDGGRGGQRPSG
FT                   TR"
FT   CDS_pept        753950..754939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0701"
FT                   /product="fumarylacetoacetate hydrolase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67456"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67456"
FT                   /protein_id="BAE67456.1"
FT                   /translation="MKLGSLKDGGRDGSLIVVSRDLRTAVRATGIAPTLQRALEDWSNV
FT                   APRLNALSASLNDGSADGVFDLEMQALAAPLPRAYEFVDGSAYLPHVERVRRARNADVP
FT                   ESFYTDPLMYQATSAGFYGPRDGIKVISEDYGIDLEAEIVVITDDVPMGASPEQATAHI
FT                   QLVGLVNDVSLRNLIPAELAKGFGFVQSKPRSALSPVFVTPDELDDAWRDNKVHLPLVT
FT                   HINGAWFGAPEAGNDMQFDFAQLIAHAAKTRPLSAGTIVGSGTIANQDTTLGASCFAEQ
FT                   RVIETLRDGKPSTPFMAFGDVVRIEMFDASGVSIFGAIEQRVERQPLP"
FT   CDS_pept        754875..755609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0702"
FT                   /product="putative maleylacetoacetate isomerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67457"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67457"
FT                   /protein_id="BAE67457.1"
FT                   /translation="MPAASASSARSNSALSGSRCHDRLLTFHERLQSGWRMSAPYRVRI
FT                   GLDIKALAYVTHPVHLVRDGGEQHAAAYAQLNPQQLVPTLRHGAVVVPQSLAILEYLEE
FT                   AFPYSARLLPAAPSERARVRALAQAIACDVHLLNNLRVMQLLEREWQRDAAQRLHWMQH
FT                   WMQQGFAALELQLANEPYTASFCHGDTPGLADCVLIPQLYNARRFEVDLAPYPTLQRIE
FT                   QACLALPAFDAARPEMQIDAVV"
FT   CDS_pept        complement(755948..757081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0703"
FT                   /product="type II secretion system protein-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67458"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67458"
FT                   /protein_id="BAE67458.1"
FT                   /translation="MDIGYFLKLMTEKNASDMFLTTGAPVHIKIEGKLYPLGNTGLPPG
FT                   MVKKIAYSLMDEGQVPQFERELELNIAIALPDAGRFRVNAFKQRGEVGMVIRAIRSRIP
FT                   SIEELHLPQVLKDIIMAPRGLVLVVGSTGSGKSTSLAAMIDHRNSTTTGHILTIEDPIE
FT                   YLHKHKMSIVNQREVGLDTHAFQSALKNAMREAPDVILIGEILDAETMEAAIAFAETGH
FT                   LCLATLHSNNADQTIERILNFFPESAHNNVLMNLALNLRAVISQRLVKGLDGRRRPATE
FT                   VLLNTPMIRDLLRRGQVHEVKQAMEESLEEGMQTFDQCLFRMVKSGEIEQEEALRAADS
FT                   RDGLALKFRLSEDGSGEHDPYADYETPAAPKISHGFI"
FT   CDS_pept        757180..757563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0704"
FT                   /product="outer membran protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67459"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67459"
FT                   /protein_id="BAE67459.1"
FT                   /translation="MTASFAYLRRSLYGIACFIVLSSPAAAQVAPELTAAEQAVQRATQ
FT                   ADADQYAPDLVNLARQELMQAQQAQLDKRQRKQVPQIALRAAADADLAKARSEEAVVTA
FT                   QLEQRKKEVAQLQSTLNTGESGR"
FT   CDS_pept        757560..758450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0705"
FT                   /product="outer membrane protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67460"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67460"
FT                   /protein_id="BAE67460.1"
FT                   /translation="MKLRPLLYLGVLSLAALPPLAMAAKDDPQADALNRRLAALQNDPQ
FT                   TNELARFERLQAQQSVAALAEAKRRDRDELVFLADRRVEIAELTARTALARRELDRLEG
FT                   TRNDLLIEASRRDAARARQEAERLRVQAQIQTEAAEQARQSAEQEALARQDAELALTSV
FT                   AGRQTAKLNAAQQKAVQLAHEEAELVAGAKLPAAKFDSRGEVFSLGSGAFGGKAALSGD
FT                   AAGQAKALAEYLNIGKKGRVSIVGFDNDAATAKKRAEALRDALVAGGVAASRLQVTGTK
FT                   GAANKTRAAEVVVAP"
FT   CDS_pept        758792..759010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0706"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67461"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67461"
FT                   /protein_id="BAE67461.1"
FT                   /translation="MFEGQPQTEIDALMKSDPQFKQLYQRHKLLNKKCMDAELGVLPID
FT                   DVTLGQMKREKLQAKEKLTRMYDQLTH"
FT   CDS_pept        759252..760622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0707"
FT                   /product="cystathionine beta-synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67462"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67462"
FT                   /protein_id="BAE67462.1"
FT                   /translation="MAIHSSVLELIGNTPIVKAQRLDTGVCELFLKLEASNPGGSIKDR
FT                   IGLSMIEAAEQRGDLTPGATLVEGTAGNTGLGLALVAQQKGYQLILVVPDKMSREKIFN
FT                   LKAMGANVVLTRSDVAKGHPEYYQDLAAKIAAETPGAYFINQFGNPDNPAAHEFGTGPE
FT                   ILAQMDGQLDAIVFGCGSSGTMTGLSRAFASASPHTELVLADPVGSILTQYIEEGTVSE
FT                   KSGSWLVEGIGEDFLPDISDFSRVKKAYSISDAESFHTARELLAKEGVLGGSSTGTLLA
FT                   AALKYCREQTTPKRVLVFVCDTGNKYLSKMYNDYWMLDNGFLERPQYGDLRDLILRPYN
FT                   KRDTVVVGPKDLLTTAYQRMKLYDVSQLPVIDDGELVGIVDESDVLLHVYGDEARFRDP
FT                   ISTAMVSKLDRLDVASPIEALLPVFDRGQVAIVMNGKQFLGLITRIDLLNYLRRRVQ"
FT   CDS_pept        760713..761906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0708"
FT                   /product="cystathionine gamma-lyase-like protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67463"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67463"
FT                   /protein_id="BAE67463.1"
FT                   /translation="MSNRTTHSHDGDRALSLATLAIHGGQSPDPSTGAVMPPIYATSTY
FT                   AQSSPGEHQGFEYSRTHNPTRFAYERCVAALEGGTRAFAFASGMAATSTVMELLDAGSH
FT                   VVAMDDLYGGTFRLFERVRRRTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPML
FT                   KLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGI
FT                   AVVGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLET
FT                   HPAIEKVIYPGLASHPQHVLAKRQMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESL
FT                   GGVESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDLERALVNQN"
FT   CDS_pept        762025..762753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0709"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67464"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67464"
FT                   /protein_id="BAE67464.1"
FT                   /translation="MATDAGELWFPVADQVMREYARNSGRWDPHVGQVLLECCASHKDG
FT                   LFIDIGANVGYFSCLLSKHFPSLKTYAFEPQPLIHDVLALNAWTYGARIQLHSCALGSS
FT                   RGTVALETAVNNLGDTRGVEGNFASTVAPLISLDELYPDLNASIVKIDVQGAELDVIRG
FT                   MVGVIRRSPSIRIVVEFGPDLAVAEHFAPDMVLDVYRSLGFRILLIRNGQLNEASNAEI
FT                   LRYCSSAGPMAQADLLLLRA"
FT   CDS_pept        762788..763864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0710"
FT                   /product="putative sugar nucleotide epimerase/dehydratase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67465"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67465"
FT                   /protein_id="BAE67465.1"
FT                   /translation="MEKAVIVTGGAGFIGCALSGQLKAFGLPVVAIDNLHPQIHAESKR
FT                   PEVLDEAAHLHIGDVTEENTWGQVLENWQPTIVVHLAAETGTGQSLTEATRHAHVNVVG
FT                   TTAMLDAFSARKLVPEHVLLASSRAVYGEGAWLDANGTTFYPPPRSHEVLARSQWNPLS
FT                   PSGRGAASPLSHRADTVFPNPTSVYGATKLAQEHILAAWCGAMQVPLSVFRLQNVYGPG
FT                   QSPFNSYTGIITLFHRMARKAQTLEIYEDGEIGRDFVFIDDVVVALMAGLRQPPAGLRT
FT                   LDVGSGVVTTIAEAAKSIAAMHGAPDPQISGKFRDGDVRWAVADGAPLEQSLGVQARIN
FT                   FQEGANRVGEWLIARGYA"
FT   CDS_pept        764896..765822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0711"
FT                   /product="putative glycosyltransferas"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67466"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67466"
FT                   /protein_id="BAE67466.1"
FT                   /translation="MFHGAEQVDILHRPFQPDRQIPWERWRQLSKRIVVTLQDLIAYRV
FT                   GSYHETGQRWLEYRRNIEIAAGRSDAIVAISDDTSESIIDERLAVELQRIYVVKNGGDH
FT                   LTDTDVEKVPPALVEKGLVAAQFLLVLGASYSHKNRDLAILAWKELRRRGHNIALVMAG
FT                   AVVAKGSSRQEEAVARWGADEEQLVIMPDVSSAVRNWLLRHASIVLYPTSAEGFGLVPF
FT                   EAASMGTPTAHVSFGPLRELIDSPELPQDWDPLRMADHCQQLLQDPQLAGKNIKRVLAS
FT                   GGRLVWSATAADLTVAYRQTLASAPRN"
FT   CDS_pept        766625..767287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0712"
FT                   /product="putative glycosyl transferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67467"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67467"
FT                   /protein_id="BAE67467.1"
FT                   /translation="MDIPAGISFCILISTDVVRKVGIMDPCFGRGYCEETDWSLRSLAA
FT                   GYRIALAPGTYVFHHGRGSNLDAGLVSSNATTVPANEAIIDLRYPQFRNQVEAFVHSGV
FT                   LSRAHDDAISHIVRSAGKQFGYSIDVGWIGRDRTNEDEVNILLSPNGANDHIQAVFRGF
FT                   RLDMQVSRRNLGQEIRKFFGQDPTAVNLYDSGALATALKSEFANVTNTRTSNYPERV"
FT   CDS_pept        767293..768345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0713"
FT                   /product="putative o-antigen acetylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67468"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67468"
FT                   /protein_id="BAE67468.1"
FT                   /translation="MAQSELAHRSNNFDFIRIVAATSVLVSHHFALAKLPEPLVLQFQT
FT                   LGGYGVFIFFSISGFLVAQSWQRDPSLVRFTYRRLLRIWPGMLCVLILCAFLLGPAVTT
FT                   LSLKEYFLNELTWTYFKTMLFQVQPFLQGVFPDSAVPYIPNGVLWTIPIEVHCYGYLAI
FT                   LGVIGVLRWRWVLLAATAALAVYYYGYHDAENVFRAGGGRVHEIEFATFFFSGVLLHYF
FT                   REIWSSWNRIIPSFLVVMTAFLLLFQNDHQLIAVFLFTPFFFVVLGNLSFPIMRRFGRF
FT                   GDMSYGIYIYAFPVQQTLFWLWGESISFNTSLALALTITGLLAWISWHLIEQPALRLKP
FT                   RTPKRIMAGE"
FT   CDS_pept        768432..769751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0714"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67469"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67469"
FT                   /protein_id="BAE67469.1"
FT                   /translation="MLNRSLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVGSAHQSMHHLVADADWSDQALLAAVAAQVLPTLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQRLPARTYR
FT                   QVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTLPKQTP
FT                   VKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
FT                   KKNSVAFKMPAVSKSVRPRGSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        770067..771251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0715"
FT                   /product="IS1113 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67470"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67470"
FT                   /protein_id="BAE67470.1"
FT                   /translation="MLDELTSGCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHG
FT                   RSGGNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYAR
FT                   GMTTRDIESALVDVYGVEISHGLIAQVTDAVLEEARAWQSRPLEAIYPIVWLDGIVVKV
FT                   QHNKQVINKAAHVVLGVNLRGEKEVLGLWLAEHEGAQYWLSVLTELRHRGVRDIYIACM
FT                   DGLKGLPEAVQAVFPQTLTQLCIVHLVRASLRYVNAGDSKAVVAALKRIYQSATAEEAA
FT                   AELEALDTQWGDKYRAVVRLWRGNWDNIIPFFQFVPQIRKVIYTTNAIESLNMVMRKLT
FT                   RNRRIFPNDDSALKSLFLAVREASKNWRSIHHWKPALQSFQVMFGEERVPMNAL"
FT   CDS_pept        complement(771781..773094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0716"
FT                   /product="putative ATP binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67471"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67471"
FT                   /protein_id="BAE67471.1"
FT                   /translation="MCSDIAIEVKGLGKCFNVYDKPAHRLMQMLWRGRRRYYREFWALR
FT                   QVSFSIRRGETVGIIGRNGAGKSTLLQMICGTLTPTEGQITVNGRVAALLELGAGFNPE
FT                   FSGRENIYLAASLYGVDKKTISMRMESIATFADIGEFIEQPVKTYSSGMYVRLAFALIA
FT                   HVDAEILVIDEALSVGDAYFQQKCMRFLANFQRQGGTLLFVSHDMGALNALCESAVLLR
FT                   RRGEHYLCDVGSARDISAVYLRDLYSDRTTSAVTRASHPIQATYDSKNIEATRFHASPF
FT                   RSNADGFGAGGARIESVAFHNMLGDPLVEFNSSEDIRLTVVARLNKSLSYPAVGFMLKN
FT                   RKGQYILAESSDSYLREEAISIQEGSVLTVTFQLRLPRLIRGEYSLDVALAEGPGDDHV
FT                   QHHWLHDAIVLTAINSQLVHGISGAQPLSVSVRYSNST"
FT   CDS_pept        complement(773084..773902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0717"
FT                   /product="putative ABC transporter system integral membrane
FT                   protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67472"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67472"
FT                   /protein_id="BAE67472.1"
FT                   /translation="MEPYSGSPSSLLQSLIANRRLISALAVREISARYRGSLLGFTWAL
FT                   IQPIFMLAIYTFVFSEVFKARWPGGSGTKTEFALVLFSGLLVFNLFSEVFNRAPQLIIG
FT                   NANYVKKVVFPLEVLPVVSVLTAMFGLIVNLMVLLVFYLASYGVPPVTALLLPLAILPL
FT                   VLFMMGLAWLLSALGVFLRDIAQITAIITTAIMFLTPIFYPIDAIPPTFRPILNINPLA
FT                   PVIAQIRNVLIWGHGLKPLEYSLCLVISALVFITGFAFFQRTRKGFADVL"
FT   CDS_pept        complement(774125..775066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0718"
FT                   /product="electron transfer flavoprotein alpha subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67473"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67473"
FT                   /protein_id="BAE67473.1"
FT                   /translation="MAKVLVVAEHLNGQLNAATAKTLSAAQAISAESIDVVVLAADPAA
FT                   VAAQAAQLAGVARVLTVANAANEHAIAQVLGPQIVQLAGQGYTHVFGPSTTFGKDLMPV
FT                   VAALLGVNQISDLMSVEDAYTFKRPIYAGNAIITVKAPADQIVVATVRSASWPEAVGGG
FT                   SATVESVTVDAALPTHTRFVGLATGSSDRPDLQSAKRVVSGGRGVGSAENFKHIYSLAD
FT                   KLGAAVGASRAAVDAGYVPNELQVGQTGKIIAPELYMAIGISGAIQHLTGIKDAGTIVA
FT                   INKDPESPIFEIADIGLVGDLFTLLPELEKVL"
FT   CDS_pept        complement(775066..775812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0719"
FT                   /product="electron transfer flavoprotein beta subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67474"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67474"
FT                   /protein_id="BAE67474.1"
FT                   /translation="MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEE
FT                   ALRLRDAGTATEVVVATLAPADAAAHLRNGLAMGANRAIHVVTDTAVQPLTAARALLKL
FT                   VEKEQPDLVILGKQAIDDDANQTGQMLATLWGRPQATFAGKLTVADGKVTVTREVDAGL
FT                   ETLEVDLPAVITTDLRLNEPRFIKLPDIMKAKSKPLETLAFADLGVDAHDSLTTTHYAA
FT                   PSKRSRGVMVKDAAELVAALKQKGLL"
FT   CDS_pept        776038..777093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0720"
FT                   /product="dTDP-glucose 4,6-dehydratas"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67475"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67475"
FT                   /protein_id="BAE67475.1"
FT                   /translation="MATWLVTGGAGFIGGNFVLEAVARGIRVVNLDALTYAGNLNTLAS
FT                   LEGNPDHVFVKGDIGDGMLVARLLQEHQPDAVLNFAAESHVDRSIEGPGAFIHTNVVGT
FT                   LALLEAVRDYWKSLPTARSDAFRFLHVSTDEVYGTLGETGKFTETTPYAPNSPYSASKA
FT                   ASDHLVRAFHHTYGLPVLTTNCSNNYGPYHFPEKLIPLVIAKALAGEPLPVYGDGKQVR
FT                   DWLFVSDHCEAIRTVLAKGKVGETYNVGGNSERQNIEVVQAICALLDQHRPRDDGKPRA
FT                   SQITYVTDRPGHDRRYAIDASKLKNELGWEPSYTFEQGIAQTVQWYLTNQAWVQGVLDG
FT                   SYRLERIGASA"
FT   CDS_pept        777149..778036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0721"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67476"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67476"
FT                   /protein_id="BAE67476.1"
FT                   /translation="MTQRKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPLSVLM
FT                   LAGIRDILIINTPHEQALFQSLLGDGSQWGIHIQYAVQPSPDGLAQAYLIGRDFVDGKP
FT                   SCLVLGDNIFHGHGLTETLRRADAREQGATVFGYWVTDPERYGVAEFDQQGKVIDIAEK
FT                   PEKPRSNYAVTGLYFYDGKASDYAAALKPSPRGELEITDLNRCYLDAGDLHLEPLGRGY
FT                   AWLDTGTHQSLHEAANFIETIQMRQGLQVCCPEEIAFGQGWIDAEQLERLAAPLLKNDY
FT                   GKYLHELAVRGVVP"
FT   CDS_pept        778033..778590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0722"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67477"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67477"
FT                   /protein_id="BAE67477.1"
FT                   /translation="MKIVETRLPGCVVIEPAVFGDERGYFFETWNAERFGQHGLPTQFL
FT                   QSNVSTSAKGVLRGLHYQWPRPQGKLVSVLEGEVYDVAVDVRHGSPNFGQWAAVVLSAE
FT                   NKKQFWIPEGFAHGFAVLSERAVFSYLCTDVYVKEADAGVRWDDAAIGIDWPISNPLLS
FT                   AKDAAAPFLADVPAERLPVYKP"
FT   CDS_pept        778587..779495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0723"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67478"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67478"
FT                   /protein_id="BAE67478.1"
FT                   /translation="MTTLVFGANGQVGTELLRALAVDGAVQATTRSGQLPDGSACETAD
FT                   FDAPETLTALLDRIKPSRVVNAAAYTAVDRAEQDRERATRANATAPGVVAAWCASNRVP
FT                   LVHYSTDYVFDGQGAAPYRENAQTSPLGVYGETKLAGEQAIRASGAQHLILRTAWVYAS
FT                   HGANFLRTMLRVGAERDELRVVADQIGTPTPAALIADVTAQLLRQRTPDTSGTWHLTAA
FT                   GQTSWHGFAEAIFEEAVSAGLLERAPRVVPITTADYPTPARRPAYSRLSIDTLQGDFGI
FT                   ELPEWRVGLQRVIAELSATKK"
FT   CDS_pept        complement(779612..781015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0724"
FT                   /product="phosphomannose isomerase"
FT                   /note="GDP-mannose pyrophosphorylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67479"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67479"
FT                   /protein_id="BAE67479.1"
FT                   /translation="MSDVLPIILSGGSGTRLWPLSRESYPKQFLPLVGDKSMLQSTWLR
FT                   AAPVAAHAPILVANEEHRFMAAEQLQQLGVKPSAILLEPKGRNTAPAIAVAALEATRDG
FT                   ADPLLLVMPSDHVIQNEAAFQAAVTAAAAAAEQGKLVTFGIKPTAPETGYGYIKAGTGN
FT                   GVSAVERFVEKPDLATAQSYLASGEYYWNSGMFLFRASRYLEELRKFHPAIVDACQKAW
FT                   ENGKRDADFTRLDKDAFAASPSDSIDYAVMEKTADAVVVPLDAGWNDVGSWSSLLDVSK
FT                   QDAQGNAHHGDVIQLDCKNTYAYGSRLIAMVGLEDVVVVETPDAVLVGHRDRIQVVKDV
FT                   VSQIKTAGRSEATWHRKVYRPWGAYDSIDMGQRHQVKRITVKPGAVLSLQMHHHRAEHW
FT                   IVVSGTAEVTRGEEVLLLTENQSTYIPLGVTHRLRNPGKLPLELIEVQSGSYLGEDDIV
FT                   RFEDTYGRA"
FT   CDS_pept        complement(781062..782408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0725"
FT                   /product="phosphoglucomutase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67480"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67480"
FT                   /protein_id="BAE67480.1"
FT                   /translation="MTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHD
FT                   VRLASPALQEALSAGLRASGRDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYN
FT                   GMKLVREQARPISSDTGLFAIRDTVAADTAAPGEPTASEQSRTDKTAYLEHLLSYVDRS
FT                   TLKPLKLVVNAGNGGAGLIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATA
FT                   KAVKDHGADFGIAWDGDFDRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRL
FT                   TWNTVEQVEEAGGIPVLCKSGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPW
FT                   LLIAELVSQSGRSLADLVEARMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDYT
FT                   DGISADFGEWRFNLRSSNTEPLLRLNVETRGDAALLETRTQEISNLLRG"
FT   CDS_pept        782542..783273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0726"
FT                   /product="IpsJ protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67481"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67481"
FT                   /protein_id="BAE67481.1"
FT                   /translation="MRNEVSGAASGKRYADAKTALDGVLADGQTLAVGGFGLCGIPEAL
FT                   IAALRDSGVAGLTVISNNAGVDGFGLGQLLATRQIRKMISSYVGENKEFERQYLAGELE
FT                   LEFNPQGTLAERLRAGGAGIAAFYTATGYGTIVAEGKETREFDGKHYVLETALHADVAL
FT                   VKAWRADTAGNLVFRKTARNFNPACAMAGRVCIAEVEEIVELGVIDPDQVHLPGIYVDR
FT                   LVLNATPEKRIEQRTVREGQQ"
FT   CDS_pept        783273..783902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0727"
FT                   /product="IpsJ protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67482"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67482"
FT                   /protein_id="BAE67482.1"
FT                   /translation="MAWTRDHMAARAARELTDGAYVNLGIGLPTLVANHIPDGVDVWLQ
FT                   SENGLLGIGPFPTEDEVDADLINAGKQTVTARAGASYFGSHDSFAMIRGGHIDLAILGA
FT                   MQVTERGDLANWMVPGKMVKGMGGAMDLVAGVKRVVVLMEHVAKDGSHKILRDCDLPLT
FT                   GVGVVDRIITDLAVFDVTADGLVLVESAEGVELEELRQKTGVEFAA"
FT   CDS_pept        complement(783960..786047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0728"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67483"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67483"
FT                   /protein_id="BAE67483.1"
FT                   /translation="MSSPGRSLQSRLRTYVFGLLRAGFRAIPLSDATRDRWRGWFLDRH
FT                   AGWVPEPARGRVRPSSSRRPAVRSDEAAIGYVPYSTATLPETLPAKLIAFYLPQFHPIP
FT                   ENDAWWGKGFTEWRNVSRALPQFEGHQQPRLPADLGFYDLRSPHVMRGQARLAQEYGVG
FT                   AFCFYFYWFAGKTLLEMPITQWHEDATITLPFCLCWANEKWARRWDGRGDEILIDQAHD
FT                   ADDDLAFIAHVATYMRNPKYLRVEGRPVLLVYRPHVLPEPAQTADRWRGWCRDHGIGEI
FT                   HLAYVQGFERPDPRDIGFDAAVEFPPNMSTPPSVAARQRLINPEFNGDVLDWRELARDM
FT                   EQRPLREYTLYPGVNPGWDNEPRRSGKGRIYLHASPRRYRDWLMLTVRNRLKNTTPAHR
FT                   LVFINAWNEWAEGAVLEPDTRVGYAWLDATRQALLHTAEVVTRSGQHDACVVLHAWYLD
FT                   VLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQRGLQAQVEGFENRGRDILPFLRV
FT                   ANRLLDEGEQVVLKLHTKKSTHREDGDTWRRDMLSGLLAPQHVAAIVRGFAEDPLLGLV
FT                   APAQHLLPVTDFMGGNADALDYLTVRTGTDAINAHSLFASGSMFWVKLEALRPLLDAHL
FT                   HPSEFESEQGQIDGTLAHAIERFLAVAVAHSGQRVATIEQLLGIPQPATAEPYRYARKA
FT                   P"
FT   CDS_pept        complement(786044..787729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0729"
FT                   /product="flavoprotein-ubiquinone oxidoreductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67484"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67484"
FT                   /protein_id="BAE67484.1"
FT                   /translation="MDTSHRANGSGAMSEAGVGAHASEAVERDVMEYDIVTVGAGPAGL
FT                   SFAIRLKQLDPNISVCVIEKSSTIGAHILSGAVIEPGPLDALLPGWRNNPPPICVAATD
FT                   DEFWFLGKDSARKFPVVPPGMRNHGNFIVSLGAMCAWLAPQAEALGVEIYPGFAAAETL
FT                   HDESGQVVGVRIGDMGIAKDGTHKPGYTAGIDIRAKVTVLAEGARGHLTKRLLKRFDLT
FT                   ADSDPQGYSIGIKELWQVPEGRVTPGKIVHTIGWPADNRTYGGSFVYHLDNNQIALGYV
FT                   SGLDYSDANYQPWEAFQQWKNHPMIKPLLAGGSILSAGARALVSGGWQSLPKVDMPGAL
FT                   LIGDTAGLLNVPKIKGTHQAIRSGMLAAEHLVQSQLAPRGFDAALRASDVMAELKQVRN
FT                   IKPGFKKGLWFGLLNAAWETALKGASPWTLKNKPDWSALHKLGEYEQPERDYVTRDLAP
FT                   RDRLQAVYFAATEHDEDQPVHLKVLDTDVCATRCVTEYDNPCTRFCPANVYEMVADTAS
FT                   PSGKRLQINAANCVHCKTCDIKDPYEIITWVTPEGGSGPNYQNL"
FT   CDS_pept        787809..788417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0730"
FT                   /product="DNA repair system specific for alkylated DNA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67485"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67485"
FT                   /protein_id="BAE67485.1"
FT                   /translation="MKIRVALPGAEIDWWRGWLPHAQADALMQALLVQAHWQLHRIRMF
FT                   GRMVDSPRLSSWIGDPEASYRYSGTRFSPQPWLEVLQPVRLRLEDETGHRFNSVLINRY
FT                   RSGSDAMGWHSDDEPELGAQPLIASVSLGARRRFAFKHRDDASVKQALELGHGDLLLMG
FT                   GQTQRHYRHALPRTAKPVGERINLTFRQVAGARVPAIRG"
FT   CDS_pept        complement(788968..789612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0731"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67486"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67486"
FT                   /protein_id="BAE67486.1"
FT                   /translation="MTAMRLLRPLLCVSLLALGGCSVLTGGDQKPATIYSPTVRVSPNP
FT                   AWPQVAWQLVVAKPSAARIIDSPRINVRPTPGELQVYQGVGWAQPATDMLEDNVVRAFE
FT                   DSGKIAAVAHIGTGIRSDYKLAIDLRRFESDYASQSLPSATIEFNAKLLHSTDQRVVAS
FT                   RTFLVARPSTSTDTAAVAVAFEQALTQVTTELVGWTLTTGQQDSQHLPRSL"
FT   CDS_pept        complement(789609..790535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0732"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67487"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67487"
FT                   /protein_id="BAE67487.1"
FT                   /translation="METKANYVLIGAFTIVAGLALLLFGLWAAKYSSDRTWQQYRVVFR
FT                   EAVTGLSVGSPVQYNGIAVGSITELTLAPNDPRQVVALVRVNSTTPIKSDTRAKLAITS
FT                   LTGPSIIQLSGGTPEAPALTTIDKSDAPIIQTTPSALQNITDTANRIVERMDQMLSDKN
FT                   VASISATLQNLEKISGGIADHDDGMQALIVSARDAARNLDTTLTTTNGTIKRLDQNLVQ
FT                   QLPGILEKLDATLVKLDSAAGNADNILGENRAAINSFANDGLGQLGPTLTELRGLIRDL
FT                   RRVSDKLDNNPARYLLGRDAPKEFEPK"
FT   CDS_pept        complement(790538..791380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0733"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67488"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67488"
FT                   /protein_id="BAE67488.1"
FT                   /translation="MITPESPLAHPGPETDAHDDQLAISVRGLTNRFGRQTVHEDLDLD
FT                   VRRGEILGVVGGSGTGKSVLMRSILGLREPDAGSIHVLGADARSGRFADRQHITRNTGV
FT                   LFQDGALFSSMTVGENVQVPLKEHHGEFPERWYFELALLKIKLAGLPADALDKLPSQLS
FT                   GGMRKRAGLARALALDPPLLFLDEPTAGLDPIGAAAFDRLIRTLQQALGLTVFLITHDL
FT                   DTLYAICDRIAVLADRKVIANAPLSEVEQIDHPWIQDYFHGPRARAARAAKTDSTETA"
FT   CDS_pept        complement(791466..792578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0734"
FT                   /product="ABC transporter permease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67489"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67489"
FT                   /protein_id="BAE67489.1"
FT                   /translation="MIKPQPPRIEQDSQDQAQLRLAGSWVLATALPQAELLQTVPDGVR
FT                   RIDARGIQQLDSAGVLQLLRFASRIGLKEDAIDFRDEHQALVCTIEELNDERPKPKRDY
FT                   GFVAALDRLGRATHRIGQDILELNSFLGENLVKIMRLIHEPRRFRLTSTVHHMEQVGLD
FT                   AVPLVVLLSYLVGAVIAFLGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTA
FT                   SAFTAQIGAMKSREEVDAIRTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVT
FT                   VGAFDLDIPPQMYLARMHETIQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVG
FT                   ERTTSSVVQTISLVIILDAIAALWFMKMGW"
FT   CDS_pept        792748..794007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0735"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67490"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67490"
FT                   /protein_id="BAE67490.1"
FT                   /translation="MSAATVVLPSASATYAQRVAFVSEIACRLHSYGTTAQRLEAALVG
FT                   LSQKLGLDCEPWSNPTGIILSFSDPTKAIGSSDITRVIRLAPGEIDLYKLSLADYVADS
FT                   VANGRMSIAQGHTALRRLDREVGRRGKAMQVLAFGLAAASVAGLWKLPWLDIATAGAIG
FT                   MSIGLLTQYTDKRAATKEAGEALAGLLAGVVASLVASLLGPLNLNTVIIASLVVLLPGM
FT                   SLTNAFNELASQHWVSGTARLAGAVTTVLKLTVGAVIAVTLTQLVGLNPQVAALRPQAG
FT                   WVELASLVVAAYAFAVLFKANRRDYLWIMAAAMLSYVIARCAGHAWGGPVGVFASAMTL
FT                   TAAGNLFGRVVHKPGAMIRLPGIIMLVPGGVSLRGFLTLVQQQDVSVGQAALLAVTNIV
FT                   MALMAGLLFGNLLIPARKNL"
FT   CDS_pept        complement(794069..794530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0736"
FT                   /product="DNA-binding protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67491"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67491"
FT                   /protein_id="BAE67491.1"
FT                   /translation="MSIDLSRLSAKQLAALIKNAKKQQTLVAERAPIAKVRTQLTRAAK
FT                   AQGYSIEELFGASATAGPGRPAGAAKPGPRAGRKLGKVPPKYRNPANAQETWTGRGKQP
FT                   RWLAELTAAGKKVEDFLISKVGGVKKATAKKASARKAVTKRATRKSKAG"
FT   CDS_pept        complement(794673..796424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0737"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67492"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67492"
FT                   /db_xref="GOA:Q2P7I5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7I5"
FT                   /protein_id="BAE67492.1"
FT                   /translation="MTSRARDWQTMGFPPKRSPMRLSQFHLHTTKETPADAELVSHRLM
FT                   LRAGMIRKLASGLYTWSPLGLRVLRKVEAIVREEMDRAGAVEVLFPTIQPRELWDATGR
FT                   WEKFGGQLLKIKDRKEQEFCYSPTAEEAAAEFARQEINSYKQLPLNFYQIQTKFRDEIR
FT                   PRFGVMRAREFLMKDAYSFHLTDADMAREYDNMRAAYTRIFTRLGLDFRAVQADSGAIG
FT                   GDASQEFHVIADSGEDSLAFSTGSDYAANVETASAALPAPRAAASEAMQQVATPTQKTC
FT                   EDVAQLLGIALQRTVKSVAVMTEAGFVLALVRGDHAVNEIKLAKVPGLAGYRLANETEI
FT                   RAHLGCEPGFLGPVNTARPVRVVADRDVAALADFVVGANVSGAHLVGVNWGRDLPEPET
FT                   VADVRNVVEGERAADGGELRLARGIEVGHVFQLGSQYAQALQATVIDEGGKVAVMKMGC
FT                   YGIGISRIVAAAIEQNHDDAGIIWPAPMAPWQVVVCVINPKQDAQVVSAAQALLDELIA
FT                   AGLDAALDDRGLRPGAMFADMELLGIPHRVVVSERGLAAGTFEYRARTAAAAENLDKAG
FT                   LFSRLGR"
FT   CDS_pept        complement(796479..796850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0738"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67493"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67493"
FT                   /protein_id="BAE67493.1"
FT                   /translation="MLVSAAAGATDIYKWKDAKSVTHYTETPPPTGQRYEARQIDARSG
FT                   TAAVAAAPTAAPESADCLTARRNLELLSGKGDVSMAAGADGKPGAVLDQETRATQRNLA
FT                   DAAVKAYCKPAATGGPATQ"
FT   CDS_pept        797015..797788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0739"
FT                   /product="phosphatidylserine synthase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67494"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67494"
FT                   /protein_id="BAE67494.1"
FT                   /translation="MDEMRPPPRSRTIYLLPNLFTTAGLFSGFYAIIAAANGQFVQAAM
FT                   AVFVAAVMDGLDGRVARLTNTSSEFGVQYDSLADLVSFGMAPALVMYHWSLSALKYDSN
FT                   VMGRVGWSAAFLYAACAALRLARFNTQVGVVDKRWFIGLASPAAAGLMMSFVWAFADDS
FT                   LGFDGEQLRYVALAITVVSALLMVSRMRFWSFKGGARGPRADRVPFLALAIATVVIALL
FT                   VIDLARSFLVIGVLYALSGPLMWLWRRWRRVPELP"
FT   CDS_pept        797799..798266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0740"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67495"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67495"
FT                   /protein_id="BAE67495.1"
FT                   /translation="MSEPPSEPMWSDLQVSYLQALGHTVYLDRDAADALPAPVEVAERA
FT                   EMAAPARVERGPQSAVVSTPVARRSATAAPAEAPRAPNTAPAAAPQRRSRVGMPDRLQM
FT                   ALLRASGCNPGDPATQALMVSWPLAELRGNPAAKRALWPQLRALRRRRDPA"
FT   CDS_pept        798263..798745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0741"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67496"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67496"
FT                   /protein_id="BAE67496.1"
FT                   /translation="MSALNVPQPTALRAMRESDLEVVMEIELRAYPFPWTRNIFRDCLQ
FT                   SGYPGWVMEQGGRVIGYGVISIAADEAHVLNVCIAPEAQSQGHGRVLLRALIKGACDRG
FT                   ARRAFLEVRPSNPSAIALYHSEGFNEIGRRPRYYPSHSGREDALVMAIELFFEGFS"
FT   CDS_pept        799304..800623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0742"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67497"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67497"
FT                   /protein_id="BAE67497.1"
FT                   /translation="MLNRSLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSLHHLVADADWSDQALLAAVAAQVLPPLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVASAATRRSGGASHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQRLPARTYR
FT                   QVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTLPKQTP
FT                   VKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
FT                   KKNSVAFKMPAVSKSVRPRGSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        800781..802100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0743"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67498"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67498"
FT                   /protein_id="BAE67498.1"
FT                   /translation="MLNRSLEVRFEQYGEVVAAALSHADRKQPAHWYLKGLLLPGGRKS
FT                   VEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPPLSRKSAACHWIVDD
FT                   TGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVGYRLYLPEQWAQDTV
FT                   RRKKAGVPDQVVFQTKTALAMDQIDSALATGMAAGVVLADAAYGTETHWRDQLSERGLL
FT                   YMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQRLPARTYR
FT                   QVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTLPKQTP
FT                   VKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRS
FT                   KKNSVAFKMPAVSKSVRPRGSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        complement(802313..803281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0744"
FT                   /product="ISXo1 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67499"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67499"
FT                   /protein_id="BAE67499.1"
FT                   /translation="MQLTFGDAEGLGKRKQTRREIFLAEMERIVPWKRLLALIEPHYPV
FT                   SGRPGRQPYALARMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPDETTI
FT                   LNFRRLLETHGIAARMLEAVNAHLSRKGQSLRSGTIVDATLIAAPSSTKNADRARDPEM
FT                   HQTKKGNQWYFGMKAHIGVDEFSGLVHHVHCTAANVADVTVTHALLHGKEDSVFGDSGY
FT                   TGAEKRDELQSCEAAFFIAAKRSTIQAIGNKRARAWAERWEHFKASVRAKVEHPFRVIK
FT                   RQFGYTKVRYRGLAKNTAQVQTLFALSNLWMVRRHLLPARG"
FT   CDS_pept        complement(803431..804405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0745"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67500"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67500"
FT                   /protein_id="BAE67500.1"
FT                   /translation="MLPPQYCGPLCQADNCQAAVSLSIANEHGSLPVGYRLYLPEQWAQ
FT                   DTVRRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGTETHWRDQLSER
FT                   GLLYMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPISVHEVAQRLPAR
FT                   TYRQVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTLPK
FT                   QTPVKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRER
FT                   LRSKKNSVAFKMPAVSKSVRPRRSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        804912..807029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0746"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67501"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67501"
FT                   /protein_id="BAE67501.1"
FT                   /translation="MPSRWLQGGTRMRVRDAPRRACERMRRLRQVRDAYSLRRSGVLRY
FT                   HRAMTYAPRFATVLIGLLCLGSTALHAQTLDPQLTAMRDAIAAAERGQTDAGQLAALSR
FT                   HPLYGWLEFATLKRSIDTVSNTQAQGFLQRYAGQPVAESFRSIWLPAVARRQDWDTLLA
FT                   NWKSTDNVGLRCAQLTALLATSKADAQWSRDALTLWRNGKALPDACDAVVAGLESRGEL
FT                   TPALRWERVEAAADAQLPAVMRKAARGLPAADLALATDYAAFLDKVHPRALSWPKSVRS
FT                   RRIAVDGLAKLAKSDPDAAEQQLPQLASALGFSEAQRGQVLYQIALWTVASYLPDSARR
FT                   LNAVPDASYDERLHEWRAREAMSRGDWPAALAAIRKMPASQRNDSRWQYFEARLAEKTG
FT                   VAAAAQPLYRAAAQSPTFHGFLAADRLQQPYRLCPWEPNDSPQAKAAVARDPALIRAIA
FT                   LFQIDRPGWAAAEWNDAATRFDDTQRRLAVEVASDNGWFDRAVFALGKQPDEQRLYSLR
FT                   FPLHHEDTIRREAAKNAIDPAWVAGEIRAESIFNPRARSPANAMGLMQVLPGTGAAVAK
FT                   GIALPGYAGATSLYEPNTNIAIGTAYLRQLLNTYVLPYLTIAAYNAGPGPTGRWQSQRP
FT                   NFDPDFWIETISYKETRDYVARVLAFSVIYDWRLNGDMLPLSDRLMGKLVDKRLKPVCT
FT                   PGQAANNPAQD"
FT   CDS_pept        complement(807296..808336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0747"
FT                   /product="pectate lyase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67502"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67502"
FT                   /protein_id="BAE67502.1"
FT                   /translation="MQLLGWATQNGRTKGGSKAAAANIYTVKTAAELKAALSASVGSNG
FT                   RIIKVSGIIDISEGKPYTRTSDMKKRARLDVPTKTTLIGITSNAEIREGYFYVKANDVI
FT                   IRNIAIENPWDPEPVWDLNDGRACNWNSEYDGLTVEGASNVWVDDVTFTDGRRTDDQNG
FT                   TENGRPKHHQDGAMDIKKGANFVTVSYSVLKSHEKNNLIGSSESASSTDSGKLKVTIHN
FT                   TLFENVSARAPRVRFGKVHLYNNYHVCGTSNSVYRFSYAHGVGKESKIFSERNVFEISG
FT                   VSSCNKIAAGYGGSVYRDQGSLLNGKALSCAWNSNIGWTPPYTYNLLSVDKVATDVKVK
FT                   AGAGKL"
FT   CDS_pept        complement(808656..809840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0748"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67503"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67503"
FT                   /protein_id="BAE67503.1"
FT                   /translation="MEPMAARVHPQNVRSAHQSMHHLVADADWSDQALLAAVAAQVLPP
FT                   LSRKSAACHWIVDDTGFSKKGVHSVGVARQYCGRLGKTDNCQVAVSLSIANEHGSLPVG
FT                   YRLYLPEQWAQDTVRRKKAGVPDQVVFQTKTALAMDQIDSALATGIAAGVVLADAAYGT
FT                   ETHWRDQLSERGLLYMVGVRSNTKVWWGSHQPAPMPPASPKGGRPRTRPMRDSAHAPIS
FT                   VHEVAQRLPARTYRQVSWRQGSDATLSSRFAAVRVRAAHNRQAHDEQWLLIEWPPGESE
FT                   PRHYWFSTRPKQTPVKTLVATAQGRWRIERDYQELKSELGLHHYEGRNWRGFHHHASLC
FT                   IAAYGFLMRERLRSKKNSVAFKMPAVSKSVRPRRSGPNATSPSQLDCHAGLRTG"
FT   CDS_pept        809926..810282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0749"
FT                   /product="ISXo3 transposase orfA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67504"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67504"
FT                   /protein_id="BAE67504.1"
FT                   /translation="MREKNDPSDVSRERFEQIRPILEQARKRTKPVTVDMYEVWCAVLY
FT                   LLRTGCPWRALPSDFPKWRTVHSYFAKWSEVDDEGMSLLERALKKSGWRGPRETGAQGL
FT                   QHVLDRGRAEREEQ"
FT   CDS_pept        810248..810724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0750"
FT                   /product="ISXo3 transposase orfB"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67505"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67505"
FT                   /protein_id="BAE67505.1"
FT                   /translation="MIVDAQSVKNSDTAGQKGYDAGKKVSGIKRHIAVDTQGFPHAVAV
FT                   TTAEVTDRQGALEALKRCRSGLGRVKRLLCDSGYTGDPFAEGVQDILGKHVTVQIAKRS
FT                   ELHTFKVMPKRWSVERSFAWLEKNRRLWKNCERRLNTSLQFIHLAFLALLLRRS"
FT   CDS_pept        810761..811309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0751"
FT                   /product="ISXo8 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67506"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67506"
FT                   /protein_id="BAE67506.1"
FT                   /translation="MRDSAHAPISVHEVAQRLPARTYRQVSWRQGSDATLSSRFAAVRV
FT                   RAAHNRQAHDEQWLLIEWPPGESEPRHYWFSTLPKQTPVKTLVATAQGRWRIERDYQEL
FT                   KSELGLHHYEGRNWRGFHHHASLCIAAYGFLMRERLRSKKNSVAFKMPAVSKSVRPRRS
FT                   GPNATSPSQLDCHAGLRTG"
FT   CDS_pept        complement(811376..811690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0752"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67507"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67507"
FT                   /protein_id="BAE67507.1"
FT                   /translation="MSMQFSSPYGSVADSYKARPTYPTELFDWLAGQVSQCVLAWDCGC
FT                   GSGQGSQDLARYFDGVVATDVSHEQISRASSNSKVEFRATPAHISGLDDASVDLVLLCY
FT                   "
FT   CDS_pept        complement(811876..812862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0753"
FT                   /product="ISXoo3 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67508"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67508"
FT                   /protein_id="BAE67508.1"
FT                   /translation="MAQQVRRHERARCQAAQGPGGREHATEEVAGRAGVSERPDQGCVA
FT                   KTMVSAPARRALVREWIDGGASERCALAAIGMSASALRYRPREDRNVELRERILALAHR
FT                   HRRYGVGMISLKLRQEGRLVHYKRVERLYCEQQLQVRGRTRKKVPVGERAPLLRPTKAN
FT                   PVWSMDVVFDRTAEGRAIKCLVIVDDATHQAVAIDVERAISGHGVARVLDRLAHSRGLP
FT                   KMIRTDNGKEFCGKAMVAWAHANRVQLRQIQPGKPNQNAYVESFNGRLRDECLNEHWFP
FT                   TLLHARTEIERWRREYNEHRPKKTIGGMTPVAYAQQLANSDIINPRL"
FT   CDS_pept        complement(812878..813447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0754"
FT                   /product="ISXoo4 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67509"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67509"
FT                   /protein_id="BAE67509.1"
FT                   /translation="MQRLTCGFGVLELPVFVTLGPGFWQFSPMRTRRPAAEQLPADELF
FT                   RSRLENQIDVRHPLVQLSHRLPWSALEQALSPRLPATTSTGGRPALPVRLIAGLLDLKH
FT                   AYDLSDEAVCERWLENPYWQFFTGEVVFQTDVPPILSSTSVWSPIPYPEEMGREEALFR
FT                   RADHRLPARSRGRHADQGPVPTAWLQ"
FT   CDS_pept        complement(813458..813583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0755"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67510"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67510"
FT                   /protein_id="BAE67510.1"
FT                   /translation="MALVVYLLYIDRVQIRLEEEALQERFGAAYQTYCQRVRRWL"
FT   CDS_pept        complement(813605..813907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0756"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67511"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67511"
FT                   /protein_id="BAE67511.1"
FT                   /translation="MSPLPPPVCVAAGMLGAWAAALTWPQLCISLPGQRACALAIMLLG
FT                   ALINVVPKWRFRRAGTTVDPRRPQRCSALVQTGLHRYSRNPMYIGHALLLAGWAT"
FT   CDS_pept        complement(813915..816857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0757"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67512"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67512"
FT                   /db_xref="GOA:Q2P7G5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7G5"
FT                   /protein_id="BAE67512.1"
FT                   /translation="MTTLASSYDPSSFESRLYAQWEAAGYFVPSDTGEPYTVLLPPPNV
FT                   TGTLHMGHAFQQTLMDALVRYHRMRGYDTLWQVGTDHAGIATEMVVSRNLALEGKGETR
FT                   DSLGREGFIAKVWEWNAASGDTIERQMRRLGTSSDWSRSTFTMDPQPSAAVNEAFVRWY
FT                   EQGLIYRGQRLVNWDPVLKTAISDLEVENVEEDGFLWSIRYPLADGVTYEHIEHDADGN
FT                   ETLRETRDYLVVATTRPETMLGDTAVMVHPEDARYLTLHTARIVLPLTGRHVPVITDDY
FT                   VDRAFGTGVVKVTPAHDFNDYQVGERHNLPLVNLFTADAKIIDPRKQYPDDESPFVNAG
FT                   IDWRELDQIQRKRLGQHLAYKIPAQYIGLDRYDARKLVLSELEDLSILVETKPHKLQVP
FT                   RGDRTGQVIEPYLTDQWFVKMDALAKRGLELVESGQIQFVPPNWINTYRHWMENIQDWC
FT                   ISRQLWWGHRIPAWFDDAGHCHVGHDEAEVRAKHGLGAEIALHQDSDVLETWFSSQLWP
FT                   FSTLGWPDSQAMAERGFARYLPSSVLVTGFDIIFFWVARMIMATDSFTGQVPFRDVYIT
FT                   GLIRDAQGQKMSKSKGNVLDPLDIIDGISIEDLVAKRTNGLMQPRMAEKIEKATRKEFP
FT                   DGIIAHGADALRFTIAALATHGRDIKFDLGRAEGYKNFCNKLWNATRFVLMNTEGARFT
FT                   GVPQPRTEAEKWILARLDKVTAETHAHYANYRFDLLAQSLYEFAWNAFCDWFVELAKPA
FT                   LNNQDTDAAASTRHTLLYVLESLLRLLHPLTPFVTEELWQQVVPRLGITTATISLQRFP
FT                   QVGDVDTSGYATAEADVEWLKSMVSALRRVRSELNVPPSKQVRLLLQADTADERPRVAR
FT                   FASQLSFLLKLERIDWLDAGQDTPPSAAAIVGELTLLVPLEGLVDMDAERMRLDKEIKR
FT                   VKGEIGKCNGKLGNATFVQNAPAVVVDQERARLADWTTQLAGLREQRGKL"
FT   CDS_pept        complement(817065..817490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0758"
FT                   /product="DNA polymerase III holoenzyme chi subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67513"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67513"
FT                   /protein_id="BAE67513.1"
FT                   /translation="MPRADFYLIAKPRFLNEPLRLVCELARKANNANLSTLILARDAEQ
FT                   AEALDDLLWAFDDEAYVPHQIAGTDEEDELAPVLIAAPEFAAPSRPLVINLRDDPYLGA
FT                   CDRVLEVVPADPAAREPLRERWKQYKALGLELTKYDM"
FT   CDS_pept        complement(817531..817836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0759"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67514"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67514"
FT                   /protein_id="BAE67514.1"
FT                   /translation="MSPRAALALIAGFSVVKGAASAVPGWTSPGIDLLWIVVQLLLLFV
FT                   WLAADSRRPAWMNIGIVASAVRFLPVYLYRPGNACVHSAARCWPCSAVLPCSWPPA"
FT   CDS_pept        complement(817836..819308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0760"
FT                   /product="probable cytosol aminopeptidase"
FT                   /note="Probable cytosol aminopeptidase (Leucine
FT                   aminopeptidase) (LAP) (Leucyl aminopeptidase)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67515"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67515"
FT                   /db_xref="GOA:Q2P7G2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7G2"
FT                   /protein_id="BAE67515.1"
FT                   /translation="MALQFTLNQDAPASAAVDCIVVGAFADKTLSPAAQALDSASQGRL
FT                   TALLARGDVAGKTGSTTLLHDLPGVAAPRVLVVGLGDAGKFGVAPYLKAIGDATRALKT
FT                   GAVGTALLTLTELTVKARDAAWNIRQAVTVSDHAAYRYTATLGKKKVDETGLTTLAIAG
FT                   DDARALAVGVATAEGVEFARELGNLPPNYCTPAYLADTAAAFAGKFPGAEAEILDEAQM
FT                   EALGMGSLLSVARGSANRPRLIVLKWNGGGDARPYVLVGKGITFDTGGVNLKTQGGIEE
FT                   MKYDMCGGATVIGTFVATVKAELPINLVVVVPAVENAIDGNAYRPSDVITSMSGKTIEV
FT                   GNTDAEGRLILCDALTYAERFNPEALVDVATLTGACMVALGHQTAGLMSKHDDLANELL
FT                   AAGEHVFDRAWRLPLWDEYQGLLDSTFADVYNIGGRWGGAITAGCFLSRFTENQRWAHL
FT                   DIAGVASDEGKRGMATGRPVGLLTQWLLDRAA"
FT   CDS_pept        819416..820498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0761"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67516"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67516"
FT                   /protein_id="BAE67516.1"
FT                   /translation="MPKLDRYLLSDFTQSFLATLIVLLVVSVGGVLVDILGNIADGRIP
FT                   ARLLLSQVGLQFVAYLPIILPLALMLGLLLALARLYRDSEMAVITAIGVGPTRMLRPLL
FT                   MLVVPVVVVIGLCSLWLGPWASRTAEAMLEDANRSVLMAGLESGQFTPLSDGGVVYMQT
FT                   ISADGKGLGKIFLQRQQNDRIDVVTADRGALFFEGKTDRYLHLDDGYRTEGPAGGATLD
FT                   YRLMKFASSDIALPDRTRLHDANDPEVMWTTQLLSDERPAARAQLHERLAPPLLALAFA
FT                   MLTLPLSRSAPRQQRYGRIMLAFLAYMVGTNLMIVGTQWIANGKAPAALGLWWLTLPLL
FT                   AVAVWAYARDGRVRRPRARA"
FT   CDS_pept        820495..821601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0762"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67517"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67517"
FT                   /protein_id="BAE67517.1"
FT                   /translation="MKLTPRVHDWYVGRVVLSTVLLTWAVLLGLDLVNAFASEAKDIGQ
FT                   GSYTFGHAVAYVAYTVPRRAYTLFPTAAVIGALMGLGQLAATSELTALRALGVSRKRMS
FT                   ASVVAAMALLTASMVISGETIGPWAQNQADTLKASARYNSDMAASLYAGLWAREGDTFL
FT                   NALSGEEKLLDGGDTALDLHDVRLYHLDSSGRMQQLTYASVAEHRDGRWTLRQVRRDTF
FT                   QERSVQRETFPELPWQSQLNPAALAAGLAKPRNLSAHDLEQSIEYRSRNGLDARDYEDQ
FT                   YWSRWFYPLNVLALCMAAIPFSFGSLRSGGLGKRLFLGILFALGFWLLQLFFGRMAGAL
FT                   KLDYRIAYALPPMVMLGVSAWLFRRRSS"
FT   CDS_pept        complement(822016..822483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0763"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67518"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67518"
FT                   /protein_id="BAE67518.1"
FT                   /translation="MTSLSSPRIARTPALVGWRLLALCYDALPVLALSMLISTVFTLGF
FT                   TLAGHPARENIAPFSGWQWLLWLCCWITAGIYATASWRRGGQTLGMRPWRLRLIGPQAS
FT                   WRALWIRYAVGTLSLALGGLGFWWAWLDRDRLTWHDRASGTRLQRSAKTLK"
FT   CDS_pept        822910..823881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0764"
FT                   /product="integrase-recombinase XerD"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67519"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67519"
FT                   /protein_id="BAE67519.1"
FT                   /translation="MSASSPAERRQLAQQLPPLQAADAGVIERFLDRFWAEQGVARQTL
FT                   ESYRRDLEGLARWRAGAGGGLLGIDRVALFDYLRWRAQANYSPRSTARLLSTLRAFYGW
FT                   CLRDGVRSDDPTALIDPPQLPRSLPKALTESQIEALLAAPEVDTPAGLRDRAMLELMYA
FT                   AGLRVSELVNLPAVGVNLRQGVLRVTGKGSKDRLVPLGEESQHWLERYLREARPLLAAN
FT                   KPVAAVDGQVPLFIDAARQALSRQHFWALVKRYAAVAGIDPAMVSPHGLRHSFATHLLN
FT                   HGADLRALQMLLGHSSLSTTQIYTLVARQHLQKLHASHHPRG"
FT   CDS_pept        824337..825134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0765"
FT                   /product="disulfide isomerase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67520"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67520"
FT                   /protein_id="BAE67520.1"
FT                   /translation="MYRLAIAALLGAISLTACAQSSQPAASTVGAKPAAAPAAAGNVDQ
FT                   RVSTALKALDPDFKPDYLGAAPFPGFREVVVGGQVLYVSDDGRYLIQAQPFDIQNKQFA
FT                   ASPGLLAYRRKQLDTVPKADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGI
FT                   AVEYLAFPRMGLGSQDHKEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYTLGQ
FT                   RLGVNGTPAIFAPDGTQLGGYLPPAQLREALEKRAVATAGGSR"
FT   CDS_pept        825533..829585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0766"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /note="Phosphoribosylformylglycinamidine synthase (FGAM
FT                   synthase) (FGAMS) (Formylglycinamide ribotide
FT                   amidotransferase) (FGARAT) (Formylglycinamide ribotide
FT                   synthetase)"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67521"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67521"
FT                   /protein_id="BAE67521.1"
FT                   /translation="MMVLEGASALSPFRRARLETRLQTLVPALRITGVWHVYFIRAEAG
FT                   QSPDQATLRRILQANAAPAVRDADAASRYVVPRLGTLSPWSSKATELVRGAGQPIQRVE
FT                   RGTRIDLAGWPDDAVAQAAVAKLLHDPMTQSLLGSAAAAEALFNVPAPGQLQRVPLDGL
FT                   EQANRDLGLALAQDEIDYLRERFAALGRDPADVELMMFAQANSEHCRHKIFNASWTIDG
FT                   KPQERSLFRMIKHTHQQTPQHTLSAYSDNAAVVEGVPAARYRPDPASGQYRREAVLPSA
FT                   FAIKVETHNHPTAIAPFPGAATGAGGEIRDEGATGRGGKPKAGLTGFSVSHLRIPTLPQ
FT                   PWEAPRALNPRMAPALDIMLDGPLGGAAFNNEFGRPNLLGYFRSFELAEGPGLTRAYDK
FT                   PIMLAGGLGAIDRNQVEKLRLQPGDAVIVLGGPAMLIGLGGGAASSVAAGDSAEALDFA
FT                   SVQRENPEMERRCQEVIDHCVALGVDNPIRWFHDVGAGGLSNAIPELLHDSGVGGIIDL
FT                   GRVLSDDPSLSPLELWCNESQERYVLGVPQARLEEFAAICARERCPFAAVGVATTEERL
FT                   VVGYGVFDSGIGDSGFGMRNGALSGAESAPASPRSPLPTPHSQLPIDLPMDVLFGKAPK
FT                   MHRDAVHPAAPQWPVLQTASLDLQQAGLRVLAHPTVASKSFLVTIGDRSVGGLTAREQM
FT                   IGPWQLPLADCAITMAGFDTFEGEAMSIGERTPLALLNAAASARMAVGEAITNLCAAPM
FT                   HRLDSIKLSANWMAAAGHAGEDALLYDAVRAVGMELCPALELSVPVGKDSLSMQAQWVE
FT                   AGIGDSAFGIGKTPESSAVANPRSPLPTPVAHKSVSPVSLIISAFAPVGDVRTQLTPLL
FT                   RSDEESELWLIGLGGGKQRLGGSVLAQVYANDAALPAFGGDVPDLDDAQRLRSFFELIR
FT                   DARDSGLLLAYHDRSDGGAFAALCEMAFASRQGLDITLDAWGDDAFRSLFNEELGAVVQ
FT                   IASEDRAAFADLVERHALTECAQRIARPTGTPRIRVSGQGRVLAEWRWEELFDAWWSVT
FT                   HAMQKLRDNPDSADEERALARDFKAPGLRPKLVFNPSDDVAAPFVATGARPTVAILREQ
FT                   GVNGQIEMAYNFERAGFRAYDVHMSDLIEGRVDLSEFVGFAACGGFSYGDVLGAGRGWA
FT                   TSILERSALRDAFAAFFARSDTFALGVCNGCQMLSQLKDIIPGAEHWPRFLRNRSEQFE
FT                   ARTALLEVVESPSIFLRGMAGSRIPVAVAHGEGRAEFDTAVDQAAARVALRYIDGNGAV
FT                   ASQYPLNPNGSPDGITGLTSSDGRVTILMPHPERTPRSANLSWYPADWGDDSPWMRMFR
FT                   NARVWCG"
FT   CDS_pept        830563..834360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0767"
FT                   /product="outer membrane protein XadA"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67522"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67522"
FT                   /protein_id="BAE67522.1"
FT                   /translation="MNQIYRKVWNKSLGVWAVASELSSGDSPGAVASASFIDRRHRLAL
FT                   TAAIALALGGAGFATPLPANAQSVEVGRGASAPASKATAIGANSHASATGAVATGADSS
FT                   ASGVNSSAIGRPTNAIGENALAIGHNSFVRQSGENGVAPGANAGVSGANSRTYEDDVVS
FT                   IGSGNGRGGPATRRITNVTAGVNATDAVNVAQLRHVADVAENTAQFFKASPGEESVGAY
FT                   VEGDSALAAGEGANAVGTATTALGTGANAVAENATAVGTNALASGQNSAAFGHNAQANG
FT                   PASVAVGGAAVNEDGEPLITNGGVPVTTGATSAGVGGTAVGASAKADGFAASSFGVGAY
FT                   AAGAQASAFGAVANAAGDYATAVGTQTRASGTSSTAVGGPVDLIPGLGLFVQTQASGEA
FT                   STALGAGAIASGTYATAVGTLSEASGTEATAVGYFAYAPGEGATAVGPQSLASGELSTA
FT                   LGYFSTARGANSVALGANSVATRANTVSVGAAGNERQITNVAAGTQGTDAVNLNQLNAV
FT                   AETAQTTGKYFKASGSAKKDVGAYVEGENALAAGEGAKAVGTGTTALGAGAHAVVRKAT
FT                   AVGVGAVADGIGAAALGNTARALGDNSSAVGSNAVASDIGATANGAGAQALSAYTIALG
FT                   SKAVASDLQAIAEGFNSTASNVGSTALGGFSQSSGRLSSALGYSAVASSVDSTAVGVAA
FT                   QATGVSAVAIGEISKATGEESVAVGGGAFSGWIPTQASGKGAAAFGAGAWATADYTTAI
FT                   GRDSYADGVNATAVGQSADALADNTLALGGGSRAKAVGASVIGVDASATGINSTGVGRQ
FT                   VNVIGENAVSVGYNSYVRQSAVNGVALGANAGATGADSVALGSGSSTYDADTVSVGSGN
FT                   GRGGPATRRIVNVGAGAVASASTDAINGGQLFESLSNAASFLGGGAAIGAQGVFVAPTY
FT                   LIQGASYNNVGAALTALDSKVTELDARSGGTPANTAARTASLRTATVPAMAATAVSAVS
FT                   SNVASTAIDATAGVQGTPTAAVVGSITPAAISTAVGTAAVANNVTGTAIGGSAYAHGAN
FT                   DTAIGSNARVNADGSTAVGANTQIAAVATNAVAMGDGAQVTAASGTAIGQGARATAQGA
FT                   VALGQGSVADRANTVSVGSVGGERQVANVAAGTLATDAVNKGQLDNGVAAANSYTDSRY
FT                   NAMADSFESYQGDIEDRLRRQNRRLDRQGAMSSAMLNMSASVAGIASPNRIGAGVGFQN
FT                   GESALSVGYQRAISPRATVTVGGALSSGDSSIGVGAGFGW"
FT   CDS_pept        834581..835333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0768"
FT                   /product="truncated serine protease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67523"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67523"
FT                   /protein_id="BAE67523.1"
FT                   /translation="MIDKNFRLNPLTGAILMMAFGASGALAAAPKLLVKEPTQAAPAGA
FT                   AFGSRLIVRYKDNTAAATDRSSKLSAVQAAVGRVGGSTSARSSAAVAKAIYVRKLGIGS
FT                   DLIKLSSTLTAAQVDKVVVELKNDPSVADVQIDRMLRPIDISKRVAAADVSPHLVPNEP
FT                   LYAQHQWHPSNPHGGINAPGAWDLSQGAGVVVAVLDTDILPGHPDFAGNILQGYDFITD
FT                   AEVSRRPTDARVPGALDYGDWQEADNVC"
FT   CDS_pept        835847..836815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0769"
FT                   /product="IS1112 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67524"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67524"
FT                   /protein_id="BAE67524.1"
FT                   /translation="MELPMSSSRLDLSERYRLHALYETGMSMRAIADVLARAPSTISRE
FT                   LRRNRHAAKYRPDHAQRISEHRRAQASRRPRINAERIRQIEVLLREDVSPEQIAGRTGL
FT                   ASHEWIYRHIYADQKRGGQLFMHLRKRRRKRRRRGVRDGRGQLTHRRSWTQRPSVVEQR
FT                   SRIGDWELETIRASHGKGVVVSMTERRSRLHLLAYSPDGTAENVRNAIVQRLGGLRHAV
FT                   HTLTADNGKEFADHRLIAACLQSDFYFADPYCPWQRGSNENANGLTRQYLPRQTDFSTI
FT                   TDAHLRWIEQRLYNRPRKILGFKTPLEVFSEEVLNSVANQS"
FT   CDS_pept        836991..837521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0770"
FT                   /product="truncated protease"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67525"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67525"
FT                   /protein_id="BAE67525.1"
FT                   /translation="MAGVVALVQSAAIGLGKGPLTPAAVEALLKKTSRRFPVTPPASTP
FT                   IGSGIVDAKAALKAVLEEPCDPATQSCAPSAIELTNKAPVAGLSGAAGSSTLYRFDAKA
FT                   GALLSFITYGGTGDVSMYVSFGAEPSTTSYDAKSTRPGNSETVRFTAPKAGTYYIKLVC
FT                   AASYAKLTLVARQ"
FT   CDS_pept        837639..839378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0771"
FT                   /product="general secretion pathway protein E"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67526"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67526"
FT                   /protein_id="BAE67526.1"
FT                   /translation="METSVNAVAVDPIEHRNAEMRIVDALLERRRLKDTDLLRARQLQT
FT                   ESGMGLLTLLGRLGLVSERDHAETCAEVLGLPLVDVRQLGDTPPEMLSEVQSLSLRFLK
FT                   QFHLCPVGERAGRLELWIADPYDDYAIDAVRLATGCTLLLQVGLRSEIDDLIERWYGQG
FT                   RSAMGTIVETADGDANSSDDIEALRDLASEAPVIRLVNLVIQHAVELRASDIHIEPFES
FT                   RLKVRYRVDGVLVEGESPPAKLTAAVISRIKIMAKLNIAERRLPQDGRIMLRVQGKELD
FT                   LRVSTVPTAHGESVVMRLLDRETVVFDFYKLGFTEAFLPQFRKVLEQPHGIMLVTGPTG
FT                   SGKTTTLYTALSQLNTSDVKIITVEDPVEYQIEGINQIQAKPQIGLDFANALRSIVRQD
FT                   PDIIMIGEMRDLETARIAIQSALTGHLVLSTLHTNNAAGGITRLLDMGVEDYLLTSTIN
FT                   GILAQRLVRKLDLANAERYAASPEEIERFNLRRLQPEGEIFLYRPRPSATAPTGYLGRT
FT                   TIVEFLVMNDELRRAVMRRAGMGEIEQLARQAGMRTMYEDGLSKALRGETTIEEVLRVT
FT                   EDA"
FT   CDS_pept        839554..840771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0772"
FT                   /product="general secretion pathway protein F"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67527"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67527"
FT                   /protein_id="BAE67527.1"
FT                   /translation="MPLYRYKALDAHGEMLDGQMEAASDAEVALRLQEQGHLPVETRLA
FT                   TGENDSPSLRMLLRKKPFDNAALVQFTQQLATLIGAGQPLDRALSILMDLPEDEKSRRV
FT                   IGDVRDTVRGGAPLSSALERQHGLFSKLYINMVRAGEAGGSMQDTLQRLADYLERSRAL
FT                   RDKVINALIYPAILLAVVGCALLFLLGYVVPQFAQMYESLDVALPWFTQAVLSVGLLVR
FT                   DWWLVLIVVPGVLGLWLDRKRRNAAFRASLDEWLLRQKVVGSLIARLETARLTRTLGTL
FT                   LRNGVPLLAAIGIARNVMSNLALVEDVANAADDVKNGHGLSMSLARGKRFPRLALQMIQ
FT                   VGEESGALDTMLLKTADTFELETAQAIDRALAALVPFITLVLASVVGLVIISVLVPLYD
FT                   LTNAIG"
FT   CDS_pept        841039..841470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0773"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67528"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67528"
FT                   /protein_id="BAE67528.1"
FT                   /translation="MIKRSITRSPSRAGQAGMSLLEIIIVIVLIGAVLTLVGSRVLGGA
FT                   DRGKANLAKSQIQTLAGKIENFQLDTGKLPSKLDDLVTQPGDSSGWLGPYAKPAELNDP
FT                   WGHAIEYRVPGDGQPFDLMSLGKDGKPGGSSYDADIKYQ"
FT   CDS_pept        841480..841989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0774"
FT                   /product="general secretion pathway protein H"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67529"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67529"
FT                   /protein_id="BAE67529.1"
FT                   /translation="MRVACQPLFHPHGGGGPGRARTRGTSLLEMLLVIALIAMAGVLAA
FT                   AALNGGIDGMRLRTAGKAIASQLRYTRTQAIATGTPQRFLIDPQQRRWEAPGGHHGDLP
FT                   PSLEIRFTGARQVQSRQDQGAIQFFPDGASTGGRIDLQVKDARWRVDVGWITGEVRSGP
FT                   LRTPSP"
FT   CDS_pept        841986..842402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0775"
FT                   /product="general secretion pathway protein I"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67530"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67530"
FT                   /protein_id="BAE67530.1"
FT                   /translation="MKCQRGYTLIEVIVAFALLALALSLLLGSLSGAARQVRAADESTR
FT                   ATLHAQSLLAVQGIEKPLEPAQQQGTFENGHFRWSMDVRPYDEPRRNLQAPLSPGAHRL
FT                   LQLTLVVRWGEQPNQMLQWRTLRLVAASAQGNPS"
FT   CDS_pept        842399..843034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0776"
FT                   /product="general secretion pathway protein J"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67531"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67531"
FT                   /protein_id="BAE67531.1"
FT                   /translation="MSRSRSAGFTLIEVLLATMLLVGGLALAFATLRSASAVSQRGEAI
FT                   AQRSERVRAVEEFLRQRLAAALPIAMVIDTQSQQPILFIGEPQRLRFAADVPDYLGRGG
FT                   PYLHDLSVAGDGDQRNLLIALTMLQSGKTIEESSPLPPEKLAEGVQQVNFRYRGMDPQT
FT                   SRLSAWLPQWEWHDRLPLMVRIEIRSDDAAWPPMVVALPQSSNPGAGQ"
FT   CDS_pept        843031..843882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0777"
FT                   /product="general secretion pathway protein K"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67532"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67532"
FT                   /protein_id="BAE67532.1"
FT                   /translation="MSRARGAALVLVLWLIALLTAMIGAFALTARVEALQGSMLRNGAQ
FT                   AQEYARAGLEYALFRLQDADTQARWRPDGRRYRWQMDDASVEIRITDESGKVDLNMAEP
FT                   GLLAGLVRAVGGDQSSATRIAGAIVDWRDTDSLSQPGGGAEDRDYADAGLPYGAKDSPF
FT                   ETLGELRLVLGIDGELYRKLLPNVTLYSGRSRPEARFAPAPVLTAMGLDAQQLLAQRDA
FT                   PLGLPGSDATIGGSGTYSIESRARLSQGREAVLRALVSTGASALPGSAYTVLRWEEGAA
FT                   VQ"
FT   CDS_pept        843879..845000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0778"
FT                   /product="general secretion pathway protein L"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67533"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67533"
FT                   /protein_id="BAE67533.1"
FT                   /translation="MTAWRDTLGRIGVRAMPGAGGFWRWWQQSLLAWLPQRWQWQLGLS
FT                   QARLLLQQDGDALQLLRQRDHSCDSVASLPWPVHPQEVNSLLPTALESLPRHWLLPAAH
FT                   ALRRPLRLPAAAAARLQDVARFEIDRQTPFTADQVYFDARVLDVREDGQFDAELVVVPR
FT                   RMIDGPAGVPDAWNSALSGIDVTDAKGLPLGVNLLPPARRLRRSDPMQRWNLLLAASAL
FT                   VLLAVAGWLLLDNRRQAADDLRAKVQANAARARQVAAERQQLMDLVEGARFFQQQRATR
FT                   PTSVEIWDELSRRLPGGTYLEKFSVEGGQLQLIGLSNEASSLVRRLEGSPLWRTPSLTG
FT                   VLQSDAGRNVDRFTITAELAGPDAKEAADATQR"
FT   CDS_pept        844984..845637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0779"
FT                   /product="general secretion pathway protein M"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67534"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67534"
FT                   /protein_id="BAE67534.1"
FT                   /translation="MPRSVKRDRWIALGLLLLVLGVAYLVLVHPWFTQPMIAVQDDLQA
FT                   LRERELRVRVQLQQATEVSKRLRQARQTLESRPGFLPETSAELASAGLVQRLERAVVEA
FT                   SPGNRSCAISNRSPLQPESKNRFTRVAVQVRLRCGTPELASVLYSLENGTPRLFVDNLN
FT                   VMAQRYQLSPNESGNGLDIAFELAGYLRPGASAAPLNNETAPAAPNAAEASNAP"
FT   CDS_pept        845627..846436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0780"
FT                   /product="general secretion pathway protein N"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67535"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67535"
FT                   /protein_id="BAE67535.1"
FT                   /translation="MRLDMIGLRTWLLATVVGWAMLVCALAVAGLGKRVELLPDDPALV
FT                   QRLPTLPAPAPERLGAFEKYSEIAAHPAFAEDRLPHPFFLSGNDGSGAASTVRLTGVLL
FT                   TDTFKMATLSLDPQDSVRVQLGGDAVKGWRLLALQPRSATIEGPSGTQTLELHVFNGQG
FT                   GQPPTANAAARGAGTATAPVPSPDAAAVAVPPPQQQQPQPQPQSVPPVQQPGWQALPTV
FT                   QPQRSDGAQEAPRPSDDQMRAIRERIEARRRQLQQQRQSGSPPGQTQ"
FT   CDS_pept        846433..848745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0781"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67536"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67536"
FT                   /protein_id="BAE67536.1"
FT                   /translation="MSERMTPRLFPVSLLIGLLAGCATTPPPDVRRDARLDPNVGAAGA
FT                   TQTTAEQSADGKASAKPSPVIRRGSGTMINQSAASAPAPTLGMASSGSATFNFEGESVQ
FT                   AVVKAILGDMLGQNYVIAPGVQGTVTLATPNPVSPAQALNLLEMVLGWNNARMVFSGGR
FT                   YNIVPADQALAGTVAPSTASPSAARGFEVRVVPLKYISASEMKKVLEPYARPNAIVGTD
FT                   PARNVITLGGTRAELENYLRTVQIFDVDWLSGMSVGVFPIQSGKAEKVSADLEKVFGEQ
FT                   SKTPSAGMFRFMPLENANALLVITPQPRYLDQIQQWLDRIDSAGGGVRLFSYELKYIKA
FT                   KDLADRLSEVFGGHSSGGDSNASLVPGSETSVLGGALGNRDSSMGGSSGMTGGSIGDSG
FT                   DGSSSGSSFGSSGGGSSSGGLGNGSLQLSPRSNGNGAVTLDVAGDKVGVSAVAETNTLL
FT                   VRSTPQAWSSIRDVIEKLDVMPMQVHIEAQVAEVNLTGKLQYGVNWYFENSVNAAADSA
FT                   ANSTGIGAGAGLASAAGRNIWGDIAGKITGEKGAQWTFLGKNAASIIHALDEVTNVRLL
FT                   QTPSVFVRNNAEATLNVGSRIAINSTSINTGLGSDSSFSSVQYIDTGVILKVRPRVTKD
FT                   GMVFLDIVQEVSSPGDRPAACTSATATVNAAACNVDINTRRVKTEAAVQSGDTIMLAGL
FT                   IDDTTSDGSNGIPFLSKLPVVGALFGSKSRNSARREVIVLITPSIVRNPQEARNLTDEY
FT                   GQKFKAMEPLKPSQKPQ"
FT   CDS_pept        848742..849581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0782"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67537"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67537"
FT                   /protein_id="BAE67537.1"
FT                   /translation="MSAALPVVLVPVGTDEEALDACLGALDAATPAGTRVWLADDAQAG
FT                   PRGRAVIEHWLVRTQLQAHHTRRQRMLGEVAHLDEMLIACGDADVVVLGVDARPLPGWL
FT                   QQLTACFARDAAIATATPWSNVGEACSWPRLGELNPMPDATERLAAACAAMPPLHPELP
FT                   SAIGHAVLLRGAARRKAGGLDASSYGSWYAALVDLSLRMGGLGWRNVLCGTAFVASPHE
FT                   GRPADGDMDALATRWPAWHARLANFLMHDPLRAQRDQLTHLLADLPPPDPQRALFDA"
FT   CDS_pept        complement(850005..850733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0783"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67538"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67538"
FT                   /protein_id="BAE67538.1"
FT                   /translation="MSVSRQHTITEAISAQIAAGEWGQDQRLPVERALAERFGCTRITL
FT                   REALQQLEAEGRIYRENRRGWFVSASRVRYDPTSIAGFMQYVAAQGRKPRTELLSATRQ
FT                   VAGAAYAAALRLDSPYDEVFVLQRRRWIDRRAVLLETNVVLAAWAPGLLEHDLAGSLST
FT                   VFNQQLGLFLSRAQLSMHPAGLDAAQAMLLQSAPGTPCFRLQRISFAEDGRAVELDIES
FT                   WRHDAVDVVVRTEAPTRSAL"
FT   CDS_pept        complement(850839..851414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0784"
FT                   /product="PnuC protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67539"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67539"
FT                   /protein_id="BAE67539.1"
FT                   /translation="MSLLESIAVAINLLGVWLTARRIRWCWPVGIVAVALYAWLFYQWK
FT                   LYSDMLLQGVYVLTQLYGWWHWQRGSPADTRIRPLPMPVMECWLSLCIGAAFAASLGAY
FT                   MHYRTDAALPWLDAALASFSLVASLWAARKRIANWVLWIVLDCVYVGVFISKGLHPTAA
FT                   LYAGFVALAVYGWRSWKTQQNPNLASAR"
FT   CDS_pept        complement(851790..853952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0785"
FT                   /product="putative siderophore receptor"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67540"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67540"
FT                   /protein_id="BAE67540.1"
FT                   /translation="MSATFPLLSRCPLALVLALCCTPALAQQQPDANAVELDAVNVRGE
FT                   RVETSTALSGFGATRLLDAPASIALIDRQQLLDRQARVLSEVLRADASAGDAYAPIGYY
FT                   ENFVVRGYSLNAANSYRINGMSAVGEQSIALENKQQVQLLKGLAGLQSGVNEPAGLIDY
FT                   RTKRPEHVRSVTLGTDEQGSRYLAADLGDWFGAERTLGVRINAAREDIDSDVDHADGYR
FT                   NFLSLAGDWKITPQALLQLDVEYQHRQQRSVPGYQLLGGTQVPRDIDVHRLLGYQPWAR
FT                   PVEMDSLNAQFRYAYQFNDDWRATADASRSRSTINDFSAFAWGCYGAASCADFATPNFF
FT                   SAQGEYDVYDYRSPDDTRVHNQLRATLEGRVATGALEHRLSVGGEWLRRTIDRFGSVNA
FT                   FVGSGSIDRDPEVFAQTDVPLAPKQRRLDSRQRALVLADRIGLGAQWELSLGGRYVQLD
FT                   ERSFDRDGLLERRMRKDTVLPQAALLFKPQQNVSLYASYAKSLAAGGTAPWFADNADEI
FT                   LPPTNAYQLETGAKIDLQSLRLGAALFDIRQAYQFTQPQADGGLLYVQQGRLHNRGLEL
FT                   SADGAATRQLRLFASIAAIRARAEDTDIAEYEGHQAINVPKLRASVQADYSVPGVDGLA
FT                   LLAGVQYSGRKFADRLGNASVPAYAVANLGARYATALGGLATTWRLNVDNVFDKRYWRD
FT                   SGEYQGDAYLFPGAPRTARLTVQVDF"
FT   CDS_pept        complement(853988..855145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0786"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67541"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67541"
FT                   /protein_id="BAE67541.1"
FT                   /translation="MNVPHQVHGMSLELALPDWPVLTTDEIHRVLHGCAAAGRLIAVRW
FT                   QSARPFSAAACVDAESGPVIVKRHHRSVRSVAALREEHNFIAHLRWAGAPVAEVLHDAQ
FT                   GCTALTYDEWVYEVQRVGAGRDLYRDALSWTPFTDVAHARAAGAALAQLHSAAQGFDAP
FT                   VRSTSVLVANLRLFAQADPLQALHDALPTRPHLAAALQYRPWQHDLATHLLPWHARAWP
FT                   LLSAPGALPPLWTHGDWHASNLLWDTDDGHTRVSAIFDFGLSDCSSALFDLATAIERNL
FT                   IPWLRLDTGARAQAELAQLDALLDGYAQHRPLDANQLRRLAALLPIVHADFALSEIEYF
FT                   AGITRSPTNADIAYHRYLLGHADWFTSADGQHLLEHLHARARRLP"
FT   CDS_pept        855366..855698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0787"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67542"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67542"
FT                   /protein_id="BAE67542.1"
FT                   /translation="MWECTKSDWQNNWRSDGCGRCALKRMYARYMHRVPPAPAWWLRSR
FT                   FAGRSKCRKRRPHGGSRRAVCALPAWVAMLPSAYGASDCLQAGAWRNVQPAREYQRNAA
FT                   ATTPDA"
FT   CDS_pept        855756..856595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0788"
FT                   /product="putative glycosyl transferase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67543"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67543"
FT                   /protein_id="BAE67543.1"
FT                   /translation="MTAVQIAAVVVTYQSSSTIDACLSRLRAAEGISEIRVVDNASSDD
FT                   TLEVVQRHALADARLHFIANPDNPGFATACNQGARDSQAPWLVFINPDLMVARDTLLQL
FT                   CDRAAGHPAVLLGVEQVDEQGRPDMAVRRRDPDFAAMLRAPRAAANLTVPADPSRALQP
FT                   VDAISGALMLMQRSLFDRLDGWDGSYRLHAEDLDLCRRARQAGALVAVANDLQVVHVRG
FT                   VSSRARPFFVEWHKHRGLWRYFRKFEARHRGLMTQLGVWLAIWTHAAAQVPRLLQKK"
FT   CDS_pept        856637..857425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0789"
FT                   /product="ISXoo2 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /note="truncated"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67544"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67544"
FT                   /protein_id="BAE67544.1"
FT                   /translation="MPVSAVQPSMKKRDGRLVSRAVLEEMRLMALQRMGEGESPAEVAS
FT                   SFGLHRGWAYKVLARAQEGGAGALMTRKGSGRPRTLTPAQERQVFGWVNGKNPRQHGFA
FT                   FGLWTRQVVRELIEKKCAARLSLASVGTLLARLGLSPQKPLQHAYQRDPLAVAQWEKQT
FT                   YPAIVTHAKREKAEIDFWDASGFRADAVQGRTWAVKGVTPVVAVPGQRQSISAASAVNS
FT                   KGGFWFAVYSGGLNGELFVALLKRMMKGRRRPIHLVLDGS"
FT   CDS_pept        858446..858754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0790"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67545"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67545"
FT                   /protein_id="BAE67545.1"
FT                   /translation="MRTRLPAWWSLTCWTTCFNPRAREDATGAGVHLQIPQGVSIHAPV
FT                   RTRPDTALTVVRTLGFNPRAREDATVTMLCRLGLRPSFNPRAREDATLRRVGYCSSI"
FT   CDS_pept        complement(860202..860567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0791"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67546"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67546"
FT                   /protein_id="BAE67546.1"
FT                   /translation="MQDGRVLTGAWIETGCSPACMLYGARRVLTGAWIETPWRHSWMGI
FT                   QPGRVLTGAWIETRWYNHELDRQLVASSRARGLKLVLPARPACATDVASSRARGLKLEC
FT                   CGQGKRRWWSRPHGRVD"
FT   CDS_pept        complement(861337..861627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0792"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67547"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67547"
FT                   /protein_id="BAE67547.1"
FT                   /translation="MMVLISYDVSTSSPGGEKRLRKVAKACRDLGQRVQYSVFEVEVEP
FT                   AQWAELRQRLCDLIDPSVDSLRFYHLGAKWEARVEHVGAKPSLDFKGPLIF"
FT   CDS_pept        complement(861642..862676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0793"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67548"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67548"
FT                   /protein_id="BAE67548.1"
FT                   /translation="MRRQLNTLYATTDGAWLRKDGANIVMEVERQERARLPVHMLESLV
FT                   CIGRVAVSPQLLGFCSEHGISICYLTPQGRFLARVEGPVSGNVLLRRAQYRRSDDPAGC
FT                   AAIVRHLLAGKIHNQRAVLARGWRDHGDCLTDVAAFQHSLKRLKRIPQRVLVETDVDVL
FT                   RGLEGEAAQSYFGVFGQLVRADKPLLRFGGRNRRPPRDAFNALLSFLYTLLTHDCRSAL
FT                   ESVGLDPAVGFLHRDRPGRPSLALDLAEEFRPLLGERLALSLINRRQLNERDFQVFDNG
FT                   AVLLKDDSRKTVLIAYQERKREQLQHAFLGEKVDIGLLPFVQAQLLARHLRGDLDGYPA
FT                   FFWK"
FT   CDS_pept        complement(862679..863311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0794"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67549"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67549"
FT                   /protein_id="BAE67549.1"
FT                   /translation="MDDADLIPLSALQHYLYCPRQCALIHVEQQWAENRQTAEGRLLHQ
FT                   RADAPQAERRRGVRTVTAMPLLALELGITGKADVVEFHRDGDGEVAFPVEYKRGHPKVH
FT                   RADEVQLCAQALCLEHMLGRAVPTGALFYGQTRRRKDVAFDAALRALTLDTIADTRAML
FT                   HDSDTPAARYDAKRCDACSLIDVCQPRLLDRGSVDQWVRRQLNADED"
FT   CDS_pept        complement(863331..864197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0795"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67550"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67550"
FT                   /protein_id="BAE67550.1"
FT                   /translation="MSAIANRYEFVYLFDVINGNPNGDPDAGNLPRLDPETNRGLVTDV
FT                   ALKRKIRNYVALEQEAQAGYAIYMQEKSVLNNQHKQAYAALGIEHEAKKLPKDEAKARE
FT                   LTSWMCKNFFDVRTFGAVMTTEVNSGQVRGPVQLAFASSVEPVLPLEVSITRVAVTNEK
FT                   DLEKERTMGRKHILPYGLYRAHGFISAKLAERTGFSEDDLQLLWRALTNLFEHDRSAAR
FT                   GEMSARKLIVFKHEHQMGNAPAHVLFDKVTVERVAEVDAGPARSFADYRVTIDRALPAG
FT                   VSVEELF"
FT   CDS_pept        complement(864194..866038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0796"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67551"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67551"
FT                   /protein_id="BAE67551.1"
FT                   /translation="MILSALADYYQRLLDDPESGISAPGYSREKIGYTVVLATNGNVIS
FT                   VDDEHRADGKKRLPKSVSVPASFKRPGTGAKSFFLWDKTSYVLGISASSKRSEQEHAAF
FT                   KALHYQALSDTDDPGLHALLAFIERWTPDGYVDHPAFAPHSEALLDANLVFRLEGDSCY
FT                   LHERPAARAAWDGQQGRGADGVSGLCLVSGTMAPLARLHPAIKGVNGAQSAGASIVSFN
FT                   LDAFTSYGKQQGENAPVSEQAAFAYTTALNHLLRRDPHNRQRVQIGDTTVVFWAQASTP
FT                   MRSQNAEDIFADFMRGSDADDPAIADGQATRRLELVMKQVRQARPLRDLDDSLDDDARI
FT                   FVLGLAPNASRLSIRFWETQSLAGFAKRLADHYDDLALEPPAWKRPPTPAYLALQTAPV
FT                   YGEHGKPKAEDVSPLLAGELTRAILTGIRYPQSLLGSIVMRFRADGQLTPLRIALCRAV
FT                   LARDARLCRQQGLSTDPKEPPMSLDTGNTDPGYLLGRLFASLENLQRAALGDRINATIR
FT                   DRYYGAASATPASIFPVLLRSAQNHFGKLRKEKAGLAVNLEKEIGQIIDALPPSFPRSL
FT                   PIQEQGRFAIGYYHQTQARFARNDGPDAPDTASEGETA"
FT   CDS_pept        complement(866035..866709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0797"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67552"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67552"
FT                   /protein_id="BAE67552.1"
FT                   /translation="MSYGVRLHVWGERALFTRPEMKVERVSYDIITPSAARGILEAIHW
FT                   KPAIRWVVDSIQVLKPICFESIRRNEVGSKLSAASISKAIKAGRTDELVKYVEEDRQQR
FT                   AATVLREVGYIIAAHFEMTDKAGPDDNVGKHLDIFNRRARRGQCFQAPCLGTREFPASF
FT                   ALLGDDDTPPASDPALSGERDLGWMLHDIDFADGMTPRFFRARMVDGLVAVPPPQDGGV
FT                   RA"
FT   CDS_pept        complement(866837..869128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0798"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67553"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67553"
FT                   /protein_id="BAE67553.1"
FT                   /translation="MAFYAHSTQRRDHSDWQGLAEHLNGVGERASVHAEAFGGQVMARV
FT                   AGQLHDLGKYTEKFQARLAGDPTRVDHATWGARKACELYRSGGTLLAYGIAGHHAGLAD
FT                   GRRDDLTSRPSLHERLSDEYCAHALPPLLPDWEREVMLPAKLELPTGFRGHPRTERRAF
FT                   QMTVLARMLFSCLVDADFVDTDDFYRRVEGRKTRAEQAGTRLTLEELRERLDSHLAGLS
FT                   SEHGINPIRATILHQARSKAHARIGLFSLTVPTGGGKTLASLAFALDHAIAHGLRRVIY
FT                   VIPFTSIVDQTAQVFRKALGVQDRDDVVLEHHSAFFDDPAKALQAIDKRKLAMENWDAP
FT                   IVVTTSVQFFESLFADRPSRCRKLHNIAGSVVILDEAQTLPQTLLRPCVALLDELARNY
FT                   RVSPVLCTATQPALRQDQGFPGGLEQVEELVAEPKVLYAQLRRVRVRHVGALEDDALAE
FT                   ELRQRTQVLCIVNNRRHARALFDAIAEQPGAHHLTTLMHARHRSAALTRVREELKAGRP
FT                   CRLVATSLIEAGVDVDFPTVLRAEAGLDSVAQAAGRCNREGRRPTDASEVLVFSPVNWQ
FT                   PPQELKVFTEVFREIERTHSGDLLAMEAIHAYFQRLYRRLGDNLLDDEAILTQLRTADL
FT                   GDLPFDTLAQKFRMIQTTMRPLIVPYAPYVTDRNAAEREVAEVNEVLRQLEHADRIGVA
FT                   GAARRLQPWLVQVPEQAYRALWQASAIAPIAPERYGEQFVCLRNSRLYDARFGLHWEDP
FT                   QFLDAQALCP"
FT   CDS_pept        869207..870205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0799"
FT                   /product="ISXo5 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67554"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67554"
FT                   /protein_id="BAE67554.1"
FT                   /translation="MLGPSLHRDQIMAMNRVQLQAGLSLPAFLKRYGNAQQCEQALEIS
FT                   RWPQGFVCPRCAATAHSRFQRHGTTYWQCTACYRQTSLRSGTVMDNSKLPLRTWLLGMY
FT                   LLGQSKTNLSALELMRHLRVSYPTAWPMKHKLMQAMTQREANRKLGGIVQLDDAYLGGE
FT                   RNGGKAGRGSENKRPFVIAVETTEDGRPLRAVMDPVPGFTKAALSEWIGQRLHPGADVY
FT                   SDGLGAFRTLEAEHAHTVIEGSGRSRCEAENARWVNVVLSNLKRSLDGAYHAFKFAKYA
FT                   QRYLAETMWRFNRRFDLTRLVPSLLAAAAASKPWSERALRDVTMFTAESAC"
FT   CDS_pept        complement(870596..871168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0800"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67555"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67555"
FT                   /db_xref="GOA:Q2P7C2"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7C2"
FT                   /protein_id="BAE67555.1"
FT                   /translation="MPRLILASTSAYRRQLLSRLQLEFDTGRPEVDEQPQSGEAPSALA
FT                   SRLAAEKAAAVAVRLPGAWVIGSDQVADLDGQALGKPGTRAQAQAQLTAMSGRTVRFHT
FT                   AVSLIGPERELHALDLTEVQLRALTPAEIERYLDAEPALDCAGSFKCEGLGISLFDAIR
FT                   SQDPTALVGLPLIALARLLREAGFHLP"
FT   CDS_pept        871284..871793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0801"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67556"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67556"
FT                   /protein_id="BAE67556.1"
FT                   /translation="MSANVPEMLDAWRMVAARRRFDGRIPLSAMTRLQGSLVDTEGECV
FT                   YSLQFDEDTLLKVAYVELSIDVELPLACQRSLQRFLYPVHVRQRLGLIRDEADEAALPA
FT                   DYEALLVPEDGMLRVVDMVEDELVLSVPVVPMAPGSEAIDAEWVPTQEEQDKASPFAAL
FT                   AALKKQ"
FT   CDS_pept        871892..872086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0802"
FT                   /product="50S ribosomal protein L32"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67557"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67557"
FT                   /db_xref="GOA:Q2P7C0"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7C0"
FT                   /protein_id="BAE67557.1"
FT                   /translation="MAVQKSRVTPSRRGQRRSHDALTAKQLSTDPTSGEIHLRHHITAD
FT                   GYYRGKKVITTKSSAVQED"
FT   CDS_pept        872176..873153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0803"
FT                   /product="beta-ketoacyl-[ACP] synthase III"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67558"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67558"
FT                   /db_xref="GOA:Q2P7B9"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7B9"
FT                   /protein_id="BAE67558.1"
FT                   /translation="MSKRIYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRE
FT                   RHIAADDQATSDLAYFASLKAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGN
FT                   VGCGAMDVNAACSGFVYALSVADKFVRSGDAKTVLVVGAETLTRILDWTDRTTCVLFGD
FT                   GAGAVILKADEETGILSTHLRADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFK
FT                   YAVKALNSVVDETLAANGYDAHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRHG
FT                   NTSSASVPLALDEAVRSGRVQRGQLLLLEAFGGGFAWGSALLRY"
FT   CDS_pept        873383..873823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0804"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67559"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67559"
FT                   /protein_id="BAE67559.1"
FT                   /translation="MHPAHDPIFVALLVGSYERFAGRPLVADRQIEPDWLYHEAPFALL
FT                   AHDTAADPRFVYANQAAQCVFGYDWSEFVGMPSRLSAELPERAERQRLLDAVTRDGVVK
FT                   DYAGVRIAKDGSRFRIAEGVVWQLVDAAGVLRGQAAAFPLPG"
FT   CDS_pept        874101..875045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0805"
FT                   /product="malonyl CoA-ACP transacylase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67560"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67560"
FT                   /protein_id="BAE67560.1"
FT                   /translation="MTESTLAFVFPGQGSQSLGMLAELSELHPQIRETFAEASEGAGVD
FT                   LWALSQGGPEEMLNRTEYTQPALLAAGVAVWRLWTAQRGQRPALLAGHSLGEYTALVAA
FT                   GVLSLHDGAHLVRLRGQFMQAAAPAGVGAMAAVLGAEDAVVLEVCAEAAGSQVVVPANF
FT                   NSPGQIVIGGDAAAVDRALALLAERGVRKAVKLAVSVPSHTPLMRDAANQLGEAMAGLS
FT                   WHAPQIPVVQNVDARVHDGSAAIRQALVEQLYLPVQWTGCVQALASQGITRIAECGPGK
FT                   VLSGLIKRIDKSLDARPLATPADYAGALDAWAH"
FT   CDS_pept        875128..875871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0806"
FT                   /product="3-oxoacyl-[ACP] reductase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67561"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67561"
FT                   /protein_id="BAE67561.1"
FT                   /translation="MSKPLQGEIALVTGASRGIGAAIADTLAAQGATVIGTATSASGAV
FT                   AIGERLAAHGGHGRELNVTDAAAVDGLIDAIGKEFGAMSILVNNAGITRDNLLMRMKDD
FT                   DWQAIIDTNLTSVFRTSKAVMRGMMKARKGRIINIASVVGVTGNPGQTNYAAAKAGIIA
FT                   FSKSLAKEIGSRGVTVNVVAPGFIDTDMTKALPDEAKTALLQQIALGHLGAPEDIAHAV
FT                   AFLAGPTARYITGETLHVNGGMYMP"
FT   CDS_pept        876076..876315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0807"
FT                   /product="acyl carrier protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67562"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67562"
FT                   /db_xref="GOA:Q2P7B5"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2P7B5"
FT                   /protein_id="BAE67562.1"
FT                   /translation="MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVM
FT                   ALEEEFECEIPDEEAEKITSVQQAIDYVKSHVKS"
FT   CDS_pept        876457..877692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0808"
FT                   /product="3-oxoacyl-[ACP] synthase II"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67563"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67563"
FT                   /protein_id="BAE67563.1"
FT                   /translation="MSRRVVVTGMGIVSPLGNDLATSWDGIVHGRSGIGPITQIDASQF
FT                   TTKIAGEIKNFDPTLFVSAKDVKKMDSFIHYGLGASFMALDDSGLEIDDSNAERVGAIL
FT                   GSGIGGLLGIEEQTIKFHEGGARKISPFYVPSTIINMLPGQVSLIKGLKGPTFSAVSAC
FT                   ATSNHSIGTAMRMIQHGDADVMLAGGAERGSSPGSVGGFCAMKAMSTRNDDPTGASRPW
FT                   DKQRDGFVLGDGAGVLVLEEYEHAKARGARIYAELVGFGASSDAFHMTAPSEDGEGAAR
FT                   SMAAAMRDAKLNPEQIGYLNAHGTSTPLGDLAETIAMKRALGDHAYKTMVSSTKSMTGH
FT                   LLGAAGGVEAIFSVMALHTGIIPPTINLEEPSEGCDLDYVPNVAREVQVDAVMSNGFGF
FT                   GGTNGTLVFKRV"
FT   CDS_pept        877863..879218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0809"
FT                   /product="anthranilate synthase component I"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67564"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67564"
FT                   /protein_id="BAE67564.1"
FT                   /translation="MTLTRSLHADIDLLALHRLSPQRYPALLESTASGTAHGRWDVLLL
FT                   AEGACLRLDPDGCTRNGEGQLLEASFLGALDAAWQAERVPHDAASPWPFRGGWAVLLDY
FT                   ELAAQVEPILQLPKRTDGLPTALALRAPAAVLRDRVQGRCVALAEPGRADLLQQIVDDV
FT                   AACSALPPLPDWMGPRAVEEDAPERFTAAVERVLDYLRAGDVFQANISRAWHAAFVDAV
FT                   DPAALHARLRAANPAPFAGLFVAAGRAVASSSPERLVSVQGEAVQTRPIAGTRARFVGD
FT                   DDAARIRELVGHPKERAEHVMLIDLERNDLGRICAPGTVEVDELMCVESYAHVHHIVSN
FT                   VRGRLRAGVTPGEVIAAVFPGGTITGCPKVRCMQIIAELEQTARGAYTGAFGWLNRDGD
FT                   MDLNILIRTAEVAGNQVRFRTGAGIVVDSDPQRELDETRAKARGVLRAIEQT"
FT   CDS_pept        879279..880352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0810"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67565"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67565"
FT                   /protein_id="BAE67565.1"
FT                   /translation="MGVAVTGKRGCLAVLGTGLLLAALLAIAAVVAWRHYLHFADTPVP
FT                   ASAPSVVIAPGDALKATLRKLRAAGLAQGTELEWQLLARQVDAAGKLKVGEYALAPALS
FT                   PRELLTRMRQGRVIQYRFTLVEGWNFRQLRAALATATPLQHSTSVLDDAALMARLGFAK
FT                   QHPEGRFLPETYVYQRGDSDLDVLKRAHAAMDKALAQAWEQRTPNLPLASPEQALILAS
FT                   IIEKETALATERPLIAGVFLRRLQMGMKLQTDPTVIYGIGSSYDGNIRRRDLTTDTPYN
FT                   TYTRTGLTPTPIAMPGREALLAAVRPAPGEALYFVAVGDGTGAHAFSATLAEHNAAVAR
FT                   YLQRRRLQSTPQTEPTP"
FT   CDS_pept        880349..881308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0811"
FT                   /product="DNA polymerase III delta' subunit"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67566"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67566"
FT                   /protein_id="BAE67566.1"
FT                   /translation="MTAAFAPWQQRAFDQTVAALDAGRLGHGLLICGPEGLGKRAVALA
FT                   LAEHVLASSPDPALAQRTRQLIAAGTHPDLQLISFVPNRTGDKLRTEIVIEQVREISQK
FT                   LALTPHDGIAQVVIVDPADAINRSACNALLKTLEEPSPGRYLWLISAQPARLPATIRSR
FT                   CQRLEFKLPPAHEALAWLLSQGVSERAAQEGLDAARGHPGLAAQWLREDGLAVRRAVAQ
FT                   DLEQIASGRAGAVDVAQRWTNDGQADQRLRHAADLVLAQASAGLTDPSRLHKLVTWFDA
FT                   ANRTRDLLRTTVRADLAVTELLLSWREGERQPRSRGTR"
FT   CDS_pept        881305..881658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0812"
FT                   /product="type IV fimbriae assembly protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67567"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67567"
FT                   /protein_id="BAE67567.1"
FT                   /translation="MSAMNARQGILSLALKDKPALYSAYMPFVKGGGIFVPTPKRYMLG
FT                   DEVFVLLTLPDSSERLPVAGKVIWTTPAGAQGNRPAGIGVQFPDGPEGEAVRNKIETLL
FT                   AGLTTSDKPTHTM"
FT   tRNA            881935..882009
FT                   /gene="XOOr14"
FT                   /product="tRNA-Val"
FT                   /note="Found by tRNAscan-SE"
FT   CDS_pept        882182..882655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0813"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67568"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67568"
FT                   /protein_id="BAE67568.1"
FT                   /translation="MREARDAGVPFELIIDGDYIATEPFPGLGVNWTFKVYPEQLRERA
FT                   QDVVRYTARQAIVEISDAMWKYALASDLKRSYESEPAVVLLRALRNAYAHRRDDWAFGN
FT                   AKLPLRWRQLDLVPGMQGLTVSETIFLNEQLLLINDAIYLIDPDSALTTQVHR"
FT   CDS_pept        883227..883511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0814"
FT                   /product="ISXoo11 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67569"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67569"
FT                   /protein_id="BAE67569.1"
FT                   /translation="MERPVHLLMDRAYEGNETRQLALDLGFVPVVPPKSNRVDPWEYDK
FT                   EMYKRRNEVERLFRRLKGYRRIFTRFEQLDVMFLGFLSFVLVVDGLRMC"
FT   CDS_pept        883676..884002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0815"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67570"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67570"
FT                   /protein_id="BAE67570.1"
FT                   /translation="MNTLLRSVLVAALLMAGCARDVGEQFVGKWVDVTSEKNVLSIEHN
FT                   GESFIIRDTRPELFGNGVKTRNHPALLTNGVLQVSNGVGTVNYAIDEATGKLSTGDTEY
FT                   TRVK"
FT   CDS_pept        complement(884238..885983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0817"
FT                   /product="propionate catabolism regulatory protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67571"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67571"
FT                   /protein_id="BAE67571.1"
FT                   /translation="MAVPWVEYRCRRKHRANHTPLILLDLAAPDVASAQRLIHYETSLK
FT                   RGNSMRSPATPETAGAALPVIWTVSVSRLTGLLADVIPEFDQRARIEQINLGFAEAVEV
FT                   IGLRLRRERCDALVAGGSNAAYLRSRLALPFAHIQATGFDLMEALARARRIAPRIGVVT
FT                   HASDVPSFRAFQHSFDLDIEHRRFVTAEDARDCIADLRASGIQVIVGTGMAIDFAEQAG
FT                   LPGVLLYSADSVRQALEQAIALGAAPSTDDLAGRSATRRARRADALLGEDSAMLQVREL
FT                   VQLYAPHAGTVLISGETGTGKELVARQLHAGSRRRGRFVAINCGAISESLLEAELFGYS
FT                   DGAFTGARRGGHTGLIEAAQDGTLFLDEIGELPMALQTRLLRVLEEHEVLRVGATVPVA
FT                   VDVRVVAASLQELQQLVEQGRFRRDLFYRLAALRIALPPLRSRHDEIALLLAHYFQQLG
FT                   NIASPLSPAALQRLQQHTWPGNVRELRNLVERLCIHWKSQPHDSLSLEQLERWTPELFD
FT                   THFGNREAPRELADLATSRLQVTATAVRAALDRANGNRALAAQALGVSRTTLWRWMQAQ
FT                   ASART"
FT   CDS_pept        885982..886878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0816"
FT                   /product="carboxyphosphonoenolpyruvate phosphonomutase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67572"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67572"
FT                   /protein_id="BAE67572.1"
FT                   /translation="MTPSSPSSAGTRFRAALAAESPLQVIGAINANHALLAQRAGYQAI
FT                   YLSGGGVAAGSLGLPDLGINTLEDVLIDVRRITDVCELPLLVDVDTGFGPSAFNIERTI
FT                   KSLIKAGAGGCHIEDQVGAKRCGHRPGKEIVSQGEMVDRVKAAADAKTDAAFFLIARTD
FT                   AIQMEGVDAAIERAIACVEAGADGIFAEAAYDLETYKRFVDAVNVPVLANITEFGKTPL
FT                   FTRDQLAQAGVAIQLFPLSAFRAANKAAEAVYTAIRREGHQQAVLDSMQTREELYERIG
FT                   YHDYEQRLDALFARKGA"
FT   CDS_pept        886954..888108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0818"
FT                   /product="citrate synthase 2"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67573"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67573"
FT                   /protein_id="BAE67573.1"
FT                   /translation="MNDTVKPGFKPKKSVALSGTAAGNTALCTVGRSGNDLHYRGYDIL
FT                   DLATTSEFEEIAYLLVHGKLPNSGELRGYKAKLRSLRGVPAAVKAALEQLPPSAHPMDV
FT                   MRTGVSVLGCLQPEKDDHNHPGARDIADKLMASLGSMLLYWYHYSHNGKRIDVETDDDS
FT                   IGGHFLHLLHGFAPKDAWVRAMHTSLILYAEHEFNASTFASRVIAGTGSDIYSAIAGGI
FT                   GALRGPKHGGANEVAFEVQKRYDTPDEAEADIKARVERKEVVIGFGHPVYTLSDPRNKV
FT                   IKDVARELSDEQGSRKMYDIAERLESVMWDIKKMFPNLDWFSAVSYHMMGVPTAMFTPL
FT                   FVLARTAGWSAHIIEQRVDGKIIRPSANYTGPEDQVFVPLDQRR"
FT   CDS_pept        888289..890880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0819"
FT                   /product="aconitate hydratase 1"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67574"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67574"
FT                   /protein_id="BAE67574.1"
FT                   /translation="MNSQYRKPLPGTSLDYFDARAAIDALQPGAYAGLPYTARVHAENL
FT                   VRRAEPQLLEAYLRQLIERKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIAEQGGD
FT                   PAQVNPVVPVQLIVDHSLAVEYAGFDKQAFAKNRSVEDRRNADRFHFIEWTKRAFENME
FT                   VIPPGNGIMHQINLEKMSPVIYTLDGVAFPDTCVGTDSHTPHVDALGVIAVGVGGLEAE
FT                   NVMLGRASWMRLPDIIGVELTGRPAPGITATDIVLALTEFLRAQRVVGAYLEFYGDGAR
FT                   ALTIGDRATISNMTPEFGATAAMFYIDQQTIDYLRLTGREDAQVALVETYARHTGLWAD
FT                   DMATAHYERVLQFDLASVVRNMAGPSNPHKRVATTELAQRGIAGTWEAVPGQMPDGAVI
FT                   IAAITSCTNTSNPRNVIAAGLLARNANARGLTRKPWVKSSLAPGSKAVQLYLEEAGLLS
FT                   ELEQLGFGIVAFACTTCNGMSGALDPVIQQQIIDRDLYATAVLSGNRNFDGRIHPYAKQ
FT                   AFLASPPLVIAYAIAGTVRFDIEKDVLGIDAAGVPVTLKDLWPSDAEIDAVVARSVRPE
FT                   HFRSVYDPMFKRSVGQGTNVNPLYDWRPASTYIRRPPYWEGALAGTRTLRGMRPLAVLG
FT                   DNITTDHVSPSNAIMAGSAAGEYLAHMGVPEEDFNSYATHRGDHLTAQRATFANPTLIN
FT                   EMVVVDGQVNAGSLARLEPEGQVLRMWEAIETYMTRKQPLIIIAGADYGQGSSRDWAAK
FT                   GVRLAGVEVIVAEGFERIHRTNLIGMGVLPLEFKPGTDRKTLGIDGSETFDVVGERRPG
FT                   ATLTLSIHRRDGDQLQVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLEASAA"
FT   CDS_pept        890883..891131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0820"
FT                   /product="hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67575"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67575"
FT                   /protein_id="BAE67575.1"
FT                   /translation="MLMETPQSACTCQMGHTRWQSLSFGGCMATMNIALPDELQQCVDP
FT                   QVAEHAYGPGSGYLRALMRKQRDIEQLRGVLLDGANS"
FT   CDS_pept        891203..891340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0821"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67576"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67576"
FT                   /protein_id="BAE67576.1"
FT                   /translation="MKPAHWRPLALRDTGAAAAWYGEPAGLEVELAFVDALEPAVDRLV
FT                   "
FT   CDS_pept        891613..892812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0822"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67577"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67577"
FT                   /protein_id="BAE67577.1"
FT                   /translation="MRHLPQLRIPATYMRGGTSKGVFFRLQDLPVAAQQPGAARDALLL
FT                   RVVGSPDPYAKQIDGMGGATSSTSKSVIVSASTRDGHDVDYLFGQVSIDSAFVDWSGNC
FT                   GNLSAAVGPFAIASGLIDPARVQRDGVATVRIWQANIGKTIVAHVPMTDGAVQETGDFE
FT                   LDGVTFPAAEVQLEFLDPADDAEGEGGAMFPTGNVIDQLEIPGLGTLDATLINAGIPTI
FT                   FLNARDLGYTGTELQDAINGDPRALIMFETLRAHGAVRMGLIAKVEDAATRQHTPKVAF
FT                   VAPPADYTASSGKPVHSAEIDLLVRAMSMGKLHHAMMGTAAVAIGTAAAVPGTLVNLAA
FT                   GGAARSAVRFGHPSGTLRVGAQAQLVDGQWQVTKALMSRSARVLMEGWVRVPAPVAEVQ
FT                   "
FT   CDS_pept        complement(893262..894230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0823"
FT                   /product="ISXo1 transposase"
FT                   /note="identified by sequence similarity; putative; ORF
FT                   located using Blastx/Glimmer/GeneHacker"
FT                   /db_xref="EnsemblGenomes-Gn:BAE67578"
FT                   /db_xref="EnsemblGenomes-Tr:BAE67578"
FT                   /protein_id="BAE67578.1"
FT                   /translation="MQLTFGDAVGLGKRKQTRREIFLAEMERIVPWKRLLALIEPHYPV
FT                   SGRPGRQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPDETTI
FT                   LNFRRLLETHGIAARMLEAVNAHLSRKGQSLRSGTIVDATLIAAPSSTKNADRARDPEM
FT                   HQTKKGNQWYFGMKAHIGVDEFSGLVHHVQCTAANVADVTVTHALLHGKEDSVFGDSGY
FT                   TGAEKRDELQSCEAAFFIAAKRSTIQAIGNKRARAWAERWEHFKASVRAKVEHPFRVIK
FT                   RQFGYTKVRYRGLAKNTAQVQTLFALSNLWMVRRHLLPARG"
FT   CDS_pept        894472..896688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XOO0824"
FT                   /product="TonB-dependent receptor"
FT                   /note="identified by sequence similarity; putative; ORF
FT