(data stored in ACNUC17686 zone)

EMBL: AP008955

ID   AP008955; SV 1; circular; genomic DNA; STD; PRO; 6296436 BP.
XX
AC   AP008955;
XX
PR   Project:PRJDA29147;
XX
DT   07-APR-2009 (Rel. 100, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 4)
XX
DE   Brevibacillus brevis NBRC 100599 DNA, complete genome.
XX
KW   .
XX
OS   Brevibacillus brevis NBRC 100599
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Paenibacillaceae; Brevibacillus.
XX
RN   [1]
RP   1-6296436
RA   Hosoyama A., Yamada R., Hongo Y., Terui Y., Ankai A., Masuyama W.,
RA   Sekiguchi M., Takeda T., Asano K., Ohji S., Ichikawa N., Narita S.,
RA   Aoki N., Miura H., Matsushita S., Sekigawa T., Yamagata H., Yoshikawa H.,
RA   Udaka S., Tanikawa S., Fujita N.;
RT   ;
RL   Submitted (31-MAR-2005) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation (NITE), NITE Genome Analysis Center (NGAC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Hosoyama A., Yamada R., Hongo Y., Terui Y., Ankai A., Masuyama W.,
RA   Sekiguchi M., Takeda T., Asano K., Ohji S., Ichikawa N., Narita S.,
RA   Aoki N., Miura H., Matsushita S., Sekigawa T., Yamagata H., Yoshikawa H.,
RA   Udaka S., Tanikawa S., Fujita N.;
RT   "Brevibacillus brevis strain 47, complete genome";
RL   Unpublished.
XX
DR   MD5; 7c6c13fe8cfc4702b5da710729ac2b66.
DR   BioSample; SAMD00060942.
DR   EnsemblGenomes-Gn; BBR47_r0010.
DR   EnsemblGenomes-Gn; BBR47_r0020.
DR   EnsemblGenomes-Gn; BBR47_r0030.
DR   EnsemblGenomes-Gn; BBR47_r0040.
DR   EnsemblGenomes-Gn; BBR47_r0050.
DR   EnsemblGenomes-Gn; BBR47_r0060.
DR   EnsemblGenomes-Gn; BBR47_r0070.
DR   EnsemblGenomes-Gn; BBR47_r0080.
DR   EnsemblGenomes-Gn; BBR47_r0090.
DR   EnsemblGenomes-Gn; BBR47_r0100.
DR   EnsemblGenomes-Gn; BBR47_r0110.
DR   EnsemblGenomes-Gn; BBR47_r0120.
DR   EnsemblGenomes-Gn; BBR47_r0130.
DR   EnsemblGenomes-Gn; BBR47_r0140.
DR   EnsemblGenomes-Gn; BBR47_r0150.
DR   EnsemblGenomes-Gn; BBR47_r0160.
DR   EnsemblGenomes-Gn; BBR47_r0170.
DR   EnsemblGenomes-Gn; BBR47_r0180.
DR   EnsemblGenomes-Gn; BBR47_r0190.
DR   EnsemblGenomes-Gn; BBR47_r0200.
DR   EnsemblGenomes-Gn; BBR47_r0210.
DR   EnsemblGenomes-Gn; BBR47_r0220.
DR   EnsemblGenomes-Gn; BBR47_r0230.
DR   EnsemblGenomes-Gn; BBR47_r0240.
DR   EnsemblGenomes-Gn; BBR47_r0250.
DR   EnsemblGenomes-Gn; BBR47_r0260.
DR   EnsemblGenomes-Gn; BBR47_r0270.
DR   EnsemblGenomes-Gn; BBR47_r0280.
DR   EnsemblGenomes-Gn; BBR47_r0290.
DR   EnsemblGenomes-Gn; BBR47_r0300.
DR   EnsemblGenomes-Gn; BBR47_r0310.
DR   EnsemblGenomes-Gn; BBR47_r0320.
DR   EnsemblGenomes-Gn; BBR47_r0330.
DR   EnsemblGenomes-Gn; BBR47_r0340.
DR   EnsemblGenomes-Gn; BBR47_r0350.
DR   EnsemblGenomes-Gn; BBR47_r0360.
DR   EnsemblGenomes-Gn; BBR47_r0370.
DR   EnsemblGenomes-Gn; BBR47_r0380.
DR   EnsemblGenomes-Gn; BBR47_r0390.
DR   EnsemblGenomes-Gn; BBR47_r0400.
DR   EnsemblGenomes-Gn; BBR47_r0410.
DR   EnsemblGenomes-Gn; BBR47_r0420.
DR   EnsemblGenomes-Gn; BBR47_r0430.
DR   EnsemblGenomes-Gn; BBR47_r0440.
DR   EnsemblGenomes-Gn; BBR47_rnp0010.
DR   EnsemblGenomes-Gn; BBR47_srp0010.
DR   EnsemblGenomes-Gn; BBR47_t0010.
DR   EnsemblGenomes-Gn; BBR47_t0020.
DR   EnsemblGenomes-Gn; BBR47_t0030.
DR   EnsemblGenomes-Gn; BBR47_t0040.
DR   EnsemblGenomes-Gn; BBR47_t0050.
DR   EnsemblGenomes-Gn; BBR47_t0060.
DR   EnsemblGenomes-Gn; BBR47_t0070.
DR   EnsemblGenomes-Gn; BBR47_t0080.
DR   EnsemblGenomes-Gn; BBR47_t0090.
DR   EnsemblGenomes-Gn; BBR47_t0100.
DR   EnsemblGenomes-Gn; BBR47_t0110.
DR   EnsemblGenomes-Gn; BBR47_t0120.
DR   EnsemblGenomes-Gn; BBR47_t0130.
DR   EnsemblGenomes-Gn; BBR47_t0140.
DR   EnsemblGenomes-Gn; BBR47_t0150.
DR   EnsemblGenomes-Gn; BBR47_t0160.
DR   EnsemblGenomes-Gn; BBR47_t0170.
DR   EnsemblGenomes-Gn; BBR47_t0180.
DR   EnsemblGenomes-Gn; BBR47_t0190.
DR   EnsemblGenomes-Gn; BBR47_t0200.
DR   EnsemblGenomes-Gn; BBR47_t0210.
DR   EnsemblGenomes-Gn; BBR47_t0220.
DR   EnsemblGenomes-Gn; BBR47_t0230.
DR   EnsemblGenomes-Gn; BBR47_t0240.
DR   EnsemblGenomes-Gn; BBR47_t0250.
DR   EnsemblGenomes-Gn; BBR47_t0260.
DR   EnsemblGenomes-Gn; BBR47_t0270.
DR   EnsemblGenomes-Gn; BBR47_t0280.
DR   EnsemblGenomes-Gn; BBR47_t0290.
DR   EnsemblGenomes-Gn; BBR47_t0300.
DR   EnsemblGenomes-Gn; BBR47_t0310.
DR   EnsemblGenomes-Gn; BBR47_t0320.
DR   EnsemblGenomes-Gn; BBR47_t0330.
DR   EnsemblGenomes-Gn; BBR47_t0340.
DR   EnsemblGenomes-Gn; BBR47_t0350.
DR   EnsemblGenomes-Gn; BBR47_t0360.
DR   EnsemblGenomes-Gn; BBR47_t0370.
DR   EnsemblGenomes-Gn; BBR47_t0380.
DR   EnsemblGenomes-Gn; BBR47_t0390.
DR   EnsemblGenomes-Gn; BBR47_t0400.
DR   EnsemblGenomes-Gn; BBR47_t0410.
DR   EnsemblGenomes-Gn; BBR47_t0420.
DR   EnsemblGenomes-Gn; BBR47_t0430.
DR   EnsemblGenomes-Gn; BBR47_t0440.
DR   EnsemblGenomes-Gn; BBR47_t0450.
DR   EnsemblGenomes-Gn; BBR47_t0460.
DR   EnsemblGenomes-Gn; BBR47_t0470.
DR   EnsemblGenomes-Gn; BBR47_t0480.
DR   EnsemblGenomes-Gn; BBR47_t0490.
DR   EnsemblGenomes-Gn; BBR47_t0500.
DR   EnsemblGenomes-Gn; BBR47_t0510.
DR   EnsemblGenomes-Gn; BBR47_t0520.
DR   EnsemblGenomes-Gn; BBR47_t0530.
DR   EnsemblGenomes-Gn; BBR47_t0540.
DR   EnsemblGenomes-Gn; BBR47_t0550.
DR   EnsemblGenomes-Gn; BBR47_t0560.
DR   EnsemblGenomes-Gn; BBR47_t0570.
DR   EnsemblGenomes-Gn; BBR47_t0580.
DR   EnsemblGenomes-Gn; BBR47_t0590.
DR   EnsemblGenomes-Gn; BBR47_t0600.
DR   EnsemblGenomes-Gn; BBR47_t0610.
DR   EnsemblGenomes-Gn; BBR47_t0620.
DR   EnsemblGenomes-Gn; BBR47_t0630.
DR   EnsemblGenomes-Gn; BBR47_t0640.
DR   EnsemblGenomes-Gn; BBR47_t0650.
DR   EnsemblGenomes-Gn; BBR47_t0660.
DR   EnsemblGenomes-Gn; BBR47_t0670.
DR   EnsemblGenomes-Gn; BBR47_t0680.
DR   EnsemblGenomes-Gn; BBR47_t0690.
DR   EnsemblGenomes-Gn; BBR47_t0700.
DR   EnsemblGenomes-Gn; BBR47_t0710.
DR   EnsemblGenomes-Gn; BBR47_t0720.
DR   EnsemblGenomes-Gn; BBR47_t0730.
DR   EnsemblGenomes-Gn; BBR47_t0740.
DR   EnsemblGenomes-Gn; BBR47_t0750.
DR   EnsemblGenomes-Gn; BBR47_t0760.
DR   EnsemblGenomes-Gn; BBR47_t0770.
DR   EnsemblGenomes-Gn; BBR47_t0780.
DR   EnsemblGenomes-Gn; BBR47_t0790.
DR   EnsemblGenomes-Gn; BBR47_t0800.
DR   EnsemblGenomes-Gn; BBR47_t0810.
DR   EnsemblGenomes-Gn; BBR47_t0820.
DR   EnsemblGenomes-Gn; BBR47_t0830.
DR   EnsemblGenomes-Gn; BBR47_t0840.
DR   EnsemblGenomes-Gn; BBR47_t0850.
DR   EnsemblGenomes-Gn; BBR47_t0860.
DR   EnsemblGenomes-Gn; BBR47_t0870.
DR   EnsemblGenomes-Gn; BBR47_t0880.
DR   EnsemblGenomes-Gn; BBR47_t0890.
DR   EnsemblGenomes-Gn; BBR47_t0900.
DR   EnsemblGenomes-Gn; BBR47_t0910.
DR   EnsemblGenomes-Gn; BBR47_t0920.
DR   EnsemblGenomes-Gn; BBR47_t0930.
DR   EnsemblGenomes-Gn; BBR47_t0940.
DR   EnsemblGenomes-Gn; BBR47_t0950.
DR   EnsemblGenomes-Gn; BBR47_t0960.
DR   EnsemblGenomes-Gn; BBR47_t0970.
DR   EnsemblGenomes-Gn; BBR47_t0980.
DR   EnsemblGenomes-Gn; BBR47_t0990.
DR   EnsemblGenomes-Gn; BBR47_t1000.
DR   EnsemblGenomes-Gn; BBR47_t1010.
DR   EnsemblGenomes-Gn; BBR47_t1020.
DR   EnsemblGenomes-Gn; BBR47_t1030.
DR   EnsemblGenomes-Gn; BBR47_t1040.
DR   EnsemblGenomes-Gn; BBR47_t1050.
DR   EnsemblGenomes-Gn; BBR47_t1060.
DR   EnsemblGenomes-Gn; BBR47_t1070.
DR   EnsemblGenomes-Gn; BBR47_t1080.
DR   EnsemblGenomes-Gn; BBR47_t1090.
DR   EnsemblGenomes-Gn; BBR47_t1100.
DR   EnsemblGenomes-Gn; BBR47_t1110.
DR   EnsemblGenomes-Gn; BBR47_t1120.
DR   EnsemblGenomes-Gn; BBR47_t1130.
DR   EnsemblGenomes-Gn; BBR47_t1140.
DR   EnsemblGenomes-Gn; BBR47_t1150.
DR   EnsemblGenomes-Gn; BBR47_t1160.
DR   EnsemblGenomes-Gn; BBR47_t1170.
DR   EnsemblGenomes-Gn; BBR47_t1180.
DR   EnsemblGenomes-Gn; BBR47_t1190.
DR   EnsemblGenomes-Gn; BBR47_t1200.
DR   EnsemblGenomes-Gn; BBR47_t1210.
DR   EnsemblGenomes-Gn; BBR47_t1220.
DR   EnsemblGenomes-Gn; BBR47_t1230.
DR   EnsemblGenomes-Gn; BBR47_t1240.
DR   EnsemblGenomes-Gn; BBR47_t1250.
DR   EnsemblGenomes-Gn; BBR47_t1260.
DR   EnsemblGenomes-Gn; BBR47_t1270.
DR   EnsemblGenomes-Gn; BBR47_tm0010.
DR   EnsemblGenomes-Gn; EBG00001235570.
DR   EnsemblGenomes-Gn; EBG00001235571.
DR   EnsemblGenomes-Gn; EBG00001235572.
DR   EnsemblGenomes-Gn; EBG00001235573.
DR   EnsemblGenomes-Gn; EBG00001235574.
DR   EnsemblGenomes-Gn; EBG00001235575.
DR   EnsemblGenomes-Gn; EBG00001235576.
DR   EnsemblGenomes-Gn; EBG00001235577.
DR   EnsemblGenomes-Gn; EBG00001235578.
DR   EnsemblGenomes-Gn; EBG00001235579.
DR   EnsemblGenomes-Gn; EBG00001235580.
DR   EnsemblGenomes-Gn; EBG00001235581.
DR   EnsemblGenomes-Gn; EBG00001235582.
DR   EnsemblGenomes-Gn; EBG00001235583.
DR   EnsemblGenomes-Gn; EBG00001235584.
DR   EnsemblGenomes-Gn; EBG00001235585.
DR   EnsemblGenomes-Gn; EBG00001235586.
DR   EnsemblGenomes-Gn; EBG00001235587.
DR   EnsemblGenomes-Gn; EBG00001235588.
DR   EnsemblGenomes-Gn; EBG00001235589.
DR   EnsemblGenomes-Gn; EBG00001235590.
DR   EnsemblGenomes-Gn; EBG00001235591.
DR   EnsemblGenomes-Gn; EBG00001235592.
DR   EnsemblGenomes-Gn; EBG00001235593.
DR   EnsemblGenomes-Gn; EBG00001235594.
DR   EnsemblGenomes-Gn; EBG00001235595.
DR   EnsemblGenomes-Gn; EBG00001235596.
DR   EnsemblGenomes-Gn; EBG00001235597.
DR   EnsemblGenomes-Gn; EBG00001235598.
DR   EnsemblGenomes-Gn; EBG00001235599.
DR   EnsemblGenomes-Gn; EBG00001235600.
DR   EnsemblGenomes-Gn; EBG00001235601.
DR   EnsemblGenomes-Gn; EBG00001235602.
DR   EnsemblGenomes-Gn; EBG00001235603.
DR   EnsemblGenomes-Gn; EBG00001235604.
DR   EnsemblGenomes-Gn; EBG00001235605.
DR   EnsemblGenomes-Gn; EBG00001235606.
DR   EnsemblGenomes-Gn; EBG00001235607.
DR   EnsemblGenomes-Gn; EBG00001235608.
DR   EnsemblGenomes-Gn; EBG00001235609.
DR   EnsemblGenomes-Gn; EBG00001235610.
DR   EnsemblGenomes-Gn; EBG00001235611.
DR   EnsemblGenomes-Gn; EBG00001235612.
DR   EnsemblGenomes-Gn; EBG00001235613.
DR   EnsemblGenomes-Gn; EBG00001235614.
DR   EnsemblGenomes-Gn; EBG00001235615.
DR   EnsemblGenomes-Gn; EBG00001235616.
DR   EnsemblGenomes-Gn; EBG00001235617.
DR   EnsemblGenomes-Gn; EBG00001235618.
DR   EnsemblGenomes-Gn; EBG00001235619.
DR   EnsemblGenomes-Gn; EBG00001235620.
DR   EnsemblGenomes-Gn; EBG00001235621.
DR   EnsemblGenomes-Gn; EBG00001235622.
DR   EnsemblGenomes-Gn; EBG00001235623.
DR   EnsemblGenomes-Gn; EBG00001235624.
DR   EnsemblGenomes-Gn; EBG00001235625.
DR   EnsemblGenomes-Gn; EBG00001235626.
DR   EnsemblGenomes-Gn; EBG00001235627.
DR   EnsemblGenomes-Gn; EBG00001235628.
DR   EnsemblGenomes-Gn; EBG00001235629.
DR   EnsemblGenomes-Gn; EBG00001235630.
DR   EnsemblGenomes-Gn; EBG00001235631.
DR   EnsemblGenomes-Gn; EBG00001235632.
DR   EnsemblGenomes-Gn; EBG00001235633.
DR   EnsemblGenomes-Gn; EBG00001235634.
DR   EnsemblGenomes-Gn; EBG00001235635.
DR   EnsemblGenomes-Gn; EBG00001235636.
DR   EnsemblGenomes-Gn; EBG00001235637.
DR   EnsemblGenomes-Gn; EBG00001235638.
DR   EnsemblGenomes-Gn; EBG00001235639.
DR   EnsemblGenomes-Gn; EBG00001235640.
DR   EnsemblGenomes-Gn; EBG00001235641.
DR   EnsemblGenomes-Gn; EBG00001235642.
DR   EnsemblGenomes-Gn; EBG00001235643.
DR   EnsemblGenomes-Gn; EBG00001235644.
DR   EnsemblGenomes-Gn; EBG00001235645.
DR   EnsemblGenomes-Gn; EBG00001235646.
DR   EnsemblGenomes-Gn; EBG00001235647.
DR   EnsemblGenomes-Gn; EBG00001235648.
DR   EnsemblGenomes-Gn; EBG00001235649.
DR   EnsemblGenomes-Gn; EBG00001235650.
DR   EnsemblGenomes-Gn; EBG00001235651.
DR   EnsemblGenomes-Gn; EBG00001235652.
DR   EnsemblGenomes-Gn; EBG00001235653.
DR   EnsemblGenomes-Gn; EBG00001235654.
DR   EnsemblGenomes-Gn; EBG00001235655.
DR   EnsemblGenomes-Gn; EBG00001235656.
DR   EnsemblGenomes-Gn; EBG00001235657.
DR   EnsemblGenomes-Gn; EBG00001235658.
DR   EnsemblGenomes-Gn; EBG00001235659.
DR   EnsemblGenomes-Gn; EBG00001235660.
DR   EnsemblGenomes-Gn; EBG00001235661.
DR   EnsemblGenomes-Gn; EBG00001235662.
DR   EnsemblGenomes-Gn; EBG00001235663.
DR   EnsemblGenomes-Gn; EBG00001235664.
DR   EnsemblGenomes-Gn; EBG00001235665.
DR   EnsemblGenomes-Gn; EBG00001235666.
DR   EnsemblGenomes-Gn; EBG00001235667.
DR   EnsemblGenomes-Gn; EBG00001235668.
DR   EnsemblGenomes-Gn; EBG00001235669.
DR   EnsemblGenomes-Gn; EBG00001235670.
DR   EnsemblGenomes-Gn; EBG00001235671.
DR   EnsemblGenomes-Gn; EBG00001235672.
DR   EnsemblGenomes-Gn; EBG00001235673.
DR   EnsemblGenomes-Gn; EBG00001235674.
DR   EnsemblGenomes-Gn; EBG00001235675.
DR   EnsemblGenomes-Gn; EBG00001235676.
DR   EnsemblGenomes-Gn; EBG00001235677.
DR   EnsemblGenomes-Gn; EBG00001235678.
DR   EnsemblGenomes-Gn; EBG00001235679.
DR   EnsemblGenomes-Gn; EBG00001235680.
DR   EnsemblGenomes-Gn; EBG00001235681.
DR   EnsemblGenomes-Gn; EBG00001235682.
DR   EnsemblGenomes-Gn; EBG00001235683.
DR   EnsemblGenomes-Gn; EBG00001235684.
DR   EnsemblGenomes-Gn; EBG00001235685.
DR   EnsemblGenomes-Gn; EBG00001235686.
DR   EnsemblGenomes-Gn; EBG00001235687.
DR   EnsemblGenomes-Gn; EBG00001235688.
DR   EnsemblGenomes-Gn; EBG00001235689.
DR   EnsemblGenomes-Gn; EBG00001235690.
DR   EnsemblGenomes-Gn; EBG00001235691.
DR   EnsemblGenomes-Gn; EBG00001235692.
DR   EnsemblGenomes-Gn; EBG00001235693.
DR   EnsemblGenomes-Gn; EBG00001235694.
DR   EnsemblGenomes-Gn; EBG00001235695.
DR   EnsemblGenomes-Gn; EBG00001235696.
DR   EnsemblGenomes-Gn; EBG00001235697.
DR   EnsemblGenomes-Gn; EBG00001235698.
DR   EnsemblGenomes-Gn; EBG00001235699.
DR   EnsemblGenomes-Gn; EBG00001235700.
DR   EnsemblGenomes-Gn; EBG00001235701.
DR   EnsemblGenomes-Gn; EBG00001235702.
DR   EnsemblGenomes-Gn; EBG00001235703.
DR   EnsemblGenomes-Gn; EBG00001235704.
DR   EnsemblGenomes-Gn; EBG00001235705.
DR   EnsemblGenomes-Gn; EBG00001235706.
DR   EnsemblGenomes-Gn; EBG00001235707.
DR   EnsemblGenomes-Gn; EBG00001235708.
DR   EnsemblGenomes-Gn; EBG00001235709.
DR   EnsemblGenomes-Gn; EBG00001235710.
DR   EnsemblGenomes-Gn; EBG00001235711.
DR   EnsemblGenomes-Gn; EBG00001235712.
DR   EnsemblGenomes-Gn; EBG00001235713.
DR   EnsemblGenomes-Gn; EBG00001235714.
DR   EnsemblGenomes-Gn; EBG00001235715.
DR   EnsemblGenomes-Gn; EBG00001235716.
DR   EnsemblGenomes-Gn; EBG00001235717.
DR   EnsemblGenomes-Gn; EBG00001235718.
DR   EnsemblGenomes-Gn; EBG00001235719.
DR   EnsemblGenomes-Gn; EBG00001235720.
DR   EnsemblGenomes-Gn; EBG00001235721.
DR   EnsemblGenomes-Gn; EBG00001235722.
DR   EnsemblGenomes-Gn; EBG00001235723.
DR   EnsemblGenomes-Gn; EBG00001235724.
DR   EnsemblGenomes-Gn; EBG00001235725.
DR   EnsemblGenomes-Gn; EBG00001235726.
DR   EnsemblGenomes-Gn; EBG00001235727.
DR   EnsemblGenomes-Gn; EBG00001235728.
DR   EnsemblGenomes-Gn; EBG00001235729.
DR   EnsemblGenomes-Gn; EBG00001235730.
DR   EnsemblGenomes-Gn; EBG00001235731.
DR   EnsemblGenomes-Gn; EBG00001235732.
DR   EnsemblGenomes-Gn; EBG00001235733.
DR   EnsemblGenomes-Gn; EBG00001235734.
DR   EnsemblGenomes-Gn; EBG00001235735.
DR   EnsemblGenomes-Gn; EBG00001235736.
DR   EnsemblGenomes-Gn; EBG00001235737.
DR   EnsemblGenomes-Gn; EBG00001235738.
DR   EnsemblGenomes-Gn; EBG00001235739.
DR   EnsemblGenomes-Gn; EBG00001235740.
DR   EnsemblGenomes-Gn; EBG00001235741.
DR   EnsemblGenomes-Gn; EBG00001235742.
DR   EnsemblGenomes-Gn; EBG00001235743.
DR   EnsemblGenomes-Gn; EBG00001235744.
DR   EnsemblGenomes-Gn; EBG00001235745.
DR   EnsemblGenomes-Gn; EBG00001235746.
DR   EnsemblGenomes-Gn; EBG00001235747.
DR   EnsemblGenomes-Gn; EBG00001235748.
DR   EnsemblGenomes-Gn; EBG00001235749.
DR   EnsemblGenomes-Gn; EBG00001235750.
DR   EnsemblGenomes-Gn; EBG00001235751.
DR   EnsemblGenomes-Gn; EBG00001235752.
DR   EnsemblGenomes-Gn; EBG00001235753.
DR   EnsemblGenomes-Gn; EBG00001235754.
DR   EnsemblGenomes-Gn; EBG00001235755.
DR   EnsemblGenomes-Gn; EBG00001235756.
DR   EnsemblGenomes-Gn; EBG00001235757.
DR   EnsemblGenomes-Gn; EBG00001235758.
DR   EnsemblGenomes-Gn; EBG00001235759.
DR   EnsemblGenomes-Gn; EBG00001235760.
DR   EnsemblGenomes-Gn; EBG00001235761.
DR   EnsemblGenomes-Gn; EBG00001235762.
DR   EnsemblGenomes-Gn; EBG00001235763.
DR   EnsemblGenomes-Gn; EBG00001235764.
DR   EnsemblGenomes-Gn; EBG00001235765.
DR   EnsemblGenomes-Gn; EBG00001235766.
DR   EnsemblGenomes-Gn; EBG00001235767.
DR   EnsemblGenomes-Gn; EBG00001235768.
DR   EnsemblGenomes-Gn; EBG00001235769.
DR   EnsemblGenomes-Gn; EBG00001235770.
DR   EnsemblGenomes-Gn; EBG00001235771.
DR   EnsemblGenomes-Gn; EBG00001235772.
DR   EnsemblGenomes-Gn; EBG00001235773.
DR   EnsemblGenomes-Gn; EBG00001235774.
DR   EnsemblGenomes-Gn; EBG00001235775.
DR   EnsemblGenomes-Gn; EBG00001235776.
DR   EnsemblGenomes-Gn; EBG00001235777.
DR   EnsemblGenomes-Gn; EBG00001235778.
DR   EnsemblGenomes-Gn; EBG00001235779.
DR   EnsemblGenomes-Gn; EBG00001235780.
DR   EnsemblGenomes-Gn; EBG00001235781.
DR   EnsemblGenomes-Gn; EBG00001235782.
DR   EnsemblGenomes-Gn; EBG00001235783.
DR   EnsemblGenomes-Gn; EBG00001235784.
DR   EnsemblGenomes-Gn; EBG00001235785.
DR   EnsemblGenomes-Gn; EBG00001235786.
DR   EnsemblGenomes-Gn; EBG00001235787.
DR   EnsemblGenomes-Gn; EBG00001235788.
DR   EnsemblGenomes-Tr; BBR47_r0010-1.
DR   EnsemblGenomes-Tr; BBR47_r0020-1.
DR   EnsemblGenomes-Tr; BBR47_r0030-1.
DR   EnsemblGenomes-Tr; BBR47_r0040-1.
DR   EnsemblGenomes-Tr; BBR47_r0050-1.
DR   EnsemblGenomes-Tr; BBR47_r0060-1.
DR   EnsemblGenomes-Tr; BBR47_r0070-1.
DR   EnsemblGenomes-Tr; BBR47_r0080-1.
DR   EnsemblGenomes-Tr; BBR47_r0090-1.
DR   EnsemblGenomes-Tr; BBR47_r0100-1.
DR   EnsemblGenomes-Tr; BBR47_r0110-1.
DR   EnsemblGenomes-Tr; BBR47_r0120-1.
DR   EnsemblGenomes-Tr; BBR47_r0130-1.
DR   EnsemblGenomes-Tr; BBR47_r0140-1.
DR   EnsemblGenomes-Tr; BBR47_r0150-1.
DR   EnsemblGenomes-Tr; BBR47_r0160-1.
DR   EnsemblGenomes-Tr; BBR47_r0170-1.
DR   EnsemblGenomes-Tr; BBR47_r0180-1.
DR   EnsemblGenomes-Tr; BBR47_r0190-1.
DR   EnsemblGenomes-Tr; BBR47_r0200-1.
DR   EnsemblGenomes-Tr; BBR47_r0210-1.
DR   EnsemblGenomes-Tr; BBR47_r0220-1.
DR   EnsemblGenomes-Tr; BBR47_r0230-1.
DR   EnsemblGenomes-Tr; BBR47_r0240-1.
DR   EnsemblGenomes-Tr; BBR47_r0250-1.
DR   EnsemblGenomes-Tr; BBR47_r0260-1.
DR   EnsemblGenomes-Tr; BBR47_r0270-1.
DR   EnsemblGenomes-Tr; BBR47_r0280-1.
DR   EnsemblGenomes-Tr; BBR47_r0290-1.
DR   EnsemblGenomes-Tr; BBR47_r0300-1.
DR   EnsemblGenomes-Tr; BBR47_r0310-1.
DR   EnsemblGenomes-Tr; BBR47_r0320-1.
DR   EnsemblGenomes-Tr; BBR47_r0330-1.
DR   EnsemblGenomes-Tr; BBR47_r0340-1.
DR   EnsemblGenomes-Tr; BBR47_r0350-1.
DR   EnsemblGenomes-Tr; BBR47_r0360-1.
DR   EnsemblGenomes-Tr; BBR47_r0370-1.
DR   EnsemblGenomes-Tr; BBR47_r0380-1.
DR   EnsemblGenomes-Tr; BBR47_r0390-1.
DR   EnsemblGenomes-Tr; BBR47_r0400-1.
DR   EnsemblGenomes-Tr; BBR47_r0410-1.
DR   EnsemblGenomes-Tr; BBR47_r0420-1.
DR   EnsemblGenomes-Tr; BBR47_r0430-1.
DR   EnsemblGenomes-Tr; BBR47_r0440-1.
DR   EnsemblGenomes-Tr; BBR47_rnp0010-1.
DR   EnsemblGenomes-Tr; BBR47_srp0010-1.
DR   EnsemblGenomes-Tr; BBR47_t0010-1.
DR   EnsemblGenomes-Tr; BBR47_t0020-1.
DR   EnsemblGenomes-Tr; BBR47_t0030-1.
DR   EnsemblGenomes-Tr; BBR47_t0040-1.
DR   EnsemblGenomes-Tr; BBR47_t0050-1.
DR   EnsemblGenomes-Tr; BBR47_t0060-1.
DR   EnsemblGenomes-Tr; BBR47_t0070-1.
DR   EnsemblGenomes-Tr; BBR47_t0080-1.
DR   EnsemblGenomes-Tr; BBR47_t0090-1.
DR   EnsemblGenomes-Tr; BBR47_t0100-1.
DR   EnsemblGenomes-Tr; BBR47_t0110-1.
DR   EnsemblGenomes-Tr; BBR47_t0120-1.
DR   EnsemblGenomes-Tr; BBR47_t0130-1.
DR   EnsemblGenomes-Tr; BBR47_t0140-1.
DR   EnsemblGenomes-Tr; BBR47_t0150-1.
DR   EnsemblGenomes-Tr; BBR47_t0160-1.
DR   EnsemblGenomes-Tr; BBR47_t0170-1.
DR   EnsemblGenomes-Tr; BBR47_t0180-1.
DR   EnsemblGenomes-Tr; BBR47_t0190-1.
DR   EnsemblGenomes-Tr; BBR47_t0200-1.
DR   EnsemblGenomes-Tr; BBR47_t0210-1.
DR   EnsemblGenomes-Tr; BBR47_t0220-1.
DR   EnsemblGenomes-Tr; BBR47_t0230-1.
DR   EnsemblGenomes-Tr; BBR47_t0240-1.
DR   EnsemblGenomes-Tr; BBR47_t0250-1.
DR   EnsemblGenomes-Tr; BBR47_t0260-1.
DR   EnsemblGenomes-Tr; BBR47_t0270-1.
DR   EnsemblGenomes-Tr; BBR47_t0280-1.
DR   EnsemblGenomes-Tr; BBR47_t0290-1.
DR   EnsemblGenomes-Tr; BBR47_t0300-1.
DR   EnsemblGenomes-Tr; BBR47_t0310-1.
DR   EnsemblGenomes-Tr; BBR47_t0320-1.
DR   EnsemblGenomes-Tr; BBR47_t0330-1.
DR   EnsemblGenomes-Tr; BBR47_t0340-1.
DR   EnsemblGenomes-Tr; BBR47_t0350-1.
DR   EnsemblGenomes-Tr; BBR47_t0360-1.
DR   EnsemblGenomes-Tr; BBR47_t0370-1.
DR   EnsemblGenomes-Tr; BBR47_t0380-1.
DR   EnsemblGenomes-Tr; BBR47_t0390-1.
DR   EnsemblGenomes-Tr; BBR47_t0400-1.
DR   EnsemblGenomes-Tr; BBR47_t0410-1.
DR   EnsemblGenomes-Tr; BBR47_t0420-1.
DR   EnsemblGenomes-Tr; BBR47_t0430-1.
DR   EnsemblGenomes-Tr; BBR47_t0440-1.
DR   EnsemblGenomes-Tr; BBR47_t0450-1.
DR   EnsemblGenomes-Tr; BBR47_t0460-1.
DR   EnsemblGenomes-Tr; BBR47_t0470-1.
DR   EnsemblGenomes-Tr; BBR47_t0480-1.
DR   EnsemblGenomes-Tr; BBR47_t0490-1.
DR   EnsemblGenomes-Tr; BBR47_t0500-1.
DR   EnsemblGenomes-Tr; BBR47_t0510-1.
DR   EnsemblGenomes-Tr; BBR47_t0520-1.
DR   EnsemblGenomes-Tr; BBR47_t0530-1.
DR   EnsemblGenomes-Tr; BBR47_t0540-1.
DR   EnsemblGenomes-Tr; BBR47_t0550-1.
DR   EnsemblGenomes-Tr; BBR47_t0560-1.
DR   EnsemblGenomes-Tr; BBR47_t0570-1.
DR   EnsemblGenomes-Tr; BBR47_t0580-1.
DR   EnsemblGenomes-Tr; BBR47_t0590-1.
DR   EnsemblGenomes-Tr; BBR47_t0600-1.
DR   EnsemblGenomes-Tr; BBR47_t0610-1.
DR   EnsemblGenomes-Tr; BBR47_t0620-1.
DR   EnsemblGenomes-Tr; BBR47_t0630-1.
DR   EnsemblGenomes-Tr; BBR47_t0640-1.
DR   EnsemblGenomes-Tr; BBR47_t0650-1.
DR   EnsemblGenomes-Tr; BBR47_t0660-1.
DR   EnsemblGenomes-Tr; BBR47_t0670-1.
DR   EnsemblGenomes-Tr; BBR47_t0680-1.
DR   EnsemblGenomes-Tr; BBR47_t0690-1.
DR   EnsemblGenomes-Tr; BBR47_t0700-1.
DR   EnsemblGenomes-Tr; BBR47_t0710-1.
DR   EnsemblGenomes-Tr; BBR47_t0720-1.
DR   EnsemblGenomes-Tr; BBR47_t0730-1.
DR   EnsemblGenomes-Tr; BBR47_t0740-1.
DR   EnsemblGenomes-Tr; BBR47_t0750-1.
DR   EnsemblGenomes-Tr; BBR47_t0760-1.
DR   EnsemblGenomes-Tr; BBR47_t0770-1.
DR   EnsemblGenomes-Tr; BBR47_t0780-1.
DR   EnsemblGenomes-Tr; BBR47_t0790-1.
DR   EnsemblGenomes-Tr; BBR47_t0800-1.
DR   EnsemblGenomes-Tr; BBR47_t0810-1.
DR   EnsemblGenomes-Tr; BBR47_t0820-1.
DR   EnsemblGenomes-Tr; BBR47_t0830-1.
DR   EnsemblGenomes-Tr; BBR47_t0840-1.
DR   EnsemblGenomes-Tr; BBR47_t0850-1.
DR   EnsemblGenomes-Tr; BBR47_t0860-1.
DR   EnsemblGenomes-Tr; BBR47_t0870-1.
DR   EnsemblGenomes-Tr; BBR47_t0880-1.
DR   EnsemblGenomes-Tr; BBR47_t0890-1.
DR   EnsemblGenomes-Tr; BBR47_t0900-1.
DR   EnsemblGenomes-Tr; BBR47_t0910-1.
DR   EnsemblGenomes-Tr; BBR47_t0920-1.
DR   EnsemblGenomes-Tr; BBR47_t0930-1.
DR   EnsemblGenomes-Tr; BBR47_t0940-1.
DR   EnsemblGenomes-Tr; BBR47_t0950-1.
DR   EnsemblGenomes-Tr; BBR47_t0960-1.
DR   EnsemblGenomes-Tr; BBR47_t0970-1.
DR   EnsemblGenomes-Tr; BBR47_t0980-1.
DR   EnsemblGenomes-Tr; BBR47_t0990-1.
DR   EnsemblGenomes-Tr; BBR47_t1000-1.
DR   EnsemblGenomes-Tr; BBR47_t1010-1.
DR   EnsemblGenomes-Tr; BBR47_t1020-1.
DR   EnsemblGenomes-Tr; BBR47_t1030-1.
DR   EnsemblGenomes-Tr; BBR47_t1040-1.
DR   EnsemblGenomes-Tr; BBR47_t1050-1.
DR   EnsemblGenomes-Tr; BBR47_t1060-1.
DR   EnsemblGenomes-Tr; BBR47_t1070-1.
DR   EnsemblGenomes-Tr; BBR47_t1080-1.
DR   EnsemblGenomes-Tr; BBR47_t1090-1.
DR   EnsemblGenomes-Tr; BBR47_t1100-1.
DR   EnsemblGenomes-Tr; BBR47_t1110-1.
DR   EnsemblGenomes-Tr; BBR47_t1120-1.
DR   EnsemblGenomes-Tr; BBR47_t1130-1.
DR   EnsemblGenomes-Tr; BBR47_t1140-1.
DR   EnsemblGenomes-Tr; BBR47_t1150-1.
DR   EnsemblGenomes-Tr; BBR47_t1160-1.
DR   EnsemblGenomes-Tr; BBR47_t1170-1.
DR   EnsemblGenomes-Tr; BBR47_t1180-1.
DR   EnsemblGenomes-Tr; BBR47_t1190-1.
DR   EnsemblGenomes-Tr; BBR47_t1200-1.
DR   EnsemblGenomes-Tr; BBR47_t1210-1.
DR   EnsemblGenomes-Tr; BBR47_t1220-1.
DR   EnsemblGenomes-Tr; BBR47_t1230-1.
DR   EnsemblGenomes-Tr; BBR47_t1240-1.
DR   EnsemblGenomes-Tr; BBR47_t1250-1.
DR   EnsemblGenomes-Tr; BBR47_t1260-1.
DR   EnsemblGenomes-Tr; BBR47_t1270-1.
DR   EnsemblGenomes-Tr; BBR47_tm0010-1.
DR   EnsemblGenomes-Tr; EBT00001580480.
DR   EnsemblGenomes-Tr; EBT00001580481.
DR   EnsemblGenomes-Tr; EBT00001580482.
DR   EnsemblGenomes-Tr; EBT00001580483.
DR   EnsemblGenomes-Tr; EBT00001580484.
DR   EnsemblGenomes-Tr; EBT00001580485.
DR   EnsemblGenomes-Tr; EBT00001580486.
DR   EnsemblGenomes-Tr; EBT00001580487.
DR   EnsemblGenomes-Tr; EBT00001580488.
DR   EnsemblGenomes-Tr; EBT00001580489.
DR   EnsemblGenomes-Tr; EBT00001580490.
DR   EnsemblGenomes-Tr; EBT00001580491.
DR   EnsemblGenomes-Tr; EBT00001580492.
DR   EnsemblGenomes-Tr; EBT00001580493.
DR   EnsemblGenomes-Tr; EBT00001580494.
DR   EnsemblGenomes-Tr; EBT00001580495.
DR   EnsemblGenomes-Tr; EBT00001580496.
DR   EnsemblGenomes-Tr; EBT00001580497.
DR   EnsemblGenomes-Tr; EBT00001580498.
DR   EnsemblGenomes-Tr; EBT00001580499.
DR   EnsemblGenomes-Tr; EBT00001580500.
DR   EnsemblGenomes-Tr; EBT00001580501.
DR   EnsemblGenomes-Tr; EBT00001580502.
DR   EnsemblGenomes-Tr; EBT00001580503.
DR   EnsemblGenomes-Tr; EBT00001580504.
DR   EnsemblGenomes-Tr; EBT00001580505.
DR   EnsemblGenomes-Tr; EBT00001580506.
DR   EnsemblGenomes-Tr; EBT00001580507.
DR   EnsemblGenomes-Tr; EBT00001580508.
DR   EnsemblGenomes-Tr; EBT00001580509.
DR   EnsemblGenomes-Tr; EBT00001580510.
DR   EnsemblGenomes-Tr; EBT00001580511.
DR   EnsemblGenomes-Tr; EBT00001580512.
DR   EnsemblGenomes-Tr; EBT00001580513.
DR   EnsemblGenomes-Tr; EBT00001580514.
DR   EnsemblGenomes-Tr; EBT00001580515.
DR   EnsemblGenomes-Tr; EBT00001580516.
DR   EnsemblGenomes-Tr; EBT00001580517.
DR   EnsemblGenomes-Tr; EBT00001580518.
DR   EnsemblGenomes-Tr; EBT00001580519.
DR   EnsemblGenomes-Tr; EBT00001580520.
DR   EnsemblGenomes-Tr; EBT00001580521.
DR   EnsemblGenomes-Tr; EBT00001580522.
DR   EnsemblGenomes-Tr; EBT00001580523.
DR   EnsemblGenomes-Tr; EBT00001580524.
DR   EnsemblGenomes-Tr; EBT00001580525.
DR   EnsemblGenomes-Tr; EBT00001580526.
DR   EnsemblGenomes-Tr; EBT00001580527.
DR   EnsemblGenomes-Tr; EBT00001580528.
DR   EnsemblGenomes-Tr; EBT00001580529.
DR   EnsemblGenomes-Tr; EBT00001580530.
DR   EnsemblGenomes-Tr; EBT00001580531.
DR   EnsemblGenomes-Tr; EBT00001580532.
DR   EnsemblGenomes-Tr; EBT00001580533.
DR   EnsemblGenomes-Tr; EBT00001580534.
DR   EnsemblGenomes-Tr; EBT00001580535.
DR   EnsemblGenomes-Tr; EBT00001580536.
DR   EnsemblGenomes-Tr; EBT00001580537.
DR   EnsemblGenomes-Tr; EBT00001580538.
DR   EnsemblGenomes-Tr; EBT00001580539.
DR   EnsemblGenomes-Tr; EBT00001580540.
DR   EnsemblGenomes-Tr; EBT00001580541.
DR   EnsemblGenomes-Tr; EBT00001580542.
DR   EnsemblGenomes-Tr; EBT00001580543.
DR   EnsemblGenomes-Tr; EBT00001580544.
DR   EnsemblGenomes-Tr; EBT00001580545.
DR   EnsemblGenomes-Tr; EBT00001580546.
DR   EnsemblGenomes-Tr; EBT00001580547.
DR   EnsemblGenomes-Tr; EBT00001580548.
DR   EnsemblGenomes-Tr; EBT00001580549.
DR   EnsemblGenomes-Tr; EBT00001580550.
DR   EnsemblGenomes-Tr; EBT00001580551.
DR   EnsemblGenomes-Tr; EBT00001580552.
DR   EnsemblGenomes-Tr; EBT00001580553.
DR   EnsemblGenomes-Tr; EBT00001580554.
DR   EnsemblGenomes-Tr; EBT00001580555.
DR   EnsemblGenomes-Tr; EBT00001580556.
DR   EnsemblGenomes-Tr; EBT00001580557.
DR   EnsemblGenomes-Tr; EBT00001580558.
DR   EnsemblGenomes-Tr; EBT00001580559.
DR   EnsemblGenomes-Tr; EBT00001580560.
DR   EnsemblGenomes-Tr; EBT00001580561.
DR   EnsemblGenomes-Tr; EBT00001580562.
DR   EnsemblGenomes-Tr; EBT00001580563.
DR   EnsemblGenomes-Tr; EBT00001580564.
DR   EnsemblGenomes-Tr; EBT00001580565.
DR   EnsemblGenomes-Tr; EBT00001580566.
DR   EnsemblGenomes-Tr; EBT00001580567.
DR   EnsemblGenomes-Tr; EBT00001580568.
DR   EnsemblGenomes-Tr; EBT00001580569.
DR   EnsemblGenomes-Tr; EBT00001580570.
DR   EnsemblGenomes-Tr; EBT00001580571.
DR   EnsemblGenomes-Tr; EBT00001580572.
DR   EnsemblGenomes-Tr; EBT00001580573.
DR   EnsemblGenomes-Tr; EBT00001580574.
DR   EnsemblGenomes-Tr; EBT00001580575.
DR   EnsemblGenomes-Tr; EBT00001580576.
DR   EnsemblGenomes-Tr; EBT00001580577.
DR   EnsemblGenomes-Tr; EBT00001580578.
DR   EnsemblGenomes-Tr; EBT00001580579.
DR   EnsemblGenomes-Tr; EBT00001580580.
DR   EnsemblGenomes-Tr; EBT00001580581.
DR   EnsemblGenomes-Tr; EBT00001580582.
DR   EnsemblGenomes-Tr; EBT00001580583.
DR   EnsemblGenomes-Tr; EBT00001580584.
DR   EnsemblGenomes-Tr; EBT00001580585.
DR   EnsemblGenomes-Tr; EBT00001580586.
DR   EnsemblGenomes-Tr; EBT00001580587.
DR   EnsemblGenomes-Tr; EBT00001580588.
DR   EnsemblGenomes-Tr; EBT00001580589.
DR   EnsemblGenomes-Tr; EBT00001580590.
DR   EnsemblGenomes-Tr; EBT00001580591.
DR   EnsemblGenomes-Tr; EBT00001580592.
DR   EnsemblGenomes-Tr; EBT00001580593.
DR   EnsemblGenomes-Tr; EBT00001580594.
DR   EnsemblGenomes-Tr; EBT00001580595.
DR   EnsemblGenomes-Tr; EBT00001580596.
DR   EnsemblGenomes-Tr; EBT00001580597.
DR   EnsemblGenomes-Tr; EBT00001580598.
DR   EnsemblGenomes-Tr; EBT00001580599.
DR   EnsemblGenomes-Tr; EBT00001580600.
DR   EnsemblGenomes-Tr; EBT00001580601.
DR   EnsemblGenomes-Tr; EBT00001580602.
DR   EnsemblGenomes-Tr; EBT00001580603.
DR   EnsemblGenomes-Tr; EBT00001580604.
DR   EnsemblGenomes-Tr; EBT00001580605.
DR   EnsemblGenomes-Tr; EBT00001580606.
DR   EnsemblGenomes-Tr; EBT00001580607.
DR   EnsemblGenomes-Tr; EBT00001580608.
DR   EnsemblGenomes-Tr; EBT00001580609.
DR   EnsemblGenomes-Tr; EBT00001580610.
DR   EnsemblGenomes-Tr; EBT00001580611.
DR   EnsemblGenomes-Tr; EBT00001580612.
DR   EnsemblGenomes-Tr; EBT00001580613.
DR   EnsemblGenomes-Tr; EBT00001580614.
DR   EnsemblGenomes-Tr; EBT00001580615.
DR   EnsemblGenomes-Tr; EBT00001580616.
DR   EnsemblGenomes-Tr; EBT00001580617.
DR   EnsemblGenomes-Tr; EBT00001580618.
DR   EnsemblGenomes-Tr; EBT00001580619.
DR   EnsemblGenomes-Tr; EBT00001580620.
DR   EnsemblGenomes-Tr; EBT00001580621.
DR   EnsemblGenomes-Tr; EBT00001580622.
DR   EnsemblGenomes-Tr; EBT00001580623.
DR   EnsemblGenomes-Tr; EBT00001580624.
DR   EnsemblGenomes-Tr; EBT00001580625.
DR   EnsemblGenomes-Tr; EBT00001580626.
DR   EnsemblGenomes-Tr; EBT00001580627.
DR   EnsemblGenomes-Tr; EBT00001580628.
DR   EnsemblGenomes-Tr; EBT00001580629.
DR   EnsemblGenomes-Tr; EBT00001580630.
DR   EnsemblGenomes-Tr; EBT00001580631.
DR   EnsemblGenomes-Tr; EBT00001580632.
DR   EnsemblGenomes-Tr; EBT00001580633.
DR   EnsemblGenomes-Tr; EBT00001580634.
DR   EnsemblGenomes-Tr; EBT00001580635.
DR   EnsemblGenomes-Tr; EBT00001580636.
DR   EnsemblGenomes-Tr; EBT00001580637.
DR   EnsemblGenomes-Tr; EBT00001580638.
DR   EnsemblGenomes-Tr; EBT00001580639.
DR   EnsemblGenomes-Tr; EBT00001580640.
DR   EnsemblGenomes-Tr; EBT00001580641.
DR   EnsemblGenomes-Tr; EBT00001580642.
DR   EnsemblGenomes-Tr; EBT00001580643.
DR   EnsemblGenomes-Tr; EBT00001580644.
DR   EnsemblGenomes-Tr; EBT00001580645.
DR   EnsemblGenomes-Tr; EBT00001580646.
DR   EnsemblGenomes-Tr; EBT00001580647.
DR   EnsemblGenomes-Tr; EBT00001580648.
DR   EnsemblGenomes-Tr; EBT00001580649.
DR   EnsemblGenomes-Tr; EBT00001580650.
DR   EnsemblGenomes-Tr; EBT00001580651.
DR   EnsemblGenomes-Tr; EBT00001580652.
DR   EnsemblGenomes-Tr; EBT00001580653.
DR   EnsemblGenomes-Tr; EBT00001580654.
DR   EnsemblGenomes-Tr; EBT00001580655.
DR   EnsemblGenomes-Tr; EBT00001580656.
DR   EnsemblGenomes-Tr; EBT00001580657.
DR   EnsemblGenomes-Tr; EBT00001580658.
DR   EnsemblGenomes-Tr; EBT00001580659.
DR   EnsemblGenomes-Tr; EBT00001580660.
DR   EnsemblGenomes-Tr; EBT00001580661.
DR   EnsemblGenomes-Tr; EBT00001580662.
DR   EnsemblGenomes-Tr; EBT00001580663.
DR   EnsemblGenomes-Tr; EBT00001580664.
DR   EnsemblGenomes-Tr; EBT00001580665.
DR   EnsemblGenomes-Tr; EBT00001580666.
DR   EnsemblGenomes-Tr; EBT00001580667.
DR   EnsemblGenomes-Tr; EBT00001580668.
DR   EnsemblGenomes-Tr; EBT00001580669.
DR   EnsemblGenomes-Tr; EBT00001580670.
DR   EnsemblGenomes-Tr; EBT00001580671.
DR   EnsemblGenomes-Tr; EBT00001580672.
DR   EnsemblGenomes-Tr; EBT00001580673.
DR   EnsemblGenomes-Tr; EBT00001580674.
DR   EnsemblGenomes-Tr; EBT00001580675.
DR   EnsemblGenomes-Tr; EBT00001580676.
DR   EnsemblGenomes-Tr; EBT00001580677.
DR   EnsemblGenomes-Tr; EBT00001580678.
DR   EnsemblGenomes-Tr; EBT00001580679.
DR   EnsemblGenomes-Tr; EBT00001580680.
DR   EnsemblGenomes-Tr; EBT00001580681.
DR   EnsemblGenomes-Tr; EBT00001580682.
DR   EnsemblGenomes-Tr; EBT00001580683.
DR   EnsemblGenomes-Tr; EBT00001580684.
DR   EnsemblGenomes-Tr; EBT00001580685.
DR   EnsemblGenomes-Tr; EBT00001580686.
DR   EnsemblGenomes-Tr; EBT00001580687.
DR   EnsemblGenomes-Tr; EBT00001580688.
DR   EnsemblGenomes-Tr; EBT00001580689.
DR   EnsemblGenomes-Tr; EBT00001580690.
DR   EnsemblGenomes-Tr; EBT00001580691.
DR   EnsemblGenomes-Tr; EBT00001580692.
DR   EnsemblGenomes-Tr; EBT00001580693.
DR   EnsemblGenomes-Tr; EBT00001580694.
DR   EnsemblGenomes-Tr; EBT00001580695.
DR   EnsemblGenomes-Tr; EBT00001580696.
DR   EnsemblGenomes-Tr; EBT00001580697.
DR   EnsemblGenomes-Tr; EBT00001580698.
DR   EuropePMC; PMC3739172; 23961307.
DR   EuropePMC; PMC5155152; 27929110.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00028; Intron_gpI.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; AP008955.
DR   SILVA-SSU; AP008955.
DR   StrainInfo; 491378; 0.
XX
CC   Yamagata, H. is at School of Life Science, Tokyo University of
CC   Pharmacy and Life Science. Yoshikawa, H. is at Department of
CC   Bioscience, Faculty of Applied Bioscience, Tokyo University of
CC   Agriculture. Udaka, S. is at Department of Fermentation Science,
CC   Faculty of Applied Bioscience, Tokyo University of Agriculture.
CC   The other authors are at NITE Genome Analysis Center (NGAC),
CC   Department of Biotechnology, National Institute of Technology and
CC   Evaluation (NITE).
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
CC   The microbial strain and microbial genomic DNA clones used for
CC   the sequencing project are available through the NBRC.
CC   URL:http://www.nbrc.nite.go.jp/e/index.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6296436
FT                   /organism="Brevibacillus brevis NBRC 100599"
FT                   /strain="NBRC 100599 (= 47)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:358681"
FT   CDS_pept        465..1826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BBR47_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40978"
FT                   /db_xref="GOA:C0ZH37"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH37"
FT                   /protein_id="BAH40978.1"
FT                   /translation="MDAAISELWRKVLAKIEKSLSKPSFDTWLKATKATTLEEDALIVV
FT                   APNDFARDWLETRYAQLITDTLYEVTGINMKVKFVALQNPDAAFADEQPVPRVKMSEPP
FT                   TVADDQPPSILNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTH
FT                   LMHAIGHYVIQHNPSAKVVYLSSEKFTNEFINSIRDNKAVEFRNKYRSVDVLLIDDIQF
FT                   LAGKESTQEEFFHTFNALHEESKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPD
FT                   LETRIAILRKKAKAENLDIPNEVMAYIANQIDSNIRELEGALIRVVAYSSLINRDIDTQ
FT                   LAAEALKDIIPSSRPRVITIIDIQRTVGEAFSLKLEDFKAKKRTKTVAFPRQIAMYLSR
FT                   ELTDASLPKIGDEFGGRDHTTVIHAHEKISRALANDPHMQTTIQSLIEKLKANH"
FT   CDS_pept        2034..3173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BBR47_00020"
FT                   /product="DNA polymerase III beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40979"
FT                   /db_xref="GOA:C0ZH38"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH38"
FT                   /protein_id="BAH40979.1"
FT                   /translation="MHITVQREKLSNAVSHVSKAVSSRTTIPILTGIKIKTDDEGLTLT
FT                   ASDSDVSIEVQIPMEEAGEWGVTVHQPGSIVLTARIFSEIVRKLPSNEIDIQVDDRLAT
FT                   KIRSGQAEFTINGMDANEYPQLPHLEEDKVFSVPCDLLKAMIRQTVFGVSTSEMRPILT
FT                   GLMWSLDQGKLRFVATDSHRLASRTAMVECPEDLSFHNVVVPGKSCNELVKILDDDQNL
FT                   ADIVVADNQILVKSKHILFYSRLLEGTYPDTTRIIPQGSKTEITVSTKEFLQSIERASL
FT                   LSREGKSNVVKLVTMPDGTVEITSNAPEIGKVTDILMPKAMNGEELKISFNAKYMIDAL
FT                   RAIDSAEIKASFSGPMSPFVIRPTDHDWMLHLILPVRTY"
FT   CDS_pept        3206..3421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40980"
FT                   /db_xref="GOA:C0ZH39"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH39"
FT                   /protein_id="BAH40980.1"
FT                   /translation="MREVSISTDYIALGQFLKLAEIIDTGGMAKAFLAEVPIQINGELD
FT                   NRRGRKLYPGDEVAIEGYGRYQVVRP"
FT   CDS_pept        3438..4556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BBR47_00040"
FT                   /product="DNA replication and repair protein F"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40981"
FT                   /db_xref="GOA:C0ZH40"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZH40"
FT                   /protein_id="BAH40981.1"
FT                   /translation="MFLKNLSLTNYRNYETMSLSFDGPIQLFIGNNAQGKTNALESIYV
FT                   LALAKSHRTPRDKELISWDADYATIRSDVLRRYGSVRLELQLTTKGKRAKINGMEQQKL
FT                   SAYVGALNVVMFAPEDLSIVKGAPAQRRRFIDMEIGQVSPTYLYYLSNYNKVLAQRNQL
FT                   LKDLAMKKSNSLEMLAIWNTQLADLAVKLLRKRFEFIRKLETWAQEIHTGITDGRERLS
FT                   LHYVNSSPVTEEMTIDQAVDKMLAAYEEVRDREIMRGSTLIGPHRDDFSLKVNNMDVQT
FT                   YGSQGQQRTSALSIKLAEIELIKEEVGEYPVLLLDDVLSELDEHRQTLLLETIQDRVQT
FT                   FVSTTGVEGLKHQVLQQASRFYVREGKISGER"
FT   CDS_pept        4568..4855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40982"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH41"
FT                   /protein_id="BAH40982.1"
FT                   /translation="MFIHIGGDTVVSTKEVISILDHQTVKSSKINKAFLLEKSKTVVDH
FT                   SEEETKSYVITQNAIYCSPISSLTLKRRAQFVDSLDQFPFVQAEVEELTE"
FT   CDS_pept        4855..6780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BBR47_00060"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40983"
FT                   /db_xref="GOA:C0ZH42"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH42"
FT                   /protein_id="BAH40983.1"
FT                   /translation="MDQVTTKDTNYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLV
FT                   WEIVDNAIDEALAGYCDEILVVIHPDNSVSVTDNGRGIPTGIHEKTGKSTVETVLTVLH
FT                   AGGKFGGGGYKVSGGLHGVGSSVVNALSEWMEVEVKQNNQVYYMRFKVGAPDADLAVVG
FT                   ETEETGTKVTFKPDPTIFTETTVFEYEILQKRIRELAFLNKGLRITLKDTRPDHEKEES
FT                   FHYEGGIIQFVEYLNKNREALHDDVIYCEGEKEGLVVEVALQYNDTYVSNIYSFANNIN
FT                   THEGGTHETGFKTALTRVINDYSRKFNFLKEKDPNLSGDDVREGITAIISVKIQEPQFE
FT                   GQTKTKLGNSEARSITESVFGDRFNTFMEENPGVAKKVVEKALMASRAREAARKAREMT
FT                   RRKSALEVSALPGKLADCSSKDASESELFIVEGDSAGGSAKMGRDRHFQAILPLRGKVL
FT                   NVEKARLDKILGNNEIRAIITALGTGVGEDFDITKARYHKVVIMTDADVDGSHIRTLLL
FT                   TFFFRYMKQLIEAGYIYIAQPPLYSIKQGKTLHYAYNDKQRDEVLATLKAQPKPNVQRY
FT                   KGLGEMNADQLWETTMDPEVRTLLQVDLEDAMDADMVFETLMGDEVEPRREFIEQYAAN
FT                   VRDLDI"
FT   tRNA            7000..7076
FT                   /locus_tag="BBR47_t0010"
FT                   /product="tRNA-Ile"
FT   tRNA            7121..7196
FT                   /locus_tag="BBR47_t0020"
FT                   /product="tRNA-Ala"
FT   tRNA            7214..7289
FT                   /locus_tag="BBR47_t0030"
FT                   /product="tRNA-Asn"
FT   tRNA            7297..7373
FT                   /locus_tag="BBR47_t0040"
FT                   /product="tRNA-Glu"
FT   tRNA            7404..7479
FT                   /locus_tag="BBR47_t0050"
FT                   /product="tRNA-Val"
FT   tRNA            7505..7581
FT                   /locus_tag="BBR47_t0060"
FT                   /product="tRNA-Asp"
FT   tRNA            7617..7692
FT                   /locus_tag="BBR47_t0070"
FT                   /product="tRNA-Phe"
FT   tRNA            7707..7782
FT                   /locus_tag="BBR47_t0080"
FT                   /product="tRNA-Thr"
FT   tRNA            7830..7914
FT                   /locus_tag="BBR47_t0090"
FT                   /product="tRNA-Tyr"
FT   tRNA            7933..8007
FT                   /locus_tag="BBR47_t0100"
FT                   /product="tRNA-Gln"
FT   tRNA            8016..8091
FT                   /locus_tag="BBR47_t0110"
FT                   /product="tRNA-Lys"
FT   tRNA            8124..8210
FT                   /locus_tag="BBR47_t0120"
FT                   /product="tRNA-Leu"
FT   tRNA            8219..8294
FT                   /locus_tag="BBR47_t0130"
FT                   /product="tRNA-Gly"
FT   tRNA            8301..8374
FT                   /locus_tag="BBR47_t0140"
FT                   /product="tRNA-Arg"
FT   tRNA            8407..8483
FT                   /locus_tag="BBR47_t0150"
FT                   /product="tRNA-Pro"
FT   tRNA            8500..8581
FT                   /locus_tag="BBR47_t0160"
FT                   /product="tRNA-Leu"
FT   tRNA            8589..8662
FT                   /locus_tag="BBR47_t0170"
FT                   /product="tRNA-Gly"
FT   tRNA            8672..8760
FT                   /locus_tag="BBR47_t0180"
FT                   /product="tRNA-Ser"
FT   tRNA            8785..8861
FT                   /locus_tag="BBR47_t0190"
FT                   /product="tRNA-Met"
FT   tRNA            8863..8936
FT                   /locus_tag="BBR47_t0200"
FT                   /product="tRNA-Trp"
FT   tRNA            8966..9041
FT                   /locus_tag="BBR47_t0210"
FT                   /product="tRNA-His"
FT   tRNA            9062..9135
FT                   /locus_tag="BBR47_t0220"
FT                   /product="tRNA-Arg"
FT   tRNA            9144..9228
FT                   /locus_tag="BBR47_t0230"
FT                   /product="tRNA-Leu"
FT   rRNA            9514..11024
FT                   /locus_tag="BBR47_r0010"
FT                   /product="16S rRNA"
FT   rRNA            11091..11207
FT                   /locus_tag="BBR47_r0020"
FT                   /product="5S rRNA"
FT   rRNA            11326..14240
FT                   /locus_tag="BBR47_r0030"
FT                   /product="23S rRNA"
FT   CDS_pept        14522..14632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40984"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH43"
FT                   /protein_id="BAH40984.1"
FT                   /translation="MAAHQLGAAVLYTVEESFKVMRIGRNALAAKVSGNM"
FT   CDS_pept        complement(14679..16058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00080"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40985"
FT                   /db_xref="GOA:C0ZH44"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH44"
FT                   /protein_id="BAH40985.1"
FT                   /translation="MSIHFRITLMFALLLCLVMGVSAFLINSFLLDNLIEQQKNELNLK
FT                   GRFWIEKMNESNAKIETEGVAELEKLLVSNRKIEVLLLGKKKKVLYTSLPSSNLNGWMD
FT                   ALERKAEKRQNRNIWMVGSDDYVVVNLPFKNDEKQRLILASPVRGLKDTRMEMTNNILL
FT                   IVLIGAVSTILLSFFITRSMVQPLHKLTREIKKIQARRFSEVQLIPARGEIAEVSNSVY
FT                   SMAQELDRFHEIQRQFLQNASHELKTPLMSIQGYAEGIRDGVFVDAAAEKGFDVIVEET
FT                   NRLKHIVTEIILLAKLEGEENLFDPSWHSATDLVTRTIERLHPLQLQHNVTISVRPTKT
FT                   NDVVYVDEGKFLQALLNIIGNALRHAKDQITIEIKSGKRQLQIEVQDDGEGIAEELLPH
FT                   LFHRFVKGKNGDVGLGLAISRAIIERSHGCLQAENGRLHGAIFRITLPLYPQPENSRTP
FT                   E"
FT   CDS_pept        complement(16055..16744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00090"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40986"
FT                   /db_xref="GOA:C0ZH45"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH45"
FT                   /protein_id="BAH40986.1"
FT                   /translation="MKIYHIAIVDDDINIRQIVEAYLQKEGYVTTAIESAEEAITLEQE
FT                   NPPDLWVLDIMLPGMNGYEFCRRIRAGSETPIIMVSARDEEVDKILGLELGSDDYLTKP
FT                   FSPRELVARVNRALQRWKQMKSHAEQTAISALVLDKEKRLVYSFGEEVEVTSKEFQVLS
FT                   LLSEHPNRAFSRDELLSLIWGFDYFGSDRVVDDLIRRIRKKLDKIPLETVWGFGYRLRT
FT                   LEGTKDE"
FT   CDS_pept        16902..17054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40987"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH46"
FT                   /protein_id="BAH40987.1"
FT                   /translation="MVILCKMKVHSITEGYTMRKLLQMIVITFGLLIDTKTMIRFSELE
FT                   MVVKL"
FT   CDS_pept        17306..19840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BBR47_00110"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40988"
FT                   /db_xref="GOA:C0ZH47"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH47"
FT                   /protein_id="BAH40988.1"
FT                   /translation="MAEETARFPKVDISHEMRESFISYAMSVIVSRALPDVRDGLKPVH
FT                   RRILYAMHDMGLTPDKPFRKSANVVGEVMANYHPHGDSSIYEAMVRMAQDFNMRYMLVE
FT                   GQGNFGSVDGDPAAAMRYTESRFSKLALELLRDIDKETVDFIPNYDGRKEEPVVLPSRF
FT                   PNLLLNGASGIAVGMATNIPPHNLTEVVDGVIAMIDNPDITIQDLMKIIKGPDFPTAGE
FT                   ILGYSGIRRAYETGRGSIIMRAKTQIEEDGKGKPRIIVTEIPYQVNKARLVEKIAELVR
FT                   EKKIEGITDLRDESDRKGMRIVMELRRDVIPKVVLNNLFKHTQMQSTFGVNMLALVDSR
FT                   PRVLNLRDMLYYYLEHQRVIIRRRTEYDLKQAEARAHILEGLRIALDHIDEIISLIRSS
FT                   QTTEEARTGLMENYSLSYEQAQAILDMRLQRLTGLEREKIENEYQELMVKIAELRAILA
FT                   DEAKIYAIIRDELGEIKEKFGDERRTEITFDENHIEDADLIPEEDVVITLTHDGYIKRL
FT                   PVSTYRSQKRGGRGVQGLGTKDDDFVEHLYITNSHDYIMFFTSKGKVYRLKGFEIPDLS
FT                   RTAKGTPIINLIQIEKGERVSAVIPVKEFDQEHYLFFATKKGIIKKTTLESYENIRKGG
FT                   LIAVNLREDDELIGVRLTDGQQQIIMGTHKGMSVRFNEGDVRTMGRNATGVKGITLDDD
FT                   DDVIDMDVIKPNAEVLIVTANGYGKRTPVDEYRIQSRGGKGIKTHNVTDRSGPVVGLKV
FT                   VEPEEDLMIITTSGIIIRTEMKGISVMGRYTQGVKLIRLSENEQVGSVAKCPPTEEEDM
FT                   TDEDAEEGIEDLQDGETVEATEPIEPTEPTEE"
FT   CDS_pept        20016..21098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40989"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH48"
FT                   /protein_id="BAH40989.1"
FT                   /translation="MEVKQLTLGAKLAEDVFTALGGILFAKGTPLYEREVQFLEAFMIK
FT                   QVQVEDSGGDLTDQGEPTSTKVDAPEASDKFTQAKPVFQESFDKAVSTLKNLMTRVQGG
FT                   NNIPVMEVREVVTPIITEFQQQPQVLLSLRRFAKMDSYAYEHAVAVGIISYMIAKWVKV
FT                   PEKEWMQVALAGTLLDIGKTKIDRRILQKPGKLTPDEFEEMKKHTVYGYQIIKSSHGLS
FT                   EGVALAALQHHEREDGSGYPLGLPGSKLHLYSKIVAVADVYHAMSSDRVHQKALSPYQV
FT                   VEQLVQDSFGKLDPTIVRSFVEGITQFAVGTLVELSDGTIGKIVFTDRNHPTRPMVETG
FT                   GKIVNLVEARHLSIVRVMEQ"
FT   rRNA            21496..23006
FT                   /locus_tag="BBR47_r0040"
FT                   /product="16S rRNA"
FT   rRNA            23073..23189
FT                   /locus_tag="BBR47_r0050"
FT                   /product="5S rRNA"
FT   rRNA            23305..26219
FT                   /locus_tag="BBR47_r0060"
FT                   /product="23S rRNA"
FT   CDS_pept        complement(26328..27341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="BBR47_00130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40990"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH49"
FT                   /protein_id="BAH40990.1"
FT                   /translation="MDNAWKTLRYFETEPTARKYLAACYHDMGAEHAERLAFQQSSRFL
FT                   YLWRQARHFYSTSAVADLSIQPLLLFYGCTHLLKAMLLTRDPYYPQNSRVLQHGVTTRK
FT                   LKRNAYILMEDEVRPQKEGFFAQLAHAFQLTPLQDRYSVHDLFSSIPSVSDSYGIATDK
FT                   PRNWLTLKIAHISQGDLVRITFPEKTDGPLSYSTETFIQYICRLSPSVCNLEKPSWANN
FT                   KNRKELTLPQCALSELDQHPLFRLHQNALFFWNGSASSLPLPEWASHYLLLYLLSMLCR
FT                   YETEWWGELTMSHGLVERYLVEHFLDNHMDTFPSIIRKQFYQNHRMPLPFFPSDPY"
FT   CDS_pept        27508..28968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BBR47_00140"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40991"
FT                   /db_xref="GOA:C0ZH50"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH50"
FT                   /protein_id="BAH40991.1"
FT                   /translation="MREDKFVKEGLTFDDVLLIPGKSEVLPRDVDLRVQLSENVKLNIP
FT                   LISAGMDTVTESGLAIAMARQGGIGIVHKNMTIEQQASEVDRVKRSESGVITNPFSLTQ
FT                   EHTVEEANALMGKYRISGVPIVDANQKLIGILTNRDLRFVHDFSIKIKEVMTKENLVTA
FT                   PVGTTLQQAELILQQHKIEKLPLVDENNTLRGLITIKDIEKAIQYPNAAKDNQGRLLCG
FT                   AAVGVSADTFERAAALVQAGVDVLVIDTAHGHSKGVIETVKAVRKEYPTLTIVAGNVAT
FT                   GEATRDLIEAGASVVKVGIGPGSICTTRVVAGIGVPQITAIHDCAQVAREYNIPIIADG
FT                   GIKYSGDLPKAIGAGASVIMIGSLFAGTEESPGEFEIFQGRRFKVYRGMGSIGAMKAGS
FT                   KDRYFQENAQKLVPEGIEGRVPYKGPLADVTYQLIGGLRAGMGYCGAKTIEDLIQNSQF
FT                   VRITGAGLRESHPHDVQITKESPNYSIS"
FT   CDS_pept        29156..30472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BBR47_00150"
FT                   /product="D-alanyl-D-alanine carboxypeptidase precursor"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40992"
FT                   /db_xref="GOA:C0ZH51"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH51"
FT                   /protein_id="BAH40992.1"
FT                   /translation="MKRKTWTKRLTGLFLSVAVFATAMGGMVSKVEAAPVASQANLQLE
FT                   AKSAILVEASTGKVLYSKDPDVALPPASMSKMMTEYLVHDAIKQKKMKWDDVVPVSEYA
FT                   FYIAKISDSSGVYLNLGESFTVKQLYEAMAIVSANDATVLLAEHIAGSEAAFVELMNKK
FT                   AAELGMKNTSFVTSTGLPADELGPYSVQTDQKENLMSARDSAILARALIHDFPDALETS
FT                   KKPIFTFRTGTPNEWTKKNYNWMLPSLISYYPGVDGLKTGHTDAAGFCFTGTAVRDNMR
FT                   LISVVMKASTESKRFAETRKLFDYGFGNFKLTKQMDKNVPVKGFETAPVKNGVEVTVPV
FT                   VTGSEVNMITKTGTEAKYTPTVTFQELTAPIQQGQVVGKIVLKEEGMKESDYLQPEDAA
FT                   KAGVDIVAGQAVEEASWIRLFFRSIIEFFSNLFSSGTGN"
FT   CDS_pept        30579..31463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="BBR47_00160"
FT                   /product="pyridoxal biosynthesis lyase PdxS"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40993"
FT                   /db_xref="GOA:C0ZH52"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH52"
FT                   /protein_id="BAH40993.1"
FT                   /translation="MVQVGTSRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPSDIRAAGGVARMADLSIVEEVLNAVSIPVMAKARIGHFVEARVLESLGVDYLDES
FT                   EVLTPADDLYHINKKEFTVPFVCGARDLGEALRRIGEGASMIRTKGEPGTGNIVEAVRH
FT                   MRTMMSQIRKVQAMSYDELMAEAKNLGAPYELLEEVHKTGKLPVVNFAAGGVATPADAA
FT                   LMMQLGSDGVFVGSGIFKSENPEKFARAIVEATTHYTDYELIARVSKGLGTAMPGIEIS
FT                   KIREADRMQERGW"
FT   CDS_pept        31474..32049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BBR47_00170"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40994"
FT                   /db_xref="GOA:C0ZH53"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZH53"
FT                   /protein_id="BAH40994.1"
FT                   /translation="MKIGVLALQGAVAEHLRMLEEVGATAVPVKRVEELDDLDGLVIPG
FT                   GESTTISKLMHKYGFMEAVQEFGKANKPIFGTCAGAILLAKRIQGQDDYHLGLMDIKVE
FT                   RNAFGRQKESFEVLMPVADVGADYPAVFIRAPYIMEVGENGQVLAKHEDKIVVARSGHY
FT                   LAAAFHPELTEDTRLHKYFLDMVKEYRS"
FT   CDS_pept        32457..33737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BBR47_00180"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40995"
FT                   /db_xref="GOA:C0ZH54"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZH54"
FT                   /protein_id="BAH40995.1"
FT                   /translation="MLDVKVLRQDLEEVKRRLAHRNEDISALDQFVEVDEKRREVIQEA
FT                   EALKNKRNTVSEQVAVMKRNKENADHLIAEMKEVNERIKALDEELRQLDEQLEFILLSL
FT                   PNLPHESTPIGTTEDDNVIAWTWGEPRAFDFEIKPHWELASQAGILDFETAAKVTGSRF
FT                   VFYKGLGARLERALMNFMMDLHSNEHGYEEVIPPFIVNRTSMTGTGQLPKFEEDAFKIE
FT                   GPDYFLIPTAEVPVTNMHRDEIMDGADLPRYYTAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEESYDELDKLVKNAEKVLQLLGLPYRVLSMCTGDLGFTAAKKFDIEVW
FT                   IPSGDTYREISSCSNFEDFQARRANIRFRRDTKSKPEFVHTLNGSGLAIGRTVAAILEN
FT                   YQEADGAIVIPEVLRPYMGGVDKIAPK"
FT   CDS_pept        34158..35765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceB"
FT                   /locus_tag="BBR47_00190"
FT                   /product="malate synthase"
FT                   /EC_number="2.3.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40996"
FT                   /db_xref="GOA:C0ZH55"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH55"
FT                   /protein_id="BAH40996.1"
FT                   /translation="MTTVPTNPYPLEVQISGEMHPGYQEILTPEAIQFVMKLEQRFGDR
FT                   RQQLLAKRVERQLQIDAGQLPDFLQETADIRKGDWTVAPLPKDLQDRRVEITGPSGDRK
FT                   MVINALNSGARLFMADFEDANSPTWENTIQGQINMKDAVRRNISYISPEGKSYTLNEKT
FT                   AVLIVRPRGWHLEEKHILLDQKPISGSLLDFGLYFYHNVDALIANQTAPYFYLPKLESH
FT                   LEARLWNDVFLFAQDELNIPRGTIRATVLIETILAAFEMDEILYELREHSAGLNCGRWD
FT                   YIFSYIKKLRNQPDVITPDRAQVTMTVPFMKAYTTLAVKTCHKRMAPCIGGMAAQIPVK
FT                   NDPVQNAEAIAKVRADKEREAYDGHDGTWVAHPGLVPVAMEVFDRLMREPNQIWYKRED
FT                   VDVSASHLLAVPEGTITEAGVRTNISVGLQYIEAWLRGSGAVPINNLMEDAATAEISRA
FT                   QVWQWMRHRHGVLQDGRKVTEGLVKQWLSEELQAIKQAIGQERYDNSKYTIAGDLFLQL
FT                   VTTEDFEDFLTVPGYRYL"
FT   CDS_pept        35792..37081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="BBR47_00200"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40997"
FT                   /db_xref="GOA:C0ZH56"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH56"
FT                   /protein_id="BAH40997.1"
FT                   /translation="MTKVNKQGAIQQVEQSWQGERFEGITRPYTAEDVVRLRGSVQIEH
FT                   TLARLGAERLWELLHTEHHIKALGALTGNQAIQQVKAGLKAIYLSGWQVAADANLSGQM
FT                   YPDQSLYPANSVPQVVKRINQALQRADQIDQSEGGTDTHWFAPIVADAEAGFGGPLNVF
FT                   ELMKGMIEAGAAGVHFEDQLASEKKCGHMGGKVLIPTQAAVRNLISARFAADVMGVPTI
FT                   IVARTDANGAFLITSDIDEQDKPFLTGERTAEGFFRLRGGLDAAIARGLAYAPYADLIW
FT                   CETSEPNLEEARRFAEAIHAKYPGKLLAYNCSPSFNWKKKLDEQTIARFQEEIGEMGYK
FT                   FQFVTLAGFHSLNYSMFELARGYRDRGMAAYSELQQSEFDSEVHGYTATRHQREVGTGY
FT                   FDEIAQVISGGNSSTTALSGSTEEEQFAHN"
FT   CDS_pept        37273..38370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40998"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH57"
FT                   /protein_id="BAH40998.1"
FT                   /translation="MRGNQLSWKRTVVVMTSVFLLAGCATETKSGTSLDTSQLTLDQIV
FT                   EKAKQEGEVNSVGMPDTWANWGETWSNLGKEYGLKHTDTDMSSAEELAKFEAEKEDATA
FT                   DIGDVGIAFGPLAKQKGLTLPYKTSYWNDIPDWAKDDEGHWLLGYTGTLAFITDKTKVQ
FT                   NPPKSWADLKNGSYKVAIGDVMKANQAQFAVLAAAYANGGDEKNIQPGIDFFAELAKNK
FT                   RLSTSDPSLANLEKGEVEVAILWDFNALGYRDKIDKNRFDVLIPEEASVSSGYATVINK
FT                   YAKHPHAAMLAREYILSDAGQSNLARGYARPIRANAKLDESAKAMLLPDDMYKNARPVG
FT                   DLTAWEETAKKLPQLWQEKVLIHVR"
FT   CDS_pept        38360..39169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH40999"
FT                   /db_xref="GOA:C0ZH58"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH58"
FT                   /protein_id="BAH40999.1"
FT                   /translation="MCASKLAMIVLDGLRFDTAVSHMGYLHHLVEYGIAARFQVRSELP
FT                   SLSRPLYEVLLTGTPVWKNGISSNQTVRLSHQESLFHLTRKNGMSNAAAAYGWVSELYN
FT                   KAPFNPFHDRIQLNSDKPIQNGMFYWEDHYPDTHLFADANFLLNGYNPDFLYVHSMNID
FT                   DDGHKHTADSAQYRNRVLAADSILANVLPAWIDAGYQIIVTADHGMTADGNHGGTSSAD
FT                   RDVPLFVISNLISPGIREEAIPQLQVAPLACHLLGISPSKEMQPLNV"
FT   CDS_pept        39230..40075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00230"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41000"
FT                   /db_xref="GOA:C0ZH59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH59"
FT                   /protein_id="BAH41000.1"
FT                   /translation="MKRFVSMFWVTTIPFFAMIALFLLVPLLSMIGGSFQAEGGGGFTI
FT                   SNYREIFSNPYYLQAFENSVLISFLSALIGIVVAVFATYAITRFPQALQQRVLVITNLT
FT                   SNFAGIPLAFAFIVLLGNSGLFVLLAKQLGIDFGQSFTLYSWSGLTLVYIYFQLPLAVM
FT                   LLYPLYNAIQKQWMEAAELLGASPWEFWLRIGFPVLLPGIVGTFSILFANAMGAYASAY
FT                   ALTGSNYNLVPIRIGALVSGDIFARPELGSALAVLLGLTLAAALIVNEWLTRKIRRDLS
FT                   "
FT   CDS_pept        40072..40860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00240"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41001"
FT                   /db_xref="GOA:C0ZH60"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH60"
FT                   /protein_id="BAH41001.1"
FT                   /translation="MKRISLPSLSFALVMLYLFLPVAATILYSLATEWNSTVLPEGLTG
FT                   KWFAELYADPRFLQAFGRSFLLSFLTTVVAVVIIVPAVFSIIVYAPRMERLVQILVMLT
FT                   YAVPGVIMAVGLIRTYSGNGIPMVIITAGAYLVGLLPYLYQGTRNSLLAMQARSLMEAA
FT                   ELLGASHWQAFVRIIVPNIMSGIFVSSLLSFSILFGEFVLINILVGGRYETLQMYLYAK
FT                   LSSSGHVASAITVTYFVLMAIITGLVVKFTRRSFARKEVP"
FT   CDS_pept        40860..41879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00250"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41002"
FT                   /db_xref="GOA:C0ZH61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH61"
FT                   /protein_id="BAH41002.1"
FT                   /translation="MSYVQIKNLSKTFHGQHVLQQLDLAIEKGELVTLLGPSGCGKSTL
FT                   LRILSGLTAPDTGMIYIDGKDVTDVSPKNRQIGMVFQSYALFPNLTVSQNIAFGLEMNK
FT                   ISKTEIRLRVQEMIELVGLVGKEQAYPRELSGGQQQRVALARSLVTRPKVLLLDEPLSA
FT                   LDAQIRKNLQKQLRTIQRELNMTTVLVTHDQEEAMAVSDRIYIMNGGRIVQHGSPQEIY
FT                   TQPHSEFVARFIGNYNVLTAEQLTRIMPKLSHPAVERFAIRPETFREQPLNGEDICLTG
FT                   NIAQVTMLGNITRYELNIGDVPVLVDTLHLSFEQEQIGTTKTLYVSPKDVIPLYDTIA"
FT   CDS_pept        41863..42663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00260"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41003"
FT                   /db_xref="GOA:C0ZH62"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH62"
FT                   /protein_id="BAH41003.1"
FT                   /translation="MTLLPEERQQVILAELNRHGKIQVMSLAKTLAVTPETIRRDLDQL
FT                   EQQRLLKRVYGGAIPYHLAKREPHFEKKQAIQQTAKTKIGQIAAELLSDGDTIALDVGT
FT                   TTLELARAIKGLNQLTIVTNSLPAASLLNELLEANQFNGQVIMLGGLTHPAQKSVAGAF
FT                   TCELLSRFHFDKAFISCGGITADGFTDYDMEETLCSTMMVQRSEQVYVLGDTSKIGQTQ
FT                   FFHICGWQDVSAVVCDQPMPDEWLSSGMQTTWISEHPGRRDFTC"
FT   CDS_pept        42657..43661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisK"
FT                   /locus_tag="BBR47_00270"
FT                   /product="putative histidinol-phosphatase"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41004"
FT                   /db_xref="GOA:C0ZH63"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH63"
FT                   /protein_id="BAH41004.1"
FT                   /translation="MLIDYHLHLEEGPFSLRWLDRTNMALDHFYPLTEPRHTRAWLLDS
FT                   LARLNNRMSLGAYDPSWIDLYLREALNKGLKEVGIVDHLYRFREARPYFERYMELGDTE
FT                   LGRLQRTWLNQVCTESLSDFCVAIEEAKQRWSASGVELRLGLEADYFIGGEAELESLLA
FT                   GASWDYVIGSVHFLQGWGFDNPETRHLFEQHDLKQLYTDFFHTVESMIRSNLFDFVAHL
FT                   DNLKVFSYRPEESELVPYYHRIATALKETDTATEINAGLYYRYPVQEMCPSPAFLDVLV
FT                   AHGVPLTLSSDAHFPDDIGRYVAVNLEILDSMGVTEIATFFGRQRIMRPICYA"
FT   tRNA            43838..43914
FT                   /locus_tag="BBR47_t0240"
FT                   /product="tRNA-Arg"
FT   CDS_pept        44079..44585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41005"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH64"
FT                   /protein_id="BAH41005.1"
FT                   /translation="MVLAIFFSGCSSDAVVQNQTAAPPAKEAANTGTEQKQSVDSTTSY
FT                   DKIAGYLQEESNKAFSPYYELLEFTLSDYEEKTVDGKVEATFGYQVKYKNFDKDPDTVD
FT                   YIKAAKEKNDPNYKQLYDEYLQPKDMNFHLKAVMEDVDSITLYTNVSPKGIQWEKAVMS
FT                   DFIIK"
FT   CDS_pept        complement(44619..45140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41006"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH65"
FT                   /protein_id="BAH41006.1"
FT                   /translation="MLLRFTFVGKLFYHTQKIQTIHPVIKEREDLLMTTIYDKAKYHYE
FT                   NFEEDLPRKQAYVHTGFFIGWLIDNDMVSEDFQKSYENLIAEFKQRKMTGPEVYEKTGG
FT                   VLAKDMLNEEGNQFAMFYFDFETGEYRYHYLEAFDCEPSVYHVEDTWENYDHIKDWIDN
FT                   EYEYWCEKNK"
FT   CDS_pept        45146..45553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41007"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH66"
FT                   /protein_id="BAH41007.1"
FT                   /translation="MQNDKRIKFINPETMPPTFGYTHAVEVRNARTIYVSGQVALNKEG
FT                   QVVGIGDLAAQTKQVFENIQFALEAAGVSFDHVVKLTFFVTDISKMHIVREIRDQYVNT
FT                   ETPPASSAVEVSKLIREELLIEIEAIAVADM"
FT   CDS_pept        45657..46838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="BBR47_00310"
FT                   /product="probable pyrimidine nucleoside transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41008"
FT                   /db_xref="GOA:C0ZH67"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH67"
FT                   /protein_id="BAH41008.1"
FT                   /translation="MNYIIAGIGLITIFLLAWLASSDKKHIRYRPILIMILIQIVLGLL
FT                   LLRTSIGLILISGIANSFSTLLKYAYEGINFVFGGIANPGATPFFLQVLLPIVFISALI
FT                   GILQYTRILPLFIQYVGLVLSKVNGMGKLESYNAIASAIVGQSEVFITVKKQLGAIPEN
FT                   RLYTLCASAMSTVSMSIVGSFMTMVKPEYVVAALVLNLFGGFIIASIITPYEVEPEDDL
FT                   LDQERGEKQAFFEMLGEYILDGFKVAVVVAAMLLGFIALIAMVNGLFSAVFGISFQALL
FT                   GYVFAPLAFLMGVPWHEAVQAGSIMATKIVANEFVAILEFTKIQSQLSERTIAIVSVFL
FT                   ISFANFGSIGTIVGAVKGLNERQGNVVARFGLRLLYGATLVSILSGIIISVVV"
FT   CDS_pept        complement(46909..47085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41009"
FT                   /db_xref="GOA:C0ZH68"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH68"
FT                   /protein_id="BAH41009.1"
FT                   /translation="MPLWLLVVLIFGGLLLIGAIIDWIAKRRKQRVLIERNNRDSHSFD
FT                   EGYDPRNKDEYLN"
FT   CDS_pept        47180..47788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41010"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH69"
FT                   /protein_id="BAH41010.1"
FT                   /translation="MRKWVCMTVMAGLIVGGCSSETSVPTDSKQQPVAEQKQETGNASG
FT                   DQKQENQSTTEGQIILDDQFLKLLAKNEISGFDIHIGMKRDEVSALYGKVTKQDYWDGG
FT                   RYEVFEKLKSALIYFDGQDRVYGIDLAGLHLNETNLDTIRKNLGAPVSEEKSMADQDYV
FT                   MFFEAGDNSVFISAKDEQSPADKIRVINKKMIEESPQKE"
FT   CDS_pept        complement(47856..48266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00340"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41011"
FT                   /db_xref="GOA:C0ZH70"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH70"
FT                   /protein_id="BAH41011.1"
FT                   /translation="MSNRFEWSTLILRVIAGLTFAIHGVAKFQMGLENVAGFFGTMGLP
FT                   AFIAYLVAFLEVVGGIALILGLGTRVFAGALSVVMLGAIFKAKLAAGFMGGEGGAGYEL
FT                   DLALLAMLVALGISGSTKFALDAILFGKRSVE"
FT   CDS_pept        48464..48811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41012"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH71"
FT                   /protein_id="BAH41012.1"
FT                   /translation="MKQSTLCPKFEKGMQLLGKRWTGLILFQLLSGPQRFCALEGALPV
FT                   SGRLLSERLKDLEKEGLVHRQVFTDSAPVRVEYSLTEMGKALTPVLKGIESWSQSWIEL
FT                   NADEMANDSEE"
FT   CDS_pept        complement(48911..49309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00360"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41013"
FT                   /db_xref="GOA:C0ZH72"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH72"
FT                   /protein_id="BAH41013.1"
FT                   /translation="MLEWNCQNDRGGFTMSIVGQRIKWLREQKQWSQLQLAEKLGIHNT
FT                   VLSRIESGEKKGVDAHLISKVADLFEVSTDFLHGRTEEPSWQRGSVRETPATFLDVDGL
FT                   TEKDLIEVKRHIEFLKWKALQEKNENPS"
FT   CDS_pept        49434..49646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00370"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41014"
FT                   /db_xref="GOA:C0ZH73"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH73"
FT                   /protein_id="BAH41014.1"
FT                   /translation="MERLNLPFIAQRRNECKLTLQEMAEALGFRNASTYLKYEKGEYDF
FT                   KANHLPVLAKKLRCSMLDLFIRMVC"
FT   CDS_pept        complement(49940..51379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00380"
FT                   /product="PTS system IIBC component"
FT                   /EC_number="2.7.1.191"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41015"
FT                   /db_xref="GOA:C0ZH74"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH74"
FT                   /protein_id="BAH41015.1"
FT                   /translation="MLAFLQKIGRALMLPVATLPAAAILQSFGLLKFEKDLNLGAFGAF
FT                   MDTYIAPLLAAGGSAIFDNLALIFAIGVAIGLAGDAVAALAAVIAYVVLTKVLAAVPAA
FT                   MPFIADDVKLNMGVIGGILAGAIAAFFYNRYHSIKLPEWLGFFGGKRFVPIVTSLSMVV
FT                   VGLIFGIIWGPIQIALDSLGSWIVGLGATGSFFFGFFNRLLVPFGLHHVLNAIAWFQIG
FT                   DFTDATGKVVHGDLHRFFAGDPSAGMFMTGFYPIMMFALPGAAFAIIHSARPEKRKVVA
FT                   SMFIGAALASFLTGITEVVEFAFMFAAPLLYFVHAILTGVSGYIVTSLGIKHGFGFSAG
FT                   LIDYGINYHLSTNAWMIIPIGLAFAVIYYALFRFLIVKLNLKTPGREDDEEMTTTATGR
FT                   NNSMQDKAIQVLTHIGGKENVVSVDACITRLRLILKDDKKVNDKALKDLGAAGVMRLGQ
FT                   GSVQVVFGTHSELLKEEISKL"
FT   CDS_pept        complement(51532..53244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00390"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41016"
FT                   /db_xref="GOA:C0ZH75"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH75"
FT                   /protein_id="BAH41016.1"
FT                   /translation="MLKGIPVSAGISIAPVLRLTHETAITQAESITPVDTTQELGLLSK
FT                   SVEQAREQLEKLKEQTEEQLGSEKAAILSAHIAFLDDPAFVGEMSALIENQQLAASTAV
FT                   SQVADQFIALFESMDDAYMKERADDIRDVSRRLIRNISGGDTVISYPEEPFILVAWDVT
FT                   PSETLQLPLQHVRGIVTAKGGATSHAAILARSLGIPAVMGAGDALMEKVDSGSLLIIDG
FT                   TSGQLIVSPDTGTLATYQEKAAQEEKERQLYEAIKELPAETTDGHCVHLMANMAVPEES
FT                   DALIESGVEGIGLFRSEFLFMDRSTLPDEAEQFAAYKHVAAAFGDKPVIIRTLDVGGDK
FT                   HLPALALPQEENPFLGFRAMRISLARPELFLVQLRALLRASAFGRLLIMFPMISHMEQL
FT                   REAKRLLEQAKAELRAEGIAFDENIAVGMMMEIPGACLQADVFAKEVDFFSIGTNDLVQ
FT                   YTLAVDRMNANIAELYSYYHPAVLRLISQVIEASHRAGIWTGLCGEMAGDPLATKLLLG
FT                   LGLDEFSGAASVMPKVKERIRSTSLEEAKRLAEHVLTLSTVDEVVQYLKDRAL"
FT   CDS_pept        complement(53276..53542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00400"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41017"
FT                   /db_xref="GOA:C0ZH76"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH76"
FT                   /protein_id="BAH41017.1"
FT                   /translation="MVQFEVTVNVEGGLHARPAALLVNCSSQSQSKITLSKGTKHADGK
FT                   SILGIMTLGVSQGDTLTVQIDGADEQNVATAIQQLLEQSSSNI"
FT   CDS_pept        complement(53572..54069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00410"
FT                   /product="PTS system IIA component"
FT                   /EC_number="2.7.1.191"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41018"
FT                   /db_xref="GOA:C0ZH77"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH77"
FT                   /protein_id="BAH41018.1"
FT                   /translation="MLRGLFSRKKQQQEVTFLAPLTGTVLPLSEVPDPVFAGKVVGDGV
FT                   AILPSADTLVSPVDGKVTHLFPTHHAIGLSTESGLEILMHIGIDTVKLNGKGFTPFVSV
FT                   GDQVKAGDKLIQFDKSVLEDAGCPIVTPIVITNGDRVAEKNVVAKATVQAGQEPLMTVV
FT                   LK"
FT   CDS_pept        complement(54199..55056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00420"
FT                   /product="probable transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41019"
FT                   /db_xref="GOA:C0ZH78"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH78"
FT                   /protein_id="BAH41019.1"
FT                   /translation="MSREKEKTYAITRVLNHNVVLVEEPGSGQEIVLFGKGIGFGAKPG
FT                   NTIPAHDLRVEKRFRLENESHQKQYQNILSQVDPAVVGIAEEIIALIASEITPELNEHV
FT                   HVALPDHIQFAIYRLNNGMEIVNPFLFEIQTLYTKEYALANRAADMIKNAFDLDIPDSE
FT                   IGFLALHIHSAISYVPVKKAVQFTNIITELVSLIEEQTAITIERSTIDYVRLITHLRFA
FT                   VERIRQQKFIKNPLLDRVKTTMPEAYQLATELAQYISTRLEIAVPEDEVGYMALHLYRL
FT                   LQQN"
FT   CDS_pept        complement(55424..55921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41020"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH79"
FT                   /protein_id="BAH41020.1"
FT                   /translation="MGLTSANTLFDRFHSPTRGLLAKEEVFSHIEHTISSIGGPFEIIV
FT                   GADSQLKSRGTFFALVITVIRPGHGGTFFYHKFQERRYSSLQQRIFQEAMYAVGLATEV
FT                   RQYLRDRHLDTPIRLHFDIGTNGPTRKFIQSLLSLAETNHFRAEIKPNSFCASTIADKY
FT                   TK"
FT   CDS_pept        56107..56589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00440"
FT                   /product="putative tRNA specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41021"
FT                   /db_xref="GOA:C0ZH80"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH80"
FT                   /protein_id="BAH41021.1"
FT                   /translation="MIQENEHDYYMKQAMEEARKAAAIGEVPIGAVIVRDGEIVGRGYN
FT                   LRETQKDPTLHAELIAIREASERLGGWRLIGCTLYVTLEPCPMCAGAIVQSRIEKVVYG
FT                   ARDPKAGCAGTLMNLLAEPRFNHQVPVIEGVLAEECGQMLKEFFRGLRKKRQPVQE"
FT   CDS_pept        complement(56628..57347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00450"
FT                   /product="pseudouridine synthase"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41022"
FT                   /db_xref="GOA:C0ZH81"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH81"
FT                   /protein_id="BAH41022.1"
FT                   /translation="MKRERLDKVLANMAIGTRKEVKALVKQRLIVVDGVVATDPGMHVI
FT                   AEEQEILVDGEPLNFKRWVYVLLNKPPGVVSATEDNVHETVVDLLPYEWAIKVHPVGRL
FT                   DIDTEGLLLLTNDGHLSHSLLSPKKKVDKEYFARIEGRVTERHVQEFAKGVELEDFTTL
FT                   PAKLEIISSGETSEIRVTIMEGKFHQVKRMFAAFDLHVVYLQRIRMGPLHLDPSLAPGE
FT                   YRELTEEELHMLQNVNK"
FT   tRNA            57507..57595
FT                   /locus_tag="BBR47_t0250"
FT                   /product="tRNA-Ser"
FT   CDS_pept        57820..59568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00460"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41023"
FT                   /db_xref="GOA:C0ZH82"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH82"
FT                   /protein_id="BAH41023.1"
FT                   /translation="MSGKLGNTMGRTGLSLRTKLLAGFLTVVALLAFVSVFALSQIKGV
FT                   TTISGDINKSWMPAVTLLGTMNGDISDVERLALDIIVEQNEEELTKQKKVLDQLLVKIE
FT                   DERKQLKTLVYASNKEGSEAANLFEEFNSKYDAYLEKMPEFVKLGRENKYDEASKLHSV
FT                   AYPLWYEANDNIKNLIDIYSEGAGQVSQSASELSQQAFVIILVSTSVAAVIALLIAFFM
FT                   SHIISKPVQKMNQAAVRIASGDLTGETIVLRNKDELGTLAASFNTMTANLRTMIESVAT
FT                   TSEQVAASSEELLASAEQNAQASEQISQTVEELAVGTSEQVNIVKNSSQAMGEMALSSE
FT                   QIAQLAQSVSVSAVDAAKQSEEGNMIIKSAVEQMSAVRNSITSLSELVMGLGERSAEIG
FT                   TITEVINNLASQTNLLALNAAIEAARAGEHGRGFAVVAEEVRKLAEESSLSAQRITDLV
FT                   QLIQNDTRQAVEAVKMNSDETRSGMEIVTAAGQAFENISNAVNKVASEIQEVSAGAEQM
FT                   AASADEVVNYVEQISAIAEEASSGVHNVSAATEQQQASTEEIASSADSLSKMAEELQEQ
FT                   INKFKV"
FT   CDS_pept        59905..60435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00470"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41024"
FT                   /db_xref="GOA:C0ZH83"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH83"
FT                   /protein_id="BAH41024.1"
FT                   /translation="MDSDDRIERWFQQYGHDIYNYLAYFTGRRDVEDLVQEVFTKALRA
FT                   LSGYEGRAQPKTWLLTIARHTAIDNRRKQKMMDWFPENVLRLLTSKERTPEKALVLKEQ
FT                   LQEVYEAMNHLKSTYREVLILRLIEGVSTAETAEILGWSEAKVSTTLHRAIKELQKQIG
FT                   NSGREVNLHDAIF"
FT   CDS_pept        60419..61726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41025"
FT                   /db_xref="GOA:C0ZH84"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH84"
FT                   /protein_id="BAH41025.1"
FT                   /translation="MTPSFEEKEISTVLQAFPSLQMDEDKRREIAGHIRRERELLEQMK
FT                   KRKKYAKVIGGAVASLASLALLFIAYQWMPSEAVPSAQQMNTEGSQKVQAAGTTSQADK
FT                   VLTLDSQIQDYIEEAIHKTNKAYQPENMTVIVTDPNNGEILGMGNLKRPTDRVPHIVRA
FT                   MSDPVVAFPIVTLAAAIEEGKYKNYETYESGTYEITPGKFIKDHNVGKGWGQIAYLEGI
FT                   QRSSQVAFAKLSERIPEDSLQQYFERFGFGAKTGTEQLNEQSGKIPNMDTPYDKAMAAY
FT                   GLGGSASPIQQVAAVGAIANGGELMKPHVTREETNHIDKGRRVISVETAKQVRAILETL
FT                   VNNKPGSDTAFSIKEHTVAGRTGIVQKRDQQGNFIDGKYTYSFIGFAPSDDPKLLVYIA
FT                   VDNPNTDLWVRLWGQEIVAPPFKEIMENSLQYLQKR"
FT   CDS_pept        complement(61808..62236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41026"
FT                   /db_xref="InterPro:IPR025454"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH85"
FT                   /protein_id="BAH41026.1"
FT                   /translation="MKLADRMKEKNTKTTELSIWGPYLREEWEKHFASHLTEEDKERIF
FT                   LKNKDGYQGYLWHLFSYKLRDCLEREEADEAFQQVAHESYYVFYQLANEVLILENAARF
FT                   SVADLEKEYDVYIVDKDFTWTYVKTHETEWCGPYFCKK"
FT   CDS_pept        62412..62993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41027"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH86"
FT                   /protein_id="BAH41027.1"
FT                   /translation="MSVQSNFSADKTLDCKGLACPMPVVRTKKAMEEMLPGQVMEVQAT
FT                   DKGSLADLKSWANNTGHEYLGSIQEGEVWKHFLRKASTHEVKEETNFLRTISNEELQKK
FT                   LEANEKLTLIDVREQAEYAFHRIPVAISIPLGVLEQRLDELQLDDDIYMICRSGKRSDM
FT                   ACQLLAKKGFTKITNVLPGMSGWNGPVEKQ"
FT   CDS_pept        63007..64158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrkH"
FT                   /locus_tag="BBR47_00510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41028"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH87"
FT                   /protein_id="BAH41028.1"
FT                   /translation="MMEQQTSVKVMTAHELTQLLFAQEELFILDVRNTSDYENWRIEGH
FT                   RVVSMNIPYFDLLDGVESVLEKIPVHQKVLVVCAKEGSSIFVAEMLAEAGFTDVSYLQG
FT                   GMKAWSDHLEPVKVGELRDGGAIYQFVRIGKGCLSYMIVSGGEAAVVDTLRMTDVYEAF
FT                   AAKHQWTIKHTIDTHLHADHISGGKKLAERLDASYWLPEKDAEEVTYFYRKLEEGQEIQ
FT                   VGATKIAILPIYSPGHTIGSTSLLVDDTYFLTGDSLFVASIGRPDLAGKAEDWVGDLHN
FT                   TLYNRYKELPEHLVVLPAHFGSYTEIGPMGVVSARLGDLYRNNPGLTIADESEFRHIVT
FT                   HHLPPQPNAYQEIRQVNMGKLKPSEEEQQEMEVGPNRCAIHDK"
FT   CDS_pept        64221..64445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrkI"
FT                   /locus_tag="BBR47_00520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41029"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH88"
FT                   /protein_id="BAH41029.1"
FT                   /translation="MADMVVDTKGLACPMPIVKAKKAMDGMQSGQTMEVLSTDKGSLND
FT                   FTAWVKQTGNELVSHEVENGVYKFLVKKL"
FT   CDS_pept        64786..65574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00530"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41030"
FT                   /db_xref="GOA:C0ZH89"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH89"
FT                   /protein_id="BAH41030.1"
FT                   /translation="MDVLQLLLMVSIGFVGSFFSGLLGIGGAIISYPMLLFIPPALGVA
FT                   QFSAQEVSVISMFQVFFASLSGVLAFRKRNGKNSPLIHKGLVRDMGVSILAGSLIGAAL
FT                   SRYLANESINLVYGILAIIAVILMLVKNRGTEAAAGEVAYNRFIAAGAAFVVGIVSGIV
FT                   GAGGAFILIPIMLTVLKIPTRVTIASSLAIVFISAIGGVIGKLSGGQIPLLPVLYTVIG
FT                   SVLGAPVGSMVSAKSDVKYLRYGLIVLICATAIKIWSDIL"
FT   CDS_pept        65659..66141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrkE"
FT                   /locus_tag="BBR47_00540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41031"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH90"
FT                   /protein_id="BAH41031.1"
FT                   /translation="MEKQKEKTTIVLFSGDLDKAIAAFIIANGAAAYDHDVTIFFTFWG
FT                   LNTMRKDEIVKVEKGWLEKAFGWMMPRGAKKLGLSKMNMMGMGPEMIKHVMKKHNALTL
FT                   PQLIELAQEQGVKLVACTMTMDLLGLKQEELLDGMEYAGVAAYLGDATQAKVNLFI"
FT   CDS_pept        66257..66523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41032"
FT                   /db_xref="GOA:C0ZH91"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH91"
FT                   /protein_id="BAH41032.1"
FT                   /translation="MDYNYSDDIKRRLKRIEGQVRGVLKMMDEQKNCKDVVAQLSAVRN
FT                   ASDKAIAQIVAENLQRCLLEEQAAGGDTSKLVKEAVELLVKSR"
FT   CDS_pept        66548..66937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41033"
FT                   /db_xref="GOA:C0ZH92"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH92"
FT                   /protein_id="BAH41033.1"
FT                   /translation="MSFTTILLLFAYAVIIWYLISRFLPVKGLENLKSDQFKERVNQKS
FT                   RVLLIDVREPHEYKAGHIPSAVNIPLSALDQRAKEISSKNDILLYCRSGMRSKRAAKIL
FT                   KKHGVSQMAHLQGGFITWSGPKKKK"
FT   CDS_pept        67127..67759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywnB"
FT                   /locus_tag="BBR47_00570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41034"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH93"
FT                   /protein_id="BAH41034.1"
FT                   /translation="MKIAIVAASGKAGKVIMKEALDRGHQVTAIVRDASKIEQKDVAVI
FT                   QKDVFDLTAADLNGFDVVVNAFGAPAGQEHLHVESGKALIEALKGAPSTRLLVVGGAGS
FT                   LFVDEAKTLRLVETPDFPKAYLATAQKHGEYLRVLEESNGIQWTYISPSAFFDAAGERT
FT                   GAYRLGKDHLLVNANGQSYVSYADYAVAMLDEIENPKHQNERFTVGS"
FT   CDS_pept        complement(67841..68149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41035"
FT                   /db_xref="GOA:C0ZH94"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH94"
FT                   /protein_id="BAH41035.1"
FT                   /translation="MDYRGVKVITHASTFFAPILVPILVWLLVQNRDAKNMALQALFFH
FT                   IIMTVLIAISWFFTFLLIGIPFLIVFGLMAIYYPIKGILYSLNGRPFSYPFVGGIGR"
FT   CDS_pept        68388..68987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41036"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH95"
FT                   /protein_id="BAH41036.1"
FT                   /translation="MMIDCHHPSSMKDRMMFFYNFLRSPGQVGSITPSSRALCKQMVAP
FT                   IDWEQAHTIVELGAGTGIFTKWIEQKKKPEAVLVSFEKETKMRMRLEPQFPDVRFHEDA
FT                   VDLNRVLTDAGLGKADCILSGLPFANFPQELRDQIMDQVYHALKPGGVFVAFQYSLQMK
FT                   KQLSSVFEQVSVKMVPLNLPPAFVYICRKDDGKGVG"
FT   CDS_pept        69000..69659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00600"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41037"
FT                   /db_xref="GOA:C0ZH96"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH96"
FT                   /protein_id="BAH41037.1"
FT                   /translation="MIVDMLSQSVGQFGYFALFFMLWLGIVGMPIPDEVIVLSAGVLTS
FT                   MGLLHVFPAFIATYLGVVSGLSLGYVLGRWLGAPALNWISRKKGMNKYVEQAQSLLDRY
FT                   GSYALCISYFFPVVRHVVPYLVGIGKMTFPRYALFSYTTGFVWTLILFLLGHFMGNKVE
FT                   LLTSYVALLNNRTVIFSVLGVLVLIAAAYYGFTVWRKQKSMAAAPQPLMIDPDRKE"
FT   CDS_pept        complement(69784..70674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00610"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41038"
FT                   /db_xref="GOA:C0ZH97"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH97"
FT                   /protein_id="BAH41038.1"
FT                   /translation="MRYILLVFLGACSYGILSTIVKLAYKQGYSPAEVIGGQMFLGFVL
FT                   TWIPALFFLRTKPPLRQLLLLVAVGLTVGSTGMMYYNALQYIPASIAIVLLFQFTWMGV
FT                   LIEAVMTRKMPGKETIFSLLLLLTGTLFAGGIFESGGLAQFHILGVIFGLLSAVSFTLF
FT                   ILFSGKTAISVNPWLRSSSMATGSFLLASLIYPPAFLFNGALLDGLFPYVFLLAFFGIL
FT                   IPTVFFNYGMPHIGPGMGAILGAAELPMAVLSSYVILNESVSILQVSGVLIILLGIILP
FT                   EWLRQRNIRRNKVTS"
FT   CDS_pept        70889..72652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41039"
FT                   /db_xref="GOA:C0ZH98"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH98"
FT                   /protein_id="BAH41039.1"
FT                   /translation="MYLKWRDRLFSTFLLLILGPTIFICFLFYDQAKEAVFELYKTNMD
FT                   ANIGLVDERLLSLFQSIQKDTDELANRLTVRLTDGPPFVEGNKNGIRRGLPSQEQAVQN
FT                   LFERFSHNQNVVGNIVFLGEDGRVFSLREDKSWSADNQFMEREQWGTGENRIDFLTKRE
FT                   QEEYPRSFFLEKRLEGLTPKATGHLLVEIDLDKLTDWVRTYVVPKEYGMMVLSPSRTIM
FT                   IHTDKAMIGSHVSGLPHYEMVRNQWEQSNEKGLFSLLIQGKDIYVYRQVSEKSGGAYFE
FT                   WLPREGINERLQRLNLIFFVTLFIVVLFACYVAHRLSKWIGEPIYSLVSATDSLLKGDF
FT                   SIRVPIQGMKEITLLENKFNTMAEQMHSLITRERQYSQQSLDQIVRSFYLAVEMKDPYT
FT                   AGHSERVTHYALIIYDYLQQQEQLAFSRDDLRYAGLMHDIGKVAIPDHVLLKTGKLSPD
FT                   EYECMKTHSIISGKIVEQIENLSHISPGVRHHHERWDGKGYPDQLKGEEIPLIGRILAV
FT                   ADTFDAMTSTRSYRKDMSANEAYEEILRCQETQFDPSIVSIFKKAFEDGAIQITQSADC
FT                   KGRVSKDREIS"
FT   ncRNA           72820..72922
FT                   /locus_tag="BBR47_srp0010"
FT                   /product="bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   CDS_pept        73214..74647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00630"
FT                   /product="probable two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41040"
FT                   /db_xref="GOA:C0ZH99"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZH99"
FT                   /protein_id="BAH41040.1"
FT                   /translation="MSALSSLHLVGSSGRLQRFMHQLPTAVLLVNQAGSIVEVNEQLLR
FT                   VTGYSRDQLVNQPISSLLPHRGSIEHLYEEYLRREEEVGTKGEVELEWRDKQGKCRNTS
FT                   VMIMAQQAEELLYMIHFPQLLKESDQLLSQRLLTKLTYDTSMGLFILDEKSIIIEASQT
FT                   ACKLLGMERLDVINKHVDQVFSGIPEPHRFIKKELLEGVKLQNVATSWTNDNQRYELIV
FT                   DANTLQDESGKIVGAFILFKDITNLRSFAQKLERNERLAMIGQIAAGTAHEIRNPLTSI
FT                   KGFLQMFLKLFGDSGMEREKTYTEIMLTEINRINSLVSEFLLLSKPRNIQYSMVDLNTV
FT                   FEEILPIVESQANLYGIDVQFASCGKLPMVVGDNELLKQVFINICKNGIEAMGEQGSLQ
FT                   ISHHFDQDGDKVSIDIHDSGPGIPLYIIDKIFDPFFTTKEEGTGLGLSVCQKIIHDIGG
FT                   QIRVSSKGFGTTFHIMLPY"
FT   CDS_pept        74789..76486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BBR47_00640"
FT                   /product="DNA polymerase III gamma and tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41041"
FT                   /db_xref="GOA:C0ZHA0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHA0"
FT                   /protein_id="BAH41041.1"
FT                   /translation="MAYTALYRVYRPQTFQDVVGQEHVTTTLRNALRENRLSHAYLFNG
FT                   PRGTGKTSAAKIMAKAVNCEQPIDGEPCNQCDTCRAISNGSVTDVLEIDAASNRGVEEI
FT                   RDIRDKVKFAPSDVRYKVYIIDEVHMLTTEAFNALLKTLEEPPSHVIFILATTEPHKLP
FT                   ATIISRCQRFDFHRIPLRVMVDLLQRICQSQGVQVEEQALQLVAKMAEGGARDALSLLD
FT                   QAISYSKDEVRASDIMQITGTVAQSYFSVLARHIAENDIAQVMEQFDKVMVQGKDPEQF
FT                   LHDFLYYYRDMLLLKTAPQLEEIVERTMIDDQFAEVAKLYSFPVLYAAIETCNQALSQL
FT                   KWSTYARVLVELTLVKMCQPNANATESMGASPVNSEELTAMSNRIRVLEERLVQVMQGQ
FT                   VSTPGQQKAEETRKSEPRRIAAASGGSRTPMNRVREVAKAMDENLTRQVRGQWSQILTE
FT                   LKKIKIQYQAWLVNGQPVAAGNEAVVVTFNSAIHCDKTMEAELRSVIERVMSTVLGRPL
FT                   QLLSVMEEEWQSVDQQVGQKDASDEPEEDPFFAEAIKLVGEGLVEVKD"
FT   CDS_pept        76523..76843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaK"
FT                   /locus_tag="BBR47_00650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41042"
FT                   /db_xref="GOA:C0ZHA1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHA1"
FT                   /protein_id="BAH41042.1"
FT                   /translation="MKNMQQMQQMMKQVKKMQEEMQKAQEGLKDRIVEGSAGGGAITVK
FT                   IDGHKQIKDIVIKPEVVDPEDVEMLQDLVLTAVNDALRKADEMVGKEMGKFTGGMNIPG
FT                   LF"
FT   CDS_pept        76872..77468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BBR47_00660"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41043"
FT                   /db_xref="GOA:C0ZHA2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZHA2"
FT                   /protein_id="BAH41043.1"
FT                   /translation="MFYPEPVSKLIDGFMKLPGIGPKTAGRLAFFVLNMKEDDVLDLAK
FT                   ALVNAKRQLHYCSVCNNITDLDPCHICRDKRRDGSIICVVQEPRDVVAMEKTREFEGYY
FT                   HVLHGAISPMDGIGPEDIRIPDLLKRLGDEQVKEVILATNPNIEGEATAMYISRLIKPF
FT                   GIRVTRIAHGLPVGGDLEYADEVTLTKALEGRRDL"
FT   CDS_pept        77620..78093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41044"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHA3"
FT                   /protein_id="BAH41044.1"
FT                   /translation="MPVIRMEFLIDAPRQVCFDAARSIDLHMESTASTKERAIGGVTSG
FT                   LINLGETVTWEAIHFGIKQNLTVKITEMEEPCYFVDEMVSGAFKRFHHTHEFIPITDNQ
FT                   TRMIDIFDYTSPLGILGKLADWLFLEAYMTRFLRTRNEYLKQVAEDQIKALQS"
FT   CDS_pept        78153..79130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41045"
FT                   /db_xref="GOA:C0ZHA4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHA4"
FT                   /protein_id="BAH41045.1"
FT                   /translation="MLTGPGLSLASGIRRQKSTPWAIMLFIGYWLMFAAELSMIRFHKG
FT                   VDGKWVASTVGQPEVWLGLLAFGVTVFSFLATVGFIVSLLRERRQLTSWLWQYDELTGN
FT                   DVLHIVAWLHVFQTGVLLLYGFLLEGTFFSIGTIGGILESAIFQLFLLILIPLWFRGRL
FT                   GEIGVRRPVRLGQMLLMLAALFLLIALVMDAVVTNPIADWFGLSLSSEREQQIEKEIVQ
FT                   AKETDILAALTSLVVIGILVPIAEEILFRGVIQTYLVQRIGPLLGIFLSSLWFGLLHMD
FT                   LALFAPLFVIGLLLGFVRHRYQSIWGAVLLHALNNMTGVLYYFQ"
FT   CDS_pept        79146..79376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41046"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHA5"
FT                   /protein_id="BAH41046.1"
FT                   /translation="MSRWRKKARFVVEWNEASLDVAVNQARMDWQHARHLVEISEPDGG
FT                   LDDVIYYLHVTEKRYMYLLAQAKRERNRQQA"
FT   CDS_pept        79389..79655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BBR47_00700"
FT                   /product="sigma-K factor processing regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41047"
FT                   /db_xref="GOA:C0ZHA6"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHA6"
FT                   /protein_id="BAH41047.1"
FT                   /translation="MTTGWVIALIVVGILLVIAVSKSVTGPIRWIGFGIMQVVIGALLL
FT                   FFTNLVGELANFHIPINPVTALLVGLLRLPGLAALIVIKLWVM"
FT   CDS_pept        complement(79672..80199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00710"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41048"
FT                   /db_xref="GOA:C0ZHA7"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHA7"
FT                   /protein_id="BAH41048.1"
FT                   /translation="MKETAAHTIYSYKLLYRFRWQFVGYLFQLLLIGLSLIWHSFMLQV
FT                   PAYTLIVTLAILPVIPICHLVLFRLYALLRGHKPKTTADMLVSPWWGAGYPLPIPLSVY
FT                   RGSELTVNVGSMAIAAGAYVWLSEGYGLTLITGTLIVSLPRLLALLTSFRLPSRSRVKY
FT                   EDRGVAFLLTDG"
FT   CDS_pept        80395..81384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41049"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHA8"
FT                   /protein_id="BAH41049.1"
FT                   /translation="MKLWVISEEVVARFGNELGACGIELVVCSTDAIQEGANGFLLTKE
FT                   SDGKLLQERVQQLGTGPWLALVYGSDVPYDWADTLHTQYEHTGEYEVIRMALFTHERAL
FT                   LGGEPDGRWMRFLCRQLARYSLVTMVCGMREVDEALRQLPRYLAWKEQFYIELGASCDE
FT                   KGISLLQVSRALGMDKRIGHGWLYPSRQDSSLIVRWLVKECRLVLQKANIQRIVLWGED
FT                   SLWEQMSSDWLAGKDVAMYTGEDKPIPNKRMTRWTLYDSWQDAIKDADLLVIGNAAGTT
FT                   IAELPLSELVSRMRHSYVIDAAACFPVQEAQSYFQAYRAIGENTNVWE"
FT   CDS_pept        81445..81627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41050"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHA9"
FT                   /protein_id="BAH41050.1"
FT                   /translation="MEKVAQRCIVCEQEQNDGIAICEQFICQRCEQEMVNTDVQDEKYP
FT                   FFIHQMRRIWLRKDA"
FT   CDS_pept        81732..83204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaO"
FT                   /locus_tag="BBR47_00740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41051"
FT                   /db_xref="GOA:C0ZHB0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHB0"
FT                   /protein_id="BAH41051.1"
FT                   /translation="MLERDVEFRERQKRAPLYEQLERHAKHRPHPFHVPGHKMGNSFDN
FT                   HAKNRFQDILELDVTEISGTDDLHQPQGVIAEAQDLAAQAFHAEQTKFLIGGSTVGNIA
FT                   LIMTVCRPGDKILVQRNCHKSVFNGIMMARATPIFLVPAVDLATGVAAGVRREDVERAL
FT                   LAHPDAKAVFLTNPTYYGMGIDLAKLAATVHRFDVPLLIDEAHGAHYGFHPAFPRSAMQ
FT                   EGADASVQSTHKMGTAMTMSSMLHIQGERIDRERLFRHLAMLQSSSPSYVLMASLDVAR
FT                   RHLVLEATEEWNRLLPLLDKFRERLDRLDWLDWPRLSTNSVYATLDPLKLFFHLRTAQF
FT                   SGFDLQKWMEKHGIFSELADDSHVLLAASTGTASRDLEALCRLLESMAPQVEPGEERIL
FT                   LAGVVSSHYLREQALPMHEAVDCPRESILLEQALGRIVAEMVIPYPPGIPVLVPGERID
FT                   EESLAMLKELARGQTRFHGVQDDQLQTIQVLR"
FT   CDS_pept        83244..83885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BBR47_00750"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41052"
FT                   /db_xref="GOA:C0ZHB1"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHB1"
FT                   /protein_id="BAH41052.1"
FT                   /translation="MEVATGKKGRFITIEGGEGAGKSTVIAKLYEELKTRGVDVLLTRE
FT                   PGGIDIAEKIREIILNPAHTQMDERTEALLYAAARGQHLAEKVLPALAEGKLVLCDRFI
FT                   DSSLAYQGHARGLGIDAVYQINRFAVGDCMPELTLFFDVQPETGLARINASRGREVNRL
FT                   DLEGMRFHELVREGYQLVMERDPERFVVIDAEQPMEQVYQSALQALLDRL"
FT   CDS_pept        84028..84357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaQ"
FT                   /locus_tag="BBR47_00760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41053"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHB2"
FT                   /protein_id="BAH41053.1"
FT                   /translation="MKMVVAVVQDKDSGRLSQQLVKKGFRATKLASTGSFLRAGNTTFL
FT                   IGTSDESVPEVIDIIAHNCKSRKQMVTPVSPLSNAVDSFMPYPLEVQVGGAAVFVLDVG
FT                   EFHSF"
FT   CDS_pept        84450..84896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaR"
FT                   /locus_tag="BBR47_00770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41054"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHB3"
FT                   /protein_id="BAH41054.1"
FT                   /translation="MKISDGLRPKLDLIKTTDSRKNPQLEKLNFGTMIQGEDERMSQEK
FT                   LTRLLTDIDKQGQILARSRAVRDFYAYKNLVKQFMEEAVKFGIALDDRRGMNRRGRSRL
FT                   YKIVKEVDAELLKLTDELLSEQAPTIDLLARIGEIRGMLINLYF"
FT   CDS_pept        84913..85893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BBR47_00780"
FT                   /product="DNA polymerase III delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41055"
FT                   /db_xref="GOA:C0ZHB4"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHB4"
FT                   /protein_id="BAH41055.1"
FT                   /translation="MTWTRFSQQPRAQELLSHSLRNERLAHAYLLAGPKGSGKKQMALH
FT                   LAKSLFCSEREADACGACVTCRRIDGGNHPDVLFITPDGASIKIDQIRSLQKEMAMRAV
FT                   ESSRKVYIIEHVDKMTTQAANSLLKFLEEPPAGVLALLLTEHSHAILPTILSRCQIVQF
FT                   SPLSAESIAEKLRAEGVLAGMAQVASHITTNVEEAMTLSQSESFAQLRNLVIQLVQECK
FT                   QRNSSALLTIHDMLQKSDKSKEELPLFLDLLILWLRDILYLQVGRHAHLINSDQQDVLQ
FT                   GQALVWTKAELLRGIDLVMETKNRIERNANAQLALERLVLQFQEG"
FT   CDS_pept        85897..86712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaT"
FT                   /locus_tag="BBR47_00790"
FT                   /product="stage 0 sporulation protein YaaT"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41056"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHB5"
FT                   /protein_id="BAH41056.1"
FT                   /translation="MYEVVGVRFKKAGKIYYFDPDRLPIEQDCTVIVETARGVEFGKVV
FT                   IGKKEVAESDVVLPLKKVIRMADERDAKQVDENKQAAKNAFAVCQTKIKEHKLDMKLVD
FT                   VEYTFDRNKIIFYFTADGRVDFRELVKDLASVFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   LLCCSTFLGDFEPVSIKMAKDQNLSLNPAKISGLCGRLMCCLKYENDNYESSKDEMPDV
FT                   GKLVTTPMGNGRVVSVNVLDQSVQVELSIDKRVTEFGLDEIAIGLPTFE"
FT   CDS_pept        86741..87112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="BBR47_00800"
FT                   /product="putative initiation-control protein YabA"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41057"
FT                   /db_xref="GOA:C0ZHB6"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZHB6"
FT                   /protein_id="BAH41057.1"
FT                   /translation="MDKREIFVKMASIEERIGDLYKEIGELKDVIVVLMEENAQLLVEN
FT                   QHLRNRLDRKKTGSQAKQKGTSPVAKEKAKKAVVGEGYDNLARLYAEGFHICNVHFGSL
FT                   RKEGDCLFCLSFLSGGPQK"
FT   CDS_pept        87221..87988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="BBR47_00810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41058"
FT                   /db_xref="GOA:C0ZHB7"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHB7"
FT                   /protein_id="BAH41058.1"
FT                   /translation="MEPVTNVPLYETERIDDLLTHEMKIIQSHEVFCFSMDAVLLARFA
FT                   SVPKRGKVLDMCTGNGAIPLIMTTRTPEASFDGIEIQERLFSMASRNVTLNGLNERITM
FT                   HHGDVKDAVSLFGHGNFDLITCNPPYMPATSGEKNISEHFAIARHEIMLSLEDVIRVGS
FT                   QLLKNGGKLALVHRSTRLIDIVSLMRQYGIEPKRMRLVYPRREAEPNMVLIEGIRGGKP
FT                   ELRIQPPLIVYENGEQYCEELQEIYYGRRDSLE"
FT   CDS_pept        87963..88238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41059"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHB8"
FT                   /protein_id="BAH41059.1"
FT                   /translation="MADEIPSSKSHYVYILSCADGTLYTGYTTELIRRLAAHNEGKGAK
FT                   YTRGRGPVELLYWEEGADRSWGLKREESIKRLTRKKKEELIGGASE"
FT   CDS_pept        88235..89107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="BBR47_00830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41060"
FT                   /db_xref="GOA:C0ZHB9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHB9"
FT                   /protein_id="BAH41060.1"
FT                   /translation="MNVQRSFASEEAGVLYLVATPIGNLDDITVRCLNTLREVDVIACE
FT                   DTRQTRKLLNHFQIEKRTVSYHEHNKEASGNGLLQWLAEGKKIALVSDAGLPAISDPGA
FT                   ELVRDATAAGFSVIPVPGANAALTALIASGLPTDRFVFCGFMGRENKERREELERLKRY
FT                   PETLIFYEAPHRVEKTLAAMREAWGNRRAVLARELTKRYEEFARGTLDELLEWLRSGEV
FT                   RGEFCVIVEGNTGPLEAEVDDAWWQSLSIVEHVDHYCAQGMGKKEAIKQAADDRNVSKR
FT                   DVYNEYHRE"
FT   CDS_pept        89238..89888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41061"
FT                   /db_xref="GOA:C0ZHC0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHC0"
FT                   /protein_id="BAH41061.1"
FT                   /translation="MGIRDSRFIVNTDEKDDHFIFTLPVTWNSRPYEYAWAKQFANPND
FT                   VVLDSACGICHPFKFYLADHCREVHACDLDNRILSKEAIYQDIVDVFGKRVADSLPVHY
FT                   FDGIHYCRANLTYLPYSNQKFDTVFCISVLEHLEDPVMVQAFSEFHRVLKDDGQLVLTF
FT                   DYPLINLARLQQVLAEVGLQFSGDVSFEMPTDVVYSDLYALRLFFFRALLKKK"
FT   CDS_pept        complement(89949..90197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BBR47_00850"
FT                   /product="transition state regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41062"
FT                   /db_xref="GOA:C0ZHC1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHC1"
FT                   /protein_id="BAH41062.1"
FT                   /translation="MMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDGERII
FT                   LKKYEPACIFCGNADKVSHFKGKIVCQDCLTEMPVKR"
FT   CDS_pept        90953..92980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="BBR47_00860"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41063"
FT                   /db_xref="GOA:C0ZHC2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHC2"
FT                   /protein_id="BAH41063.1"
FT                   /translation="MKPTYYITTPIYYPSNKLHIGNAYTTIACDALARYKRLRGYDVYY
FT                   LTGTDEHGQKLQERAAEEGKQPLEFIDPIVDWVKDLWEKLDISYDDFIRTTEPRHKEVV
FT                   QKVFQRLLDQGDIYLGEYEGFYCVPDEAFWTETQCKTDNGYICPDCGREVKKVKEKNYF
FT                   FRMSKYQDRLLAHIEANPEFIQPESRRNEMVNNFLKPGLQDLSVSRSTFDWGIKVPTDP
FT                   EHVIYVWIDALTNYISALGYLSEDDSKYRNFWPANVHMVGKDILRFHTIYWPILLMALD
FT                   IPLPKQIFGHGWLLMPDGKMSKSKGNVIDPKVLIDRYGSDGVRYFLLREINFGQDGIFT
FT                   PESFVQRLNYDLANDIGNLLSRTATMIEKYFDGIVPAPQDAGEPDDSLIGLAMKTKALV
FT                   EEHMEEMRFSNALAHIWELVGRTNKYIDETMPWNLAKSEETKGRLATVMYNLVESIRIS
FT                   SVLIQPFMTKAPAKIWDQLGILGNEEATNWESASVWGGLPAGSTVSRKELLFPRLDVQA
FT                   ELAFIDDSTAEARRQAEENKKKQAALKGEAPVSETNTNQTEAATDKPADAKEEISIDDF
FT                   GKVELRVAQVVECAKHPNADKLLVLQLDLGYEKRQVVSGIAKYYSPEDMVGKKVILVAN
FT                   LKPVKLRGELSQGMILAASAGDQLTLATVDPSMPNGAIVK"
FT   CDS_pept        93008..93778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabD"
FT                   /locus_tag="BBR47_00870"
FT                   /product="putative deoxyribonuclease"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41064"
FT                   /db_xref="GOA:C0ZHC3"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHC3"
FT                   /protein_id="BAH41064.1"
FT                   /translation="MLFETHAHLNANEFDEDRAEVIARAQENGVSTIVNIGFNAETIPS
FT                   CMDLAHAYDFIYAVIGWHPQDAKDMTDEHLEWIEELSRDPKVVGLGEMGLDYYWDTSPR
FT                   DVQAEVFRKQIRLARKLDMPIIIHNRDAHQDVLTILKEEKAADVGGIMHCFSGSWETAK
FT                   QALDMNFYISFGGPLTFKNAKQPKEVAAKVPLDKLLIETDCPYLTPHPFRGKRNESGYV
FT                   RYVCEEMANIHGLSYEEMAQITADNARRLFRMNG"
FT   CDS_pept        94137..95234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="BBR47_00880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41065"
FT                   /db_xref="GOA:C0ZHC4"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHC4"
FT                   /protein_id="BAH41065.1"
FT                   /translation="MELRAIWERYKNRGLVMFGCLALVLVPMIGYFSAQATQPKQVTFS
FT                   MDGESKTVATKATTVEQFLTERNITVTEKDSLQPTPETKLKDGALITLYTTWSIPIQVD
FT                   GQKKTIETLSRDVAGALKDGGIVLGEKDRVEPALTATLTKDSSISVKRIVEKMVKVDER
FT                   VTFQEIRKNDPALEKGKSRVLQSGQEGKAIAHYKLIMEDGKEVSRDLVKRDVLVPKKDN
FT                   VVAVGTAIPMLQKKGQPDRVLVASAAGPVSRGGKVFRPKKVLNGVTLTAYTPSGGGKHP
FT                   SSPGYGRTSTGAKAKVGHTIAVDPNVIPYGWWVYIEGVGYRRAEDTGGAMKGGKIDVFV
FT                   GTESEARNFGRKRNKTVYIIGPQKP"
FT   CDS_pept        95405..95953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BBR47_00890"
FT                   /product="probable 5S ribosomal RNA maturase"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41066"
FT                   /db_xref="GOA:C0ZHC5"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHC5"
FT                   /protein_id="BAH41066.1"
FT                   /translation="MKIKEVIVVEGRDDTATIKRAVNADTIETGGSAIHKRTIEKIRLA
FT                   QQKRGVIIFTDPDYQGERIRKIISKSVPGCKHAFITQEDGTKKGDIGVENATPDVIIRA
FT                   LSEVRTEMAETAGEITSDDLLANGLTSGVDAKERRIKLGEALGIGYANAKQMLQRLNAF
FT                   QISRAEFEAAIAAINKERE"
FT   CDS_pept        95957..96850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BBR47_00900"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="protein synonym:S-adenosylmethionine-6-N',
FT                   N'-adenosyl(rRNA) dimethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41067"
FT                   /db_xref="GOA:C0ZHC6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHC6"
FT                   /protein_id="BAH41067.1"
FT                   /translation="MTQIAGKDIATPTRTKEILEKYGFAFKKSLGQNFLIDTNILHNIV
FT                   SEADLTKEKGAIEIGPGIGALTEQLGRAAKKVMAIEIDQRLLPILQDTLSPYENIEVVH
FT                   GDVLGLDLKKLIEEKMTGVEKLSVVANLPYYVTTPILMKLLEERLPLENIVVMIQKEVA
FT                   ERIAAKPGTKDYGSLSVAAQFYADTEVAMIVPASVFIPRPNVDSAVIRLKVRDRPPVEV
FT                   DDQDVFFRVVRCSFAQRRKTLLNNLMNGLFPKTQKDEVIQMLTDIGIDPTRRGETLSLD
FT                   EFARLANEGMRRGLIT"
FT   CDS_pept        97066..97338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="BBR47_00910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41068"
FT                   /db_xref="GOA:C0ZHC7"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHC7"
FT                   /protein_id="BAH41068.1"
FT                   /translation="MARNALLDIKRSLDGHIGERILLKANGGRRKTVERSGILEETYPS
FT                   VFVVKLDDDQLFERVSYSYADILTETVELTVCRENEHIRITFVQQ"
FT   CDS_pept        97456..97635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00920"
FT                   /product="small acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41069"
FT                   /db_xref="GOA:C0ZHC8"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHC8"
FT                   /protein_id="BAH41069.1"
FT                   /translation="MGRRRGLMSEQFKMELAKELGFYDTVKSEGWGGITTRDAGNMVKR
FT                   AVQLAEEALAAKRL"
FT   CDS_pept        97850..98728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BBR47_00930"
FT                   /product="probable
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41070"
FT                   /db_xref="GOA:C0ZHC9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZHC9"
FT                   /protein_id="BAH41070.1"
FT                   /translation="MRISVKAPAKINLTLDVLAKRPDGYHEVEMVMTTVDLADRVDMTL
FT                   REDGEITLDCSASFVPDDIRNHAYKAATLMKAKFQVRQGVHLYIDKQIPVAAGLAGGSS
FT                   DAAATLRGLNQLWNLGLTRDELAKIGAEIGSDVPFCVYGGTALATGRGEQIAHLGAPAP
FT                   CWVILAKPPIGVSTPDVYGNLRVAQIDNHPDTKQMLQAIATQDFSLMCQSLGNVLENVT
FT                   LSLHPQVRQIKDLMIASGADGVLMSGSGPTVFALVQKEAKVHRIYNALRGFVKDVFVVR
FT                   MLGAQEGEILA"
FT   CDS_pept        98784..99617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BBR47_00940"
FT                   /product="transcriptional repressor of purine operon"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41071"
FT                   /db_xref="GOA:C0ZHD0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHD0"
FT                   /protein_id="BAH41071.1"
FT                   /translation="MKKLRRSARLVDMTQHLLAHPHTLTPLTLFAEQYGAAKSSISEDL
FT                   SIIKEAFEVQGVGLLKTVAGAAGGVKYIPQVKTEEALHFMRELIGQLANPERLLPGGYL
FT                   YMSDILGNPQTMAKIGKLFATAYADKNVDVVMTVETKGIPLAYATAMFLNVPVVIVRRD
FT                   NKVTEGSVVSINYVSGSSKRIQTMSLARRGLAEQSRVLIVDDFMKAGGTLRGMIDLLQE
FT                   FRATVVGCGVLVETTADVSERLVDEYVSLAKLQDVDFKGKQIEIELGSFFEKRGE"
FT   CDS_pept        99624..100004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="BBR47_00950"
FT                   /product="putative ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41072"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHD1"
FT                   /protein_id="BAH41072.1"
FT                   /translation="MAISFVSTDKAPAAIGPYSQAAKVGPFLFASGQIPLRADGTLVEG
FT                   DVVEQTHQVFSNIQAVLAEAGGSLTNVVKATVFIKDMNDFGQLNEVYGQYFGDHKPARS
FT                   TVEVARLPRDVKVEIEIVAYIE"
FT   CDS_pept        100196..100483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BBR47_00960"
FT                   /product="stage V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41073"
FT                   /db_xref="GOA:C0ZHD2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZHD2"
FT                   /protein_id="BAH41073.1"
FT                   /translation="MEVTDVRLRRVNTDGRMKAIASITIDHEFVVHDIRVIDGNNGMFV
FT                   AMPSKRTPDGEFRDIAHPISSTTREKIQAAVLTEYDRVGQEEESTIEAGA"
FT   CDS_pept        complement(100538..101554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_00970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41074"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHD3"
FT                   /protein_id="BAH41074.1"
FT                   /translation="MSAEVYLLTGYLGSGKTTLLQKWLTHLRITDQKVVVLMNEMGEED
FT                   IDGEQLQGFGFPVKKMLDGCICCSIKGELTEGLKDIMNTIAPDRILIETTGVADPLDVI
FT                   DTITHPELYDRLELKGTISVVDASRFLDLNSRFSSTATLVKTIRNQVRYADLLLLNKTD
FT                   LTSPDVIERVRQKLSEINPTAPIHATVQAKIEVSRLLSVKRTVHERSPGNEISRPIAVQ
FT                   KSIGRMPTMDRLKQSLGLKTSQPSLYNSIETFSYVFTGPVDAKKFEDFLYDLPKNVYRA
FT                   KGYVQFHGKPELISFQHTDNQVLLFPFENFGPKMVAVFIGEGMDREIILNDLIKCYG"
FT   CDS_pept        101750..103135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="BBR47_00980"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.157"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41075"
FT                   /db_xref="GOA:C0ZHD4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZHD4"
FT                   /protein_id="BAH41075.1"
FT                   /translation="MSKIHAVVLAAGQGTRMKSKLYKVLHPVCGKPMVQHVVDTMASMQ
FT                   VQDIVVVVGHGADAVRAKLGEDVTYALQEEQLGTAHAVSQAAPFLQDKEGTTFLLYGDV
FT                   PLLSATTLSALLTYHEEQQAAATVLTAVLPDATGYGRIVRNEAGEVLRIVEHKDASEAE
FT                   RAIREINTGIYCYDNRKLWKALAEVKNDNAQGEYYVTDVVGILRDAGEKVVGYEAIDPE
FT                   ETLGVNDRVQLSEAEAYMKKRIMTGHMRNGVTIIDPTSTYIETDVKIEADTVIHPGSFL
FT                   RGQTTVGADCVIGPQADLTNVEVASGVTISYSVMVDSRVESDSSVGPFAYVRPGSQIGS
FT                   NAKIGDFVELKNAKIGDGTKVPHLSYVGDAEIGDGVNIGCGTITVNYDGAVKHKTTVKD
FT                   GAFIGCNSNLVAPVTVGQNAYVAAGSTINQDVPDNALAIARERQVNKIDYANKMPRKGK
FT                   KQS"
FT   CDS_pept        103158..104108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BBR47_00990"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41076"
FT                   /db_xref="GOA:C0ZHD5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHD5"
FT                   /protein_id="BAH41076.1"
FT                   /translation="MANYRDPKLKVFTCNANPELAKEIAEHIGVPLGNAQVVRFSDGEC
FT                   QLKLNESVRGCDVFVIQPTSAPVNEHLMELLVMVDALKRASAKSINVVIPYYGYARQDR
FT                   KARARDPITAKLVANLIETAGAQRVITMDLHATQIQGFFDIPVDHLLGVPILGKHFSEK
FT                   GLKDIVVVSPDHGGVTRARKLAERLEAPIAIIDKRRPEPNVAEVMNIVGNIEGKTAIII
FT                   DDIIDTAGTITLAASALVEAGAREVYACCTHPVLSGPAIERIANSKIKELIVTNSIPLT
FT                   EEQIIDKITVLSVAPIIGEAIIRVHEELSVSKLFD"
FT   CDS_pept        104199..104807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="BBR47_01000"
FT                   /product="probable 50S ribosomal protein L25"
FT                   /note="protein synonym:general stress protein CTC"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41077"
FT                   /db_xref="GOA:C0ZHD6"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHD6"
FT                   /protein_id="BAH41077.1"
FT                   /translation="MEQLQAQSREKKTGNAVKVLRNEGWVPGIMYGSEVGNKPIQVKGR
FT                   ELDAALRQQSTNKPFRLSVDGNTHDVMVYELQRHPLQGNILHADFKKINMNEKIHTSVP
FT                   VLMTGDPELGVATLVRHSVEVTCLPGNIPESFLVDVDGFNIGDVVLVGDLTVPPGVELG
FT                   LDSTEVLISVLPVKAKSEESIDAEQEAEAVAEKAGTANE"
FT   CDS_pept        104912..105481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /gene_synonym="spoVC"
FT                   /locus_tag="BBR47_01010"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41078"
FT                   /db_xref="GOA:C0ZHD7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZHD7"
FT                   /protein_id="BAH41078.1"
FT                   /translation="MKVIIGLGNPGKKYEDTRHNAGFMAIDKISDKWGIPVTQNKFRAL
FT                   VGEGRIEGEKVLLVKPQTYMNLSGESVAEVLKFYKLIPDDLVVIYDDLDLPTGHLRLRE
FT                   KGSAGGHNGIKSMIQHLGTQEFKRIKVGISRPEPGRSVSDYVLNTFPVAERADIQEAVS
FT                   LAADACAMWTRESFLKVMNHFNSLKK"
FT   CDS_pept        105543..105773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="BBR47_01020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41079"
FT                   /db_xref="GOA:C0ZHD8"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHD8"
FT                   /protein_id="BAH41079.1"
FT                   /translation="MSIRYTCRCCGMKIAEFDESQVTEAQLGFDSLTPEERALIISREQ
FT                   SGDTVVSITCDYCREALIQHPELSLVGNPLQ"
FT   CDS_pept        105920..109468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BBR47_01030"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41080"
FT                   /db_xref="GOA:C0ZHD9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHD9"
FT                   /protein_id="BAH41080.1"
FT                   /translation="MQVIINPMKQDTNVGTIVAGLEKGLHEQLVSGLAGSARQVLMASL
FT                   QQMADRPVCVVTHNMYQAQKVYEDLIELVPSDQVLLYPGNELIGSELAIASPEMLAQRI
FT                   HVFNRLAQGFTGFLVAPFAGLRRLVVPPQVWKEAQIQLSVGNELDIESFLLRCIELGYE
FT                   RVDMVERKGEMSIRGGIIDLYPIDSEWPVRIELFDVEIDSIRTFDMLSQRSLESVQTYI
FT                   LGPAKEMIASTPLLQESAVRLEQKLGETLANLKDGAAKEKVMERIGSDAERMKQGQRFA
FT                   QLYSYISVIYPTGDTLLSYMPSDTLLLVDEPSRVLDTAAQLQKEEGEWLTGRIIQGEYM
FT                   SNLSLSRTYDEIVSTKKRQIVYLSLFLRQSPKTQPQNIVNLTCRTMQNFHGQMNVLKTE
FT                   LARWKKSQDQIVFVAADLERAKRLERVLHDYEMEADVLTEAVETVPPGRPTIILGNLQT
FT                   GFELPLNKLVVITEGEVFTAKQRKARKVQQTMNNAERIKNYLELKPGDFVVHVNHGIGK
FT                   YLGIETKEILGIHKDYLHIQYAAGDSLFVPIDQIDHVQKYVASEEAQPKIYSLGGSEWK
FT                   RVKNKVQSSVKDIAEDLIKLYAARESAVGHTFSPDTTEQREFEAMFPYQETQDQLRAIS
FT                   EVKADMERKRPMDRLVCGDVGYGKTEVAIRAAFKAVMDGKQVAVLVPTTILAQQHYETF
FT                   RERFAEYPIRVEVLSRFRSRKEQNATLKGLKEGTVDVVIGTHRLLSKDLTFRELGLLIV
FT                   DEEQRFGVSHKEKLKQIKTNVDVMTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQ
FT                   TYVMDYSPALVREAIEREMARDGQVFFLYNQVQGIEQMAEQISMLVPDARIAVAHGQMN
FT                   ESELEGVILDFLEGNFDVLVSTTIIETGVDIPNVNTLIIYNADKMGLSQLYQLRGRVGR
FT                   SNRIAYAYFTYQRDKVLTEVAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQH
FT                   GFINTVGFDLYSQMLKEAIDELKGEVKHEIVTPVEINLQLDAYIPSMYITDSRQKIEMY
FT                   KKFVAVSTLEDVDDLAEELLDRFGPVPKPVDNLLTISRLRVYALKHHITEISQKNPDEI
FT                   KLLLHPSQNNNIDGGALFALTSNWSKRVGLSGGQQITIAVKVKGLKEDEGVQLVEKLLR
FT                   QFHQVRRDTGTESPVS"
FT   CDS_pept        109509..110576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="BBR47_01040"
FT                   /product="putative foldase protein PrsA precursor"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41081"
FT                   /db_xref="GOA:C0ZHE0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE0"
FT                   /protein_id="BAH41081.1"
FT                   /translation="MKRSVAILSSAVLVVALMTGCGGKAEEAKQDSKTPANQTDGSNQA
FT                   ANDPLVQFPKLTLPYAADQKAVIVEYQGGTVTGKEFEEFLRVINFMNPQQGTMIEMADS
FT                   KSLKAFAREFTATKVLASRSDDAMKKESKELAEKTFEKIKTQYMSFLGKDEAQFNKLMD
FT                   GQGVTKDMILNQMDLINQSINVMKKNIDDATLKQTYDQMDKASRTVASVRHILISTEKR
FT                   TPEEALKISNDLEARLKKGEDFAKLATEFTDDPGSKQSGGLYENADVTQWVPEFKEASL
FT                   TQKVGEVGPPVKTNFGYHIIKVENRKEKTFDEMKEQLRASSLEKAYDTFAKTELDKLIT
FT                   KFNIPQSKNDAPAKK"
FT   CDS_pept        110812..111354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BBR47_01050"
FT                   /product="stage V sporulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41082"
FT                   /db_xref="GOA:C0ZHE1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE1"
FT                   /protein_id="BAH41082.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPIGELGDFAKEYADSLYESMNHTVLISDRDTVIAVAGASKKEYLEKPIGSIVEK
FT                   CLEERKTRLEKNAGSYEICRDLNETMGSFVIAPIVAGGDPIGSVILLNKNESTKMSDLE
FT                   IKMSETAAGFLAKQMEQ"
FT   CDS_pept        111463..113127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01060"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41083"
FT                   /db_xref="GOA:C0ZHE2"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE2"
FT                   /protein_id="BAH41083.1"
FT                   /translation="MGQEKASVQFVKGAAILGIAGLVSKLLGAVYRIPYQNIAGDIGLY
FT                   VYMQVYPLYTALLILATAGFPIAISKIVSERVAVGDAIGARRAFRVASISLVVLGIFFF
FT                   LLLYGGAPIIASMMGDEHLITPLRAVAWSLPLVPMAAILRGYFQGHQNMMPTGVSQVAE
FT                   QFIRVIFILVAAFWAMNVYQDPYLAGTGAVFAAFPGAIAAILVLLWYWRADKKMGQLSM
FT                   GQVQQSSVQPWTNRQILRHLLTYAVPICMGALVLPLVPLVDSMTVVNILQWSGTPEDLA
FT                   KLLKGAFDRGQPLIQFGTFFATSLSLALVPAISEAVAQRQHQLISHRSEVAIRLTFLLG
FT                   LPASFGLALLAEPINVMLYGDSNGTEALAVQSFTIIFATVSIASAGILQGLGRVMRPAR
FT                   NLFIGVLVKLILNLALVPFWGISGAAVSTVLAYLVAMGLNVLAVIKYTGANIGFRQTVK
FT                   KPFVSVVVMSIVVLIVEWLANTVLASAGLSNRLFYTLVGLIAVALGALFYLLALLKTGG
FT                   LTRSDIQFLPKGKRIASLLTKYKLLPAEKARMNEKEA"
FT   CDS_pept        113137..114606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="BBR47_01070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41084"
FT                   /db_xref="GOA:C0ZHE3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE3"
FT                   /protein_id="BAH41084.1"
FT                   /translation="MKNKTITVVGLGAGDLDQLPYGIYRTLKAAKQLYLRTKEHPVVAE
FT                   LIAEGITIESFDDVYEQHDTFSDVYTDIVERLFSRVNEAGSLVYAVPGHPLVAERTVQL
FT                   LLAEGPNRGVEIEIGGGQSFIDPLFARLHIDPIEGFSLLDGTALAAHQVSPGLHTIIAQ
FT                   VYDAFVASDVKLTLMEVLPDDYEVTVATAVGVTGQEIIETVPLYELDRLDHFGNLSLVY
FT                   VPPTKDEKVSYRQFSYLKEIVAILRSPDGCPWDREQTHQSIRKNLIEETYEVLETIDDD
FT                   DPDAMCEELGDLLMQIMLHSQMAAEDGYFSVDDVVATLNEKLVRRHPHVFGEKSANDSE
FT                   EALANWQEIKAQEKAAKGIDVTVQSQLAGIPRDLPALMYAYKLQKKAAQVGFDWDDIAD
FT                   VFKKVEEEYHELQEASEEERAGELGDLLFAVVNLARFLGLDPEEALALTNNKFKKRFSY
FT                   IEGKLQEAGRTFEQTDLQEMDKWWEEAKHET"
FT   CDS_pept        114596..114889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41085"
FT                   /db_xref="GOA:C0ZHE4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE4"
FT                   /protein_id="BAH41085.1"
FT                   /translation="MRLDKYLKVSRLIKRRTLAKEVCDKQRVEINDRPAKASSNVKIGD
FT                   KLAIRFGQKIVSVKVEDIKENPRKEEAASLYTVIGEVPVPRDEKEEDAYLKG"
FT   CDS_pept        114999..117134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01090"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41086"
FT                   /db_xref="GOA:C0ZHE5"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE5"
FT                   /protein_id="BAH41086.1"
FT                   /translation="MQQNGVRTGYFLSISLLLSSILYFFASNWPLMVREQKIGVSVAIL
FT                   VLFYLLSYGLRFIKRHSFLSNWLLVAGGLAFGTSVALLGQIYNSHADSYMLFVVWLIPN
FT                   LLFAIFTRYQPFYVISYVLAHLAIYFFLHPSVIHVAREDEWWFMIFWLIALGNMVLFWL
FT                   TSTGKWHSKPIYYLSFLTFSLSLFGSSFTEVYGPLPELLYVLTGGILFVTFLKWVPSRG
FT                   LLIVTASLLALFVLANFISYMVQYFSESFFVFMLLLTVLIVWGAVAGINWLRKESAHQK
FT                   SKWVVFFQEAFTVLVTTIAASIGATSIAGLLFLIIQDEVVIDLLFFLSLIGFIGPVVFM
FT                   SRMNTTVRYTLLTMGYLLGVGSILFLEGAYWIVFLLVLLYVWKAVSAIPARLLTQLTFL
FT                   VVLATKLDEYLPSFEYVLVIIFATQMGMHYVKQLPVVLQNSSLVYALLSLLILTEKSFQ
FT                   SGSMDVVVNLAFFAVSTYLLYRTLHQQNRVRFGIVLGFWFAFLLMKYYDMLWSLLHKSL
FT                   SLLLLSLVFFVATLWWDRRAKIEWPKSEPSLFVRKALVLLPVILLQFALIGYQVWSSET
FT                   ILANGKTVKLELVPIDPRSLLQGDYVRLGYTISALDQEQVDSGDKIRVVLRQQANGLHS
FT                   YSGYYERNGQWNRAYEPQPSDVIINGSTIGGNRVEYGIESYFVPEGTGLEVERNAKYAI
FT                   VKIGGRGDAILESLTNQ"
FT   CDS_pept        complement(117161..118441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01100"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41087"
FT                   /db_xref="GOA:C0ZHE6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE6"
FT                   /protein_id="BAH41087.1"
FT                   /translation="MSFSQLHPNIRIRIVTSFLTRLVGNMIFPFMAIYFSAKLGPAITG
FT                   LLLVLTVCAQILMGFYGGYLADRWGRKKVMVYGQWIQCCALFIMMAANSPWLDSAWLTF
FT                   AMMLVQNASNGMINPAADAMLIDVSTKENRTYMYGISYWSNNLSIALGSVVGGLLFATH
FT                   RFELLLVLTVVSFLTLVIIAFSIKESYQPKPMPPIGSRTGILRDMVASYKLVMTDRRFI
FT                   LFSLSGMLIFAPEFQTPNYIAVRLAQEFAPRSIGLFDWFTVELTGIKIFSLIQLENTLL
FT                   VVLFSLAVTKLIERLKEAPALYISGLMYIAGYSLIMYSNSLIVILAAVLISTIGELIHA
FT                   PIRQTYLAQIVKDDLRSSYMAVNGLVVPGARIMGAVGITLGAVLPSYLMALLIFSLGVV
FT                   GVILTRSIVLQMDSKERLLPHTKEAAR"
FT   CDS_pept        118528..120318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41088"
FT                   /db_xref="GOA:C0ZHE7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE7"
FT                   /protein_id="BAH41088.1"
FT                   /translation="MGCLMKSNEHFMQMLLGLSEWETGREQKIGIQELSHLLCCTPRNV
FT                   KLILRKWESEGLLLWKAGVGRGNHSRLTILCDITDFLASYFQKRLMDGKVGEAVELLHH
FT                   KNLPAGAKRLLQETWDSQFGFVAIENDKRSQEILRIPRERAFSTIDPAFVAVAAESHFI
FT                   QQICHTLVIFDLATQDFKPQLAYAWERNLDMTAWTFYLRKGVRFHHGRVLTGEDVTYTV
FT                   QRLIQLDSPYRWQVDDIDWIEQRNDGAITFHLRKPNGFFLHLVSCIGMSILPHDVLFSE
FT                   SAIVGTGPFRMVEFTEDRLVLAAFDDYYRERAILDRVEIWRVPGSCSSKQRYQLSLAED
FT                   EATEDDSKSLEVQEVGCHYLNFNFRKPGIQHDFAFRQAIKLLIDPVQMIRDLKKETFTP
FT                   AGSFLPERSQRMHFSSHTIEEAAHWLQKSAYQGEAVLLSFNDTKKVREEAEWLHERCQR
FT                   VGIRLELQGITKGQFLSYDTAQHADMAMMGEVLQRDIELGLMEIYKNKCSLVHRFLDDD
FT                   RLAIVEERMSKILQLQDSKERMRALEKMEDILKDEAWLLFLYHTKRFDHYHPALQGIAV
FT                   DSFGWIDFSKLWVKSFVTSL"
FT   CDS_pept        120379..122415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41089"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE8"
FT                   /protein_id="BAH41089.1"
FT                   /translation="MNKSVNKGISVLLATAVLASPVMLEPKAAYALSIEDVSADSTRVD
FT                   EETEYTIEFEINKDLSSGDSIFVRFPSDYSVDKKLKKSDVTLKDDDNDKISIDSVSVSK
FT                   NVVEVEVDEKIRKGTVLTLTIDNITNPEDKGSYEIEVKTSAETSYKGEKITISKSSSSS
FT                   SSSSSKGDFEASPSSKNAEDSISLTLGKFNLSSKSRLKEGKYIYVNFPSKDMLPKSISK
FT                   SDVKVNGYKPDYVSILDSDSIRIEIPSGADGDSYIKLEFTSSAGIVNPSKPDKYYSYEI
FT                   EYDSKEYKSKDVEITNTSNTPFTVSLSDSAAGARTSYTFDVDLSNKLGSNAEIEVEFPN
FT                   GVTVPPVLTSNSVTVNGAQVTNVSVLGNKVYFRTPYGFTSTNRASIKFAFEGYLTTPRT
FT                   AGTYTVTAKIDNKTYKSKEFQVSGVTPPVAVDNTLATVGLTRATASTPAGISIGIKAMG
FT                   APIVRNQGFIEVVLPVGFRVPAYLPANTVTVNGVAASFVGVRGQNLIIIPAQDIPAKTV
FT                   AQVNIAESAGIVNPATPGVYSIGVYNSEERGLLFSRPATIVALNGVSFKQSVASFTKAG
FT                   KTTGLAVAPYTVNGNTLMPTTFFRDALGFSISYTKTTAKVVSGNTVMQFKVGSNVATIN
FT                   GKNVTLPTAVQLKNNVPTLPLKTITERTGYKIIYVNGNYTVYK"
FT   CDS_pept        122539..122823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="BBR47_01130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41090"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHE9"
FT                   /protein_id="BAH41090.1"
FT                   /translation="MNDHTRRPRHEVVMINRRSLAISGVKNVESFDSEEFLLETDGGFL
FT                   TIRGQNLHMKNLSLETGEVAIEGLVHEMAYLEQGQAGDRSRGFFGKLFK"
FT   CDS_pept        122820..123392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /gene_synonym="spoVUB"
FT                   /locus_tag="BBR47_01140"
FT                   /product="spore cortex formation related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41091"
FT                   /db_xref="GOA:C0ZHF0"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF0"
FT                   /protein_id="BAH41091.1"
FT                   /translation="MNIVIQLQTVLAMSTCGALMGMGFDTYHVFKGKARLPLWLVFFFD
FT                   ILFWVGSMGVVFIVLVKVNDGIIRFPIFFGMIFGAWLYFLLGSKKYILFLHRVIKFCQW
FT                   FYRTVVKIIDILLVRPVLFLFRVIIMVLTFLYSVLLGILGFLWKVTRFVTSPFARWGQH
FT                   LGKKMYGKTTGFWTNWKNWFHSKRKRE"
FT   CDS_pept        123411..123719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BBR47_01150"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41092"
FT                   /db_xref="GOA:C0ZHF1"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF1"
FT                   /protein_id="BAH41092.1"
FT                   /translation="MKESRTSSINRKGQRRRMRLFFFVILCFFVWTSYTLFLQSGELSK
FT                   KETELGVLKQESAVLQQKQDDLTYEASRLNDQEYLAELVRKRILFTKQGESIYMIPD"
FT   CDS_pept        124243..126717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BBR47_01160"
FT                   /product="stage II sporulation protein E"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41093"
FT                   /db_xref="GOA:C0ZHF2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF2"
FT                   /protein_id="BAH41093.1"
FT                   /translation="MIANKNVTQAGHAWTRQVSDRMGTTAQTWGEKVADIIEKWNVLPI
FT                   LMGFLLGRALIVEELTPFAIPYFIVMFYIRRDCLLVTGMALIIGAFTQSVPVGLETSLS
FT                   VILAFFACKLMNKMRKKDFSRTPLLVVGTIFISRLLYAVLTNQVTTYELVMVAVEAILG
FT                   FVLTLIFIQSLSIIHLAKPYEPLKNEEIVSLVILLASLMTGTVDWMVEGISMEHVLSRY
FT                   LLLVFAFVGGGTIGAAVGVVTGLILSLANVSALLQINLLAFSGLLAGLLKEGGKVGVSA
FT                   GLLIGTAILAIYGGAEETLYFSLIETSLAIVLFILTPAAIWKKVARFIPGTPENLQSHQ
FT                   EYMRRVRDVTAGKIQQFSDLFTQLSHSFAQTADPEEIEEQADAFLSRVSEFTCQKCWKK
FT                   EQCWEKDTQSTYEGMRFLREKVYEHGTLAGVTPPRDWERKCVKTEKVMTVMEQEYDRQQ
FT                   SFDQLKKQIKESRMLVADQLSGVSRVMSDFAREIQREGMELSFQEKQVSQALEGLGLSV
FT                   RRVEIHSLEEGKVDIEISQPTCYGRDECAKIVAPMLTEILGENIVVRERHCEAQKDGSC
FT                   TMCLASAKTYEIDIGIAGAAKDGKLLSGDSFRTMDLGNGKMALAISDGMGNGERASIES
FT                   QSALDMLQQLLRSGMDEKISIKTVNSVLALRSKEEMFATVDLALIDLQTAHTRFVKIGS
FT                   TPSFVKRNKDVITITANNLPVGILEEIEVDVVSRMLKPGDLLVMMSDGIYEAPRHIENR
FT                   QAWMKRIISELETNDPQEVADLLLEKVIRQHSGQIVDDMTVLVARIDRFVPQWAAIAVH
FT                   GMEKLERPRIVS"
FT   CDS_pept        126838..127599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabS"
FT                   /locus_tag="BBR47_01170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41094"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF3"
FT                   /protein_id="BAH41094.1"
FT                   /translation="MKEATLRQILVVTDGCSNSGMSPVAAAALAREQGITVNVIGVIDK
FT                   SELGEKGEKEIRDIAEAGGGLCDIVYPQQLAQTVQMLTRKAMTRTIHQVVNKELKEILG
FT                   DSGIEELAPDKRVQVAGMVDELGEKSSLNVVMLVDTSGSMKPKLSAVQQAIHDFSISLH
FT                   SRSGHSRMAVGSFPGKQKHLDIRIPWTEKVEQAHQITSDLAMSGITPTGPAIVEAIALF
FT                   EQDKLPRSLQDRYIDQDDEDDSNGMLRDHVF"
FT   CDS_pept        127556..128524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabT"
FT                   /locus_tag="BBR47_01180"
FT                   /product="putative serine/threonine-protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41095"
FT                   /db_xref="GOA:C0ZHF4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF4"
FT                   /protein_id="BAH41095.1"
FT                   /translation="MRTTRTECCVTMSFKAATPDLPKHFTGKWNKKSYHVLRELGRGAN
FT                   GTVYLVSQGGVQRAVKVGVEGMDILMEVNVLKSTQQGRDSRVGPLLCDVDDLVVNGKAC
FT                   TFYAMEYLQGLQLDEYIKQEGTDWVAVMMVQLLARLDVLHQHGYIFGDLKPQNVMVTQT
FT                   NKQVRLIDFGGVTKLGNAVRQFTEEYDRAFWHAGDRRAEVSYDLFSTAVMMVRLTVGPE
FT                   TWKNSHGDPRHTILLCDIIRKSDSLYPYREPLLKAFHGKFATAKEMRAELLAVLRDSMG
FT                   AKPQKSQKKARAKGNVGAGISGLFVASLLLLAGTLYYAWFM"
FT   CDS_pept        128540..129289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01190"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41096"
FT                   /db_xref="GOA:C0ZHF5"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF5"
FT                   /protein_id="BAH41096.1"
FT                   /translation="MSSDLVMDTCLLAGSIILKNGGETYRTEETMALIAKAAGMDDVNS
FT                   SATPTSIILSFRCSGFDHTRMVRTPKRTTNLNKITLVNDVSRQFVGGKINLEQAYRTLR
FT                   EIDQKKQIYPKWLQHLAAATASGSFAMLAGGDWGSLVPSAIAGLIVNLSQEYLEQFVRM
FT                   KFFTEFSAALLGGLFALLTVTVFPQLHLSIIIIGAMLPLFPGIAITNSLRDLMAGDLVA
FT                   GVSRGVEAMLTAVSVAVATAIILSFTR"
FT   CDS_pept        129295..129747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01200"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41097"
FT                   /db_xref="GOA:C0ZHF6"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF6"
FT                   /protein_id="BAH41097.1"
FT                   /translation="MLLKGLALSFASSVAWCVLFNVPVRTIVAAGLAGVVGFLVYSILP
FT                   IYGAEVLLSTFVSAAVVSLLSQLLSIILRVPSTNFSVAGIIPLVPGSLAYKAMLAFVNN
FT                   DYVGGITQATKTLMVAGAIASGLIFGISVLTIWKGARYAGKRAQRD"
FT   CDS_pept        129719..131146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BBR47_01210"
FT                   /product="putative tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41098"
FT                   /db_xref="GOA:C0ZHF7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF7"
FT                   /protein_id="BAH41098.1"
FT                   /translation="MLASVRNEIEAEGLLLPGESVVVGISGGNDSTALLHILASLNKQY
FT                   QYQWKLHAVHLNHGFRGEEARQDALYAEELCRELGVVFHLFEYDVPAYMEKTGLGGQEA
FT                   SRDIRYRLYREVGLAQGATKLALAHHADDQVETILFRFVRGSRLNGLTGMPKRRMLADC
FT                   PIELVRPLLHKTRQELEGYCREHQLVPREDSSNQSRKYTRNLLRLDVMPLLEKVNDKYR
FT                   EHILATAEAIRQDEALLMRLANEQLKKVMIEKKPEAFLMDNDKFQTCDVALQRRMITLI
FT                   LSYLSKHTEWSSQHVETVLHMLGGSRPSAELHLPNDLVVDRVYERITFRRRKRQDRIHT
FT                   YSYELAVPGVTWIDESKATVHITYLEGPMDWERLSANEAVFDADQLPGSLYLRNRKPGD
FT                   RITLFGSANGKKLKELLIDAKFPRAWRDKLPLLTAGDEVILVPGVRRSAVAPINGQTRR
FT                   FLHVRVEFGEDWREVFS"
FT   CDS_pept        131143..131682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /gene_synonym="hpt"
FT                   /locus_tag="BBR47_01220"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41099"
FT                   /db_xref="GOA:C0ZHF8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF8"
FT                   /protein_id="BAH41099.1"
FT                   /translation="MNQDIEKILLSEEDIAGKVRELGETLAAEYKDKNPLVICVLKGAV
FT                   IFMADLIRHMSIPCEMDFMAVSSYGSGTESSGMVKILKDLDTSVENRHVLVVEDIMDSG
FT                   LTLSRLVELLRHREAASVKVVTLLNKPERRKVDISPDYKGYDVPDEFVVGYGLDYAEHY
FT                   RNLPYIGVLKPEVYTK"
FT   CDS_pept        131752..133698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BBR47_01230"
FT                   /product="cell division protein FtsH homolog"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41100"
FT                   /db_xref="GOA:C0ZHF9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHF9"
FT                   /protein_id="BAH41100.1"
FT                   /translation="MNRFFRNTGFYLLIFLVTVGIVNFILSGTDKVGKLTYQEFRVQLK
FT                   ADNVTDLSIRPENGTYRVEGTLAKAIPGQESNKFFTNVFLYDSDIIKLVEEKIDAQKMK
FT                   NVVVNPAEGNSIWLTFLTSIIPFVIIFILFFFLLNNAQGGGSRVMNFGKSRAKLYNEEK
FT                   KRVTFDDVAGADEEKAELEEVVDFLKDNRKFNAVGARIPKGVLLVGPPGTGKTLLARAV
FT                   AGEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGL
FT                   GGGHDEREQTLNQLLVEMDGFGGNEGIIMIAATNRPDILDPALLRPGRFDRQITVDRPD
FT                   IKGREAVLKVHARNKPIGEDVKLEVIARGTSGFTGADLENLLNEAALLTARRNKKQITM
FT                   TEVDEAIDRVIAGPAKKSRVVSEDERRLVAFHEAGHTIIGYHLRNAEMVHKVTIIPRGQ
FT                   AGGYTVMLPKEDRFFATKTDLLDKIVGLLGGRVAEELVLGDISTGAHNDFQRATAIARS
FT                   MITEYGMSKLGPMQFGKSQGQVFLGRDYGNERNYSDKIAYEIDQEMQSIINECYAKCTE
FT                   LLTKHRDQLDLIANTLLRVETLDAEQIKQLIETGKMDNDPDANKDVVVNIQPKLEEVKE
FT                   ESKQEDTNEEPKQ"
FT   CDS_pept        complement(133928..134029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41101"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG0"
FT                   /protein_id="BAH41101.1"
FT                   /translation="MGLPFSQHSGGEEKAQVSSTLTRQLGDSLGVST"
FT   CDS_pept        134051..134920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41102"
FT                   /db_xref="GOA:C0ZHG1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG1"
FT                   /protein_id="BAH41102.1"
FT                   /translation="MLLTPGMVAFDMDGTLLTHDSKLTEGTKEALRQLQQQGCKLVLST
FT                   GRMYGSAQIPIDSFPFDGYVCSNGGTVFEGDGTLVRQWLLPTEMVIGAIHALRQETIYY
FT                   ELHDTNSNRWMIKEDRERLEATMSEDASVEGFSILSFPYYRLARVEPLAEVLEKVESGE
FT                   VEIVKFFVWHQDPDRLEWVKEQLKPWSEQVTITSSGKQNVEVIPQGVSKWEGLQYFCEK
FT                   WGISPEKVMAFGDAENDREALTGAGYSVAMENASDEIKQVAKYIAPHHNEEGVARFIRE
FT                   RVLGEKGE"
FT   CDS_pept        135058..136002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="BBR47_01260"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41103"
FT                   /db_xref="GOA:C0ZHG2"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG2"
FT                   /protein_id="BAH41103.1"
FT                   /translation="MDALALEKKAQRNAELRERLLQLKKERNAIILAHFYQRPEIQEVA
FT                   DFIGDSFGLAQKAKETDADVILFCGVHFMGESAKILNPQKTVIIPDERAGCPMADMVNV
FT                   DGLRKLKAQHPNAKVVAYINTSADVKAETYICCTSSNAKRVIESIDSDEIIWVPDKNLG
FT                   HYVSQFTDKKMIIWEGYCNTHDQLSVEDIMTLKQQHPEAVVVVHPECRPEVVSLADYVG
FT                   STTGILKYCRESSHKEFIIGTEDGTRYMLEKDSPDKTFIFASKYLVCPNMKVNNLKKCV
FT                   EALENMKPEIFVPEDVADAARASLERMLAVAPA"
FT   CDS_pept        complement(136276..136767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41104"
FT                   /db_xref="InterPro:IPR025673"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG3"
FT                   /protein_id="BAH41104.1"
FT                   /translation="MKRKSWLAITFITAALLNGCGSTDQAEQNHSDHTQHAPNGDLQEL
FT                   TASADQLPKFLDNQDPVIIDSYKVAAANRELLKSIPCYCGCGESAGHGHNGNCFIKEEK
FT                   SDGSIVWDDHGTRCGVCMEIAVISGKLKAEGKSTKEIRTYIDQTYGQGYGKPTPTPMPS
FT                   "
FT   CDS_pept        136960..137925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01280"
FT                   /product="putative zinc ABC transporter substrate binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41105"
FT                   /db_xref="GOA:C0ZHG4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG4"
FT                   /protein_id="BAH41105.1"
FT                   /translation="MKRAMLAALSFITAVGLVGCGAANETAGTPQAGNEASGKPKVYTT
FT                   IYPLEYVAKRIGGEHVEVTNLVPAGVEPHDYEPTAKDMVALSGADIFAYNGSGLELWVE
FT                   KAVTNLDKNKTTIVNATEGLEMIRAAEHEHEGEGHTEEAGHDHGDLDPHVWLDPMQLKA
FT                   QAEKVKNTLVQKDQAHAADYEKNYTQLATDLEQLDKDFKDMVTQAPKKEFMVSHSAFSY
FT                   MAKRYGLEQVAISGVNPSDEPSTTELKSLVEHVKEHNISYVLFETLVSPKVAEVIAKEA
FT                   GVKTATLNPLEGLTEDDVKAGRDYLSIMRDNMNTLKTALQ"
FT   CDS_pept        138058..138828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01290"
FT                   /product="putative zinc ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41106"
FT                   /db_xref="GOA:C0ZHG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG5"
FT                   /protein_id="BAH41106.1"
FT                   /translation="MEPHKQEVPVIKLTGVSFQYEDKQVLDEVEFTLERGDFVGIVGPN
FT                   GSGKSTLMKLILGLLTPNKGTVELFGQPLSKFREWNRIGYVAQQVAHGAGGFPATVREV
FT                   VSSGLVGKVGLFRRLTKQHHENVRAAVERVGLLEKLDQRIGNLSGGQLQRVFIARALVA
FT                   EPELLILDEPTVGVDQESIDQFYSLLRSLKEENGLTMMIVSHDVGVMSQWVTKVACVQK
FT                   KIHFHGTAHDFEHNQDKILQSMYGDSVRLLSHHH"
FT   CDS_pept        138864..139703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01300"
FT                   /product="putative zinc ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41107"
FT                   /db_xref="GOA:C0ZHG6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG6"
FT                   /protein_id="BAH41107.1"
FT                   /translation="MLADWWQYDFLRYTLFSGILIGLICPILGTFLIVRRLSMMADGLS
FT                   HVTLSGVAAGMLISKKVAFFSLVNPLFFGMLFAVIGSLFIERLRKVYKAYQDLAIPIIL
FT                   SAGLGLFTVLISIADGFNADLYSYLFGKIVTVSIEDLYALIGVAVVVLGTVVLIYKELF
FT                   AVSFDEEFARVSGVARRSINLLFMVLVALTIAASMRIVGVLLISALITLPVAASLQIAK
FT                   SFRQTIYLSILFAEFSVLSGLYFAYLLDWASGGTIVLMAVLVMLVVLGVKKLRVAFR"
FT   CDS_pept        139743..140168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="BBR47_01310"
FT                   /product="zinc-specific metalloregulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41108"
FT                   /db_xref="GOA:C0ZHG7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG7"
FT                   /protein_id="BAH41108.1"
FT                   /translation="MKVEEALQILKEHGFKYTGKREEMIRICATEKRYLSAKDIMERIK
FT                   EQYPTLSFDTVYRNISTFVELGILEETELDGEGRFRLACSTDGHHHHHVICTECGKTSS
FT                   LPGCPMNIISAVPEEFQVTGHKFEVYGTCKECVTHSN"
FT   CDS_pept        140332..141906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="BBR47_01320"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41109"
FT                   /db_xref="GOA:C0ZHG8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG8"
FT                   /protein_id="BAH41109.1"
FT                   /translation="MRADVAVIGAGIAGLYTALQTSEYADVVLISKKGLDDSNTRWAQG
FT                   GIAAVTAQSDSPALHRQDTLIAGAGLCSYNAVEVLVHEGPDRLHELIAYGTEFDRDEQG
FT                   EYELTQEGAHSKRRILHANGDATGAEIVRALSKRLMEQPNIQVLEYHFAVDVITQDGEC
FT                   VGVLVRKPDGELFFLEAKATVLATGGAGQLYRYTTNPQIATADGIGIAYRAGARIKDVE
FT                   FIQFHPTALYYPGAPRFLISEAVRGEGAILRNSNGDRFMDKYHPQKELAPRDIVARAIV
FT                   SEMEQTKSTFVYLDITHESEELIKRRFPTIYNFCLQYGLNMVTDWIPVAPACHYIMGGV
FT                   QTDLNGETSTSRLFACGEASCTGVHGANRLASNSLSEAVVFGHRIAERIKQLADLPSIH
FT                   PFEVVSKQKLPQTFNTREQRLKMQKLMLRHVSVKRDDKGLTKALAELARMEQYYQYEPE
FT                   SLETFEFFNLLNAAVLTTRAALLREESRGGHYRTDFPNKDDLVWRKHLIQSVEDGVQEE
FT                   CEKHDVE"
FT   CDS_pept        141893..142741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="BBR47_01330"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41110"
FT                   /db_xref="GOA:C0ZHG9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHG9"
FT                   /protein_id="BAH41110.1"
FT                   /translation="MMWNKRELQRKIEEWLQEDVGFGDVTTMSTIPESEQGVGILYAKE
FT                   AGIVAGLPIAEQVFATVDSTLVFEAKVEEGARVEVGQQIAEVSGSVRSILSGERLALNL
FT                   MQRLSGIATKTSEYATAVAGTKARVVDTRKTTPGLRALEKYAVRVGGGYNHRFALYDAV
FT                   MIKDNHIKGAGGIAQAVAAARAVIPHTMTVEVEAESFEQVQEALAAGADTIMLDNMSLD
FT                   QMVEAVQFINGRAVVEASGGVSLETIGDIAKTGVDIISVGALTHSVKAFDISLDLNTRK
FT                   R"
FT   CDS_pept        142754..143521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /gene_synonym="yacB"
FT                   /locus_tag="BBR47_01340"
FT                   /product="type III pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41111"
FT                   /db_xref="GOA:C0ZHH0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZHH0"
FT                   /protein_id="BAH41111.1"
FT                   /translation="MLLVIDIGNSNIVLGLYEGDELQHHWRVSTDRNKTEDEYGMLVKS
FT                   LFGSVGLGFEQVRGVIISSVVPPLNLTIERMCGKYMQQKALIIGPGIKTGLNIKYEYPR
FT                   EVGSDRIVNAVAAIHHYGAPLIVVDFGTATTFCYVDERAQYWGGAIAPGIGISTEALFT
FT                   RAAKLPRIEITKPASVVGRNTIAAMQAGIFYGFVGQVEGIVRRIMDEYGTQPTVVATGG
FT                   LASLFANETSCIHVVDQNLTLKGLRLIYERNQS"
FT   CDS_pept        complement(143516..143947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41112"
FT                   /db_xref="GOA:C0ZHH1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZHH1"
FT                   /protein_id="BAH41112.1"
FT                   /translation="MTSIRLATPQDIPAVCTIDAIVIGSTSRSSELQEAIEKGHCYLAL
FT                   IDKNIVGFAIINQSFFKNSFIHLLIVHPHYQNRGVGEEMMRYLETISPTEKLFTSTNLS
FT                   NERMQRLCLKLGYVHCGTLTHLDQDDPEMFFCKYVRQSL"
FT   tRNA            144704..144796
FT                   /locus_tag="BBR47_t0260"
FT                   /product="tRNA-Ser"
FT   tRNA            144813..144889
FT                   /locus_tag="BBR47_t0270"
FT                   /product="tRNA-Glu"
FT   tRNA            144920..144995
FT                   /locus_tag="BBR47_t0280"
FT                   /product="tRNA-Val"
FT   tRNA            145074..145150
FT                   /locus_tag="BBR47_t0290"
FT                   /product="tRNA-Met"
FT   tRNA            145228..145304
FT                   /locus_tag="BBR47_t0300"
FT                   /product="tRNA-Asp"
FT   tRNA            145345..145420
FT                   /locus_tag="BBR47_t0310"
FT                   /product="tRNA-Lys"
FT   tRNA            145451..145536
FT                   /locus_tag="BBR47_t0320"
FT                   /product="tRNA-Leu"
FT   tRNA            145545..145620
FT                   /locus_tag="BBR47_t0330"
FT                   /product="tRNA-Gly"
FT   tRNA            145627..145703
FT                   /locus_tag="BBR47_t0340"
FT                   /product="tRNA-Arg"
FT   tRNA            145709..145785
FT                   /locus_tag="BBR47_t0350"
FT                   /product="tRNA-Pro"
FT   rRNA            146064..147574
FT                   /locus_tag="BBR47_r0070"
FT                   /product="16S rRNA"
FT   rRNA            147640..147756
FT                   /locus_tag="BBR47_r0080"
FT                   /product="5S rRNA"
FT   rRNA            147873..150787
FT                   /locus_tag="BBR47_r0090"
FT                   /product="23S rRNA"
FT   CDS_pept        150993..151721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41113"
FT                   /db_xref="GOA:C0ZI95"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZI95"
FT                   /protein_id="BAH41113.1"
FT                   /translation="MSIHPLRLLAILLFATCIGVATYIILKPHQVTYIQLRSTVEKESG
FT                   QLLEARDMEPLTLRLGGIFQQPIAPIPGLIPWEEGQSLVGLAFTRQVKGGRPLLKSDLE
FT                   QTSNAQGSGVITEKMTGMSIPIDNVAGVSPHVSSGERVHVYASFEDETGAHSGLLLQNM
FT                   PIIGIQREMEGDHPNLVAVTLSLTRDEAVLLTHALHYGKIRLGLAAVKDEGNPGIGDVK
FT                   FASELMKTKTRWGIKKEEHE"
FT   CDS_pept        151718..153121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01370"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41114"
FT                   /db_xref="GOA:C0ZI96"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZI96"
FT                   /protein_id="BAH41114.1"
FT                   /translation="MKRRLLIVDDDRDSVRLLKAQLINSRWIEVCGEALGVEEAWAKLQ
FT                   ANQPHLVLLGGIKGTERGVLCQQFRLAFPHLSFIAACSSNELMWEPFFRNLGLWVIAKP
FT                   IEPGQIEALAMMIQPPGMVAEAAPQQHQYVIQEQTRSYPSQQPSISEPITDSLVPEMTR
FT                   PKQLITVYGPKGGVGKTFISRELAIFFSMQKNEGVPLRVIAVDFNLDLGTFATTLNLPR
FT                   TPNLFTWVKDLDAQLHSFIQDQGKDPYSISSEEWQEYAQALPLSPQHIEKYVVAHPDTG
FT                   LHVLTSPRDIRQSFEIRDYHLYLILETLKQSNYDVILIDTAPDTTDATIQALFFAEHVV
FT                   MVGNPVVDSIENIQRLLKLLREAEYPEERIQICMNRLQRKEMFTLDEIRAYFQLLPSKK
FT                   IFSIPDDVEVKKSINTGTPVMLQSGRIPAKEAIETLGKALFPVDGEQMKAAEKEKQKEK
FT                   TSLFKWLWG"
FT   CDS_pept        153133..154620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41115"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZI97"
FT                   /protein_id="BAH41115.1"
FT                   /translation="MFDKKQLLGISNQVRPAQELRSAGRGTAGVPATLHEKMQAPDHER
FT                   TNEKWVGTDRETSIRTQIVEKYGKRLWEEKHSSLFMDELTADIRMLLESQTTLTSIQME
FT                   AEVKRLLHSLTGWGPLDALLEDNDITEILFHRYNYLVIERKSTGRLESPEIAVFRDEEE
FT                   LLRLLEQIAATMGREFNETKAELHTQLPDGSRVAATHRSISPDGHMLTIRKHRELLSES
FT                   DYLRYGSICEPMLLFLNRAVRLSRASGIVSGGTGSGKTHMLNLISQYVPDHLSIITIED
FT                   VLEMKLQHPFVRRFLAKPANYEGKGGFSIKDCVRLSLRKRPDVIMVGETRGGEIVDMLW
FT                   AMNTDHPGSWSTAHANSPRALVDSTLPILFGKADEGYSAEERNLMIGSALDLIVQVKRF
FT                   EEDGSRKVVAITEVVGTGQSHEEWIKRACNIKQVLPDRVYLQDIYVYEVTGVENGRVKG
FT                   HFKWTGYRPERLIKRWLEKGLSREEIDRVFFTTPIPL"
FT   CDS_pept        154632..155528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01390"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41116"
FT                   /db_xref="GOA:C0ZI98"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZI98"
FT                   /protein_id="BAH41116.1"
FT                   /translation="MDISLPVAIGMGMAILLLILPNKLYMREPTGKHEIVEVLQQDRKT
FT                   IWKKFEERLAKSRSGWGVNQYVTLSFLLGIASFGVSSQILQSWWMALPALLAGILFTER
FT                   LVSVWGARRKEDFEAGNVKAIRLMASSLRTSPSYLHAFEQVATSPFLSEIVLEEYRRIV
FT                   ELLRAQVPLEHVMNRFFERTGSADVKYLATIVHIQREMGGDMAKTLDLAASSILRRRQS
FT                   LRRQKAAMAQIVAQVNLLSVMPFVFVIALYVNNPNHFDPLTATIGGRFLILGSLASILI
FT                   GGEAIRFVAHKSISRGA"
FT   CDS_pept        155540..156454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01400"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41117"
FT                   /db_xref="GOA:C0ZI99"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZI99"
FT                   /protein_id="BAH41117.1"
FT                   /translation="MFVLVLSILVSVAIFLYGLPSCVSKGEPISATLLGRIDSVKQAKL
FT                   EQSFQQGRKRWTLVRSLEKNQVLLQHFYKWTGVDKKKIQETLARLGIDISLTEIVLFRL
FT                   ISMCFIVSSLASLSISMVHGEKITMVTGLPLTISLFLYLLPNMLLDRVDKRAKAEIREQ
FT                   VPIFFSIVQSLVEAGMPLQQAVKQTARRFDARLGRELASLEMGEKRHGNWRKALEELAF
FT                   RWEVDSLTTIALEMNEAMKKGVSISQMLSVQVEEQVRQQEDEAATHMNRLNIRLLPFVI
FT                   MLMGLPLLFLVMGPAFIGIGESL"
FT   CDS_pept        156545..156721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41118"
FT                   /db_xref="GOA:C0ZIA0"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA0"
FT                   /protein_id="BAH41118.1"
FT                   /translation="MGTIADYVKRFWYEEDGVTIVEMVIIIAVILIVLIPTLTQLGTAE
FT                   DEKLKELQEKISK"
FT   CDS_pept        156763..157215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41119"
FT                   /db_xref="GOA:C0ZIA1"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA1"
FT                   /protein_id="BAH41119.1"
FT                   /translation="MDWRQRRIPNTLVFPVIAVGLWYQWEGELLAGAVLGVAGAFLLTV
FT                   GPVILKGMGMGDQKLLMAVGAWTSWSVVYSLFLHSIILCLIVMVFYPQNWARLRNNLQI
FT                   IAAGWTAHRQVWLPGREKTAFSFPYAVYLLGAFVLQSVRDVIGASG"
FT   CDS_pept        157233..157643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41120"
FT                   /db_xref="GOA:C0ZIA2"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA2"
FT                   /protein_id="BAH41120.1"
FT                   /translation="MIRARVKDERGSQMIEFILVFPLVWILIVFSFDQFSMMYNKQKAL
FT                   AAAYEAGRIAAVQPNFGLAKFHAKQRGTSELAQGIGVLHKDVQLELDGNGWRKGSHVKA
FT                   KATVSFRLLSTGELFEITESYYMMVENAEEKQ"
FT   CDS_pept        157640..158149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41121"
FT                   /db_xref="GOA:C0ZIA3"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA3"
FT                   /protein_id="BAH41121.1"
FT                   /translation="MNDSLHHFLIRVKEERGATMITVLFFLFCLGSLLSILLFLEQTDY
FT                   LKMKMQHTADLITKGARAAGKWEYVDTNGDKQIRLFATTEEAERRDADIIRGAREEAGI
FT                   LWRLNRPNLERTSDEVSVINQKGERPYLYLQGIYHLEVKVEKNIPVFWDELFVKMNRVS
FT                   QSGVYE"
FT   CDS_pept        158241..158864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41122"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA4"
FT                   /protein_id="BAH41122.1"
FT                   /translation="MTVPSKIVDRYKRILSGEQKRFSPYEFEDVQYRKQKVQLVVRYAI
FT                   ENVKRWTPEQARRELNLQDVKELKLHLVREFIEPPIEAKTEDVYYFVEFAYPYLPRLSE
FT                   EQRVLWVYQEVLSGIRRHFPPAYFQSIKGEERAKICVDYMCKHLLKLADLRQLPSIFSK
FT                   TERAYTLLKTYKLKILVDTLYFSPFDMVTEMYPELSDPSYWDEL"
FT   CDS_pept        158973..159251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41123"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA5"
FT                   /protein_id="BAH41123.1"
FT                   /translation="MATVEAHQKCSASVEQLLGRQVRYQKHKPGRHLSVERVPQGAFQI
FT                   ESVHRFGDRVVLNDGLIVMENAPTVMERAGRIALLFATGEELYFVTE"
FT   CDS_pept        159400..160164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41124"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA6"
FT                   /protein_id="BAH41124.1"
FT                   /translation="MLAKSAIELVNRCYEETNKLTLLSLEEFKESFIAFVFGDYQEEFM
FT                   VQYDLEEFYEHLNQLQLSNCRRDFDRAVEEWYITEYGSGYKGVNYHDILFTLVKEAVVQ
FT                   YQSPNRIALIRDVTKLLTMPNGFLARWQDGQIRERPIPTYFKYLMKLGVRTHEDIETLV
FT                   DMWLVEYPNAFNKKQQELFANPPRRGRPNNVELALLIELAMKVRPEMTAQERERLRKIY
FT                   YYHRKSLTVREMVEKFEKYIASKNKSNDSQVG"
FT   CDS_pept        160167..161045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41125"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA7"
FT                   /protein_id="BAH41125.1"
FT                   /translation="MFHQMSRFVSRFRDLEQQEFSQSIEEERQWRILKEKLASPQIVEQ
FT                   LESYQRKCIAVMSLYAQAGASFLASNLAYAWSGKGIPVTLCELPKVTSYYYFALDFERR
FT                   ARQQVRDSPTSLLLMQNNHLRIQIESPARLQQESSQTDTANWLLRICKDSPIVVIDVSS
FT                   YWNDAHSKQIFEHADEIWVVFDADLARLTRLFLAEPAPAWWKTERRKIKMIANKWNSQL
FT                   SRTSIMKKVEGTLSLWDQQPGATQVTNMIPLMNGEKTAMASAKANLFLEIFPEEEIEFQ
FT                   SLIHAYKGRML"
FT   CDS_pept        161042..161830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41126"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA8"
FT                   /protein_id="BAH41126.1"
FT                   /translation="MKKQTLLVICLISFLLAGSSFYAATQYIDAMAAEKLFAPVIKVAA
FT                   GKEISAFEPITQDDVILVQEEVDEILPGSARDLDTVLGKRSTQTMYEGEQLLVEKLTDS
FT                   QLLPEKGEARYEFPLLSIHPLTELRKGDHVKIWVKYKSLTELKDYPTPLHFRKTNDTAD
FT                   LLFESQLASVRDSNGIEIYTLKPSLLPSPDQMDSIFHGSREKPLQNGEKRYRDYRVQPT
FT                   ALPAFIGFNLTDEEYVIITEAMSYGMLQVGHIMGSKEQAS"
FT   CDS_pept        161827..162945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41127"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIA9"
FT                   /protein_id="BAH41127.1"
FT                   /translation="MKILVCYPMKSLAKTYMPMYSDVLVAESAAEFSRLVQLYMPEASV
FT                   IFSEMFNSPVWEWLPALKAQLPPNSPLIIVPLYRDEKMIEKVAEESGLEHVYILSAHLS
FT                   QEEIRHQISLILGFVQECADIGSSKEKGFVYALLSYGASGITTFCINYPVILARQHPEK
FT                   RIVVLDMNEAKPDLSRFFKLQQHQLSLFRPDFIDIQTTAKRNWSNVCKQSAHLPNLYYA
FT                   HAASKWKSSELSNLITVFRRQFDYVYVDWGYCFPESETLQRLLHTVDRNLLFVRADPFS
FT                   IDSAREWLYKWKERGVKCEVLLSHLDPGQPFRIGEDVSVYGVVPRISENRLMQSHQSSS
FT                   VLIEEFFAPKSYISSLKEIAKAQYMDRSAVFC"
FT   CDS_pept        163065..164297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41128"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB0"
FT                   /protein_id="BAH41128.1"
FT                   /translation="MQRILALAEQGDRDSHNHIILRLQHYFEEVLQRPVTEQILPHVNS
FT                   YEGLTFSTYGWGILDAVLHLSPWVEEVRISANRNIAYLEQGVKKFLSYTPSWKEVETLQ
FT                   QKLTNTAGLSFNEKKPRLSGYLHSLKARLTMFTFPYSRVPTILVRRFTTPAFSLDQLRT
FT                   QQQPAFDERIQWLMEQQVYGRSNVLVIGPMAAGKTTLMMCMLKLKDPRTEYITIFESEH
FT                   EMRFGDIWPGEVIELQNVEEIGIELEHCFKDMYRSTANTILIGEIREPIEAYHFINAGI
FT                   RGTDATIGAMHERFAHRALHDLTDLVYQYGGRSVELTQERISRAVNFVNSLTYRNNGHR
FT                   FIDAIHTTEWNSSFNRVESIPLVGRNMQTGAYEWTGNQLSPPLVEYMCYVGKADIEVLK
FT                   ELRLTDIGRQL"
FT   CDS_pept        164294..165193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01520"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41129"
FT                   /db_xref="GOA:C0ZIB1"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB1"
FT                   /protein_id="BAH41129.1"
FT                   /translation="MIYTFLFPVFLCLFSGFLFLGLHLYKGWRSPRVFFPRTVEVWREK
FT                   FLRHSTRRMLYEHFERWCQIVGGTPEGYLLLSMIGAIAGFISGILLGNMVVSLSLFLLF
FT                   LLLPTLILYARYIVQMNKKISSFCRFVELFARYYNSRKNIVLTFREMIEECPKELLPDL
FT                   LLLNNSLSDGGNSVAAVEKFAQRLDHPWAFDFATYISSGLEGETEDIQSPLNRLTNEMF
FT                   VQQDEKHERDSEIYSIWISLLIVIAICICLIPYNQGLLQDSYRLYFYTPDGQAILAIAA
FT                   TVWTFSILLAFIWGRRYR"
FT   CDS_pept        165193..166032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01530"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41130"
FT                   /db_xref="GOA:C0ZIB2"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB2"
FT                   /protein_id="BAH41130.1"
FT                   /translation="MPMLIMYTYLGIGALFVFSAAFMIGKYLFHKQKPKLFVSGMWWEK
FT                   WEQALKPDEDDKWEQLLSRAGRPFGWGKPEWVFLQLLTGSMVCILVLMWVVVSRVESFP
FT                   LLSMCLASAGSYMLPYMGLKTWANHREDMLSTDIARFINRYVTLLENQVPIYNAMVKAA
FT                   RPTRKLKEYIPTLSEWNRDPNEALESFKRKIGVDDGIILVSSMRTIETLSEGQVSATMQ
FT                   RMEWAVDHRRMFRHRKKIKSLGIGYTVIVYPAFYMGLLVAMFPWYKLLTEILDKYLT"
FT   CDS_pept        166427..166573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41131"
FT                   /db_xref="GOA:C0ZIB3"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB3"
FT                   /protein_id="BAH41131.1"
FT                   /translation="MMLHIHVLLIISIMVGSLCAVLWNLQPEEQLKQTQQERVYRAATV
FT                   IFH"
FT   CDS_pept        166598..167005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41132"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB4"
FT                   /protein_id="BAH41132.1"
FT                   /translation="MVKAKVFLICLLVLLLITSALGAYHLYAMERAIARGIYADLLDDM
FT                   QDIGYLEPTLADYYLLKMKGLGWEVTVDTFAGSWPRTEGERARKERQEAITLSVTIQPS
FT                   KVTQWLHKFVEGDTSFSFTGSRPSEYFDPGW"
FT   CDS_pept        167009..167161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41133"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB5"
FT                   /protein_id="BAH41133.1"
FT                   /translation="MNKMISILAVMAIVLPLTVGLLLTGPQNLFSACTQFFGDLLAEVT
FT                   RFGTG"
FT   CDS_pept        167179..167577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41134"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB6"
FT                   /protein_id="BAH41134.1"
FT                   /translation="MILNIMVMLLVPLGLLQVHTVVQARNELLEVSAAATKYVSNHGGT
FT                   SEANLQQEVRALITRELREKKLSIPDQELFVSVTRTRSLDPVLWSHEDEFVVELAIPYP
FT                   RFTSWIPMPADSLQVQRIGTVNIMDYDL"
FT   CDS_pept        167633..168196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41135"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB7"
FT                   /protein_id="BAH41135.1"
FT                   /translation="MLFFLLVGMFIVDADLAMQKKTEVKILLELSNHHATFAVDPVLKT
FT                   EGVIDLLEEEALERFDDRMHENGGYRREQAMFFPQADSVTTDPIPFSRYYVDFRSWRND
FT                   HQLRLQYNGKTLVTERATKGPARPGGGMLQITVVTERGEELQLAPKTMVGPSHVVVAYI
FT                   DERPFLPMLPSHSFPVVSVEELKD"
FT   CDS_pept        168334..168675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41136"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB8"
FT                   /protein_id="BAH41136.1"
FT                   /translation="MFDKDTIYIVGDAQSSSNNPITQQFSAFFIGLVVDTSNDKIVDAA
FT                   CSSTVQLTSDFARSIFIGHSIMASEEIGEEIRFRYFGSSQKTLIAAFKDAQKKYKQAVS
FT                   TRNKATVTK"
FT   CDS_pept        168812..169750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="BBR47_01600"
FT                   /product="dipeptide ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41137"
FT                   /db_xref="GOA:C0ZIB9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIB9"
FT                   /protein_id="BAH41137.1"
FT                   /translation="MLSFVFRRFISMIVTLWLIITLTFFLMHAVPGSPFEKEGKALNEA
FT                   VAANLNAYYNLDKPLLVQYGLYLQKLVQFDLGPSIANSSDTVNKMIARGFPVSFQLGLI
FT                   SVVFAIVTGIALGVIAALRHNRLIDYLAMIIAVIGISVPSFVVASLLIKYMAVEWKLLP
FT                   TATWGSWQHVIMPALALAFGPIAIIARLTRTNMLEVLTQEYIETARAKGLSPATIVLKH
FT                   ALRNAILPVVTLLGALIANVLTGSFVIEKIFAIPGMGKYFVAGINNRDYSVIMGTTVFY
FT                   SALLIFLMFVVDVLYGIIDPRIKLHRKESEG"
FT   CDS_pept        169747..170664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="BBR47_01610"
FT                   /product="dipeptide ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41138"
FT                   /db_xref="GOA:C0ZIC0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIC0"
FT                   /protein_id="BAH41138.1"
FT                   /translation="MIVSDDLFIPMRKDNLNAEAIVRPQLTFWQEAWLRLRGNKLALLG
FT                   LVVIILLGVMATIGPMISGHEYAKQSIIMKNKPPSDANWFGTDDFGRDVFTRVWYGARI
FT                   SLFVGLTAALIDFFIGVLYGGIAGYLGGRIDNIMMRFVDILYGLPYLLVVILLMVVMGP
FT                   GLLTIIIALSATGWIGMARTVRGQVLQMKNSEYVLAAKTMGAKPFYIIRKHLLPNTIGI
FT                   IIVYVTLSVPSAIFSEAFLSFLGLGIQAPMASWGVMANDGLPTILSGHWWRLFFPAFLI
FT                   SLTMLAFNVLGDGLRDAFDPKSRR"
FT   CDS_pept        170670..171695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="BBR47_01620"
FT                   /product="dipeptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41139"
FT                   /db_xref="GOA:C0ZIC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIC1"
FT                   /protein_id="BAH41139.1"
FT                   /translation="MDKTEKLLEVSGLRVTFKTHGGEVNAVRDVNFTLNKGETLAIVGE
FT                   SGCGKSVTARSIMRLIPEHIGKIAGGSIHFKGQDLAKLPEKQMRELRGKEISMIFQDAM
FT                   TSLNPTITIGEQIVEGIIRHQKVTRSEARRQAIEILTLVGIATPESRLKQYLHQFSGGM
FT                   RQRIMIAIALVCKPSILIADEPTTALDVTIQAQIIELFKSIQKKTGVSIIIITHDLGVV
FT                   AKIADRVNVMYAGKVVESGPVRDIFYNPQHPYTKGLLASMPRLDADRSIPLSPIPGTPP
FT                   DLFSPPIGCAFAARCDYALEVCRNYQPAETHVHSKHAVSCWLQDPRAKKLLASMQPPTG
FT                   T"
FT   CDS_pept        171814..173472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppE"
FT                   /locus_tag="BBR47_01630"
FT                   /product="dipeptide ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41140"
FT                   /db_xref="GOA:C0ZIC2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIC2"
FT                   /protein_id="BAH41140.1"
FT                   /translation="MEKLSTLLLTATLGVSMLMAGCTSGQPAASGEAAPGNTAQPNAPT
FT                   PGDQAAKLLLLNNIKEPTSLDPPIGFDEPSYNILNNLMEGLTRLDENQKPQPAAASEWT
FT                   VSVDGKTYTFTLRDNKWSNGEPVKAQDFEFAWKRMLDPALASPAASLAYIIEGAEAYNS
FT                   GKGPADGVKVKALDDKTLEVVLAQPASWTLLLASNPAFFPVHKATVEKDPKWAAEAASF
FT                   VGNGPFKLTEWAHDSELKIMKSDTYWDAANVTLSGAVWKMIDDENTEYQMFTNEELHRT
FT                   TTVPADMADQLFKDGKVFVRDGAGTEFYRFNVTKEPFDNANIRKAFSLAIDRKTLVDLV
FT                   LMRQQKPGTGFVSYGLPDANGEGQFREVGGELVNFNPDEAKKLLEQGMKEKGYTKLPEV
FT                   TLTYRSGTANEKTAQAAQEMWKQTLGVDVKLQKVEGKVLTDMQKQLQYQIARSSWLPDF
FT                   GDAINFLDIFQSKAASNRTGWSNAQFDKLIQDAYKEPDDTKRLKLLHDAEKILVDEAPI
FT                   APLYFYNTSLLSSDKVSGVQSSSLSYTDLRKAVVK"
FT   CDS_pept        173620..174714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01640"
FT                   /product="putative muconate cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41141"
FT                   /db_xref="GOA:C0ZIC3"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIC3"
FT                   /protein_id="BAH41141.1"
FT                   /translation="MIIQAIEVKRISVPLKKPFKTALRTVHSLESVLVKITCDNGMVGW
FT                   GEASATVVITGDSIESIESAIMNTMRPQLIGLNLLAYERVFQTLHQSMVGNTSAKAAVD
FT                   IALYDLISQRAGMPLYQFLGGYRDQLETDYTVSVNSPKEMGEDAAAYLKQGFHVLKIKV
FT                   GKDNIEDDILRIQEIRKTVGNQVKIRLDANQGWNVKEAVQSIRKMEDMGLGIELIEQPV
FT                   KAHDLEGLKRVTDSVDTPIMADESVFSPTQALQVLQNRAADMINIKLMKAGGIYKAQLI
FT                   NQLAEEYGIPCMVGSMIESRLAVSAAAHFAASKKNITRFDFDAPLMLLHDGIEGGVTYE
FT                   GRLMRMPEESGLGIRSVSLWEGEN"
FT   CDS_pept        174674..175633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfC"
FT                   /locus_tag="BBR47_01650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41142"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIC4"
FT                   /protein_id="BAH41142.1"
FT                   /translation="MVFVPSACGKGRTKMKSAIVSVSVATVWTKPESPRDIDQVALQSP
FT                   VDARSWLASLTVEEKLGFYDNNAIQTQALYGTRVEVVEEQGEWSQVLIPDQTTNKNATG
FT                   YPGWIPSRQLAPWSDAFVVQQGQKLAMVTAAFTRLHTADKKPDLELAFLTKLPLIEETG
FT                   DWVTVATPNGKGLLPKADVQIVNANKPIELSGNRGEAIVEAGKRFINLHYLWGGMSSYG
FT                   YDCSGFAYNMHRSVGLQIPRDASDQAKAGQLVEKEALLPGDLLFFAHEEGKGRVHHVGI
FT                   YMGNGEMIHSPDSRSAIEIVKLDGYKLEKEHCVSRRYW"
FT   CDS_pept        175659..176618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01660"
FT                   /product="probable ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41143"
FT                   /db_xref="GOA:C0ZIC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIC5"
FT                   /protein_id="BAH41143.1"
FT                   /translation="MQRKKLVQVNNLTKTFTLGKGLSLTAADNVSFDIYEGETFGLVGE
FT                   SGCGKSTTGRTIIGLYQPTTGEVIFDGQNVHQASSAERSKLTRHMQMIFQDPYASLNPR
FT                   MNISEIISEGLHLNGLYKGKERMNRVIELLEMVGLQKEHANRFPHEFSGGQRQRIGIAR
FT                   ALAVNPTFIIADEPISALDVSVQAQVVNLMKKLQQEQKLTYLFIAHDLAMVKHISDRIG
FT                   VMYLGNMVEMTASEILYESPKHPYTQALLSAIPVPDPDLEKSRERTIIEGDVPSPINPP
FT                   SGCVFRTRCPVAKAVCAEKKPIWQEVDTNHFVACHLYQ"
FT   CDS_pept        176869..177813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01670"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41144"
FT                   /db_xref="GOA:C0ZIC6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIC6"
FT                   /protein_id="BAH41144.1"
FT                   /translation="MTLSTSSFHSTPRRWREVETQLGIVVPRSLRSDTSALLFLESVAA
FT                   TPMLDKEEELACLIRYQRDGDLEARETIVRAYLRYVVSTALRHLKRGMPFLDLIQEGTI
FT                   GLFTAIDKFDVGRGVRLYHYSHWWISQAITRAINDKATLIRIPVHMHEQIRQYQKQVLH
FT                   LVHALNRTPDRQEIAVLLDIPLEKVEAIELALMMKMESIDAELDSEKWQTWHEDESLSY
FT                   AEIMDDGLSSLDDWIEKVDLRSQMRAALDRLSPRAQEIISMRYGLYDDQVYTLEEVGKM
FT                   FGLTRERIRQIEATTIDRLRTQKASHVLKDYLT"
FT   CDS_pept        177977..178849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BBR47_01680"
FT                   /product="33 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41145"
FT                   /db_xref="GOA:C0ZIC7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIC7"
FT                   /protein_id="BAH41145.1"
FT                   /translation="MGDYMIRATGFNGHVRAFAARTTESVEDMRRRHDMWNTATAAAGR
FT                   TLTITLMMGAMLKGNESLHVKVKGGGPIGQIMAEANAHGEGIAYVSNPHVHFELNDKGK
FT                   LDVARAVGTDGFVYVTKDLGLKEPYQGSAPIVSGEIGEDFTYYFVMSEQTPSAVGVGVL
FT                   VNPEDRSVLAAGGFILQLLPNTPEEVVAAIEERLGQLPQVSRMIGEGLTPEEILDRVLD
FT                   EPKILSHTEIQFSCKCSADKVVQALISMGREEMEGLIEEQGEAEVHCHFCNERYHYDRS
FT                   ALEDILKDM"
FT   CDS_pept        178878..179780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacD"
FT                   /locus_tag="BBR47_01690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41146"
FT                   /db_xref="GOA:C0ZIC8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIC8"
FT                   /protein_id="BAH41146.1"
FT                   /translation="MTNVKGLWAFIGALVLLLLAVTWAWYQASGKLQPAAIVGDKTISN
FT                   DEYVTALKQKFGKQVLNDMINREVVFQEAKRSGITVDPKQLEQELSQIRDSYGSRTDSE
FT                   FEAALIKQAGTTVEALKQEISYQILLQTLATKDMTIKDEELINVYNSRSDRYTRPMQVR
FT                   LGQIVVASQKEAEQVLADLKNGADFQTIAKARSIDADTAVNGGDVGWVSIKDNRLPDEA
FT                   KPIVEKLEKDKYSEAIKIQDQYVIYQLRERREASQRTFEEVKDELRREMAFAQVESLDV
FT                   VLERLRKSVGVQISGQMPH"
FT   CDS_pept        179863..180795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BBR47_01700"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41147"
FT                   /db_xref="GOA:C0ZIC9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIC9"
FT                   /protein_id="BAH41147.1"
FT                   /translation="MRVANSITDLIGFTPLVKLNRVVTEDIADIYLKLEFFNPGSSVKD
FT                   RIALSMIEAAEADGSLKPGDTIIEPTSGNTGIGLAMVAAAKGYRAILVMPETMSMERRN
FT                   LLRAYGAELVLTPGSEGMGGAIRKAEELAKEDSSYFIPQQFKNLANPAIHRETTARELL
FT                   DQAKEIGGVDAFISGIGTGGTITGVGQVLREHYPNVQIVAVEPAASPVLSGGKPGPHKI
FT                   QGIGAGFVPDILDTQIYDEIIKVENEDAFETARRVARQEGILGGISSGAAIHAALQVAA
FT                   KLGKGKKVIAIIPSNGERYLSTPLYQFED"
FT   CDS_pept        180916..182409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BBR47_01710"
FT                   /product="para-aminobenzoate synthase component I"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41148"
FT                   /db_xref="GOA:C0ZID0"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID0"
FT                   /protein_id="BAH41148.1"
FT                   /translation="MFPTFADCQTYALSYSLVPLALRRPWSSTIDPWQVLTKLQPSLQN
FT                   AVLLESGRAGRYTFLAYEPIATLRSQRGETIVSYPEGKMESIEALNPLNALRELLSRYR
FT                   TPVLPGMPDFAGGAVGYISYEMNRFFEPSLPQIATDDLQLPDLYVMIMQDLLVFDHETR
FT                   EIICLTHLNAGNLTEESYRQAALQLEKRIDSIASLTMDRDQTDWEALRKRPLAKLVPAS
FT                   VSFAKDQFEEAVRRVQEYIAQGDVFQVNLSVRQSKPVQVTAPEVYDVLRKLNPSPYMGY
FT                   LSFPEFQLVSASPELLVKVKGKEVHTRPIAGTRPRGLTDEQDDALARELIDNEKERAEH
FT                   VMLVDLERNDMGRVCRFGSVEVSEFMVVEKYSHVMHIVSHVKGELAAGKDALDAIEATF
FT                   PGGTITGAPKVRTMEIIEELEPVKRGVYTGSIGWFGFNGDIEVNIAIRTMVIKDGVAHV
FT                   QAGAGIVIDSVPEAEYAESLKKAEALWKALELSEQRTMS"
FT   CDS_pept        182427..183011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /gene_synonym="trpG"
FT                   /locus_tag="BBR47_01720"
FT                   /product="para-aminobenzoate/anthranilate synthase
FT                   glutamine amidotransferase component II"
FT                   /EC_number="4.1.3.27"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41149"
FT                   /db_xref="GOA:C0ZID1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID1"
FT                   /protein_id="BAH41149.1"
FT                   /translation="MILMIDNYDSFTYNLVQYVGELGEELQVYRNDKITLEEIERLAPD
FT                   YLMVSPGPCTPNEAGISMDAIRHFAGKIPIMGVCLGHQSIGQVFGGKVIRAERLMHGKT
FT                   SEVFHDGKTIFQDIPSPFTAARYHSLIIEEASIPSELEVTARTAEGEIMAVRHREYPIE
FT                   GVQFHPESIITEHGKQLLKNFLTAYARHTTG"
FT   CDS_pept        183193..184554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01730"
FT                   /product="alkaline phosphatase precursor"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41150"
FT                   /db_xref="GOA:C0ZID2"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID2"
FT                   /protein_id="BAH41150.1"
FT                   /translation="MFRTFPKKLVPMAVISSLAFTAFFGPTTGLVKAAENNNNAKVKNV
FT                   IFLIGDGMGTAYTTAHRYMKDDPSTPLMEPTEFDKYLVGAQMTYAEDHKQNITDSASAA
FT                   TAMSSGKKTYNNAIAVDNDKSEVETVLERAKKVGKSTGWVATSEITHATPASYGAHDES
FT                   RKNMDAIANDYYDLKINGEHSIDVMLGGGLKNFVRKDRDLTKEFKKDGYSYVTSKSELL
FT                   DDKNGKILGLFADGGMDKMIDRSKETPSLEEMTNAAIDRLSKNKNGFFLMVEGSQIDWA
FT                   GHDNDIVGAMSEMEDFERAFKAAIDFAKKDGHTLVIATADHSTGGLSVAAKDEYNFLVA
FT                   PIKAVKRTPDFISTEIAKGANVEETLKKYIDLELTPEEIASVKKATETKDQVKIDNAIE
FT                   AIIDTRSFTGWTTGGHTGEDVNVYAYGPGKEKVSGLIDNTKNADVIFEILGGKK"
FT   CDS_pept        184697..184867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01740"
FT                   /product="putative sec-independent protein translocase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41151"
FT                   /db_xref="GOA:C0ZID3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID3"
FT                   /protein_id="BAH41151.1"
FT                   /translation="MLSSIGIPGLILLLIISLLLFGPKKLPEIGRAVGQTLNEFKLSMK
FT                   DLTPDEEEKKM"
FT   CDS_pept        184906..185751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BBR47_01750"
FT                   /product="aminodeoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41152"
FT                   /db_xref="GOA:C0ZID4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID4"
FT                   /protein_id="BAH41152.1"
FT                   /translation="MHVYVNGTICPAHEATVSVLDHGFLYGIGLFETLRVYDRKLFLWD
FT                   AHYARLCSGLFALQIQSAWTKEELAEAILMTIDANELRDAYVRLSVTAGAEGVGLVAGG
FT                   YERPSLFVFAKPVAPLEVPPMPKRLQTLALARQTAEGQQRFKSHNYLNNALARQEVGAR
FT                   PDVEGLFLTHDGFVAEGIVSNVFWVKNDQLFTPSIDTGILDGVTRRHVLALAQQLSMPV
FT                   EEGRYRLEELLNADEVFTTNSVQEIVPITEIDGYSVLSTYGTYSCELHRAYRQSVAASE
FT                   "
FT   CDS_pept        186149..186991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BBR47_01760"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41153"
FT                   /db_xref="GOA:C0ZID5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID5"
FT                   /protein_id="BAH41153.1"
FT                   /translation="MPAKLRARRELNCGQYVLPLGERTLVMGILNVTPDSFSDGGRYVN
FT                   VEAALAQARAMVEAGADLIDIGGESTRPGSEAVDEATELDRVLPVIRMLSQELSVPLSI
FT                   DTYKAAVAERAILEGAHIINDVWGAKRDPRMAEVAARLDVPIILMHNREDTDYHDFFPN
FT                   YIKDLRESVQIALQAGVKQERIILDPGIGFVRTVEQNLETMRRLDDLVGLGYPVLLATS
FT                   RKRMIGHVLDLPVDERVEGTAATVALGAAKGCHMVRVHDVKEMKRVTKMMDAMLKGGI"
FT   CDS_pept        186995..187366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BBR47_01770"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41154"
FT                   /db_xref="GOA:C0ZID6"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID6"
FT                   /protein_id="BAH41154.1"
FT                   /translation="MDKIYFNGMSFYGYHGVFGAEAELGQRFYVDLELSLDLSRAGASD
FT                   DLHDTVNYADIFTCVQKIVEGERFHLVEKLTAVIAERLLEQFPLHEVKAKVTKPNPPIN
FT                   GHYESVAIEMIRRREDFAS"
FT   CDS_pept        187363..187893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BBR47_01780"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41155"
FT                   /db_xref="GOA:C0ZID7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID7"
FT                   /protein_id="BAH41155.1"
FT                   /translation="MTVCAYLALGSNLGDRAQNLRRAIQRLNEQPGIRVLRVSSVYETD
FT                   PFGYVEQDAFLNMAIAVETEQSPDQLLETALSVERELGRVRTVRWGPRTIDIDLLLYGT
FT                   SRVSQDNLMIPHPGLSERAFVLVPLRDVWEGGVLPEHNQTIDHYLSLLVEDHKGVREWG
FT                   AINWEIESGPSES"
FT   CDS_pept        187845..188054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazB"
FT                   /locus_tag="BBR47_01790"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41156"
FT                   /db_xref="GOA:C0ZID8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID8"
FT                   /protein_id="BAH41156.1"
FT                   /translation="MGSNQLGNRIRSFRKLKGYTQQSLSDKMGVSLSFVGSLERGTRTP
FT                   TEPVLRKIASTLQVDYDELCAINK"
FT   CDS_pept        188125..189153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dus"
FT                   /locus_tag="BBR47_01800"
FT                   /product="probable tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41157"
FT                   /db_xref="GOA:C0ZID9"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZID9"
FT                   /protein_id="BAH41157.1"
FT                   /translation="MKIGNIELKNNVVLAPMAGVCNPAFRLIAKEFGTGLVCAEMVSDK
FT                   GIVHGNKKTIDMLFVDEREKPLSLQIFGGDKETLVSAAKYVDQHTNADIIDINMGCPVP
FT                   KITSCDAGARLLLDPDKIYEVVSSVVDAVDKPVTVKMRLGWDEDHLYVLDNAKAVERAG
FT                   GKAIAVHGRTRVQMYKGKADWDWIRRVKETVSIPVIGNGDVATPEDARRMLDTTGCDGV
FT                   MIGRAALGNPWMLYRTIQYLTTGELGPEPTAREKMNICLLHAERLIALKGPRVGVLEMR
FT                   KHAAYYLKGLKGSTHTKNLVNAVETEEELRSVLMNFVDWIENYADDSEEPLETASDEAV
FT                   SY"
FT   CDS_pept        189371..189847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="BBR47_01810"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41158"
FT                   /db_xref="GOA:C0ZIE0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIE0"
FT                   /protein_id="BAH41158.1"
FT                   /translation="MSEKEVILTPEGLTKLEQELEDLKTVKRKEVAARIKEAISFGDIS
FT                   ENSEYEEAKNEQAFIEGRILTLEKMLRNARIITNEDVDTGVVSVGSRVKLKDLEFGDVM
FT                   DYTIVGSAESDPMNNKISNESPVGQALLGKAKGAIVDVNVPAGVIQYEILDINL"
FT   CDS_pept        189950..191470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BBR47_01820"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41159"
FT                   /db_xref="GOA:C0ZIE1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIE1"
FT                   /protein_id="BAH41159.1"
FT                   /translation="MANEQDLQQEEQQQEGLHELLQVRHDKMNQLREWGFDPFGKKFEQ
FT                   THHAADITKAFSEKSKEELEAEENVVTIAGRLMAKRGMGKASFAQLLDRSGQIQIYVRQ
FT                   DTVGEELSKVFDLADIGDMIGVTGVVFKTKTGELSVKAKELSYLTKSLRPLPEKYHGLK
FT                   DIETRYRKRYVDLIVNPEVRDTFITRSRILTSMRRYLDNLGYLEVETPTLHAIAGGASA
FT                   RPFITHHNALDMQLYMRIAIELHLKRLIVGGLEKVYEIGRVYRNEGISTRHNPEFTMIE
FT                   LYEAYADYQDIMSLTEEMVAHIAQEVLGTMKIQYQGNEIDLTPKWRRVHMVDLIKENLG
FT                   VDFWKEMSDDEARALAKEHGVSVEPHHTFGHVVNEFFEQKLEHTLIQPTFVYGHPVAIS
FT                   PLAKKNDQDPRFTDRFELFIVAREHANAFTELNDPIDQRERFEAQLLEKEAGNDEAHDM
FT                   DDDFIEALEYGMPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPHMRNRD"
FT   rRNA            191829..193339
FT                   /locus_tag="BBR47_r0100"
FT                   /product="16S rRNA"
FT   tRNA            193472..193548
FT                   /locus_tag="BBR47_t0360"
FT                   /product="tRNA-Ile"
FT   tRNA            193566..193641
FT                   /locus_tag="BBR47_t0370"
FT                   /product="tRNA-Ala"
FT   rRNA            193723..193839
FT                   /locus_tag="BBR47_r0110"
FT                   /product="5S rRNA"
FT   rRNA            194029..196943
FT                   /locus_tag="BBR47_r0120"
FT                   /product="23S rRNA"
FT   CDS_pept        197193..198314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41160"
FT                   /db_xref="GOA:C0ZIE2"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIE2"
FT                   /protein_id="BAH41160.1"
FT                   /translation="MKKILIFSASIGNGHNQAARAMQESLAESGCTSMIIDTLEYISPT
FT                   FHKILLESYMNLLRLSPKMWGRIYHNTEKTRFFDMNVLMNKLLANKLKKLINSVQPDAF
FT                   IATHPFASCMLSVLKGRNDWKEPIYTIITDYTIHPSWINHHINYYFIGHEQLYYLLDVY
FT                   RQDHQKFIPMGIPIMKKFSLPLEPELIRQKLGLAPEQKSIILSGGGLGLGSMEKVLDGL
FT                   EEINIPLKTFVLTGTNDKLYNKVTNRTYRHEVIPLKFINNFHEYLETADLIVTKSGGLT
FT                   SAEVMSKRVPMIVYNPLPGQEERNSHFLLNNGCAVHANLSEQLIYFIDELLHSPSKVEY
FT                   MRRMGQKISKPDAAQRITEFIMDDMNMLPGKVE"
FT   CDS_pept        198344..199030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41161"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIE3"
FT                   /protein_id="BAH41161.1"
FT                   /translation="MTVPFAILFDMDGTLLQTEKLSTPAFIRTFDQLRQKGLWQGETPD
FT                   ERELINVLGMTIEQIWDKLLPGASEEAIRSADAFLLDNEIQLLKERVTELYPDVKSTLE
FT                   KLHEKGVALFVASNGQEEYIDAICQAYELKPLMTDLYSAGRFRTHSKNDLVAKLLSDYK
FT                   IGQAIMVGDRHSDVEAGKTNGLFTIGCDFGFAKPGELDGADVIITSFSQLLNHLPAIDT
FT                   NKQEQA"
FT   CDS_pept        199219..199683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BBR47_01850"
FT                   /product="transcriptional regulator CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41162"
FT                   /db_xref="GOA:C0ZIE4"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIE4"
FT                   /protein_id="BAH41162.1"
FT                   /translation="MRNISDIIEHHLKSILTNSPNGSIEIQRSELADHFQCVPSQINYV
FT                   INTRFTVQKGYLVESKRGGGGYIRIRKVQIVSKARLQELLTEELIGESISQSVGYAIVE
FT                   RLLEEGLVNIREATLMKIATSRNVLTLEAELRDRLRANILKQMIAAILLK"
FT   CDS_pept        199700..200218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsA"
FT                   /locus_tag="BBR47_01860"
FT                   /product="modulator of CtsR repression protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41163"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIE5"
FT                   /protein_id="BAH41163.1"
FT                   /translation="MNCEECGKRPATLHLTKIVNGEKTEYHICEQCAHEKGDVFTGFHN
FT                   FSINNLLSGLLKFDPMQKNGRETATNKPLQCETCGLTYAQFSKSGRFGCSDCYTFLGDR
FT                   LDPLFRRIHGNTQHSGKVPERTGGKLKIRKELEQLKQALQSHVASEEFEKAAEMRDRIR
FT                   ALEQKMAQS"
FT   CDS_pept        200238..201311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="BBR47_01870"
FT                   /product="modulator of CtsR repression protein"
FT                   /EC_number="2.7.10.2"
FT                   /note="protein synonym:tyrosine-protein kinase McsB"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41164"
FT                   /db_xref="GOA:C0ZIE6"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIE6"
FT                   /protein_id="BAH41164.1"
FT                   /translation="MSQKQFMQNPWSNWMKGEGPDSDIVISTRLRIARNLRQHPFPLLA
FT                   TDSQAEEVVRKVTEVSDSEAMRKRHQLQVIHMDQINPLEKRVLVEKHLISPHLAEESRK
FT                   GAVLLREDESVSIMVNEEDHIRIQVLLPGFRLNEAWEIGTKIDDIFEKSLNYAFDETRG
FT                   YLTSCPTNVGTGIRASVMLHLPALVMTQQISRILQAINQVGLVVRGIYGEGSEALGNLF
FT                   QLSNQVTLGMSESDILSNLYGVARQIIEQERVARTYLLEHTRVSLEDRIFRSYGILMYA
FT                   RTVESKEAAQRLSDVRLGIDLGIIPNVSPLVLNELLVTTQPGFLQHHAGQKLTPDQRDE
FT                   RRARLIRERLRVVESQE"
FT   CDS_pept        201381..203828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /gene_synonym="mecB"
FT                   /locus_tag="BBR47_01880"
FT                   /product="negative regulator of genetic competence"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41165"
FT                   /db_xref="GOA:C0ZIE7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIE7"
FT                   /protein_id="BAH41165.1"
FT                   /translation="MFGRFTERAQKVLALALEEAVRLGHKDIGTEHVLLGLIREGEGIA
FT                   AKALQSLGLGLDKIQSEVESLIGRGTEQSGSNYTPNYTPRAKKVIELSMDEARKLGHTY
FT                   VGTEHILLGLIREGEGIAARIMNNLGVSLNKARQQVLQLLGSSEMMASHQPSGGNPAAN
FT                   TPTLDGLARDLTAIARDGGLDPVIGRQKEIERVIQVLSRRTKNNPVLIGEPGVGKTAIA
FT                   EGLAQKIVNNEIPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKIMDEIRQAGNIILF
FT                   IDELHTLIGAGGAEGAIDASNILKPALARGELQCVGATTLDEYRKYIEKDAALERRFQP
FT                   IQVDEPTAEDAIRILHGLRDRYEAHHRVKITDEAIEQAVKLSDRYITERFLPDKAIDLV
FT                   DEAASKVRLQSFTVPPNLKELEGRLEEVRKEKDAAVQSQEFEEAAALRDQEQKLREELD
FT                   KTKKDWKERQGQLNMEVTPEDIAQVVASWTGIPVLKLKEEETERLLKMEEILHDRVIGQ
FT                   DEAVKSISRAIRRARAGLKDPKRPIGSFIFLGPTGVGKTELARAVAETLFGDEDAMIRV
FT                   DMSEYMEKHSTARLVGAPPGYVGFDEGGQLTEKVRRKPYSVILLDEIEKAHPDVFNILL
FT                   QVLDDGRLTDSKGRTVDFRNTVVIMTSNVGASMIKKNTTLGFTTNDSERKYQDMKDKVM
FT                   DELKKSFRPEFLNRIDEVIVFHSLEQEHIEQIVTLMTDELRKRLKEQDIDFQLTEEAKK
FT                   VLAKEGFDPAYGARPLRRAIQRHIEDNLSEELLKGTISKGDTVNIEAEEGKLVVKRLEK
FT                   TKS"
FT   CDS_pept        203935..205302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /gene_synonym="sms"
FT                   /locus_tag="BBR47_01890"
FT                   /product="probable DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41166"
FT                   /db_xref="GOA:C0ZIE8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIE8"
FT                   /protein_id="BAH41166.1"
FT                   /translation="MSKYKTKYACQECGYESPKWMGKCPGCSSWNTLVEEVTVKTAHRH
FT                   EGMSGGQRQSAIPLTQVASEEDPRMDTTIGELNRVLGGGLVPGSLILVGGDPGIGKSTL
FT                   LLQTSFALAHQGAKVLYVSGEESAKQIKIRADRLHLQTPPMFVLAENDLDLIEQHINQV
FT                   DPDVLIIDSIQTVFHPTIQSAAGSVAQVREATAQLMRIAKGKGIGTFIVGHVTKEGSIA
FT                   GPRMLEHMVDAVLYFEGERHNTFRILRAVKNRFGSTNEIGIFEMKDRGLEEVANPSEIF
FT                   LAERPFGVAGSTVVASMEGTRPVLVELQALVAPTSFVTPRRTATGVDHQRVAMIMAVLE
FT                   KRMGMMLQNQDAYVNVAGGVRLDEPAVDLAIAVSIASSFRDHATNPHDVVIGEIGLTGE
FT                   VRGVSRIEQRVREAHKLGFKRVIIPEKNIRGLDAPADIQVIGVSNIADALNEVIRR"
FT   CDS_pept        205311..206387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="disA"
FT                   /gene_synonym="yacK"
FT                   /locus_tag="BBR47_01900"
FT                   /product="DNA integrity scanning protein DisA"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41167"
FT                   /db_xref="GOA:C0ZIE9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIE9"
FT                   /protein_id="BAH41167.1"
FT                   /translation="MQGNIKRTPQIGDVLRLVAPGTQLREGLENVLRAKTGGLIVIGCG
FT                   PEMKSIVDGGFSINCDFSPAHLYELAKMDGAIIVSEDAKRILYANTQIFPPSSIPTSET
FT                   GTRHRTAQRTAIQTNHLVIAISQRRNVITLYQGSFRYVLSEISVILAKANQAVSTLEKY
FT                   KAVLDQTLTNLGALEFEELVTLHEVASVLQRIEMVLRIKTEVSKYICELGVEGRLVSMQ
FT                   LEELVSNIEEEAHMLIRDYSRDPSYSPDLVLRDMKKLNSEEMLELTSFLRTLGYSSNAS
FT                   MLDESVSPRGYRILYKIRRLPVTIISNLVEHFHHLPRIMMATIQELDEVEGIGEVRARA
FT                   IKEGLKRIQEQVFIDRHI"
FT   CDS_pept        206502..207230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01910"
FT                   /product="probable CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41168"
FT                   /db_xref="GOA:C0ZIF0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIF0"
FT                   /protein_id="BAH41168.1"
FT                   /translation="MFVKSLPNILTVSNLFLGVLAIILAFRGDQYVEYAAITVIIGMLA
FT                   DGLDGRVARMLNAQSEFGKELDSLSDVITFGIAPAFIMYVVVLQHFDLLGILITAIFPI
FT                   CGALRLARFNVQAGVPGYFIGLPITAAGGVLATLALYHQVFTPVLLAVSMLLLAFLMVS
FT                   KVKYPNFKKVGIPKSAYWITPIIIAIVVIVAIKYPQQFPKIVFLPLAFYALYGIKKNVD
FT                   FLVKKLRKRKNKEKESVPFE"
FT   CDS_pept        complement(207326..207721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_01920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41169"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIF1"
FT                   /protein_id="BAH41169.1"
FT                   /translation="MDNRNIDDFQTQVSELLIRHRSVLDVMSKVQETASRINRSLTKAI
FT                   TECGCVEVVAKKQTYDSNKNLEDNKSHLDTHFNGPLCEHCRDVVTAELGKNLFYLTALC
FT                   NITDIKLEDVLQKESNRLNTLGVFNLS"
FT   CDS_pept        208008..209096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="BBR47_01930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41170"
FT                   /db_xref="GOA:C0ZIF2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIF2"
FT                   /protein_id="BAH41170.1"
FT                   /translation="MLRRVGKFIFVLIGAGLGYRFGDELFSLLDPLLNFGVVAGSQYIG
FT                   AVLGAILFFFLANWVVDYVLRIVRWGEETLVKMPVVDVMFGAMGLISGLIVAFLLFLPI
FT                   SKIPIPFVGDLLPLIVSGLLGYLGFQVGFRKRDEIMSVFSIGRKDKKKDSATTTVNLEN
FT                   KILDTSVIIDGRIADICRTGFLEGVLVIPGFVLEELQHIADSSDVLKRNRGRRGLDILN
FT                   KIQKEMKVKVQIWEGDFEEVSEVDSKLIKLAKLINGKVVTNDFNLNKVCELQGVAVLNI
FT                   NDLANAVKPVVLPGEEMNVQVIKDGKEHGQGVAYLDDGTMIVVEGGREYIGNDVDVLVT
FT                   SVLQTSAGRMIFAKPKLLERAL"
FT   CDS_pept        209124..209810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BBR47_01940"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41171"
FT                   /db_xref="GOA:C0ZIF3"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIF3"
FT                   /protein_id="BAH41171.1"
FT                   /translation="MSTGVVIVAAGSGKRMGGQRNKLWLPLAGEPILAHTVRLFATHPD
FT                   IDEVVLVVSEADHAEVMTLISAEKLMVVITMGGAERQDSVRNGLASLSANCDYVLVHDA
FT                   ARPFVTRKQISDMIKQVQQDQATIMAVPVKDTIKVVGVNGLVESTPARESLWAVQTPQA
FT                   FRMSLLREAHQAAGEAGKLGTDDAMLVEWLGHPVSIMQGSYENIKITTPDDLWFGEEIL
FT                   RKRKGE"
FT   CDS_pept        209814..210287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BBR47_01950"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41172"
FT                   /db_xref="GOA:C0ZIF4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIF4"
FT                   /protein_id="BAH41172.1"
FT                   /translation="MRIGQGFDVHQLVEGRPCIIGGVTIPNEKGLLGHSDADVLLHAIS
FT                   DAILGAIGEGDIGRHFPDTDPAFKDADSVKLLEHVWKLVRERGYRLGNVDATIIAQAPK
FT                   MAPYIPQMCEVIARVLEADDLSQVNVKATTSEKLGFTGRGEGIASQAVCLLVK"
FT   CDS_pept        210375..211841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BBR47_01960"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41173"
FT                   /db_xref="GOA:C0ZIF5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIF5"
FT                   /protein_id="BAH41173.1"
FT                   /translation="MAKEIRTRYAPSPTGHLHIGGARTALFNYLFAKHHGGSFIVRIED
FT                   TDQTRNKENADEEQMKNLKWLGVTWEEGTDVGGPYGPYRQTERLDIYRKYIDQLLAEGK
FT                   AYYCYATKEELDAEREEQLARGETPRILEKHRHVTDEQRAQYEAEGRVPSIHFLVQDDR
FT                   EYVVNDLIRGQVTFNSNEMGDFVICRPDGIPTYNFAVVVDDYLMKISHVIRGEEHLSNT
FT                   PRQLMIYEAFGWEAPDFAHLALILNQDGKKMSKRDESILQFIEQYRDLGFLPEAIVNFL
FT                   VLLGWSPGGEEEIFLMEDLIKLFSMDRVNKSPAVFDATKMNWMNNFYLKRQPLDMITDM
FT                   CIPHLQKAGFIEETLSAEKREWVRSIVGLYQEQMSYCAQIVPLAALFFLDEVVYDEEAT
FT                   LVLKEPQLPEVLASFVKHLSAQDAYNVDVIKAVLKDVQKETGHKGKALFMPVRVGATGQ
FT                   AHGRDLAETLYLLGRDKVIARAQQVIANGQ"
FT   CDS_pept        212219..212884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BBR47_01970"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41174"
FT                   /db_xref="GOA:C0ZIF6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIF6"
FT                   /protein_id="BAH41174.1"
FT                   /translation="MLAQMRDDIHAVFERDPAARSTLEVVMTYSGLHAIWGHRIAHRLW
FT                   KAELCTLARIVSQLSRFFTGIEIHPGATIGRGLFIDHGMGVVIGETCEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIGNDVIIATGAKVLGSFKIGDNSKIGAGAVVLQEVPPNSTVVGI
FT                   KGRIVIQDGKRVKNDLDHVNMPDPVADTIRMMQKEIDQLRKELELLREDKKNDGHSAD"
FT   CDS_pept        212865..214271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BBR47_01980"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41175"
FT                   /db_xref="GOA:C0ZIF7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIF7"
FT                   /protein_id="BAH41175.1"
FT                   /translation="MGIQLTNTMTRRKEPFHTLEPGKVKMYVCGPTVYNYIHIGNARPA
FT                   IVFDTLRRYLKYRGYEVTFVQNITDVDDKLIRVANQEGVTVKEVADRYTDAYNADLKSL
FT                   NVSPPDIQPRVMQTIPEIIEFVQGLIEKGFAYESEGDVYFRTGRFQEYGKLSHQPLDDL
FT                   QAGARVEINEKKEHPLDFVLWKAAKTGEVTWDSPWGEGRPGWHIECSAMALKFLGEEID
FT                   IHAGGTDLVFPHHENEIAQSECFTGKVFARYWLHNGMLNIDNEKMSKSLGNFLLARDLS
FT                   EKFGGQLIRFFMLQGHYRNPINFSEELIEQAANGLDRITTAYTNLSHRLDTARAEEPND
FT                   QAQEQARIIGELRERFIAEMDDDINTANAITVIFDVVKEANLYLRHQNVGETEVRAYMD
FT                   LLVELTEVLGLDIAEEQELLDSEIDALIEERTEARKARNFARSDEIRDLLAAKGIVLED
FT                   TPQGVRWRRK"
FT   CDS_pept        214289..214693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazC"
FT                   /locus_tag="BBR47_01990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41176"
FT                   /db_xref="GOA:C0ZIF8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIF8"
FT                   /protein_id="BAH41176.1"
FT                   /translation="MQKEELTRDPNLTNPLVLAFLGDATYSHCVRYHLIAKGLVKPNQL
FT                   HKAANRYVSAKAQANVLLTLMPTLPEEELNVVKRGRNAKSGSSAKNADIIDYRHATAFE
FT                   ALIGYLYLSGKEERIAEIVQQAFAIVEGES"
FT   CDS_pept        214695..215450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="BBR47_02000"
FT                   /product="probable 23S rRNA
FT                   (guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41177"
FT                   /db_xref="GOA:C0ZIF9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIF9"
FT                   /protein_id="BAH41177.1"
FT                   /translation="MSEEWILGKNPVIEALRSGRTINKIWVAEGTNKNLMGPVFALAKE
FT                   QGVIVTTANRKKLDQLVSTDNHQGVVASVAAYDYVEVDDILKRAEEKNEAPFILLLDEL
FT                   EDPHNLGSIMRTADAVGAHGVIIPKRRSVSLTATVAKASAGAINYVPVARVTNLVRTME
FT                   ELKERGVWIAGTDASAKQDFRQGDYTMPLAIVIGSEGKGMSRLVRENCDFLYSLPMAGN
FT                   VTSLNASVAAALLMYEVYRSRSPIPTRVK"
FT   CDS_pept        215452..215976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41178"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIG0"
FT                   /protein_id="BAH41178.1"
FT                   /translation="MAKRKAKQLLIVDGYNIIGAWPDLRLLKDQERMDEARDQLIAKMA
FT                   EYQSYTGVMVIIVFDAYNVPGSGRQMEDFQVEVYFTKKKETADEKIEQLVSQFHNKNRQ
FT                   IYVATSDYTSQRVIFGQGALRKSARELLLDMENAGKEIKKQVEKTQEERFSTRITLNDE
FT                   IAKIFEKWRRE"
FT   CDS_pept        216042..216710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="BBR47_02020"
FT                   /product="RNA polymerase sigma-H factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41179"
FT                   /db_xref="GOA:C0ZIG1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIG1"
FT                   /protein_id="BAH41179.1"
FT                   /translation="MAEGSFVSVDLKELKHAQYELMTDEEVVDLVRDNDAEALEYLINK
FT                   YKNFVRAKARSYFLIGADREDIVQEGMIGLYKSIRDFRGDKLTSFKAFAELCITRQIIT
FT                   AIKTATRQKHIPLNSYVSLDKPIYDEDSDRTLLDVISGTKVTDPEELFINREEFDDIEG
FT                   KMSEILSDLERQVLMLYLDGRSYQQIAVELKRHVKSIDNALQRVKRKLERYLEGREIHL
FT                   "
FT   CDS_pept        216948..217097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmGB"
FT                   /locus_tag="BBR47_02030"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41180"
FT                   /db_xref="GOA:C0ZIG2"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIG2"
FT                   /protein_id="BAH41180.1"
FT                   /translation="MRVNITLACTECGERNYISTKNKRTTTERVELKKYCSRDKKQTLH
FT                   RETK"
FT   CDS_pept        217097..217345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BBR47_02040"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41181"
FT                   /db_xref="GOA:C0ZIG3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIG3"
FT                   /protein_id="BAH41181.1"
FT                   /translation="MVDATKSGGGKVGFLSRIGASFRRTGGFFSDVMSELKKVRWPNRK
FT                   ELTTYTLVVLVTVVLLAIFFFVVDLGISRLIDLILGT"
FT   CDS_pept        217391..217927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BBR47_02050"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41182"
FT                   /db_xref="GOA:C0ZIG4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIG4"
FT                   /protein_id="BAH41182.1"
FT                   /translation="MEKAWYVLHTYSGYENKVKTNLEKRLESMGMEDKIFRVLVPTEEE
FT                   VETKDGKKRTVTKKVFPGYVLVEMVMTDDSWYVVRNTPGVTGFVGSTGAGSKPTALRPE
FT                   EADTILKQMGIEIPKIRVDFALRDMVRVTDGPFSNRTGEIIEIYPDRQKVRVLVDIFGR
FT                   ETPVELDFTQVQQLD"
FT   CDS_pept        218115..218540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BBR47_02060"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41183"
FT                   /db_xref="GOA:C0ZIG5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIG5"
FT                   /protein_id="BAH41183.1"
FT                   /translation="MAKKVIRVIKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TESEVGMIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGVPNKTKVATLKRDK
FT                   VREIAELKRPDLNAASVEAAMRMVEGTARSMGIVIED"
FT   CDS_pept        218630..219313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BBR47_02070"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41184"
FT                   /db_xref="GOA:C0ZIG6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIG6"
FT                   /protein_id="BAH41184.1"
FT                   /translation="MAKKGKKYQDAVKLVDKNKVYEVVEGVELVKKAATAKFDETVEVA
FT                   FRLGVDPKRADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKDAEAAGADFVGDADMIAKI
FT                   QGGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKIEY
FT                   RVDKAGNIHAPIGKASFDADKLVENLAALTEALNRAKPAAAKGVYMRNVTLSSTMGPGV
FT                   RVAVK"
FT   CDS_pept        219543..220058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BBR47_02080"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41185"
FT                   /db_xref="GOA:C0ZIG7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIG7"
FT                   /protein_id="BAH41185.1"
FT                   /translation="MAEIRPTVIREEKVQAINEIAAKLRESQTTVVADYRGLTVAQVTE
FT                   LRKQLREAGVEFQVLKNSLTRLATEKESLTELDQYLTGPNALAFSKDDIIAPAKVIAEF
FT                   AKKNDKLEIKGGVIEGKVVDAEQIKALASLPNREGLLSMLLSVLQAPMRNVALAVKAVA
FT                   EQKEGQGA"
FT   CDS_pept        220114..220476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BBR47_02090"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41186"
FT                   /db_xref="GOA:C0ZIG8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIG8"
FT                   /protein_id="BAH41186.1"
FT                   /translation="MSKDQILEAIKGMSVLELNDLVKAIEEEFGVTAAAPVAVVAGGGA
FT                   EAAAEQTEFTVNLVSGGASKINVIKVVRELTGLGLKEAKDLVDNAPKTLKEGVSKDEAE
FT                   ALKAKLEEAGAQVEVK"
FT   CDS_pept        220579..221175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41187"
FT                   /db_xref="GOA:C0ZIG9"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIG9"
FT                   /protein_id="BAH41187.1"
FT                   /translation="MADHYYTNQPGAAHDEQQFTFKLRDNEFRFITDAGVFSRDRIDFG
FT                   SVLLIENMEINSHARVLDVGCGYGPMGLTAAKLADHGRVTMIDVNERAVNLARRNAEAN
FT                   GIKNVEVRVSDVYSGVQGEQFDVILTNPPIRAGKEIVHRIFVEGYDLLVEGGEMWVVIQ
FT                   KKQGAPSALKKLQEVYREVIEVDREKGYHIFRAIK"
FT   CDS_pept        221485..225024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BBR47_02110"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41188"
FT                   /db_xref="GOA:C0ZIH0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIH0"
FT                   /protein_id="BAH41188.1"
FT                   /translation="MAGKVIQSGRHRQRRTYSRINEVLGLPNLIEIQQKSYQWFLDEGL
FT                   REMFQDISPIQDFTGNLVLEFIDYSLGEPKYDVDESKERDVTYAAPLRVKVRLLNKETG
FT                   EVKEQEVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYNTKVDKNGKQTFTATVI
FT                   PNRGAWLELETDAKDVIYVRIDRTRKIPVTVLLRALGFGSDIEILNLLGEDEYIKNTLE
FT                   KDNTDSTEKALIEIYERLRPGEPPTVENAKSLLISRFFDPKRYDLASVGRYKMNKKLHL
FT                   KNRLYNQRLAETLIDTTTGEIFAEAGQMIDRRVLERIVPALEGSIGFIDVRTHGGVLED
FT                   EAIHLQSINIFSPIEDGKIIKVIGNGNVDKSFKHITPADIVSAINYFMNLLHSVGSTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDQNQITPQALINIRPVIASLK
FT                   EFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHHSHYGRMCPIE
FT                   TPEGPNIGLINSLSSFARINDYGFIETPRRKVDPETGFVLTDISYLTADEEDVFNVAQA
FT                   NQPLDEDGRFVNDMVICRRKGEILSVPRDKVDFMDVSPKQVVSVATALIPFLENDDANR
FT                   ALMGSNMQRQAVPLLIPQAPFVGTGMEHKAAQDSGVAIVAKHPGQVERVTAREIWIRRY
FT                   QEIDGRKVAGDLDKYKMHKFIRSNQGTCINQRPIVSTGDWIEKGDIVGDGPSTEKGELA
FT                   LGRNVIVAFMTWEGYNYEDAILLSEKLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVGEDALKNLDERGIIRVGAEIQDGDILVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGGSGIIVDVKVFTRENGDELPPGVNQLVRVYIAQKRKISVGDKMAGRHGN
FT                   KGVIARIMAEEDMPFLPDGSPVEIVLNPLGVPSRMNIGQVLETHLGMAAKLLGIHVATP
FT                   VFDGARQAEVFETLAEAGLDRDGKTILFDGRTGEPFDRRVTVGCVYMLKLAHLVDDKIH
FT                   ARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVK
FT                   TYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKILSGDEQEIEMREMEDEDEGNGEK
FT                   LNLVLEGGSLNEE"
FT   CDS_pept        225054..228680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BBR47_02120"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41189"
FT                   /db_xref="GOA:C0ZIH1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIH1"
FT                   /protein_id="BAH41189.1"
FT                   /translation="MIDVNNFEYMKIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRSLEEVIYFASYVVTDPGDTPLDKKQLLSEKEYRNYREKYG
FT                   HSFQAMMGAEAIKRLLAEIDLDKDVETLKEDLKTAQGQRRNRAIKRLEVLEAFRNSGNH
FT                   PDWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPDIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVSKGLAHNIKSAKRKVERVQPEVWD
FT                   VLEDVIREHPVLLNRAPTLHRLGIQAFEPVLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGSYYLTLEREGDKGEGTIYR
FT                   DPHDAIAAYQQGFISLHTRIVLPAKRLNKISFTERQENALIVTTVGKVIFNEIFPADMP
FT                   FINAPTRANLQTMVPDECFIFDKGTNVSEFIKNLPDPGAVKKGFLGTIISECFRRFGTM
FT                   KTSMILDRIKELGFTYSTKAGITIAVADIAVPGKKKDILDAADEKVATVMTQFRRGLIT
FT                   EDERYDRVISIWSKAKDEVTEVLMKSMDKFNAIFMMANSGARGNVSQITQLAGMRGLMA
FT                   NPSGRIIELPIKSNFREGLTVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVAQDV
FT                   IVRETDCGTDKGIRVTAIKDGKEEIEKLSDRLTGRTCFETLRHPETKEIIVHRNEEISE
FT                   EVAEYIEKVGITDVYIRNVLACRTSHGVCKLCYGRNLATGAEVEVGEAVGIIAAQSIGE
FT                   PGTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQAVISEIDGEVIDIREGKDRR
FT                   EIEVRGEAENKVYAAPYGSRIKVSVGVKLNAGDELTEGSVDPKEMLKVRGMRGVSNYIL
FT                   QEVQKVYRMQGVEINDKHVEVMIRQMLRKLRVIDSGDTDLLPGSYVEVPEFEQANAKVL
FT                   MEGRNPAVGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKVDRLLGLKENVI
FT                   IGKLVPAGTGMSRYRNVKVASQVDYEAELEAAKAEQEAVSVE"
FT   CDS_pept        228819..229073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxF"
FT                   /locus_tag="BBR47_02130"
FT                   /product="putative ribosomal protein L7Ae family"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41190"
FT                   /db_xref="GOA:C0ZIH2"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIH2"
FT                   /protein_id="BAH41190.1"
FT                   /translation="MSYEKVERAKDLTIGIKQTIKAVESQQVEAVYIAVDADKRLTQKV
FT                   ELLCKEKGVPVIHVDSMYRLGKACGIEVGAATAAIKKSG"
FT   CDS_pept        229197..229631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BBR47_02140"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41191"
FT                   /db_xref="GOA:C0ZIH3"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIH3"
FT                   /protein_id="BAH41191.1"
FT                   /translation="MPTINQLVRKGREDKVVKSKSPALQKGYNSFKKSQTNQSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIGGIGHNLQEHSVVLVRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNNRKQGRSKYGTKRPKPGQAAAKK"
FT   CDS_pept        229688..230158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BBR47_02150"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41192"
FT                   /db_xref="GOA:C0ZIH4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIH4"
FT                   /protein_id="BAH41192.1"
FT                   /translation="MPRKGPVTRRDVLPDPIHNSKLVTRLINRLMLDGKRGVAQNILYN
FT                   AFDIIQERTGRNPMEVFEEALKNVMPVLEVKARRVGGANYQVPIEVKPERRTTLGLRWM
FT                   VNYSRNRGEKTMEQRLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   CDS_pept        230228..232306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /gene_synonym="fusA"
FT                   /locus_tag="BBR47_02160"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41193"
FT                   /db_xref="GOA:C0ZIH5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIH5"
FT                   /protein_id="BAH41193.1"
FT                   /translation="MAREFSLPNTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHE
FT                   GAATMDWMEQEQERGITITSAATTAQWNGHRINIIDTPGHVDFTVEVERSLRVLDGAVT
FT                   VFDAKGGVEPQTETVWRQADRYGVPRMCYINKMDIMGANFDMCLGQIKSRLGANPVAIQ
FT                   YPIGAEDQFKGMVDLIEMKAIVYTDDLGKTSDSAEIPADLLARCEELRMAMVEAAAEQD
FT                   EELMMKYLEGEELTNDEIRAALRKGTIDCKLTPVMCGSSYKNKGVQPMLDNVVAYLPSP
FT                   VDIPAIKGTLPDTEDEVDRPADDNGPFSALAFKIMTDPYVGRLTFFRVYSGVLNSGSYV
FT                   LNSTKGKRERVGRILQMHANHREEITTVYSGDIAAAVGLKDTTTGDTLCDEKAPVILES
FT                   MDFPEPVISVAIEPKSKADQDKMGIGLSKLAEEDPTFRTRTDEETGQTIISGMGELHLE
FT                   IIVDRLKREFKVESNVGAPQVAYRETFRNAAKVEGKFVRQSGGRGQYGHVWVEFAPLEA
FT                   GQGFQFENKIVGGVVPREYIPAVQAGIEESMKNGVIAGFPLVDIKATIVDGSYHDVDSN
FT                   EMAFKVAGSLALKEAAKKCGAVLLEPIMKVEVTMPEEYMGDVMGDLNSRRGRIEGMEAR
FT                   ANAQVIRAMVPLSEMFGYSTILRSRTQGRGVYSMVIDHYEEVPKFIAEEIIKKSKGE"
FT   CDS_pept        232427..233617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BBR47_02170"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41194"
FT                   /db_xref="GOA:C0ZIH6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIH6"
FT                   /protein_id="BAH41194.1"
FT                   /translation="MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITTVLAQTGQAQAM
FT                   NYASIDAAPEEKERGITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSKQVGVPYIVVFMNKCDMVDDEELLELVEMEIRDLLSQYEF
FT                   PGDDTPVIKGSAKEALDNPTGEWAKKIGELMEAVDSYIPTPERATDKPFLMPVEDVFTI
FT                   TGRGTVATGRVERGIVKVGDQVEIIGLAEETKNTTVTGVEMFRKLLDQAQAGDNIGALL
FT                   RGVDRNDIERGQCLAKPGSVKPYTKFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDV
FT                   TGIIQLPEGVEMIMPGDNTEFTVELIAPVAMEQGTRFAIREGGRTVGAGVVASIDA"
FT   CDS_pept        233771..234706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02180"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41195"
FT                   /db_xref="GOA:C0ZIH7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIH7"
FT                   /protein_id="BAH41195.1"
FT                   /translation="MKNNERLLFLMLAGVVTLWGLNVVMVKYLTTFPPLYVAAIRMTVG
FT                   GICLSPLIFLYRKSLRFSKTDWFLLAGVGASSIALHQITLAAGVQYTTAGNASLILGLN
FT                   PLATALLAMLFLGEGMSLKKGLGIGMGFAGVLIVVISQHGGLHMNGWGDAIMFFSMLMY
FT                   VTGGLLIRKLVVRGVPVLLITALSQTFGVIFLWGVALTVQPASYYFSLDVSSFQWLVIF
FT                   ASGALSTALGSVGWNYGIRQLGASRTAVFLNGMPMASLVFAAIFLGESLQLVHLLALCM
FT                   IVGGVYLGSRSLVRPKATCAAAPSDITTKA"
FT   CDS_pept        complement(234733..235119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02190"
FT                   /product="probable hemoglobin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41196"
FT                   /db_xref="GOA:C0ZIH8"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIH8"
FT                   /protein_id="BAH41196.1"
FT                   /translation="MSDVNQTPYEIIGGADTLTRLVDTFYDLVKQHPDINDLFPEDLTH
FT                   VKERQYQFLTQFLGGPSLYSDAHGHPMLRARHMPFPIGPVQAEAWLSCMDKAMNLTGLE
FT                   GEIRKQIFDRLRLTAHHMVNKWDQ"
FT   CDS_pept        235476..235784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BBR47_02200"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41197"
FT                   /db_xref="GOA:C0ZIH9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIH9"
FT                   /protein_id="BAH41197.1"
FT                   /translation="MAKQKIRIRLKAYDHKILDQSAEKIVDTAKRSGANVSGPIPLPTE
FT                   KAVYTILRAVHKYKDSREQFEMRTHKRLIDILNPTPQTVDALMRLDLPSGVDIEIKL"
FT   CDS_pept        235935..236564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BBR47_02210"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41198"
FT                   /db_xref="GOA:C0ZII0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII0"
FT                   /protein_id="BAH41198.1"
FT                   /translation="MTKGILGKKLGMTQVFGPNGTATAVTVIEVGSNVVLQKKDVETDG
FT                   YEAIQIGFEDKKEQRANKPEKGHAAKANTAPKRFIREIRGVNLADYEVGQELKADIFAE
FT                   GEMVDVAGVSKGKGFQGAIKRHNQSRGPMAHGSRYHRGPGSMGAVAPNRVFKGQTLPGQ
FT                   MGGDNVTIQNLEVIKVDTERNLVLVKGSVPGPKNSCVLVSTAVKKN"
FT   CDS_pept        236585..237208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BBR47_02220"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41199"
FT                   /db_xref="GOA:C0ZII1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII1"
FT                   /protein_id="BAH41199.1"
FT                   /translation="MPKVALYNQTGSQVGEIDLADSVFGIEPNSAVLYDAIVMQQASQR
FT                   QGTHDVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWKGGGVVFGPTPRKYGYKLNRK
FT                   VRRLALKSALSTKVQNNELLVLEALNFAAPKTKEMTAVLSSLKVDRKVLIVTSEYDQNV
FT                   ALASRNIPGTKIVDAAGINVLDLVAHDKVIVTREAVAKVEEVLA"
FT   CDS_pept        237208..237498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BBR47_02230"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41200"
FT                   /db_xref="GOA:C0ZII2"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII2"
FT                   /protein_id="BAH41200.1"
FT                   /translation="MKSLHDVLKRPVITERTTDMMAEKKYVFEVPLKANKTEIKQAVEK
FT                   VFGVKVEAVNTVRVPAKPKRYGKYSGYTSEWKKAIVKLTDDSKELAFYEGV"
FT   CDS_pept        237531..238361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BBR47_02240"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41201"
FT                   /db_xref="GOA:C0ZII3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII3"
FT                   /protein_id="BAH41201.1"
FT                   /translation="MGIKKFKPTSPGRRQMTVSTFEEITTSTPEKSLLAPLSKKAGRNN
FT                   QGRITVRHQGGGHKRKYRIIDFKRNKDGIIGRVATIEYDPNRSANIALINYADGEKRYI
FT                   IAPHNLKVGDQIVSGADADIKIGNALPMEKIPVGTTIHNIELKPGKGGQLVRAAGTSAQ
FT                   LLGRDGEFVIVRLSSGETRRIHNVCRATIGQVGNLDHELLNIGKAGRSRWLGIRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKAPVTPWGKPTLGLKTRKKKNKSDQYIIRRRKK"
FT   CDS_pept        238411..238692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BBR47_02250"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41202"
FT                   /db_xref="GOA:C0ZII4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII4"
FT                   /protein_id="BAH41202.1"
FT                   /translation="MGRSLKKGPFVDDHLMKKVDEQNEKNEKRVIKTWSRRSTIFPDFV
FT                   GHTFAVYDGRKHVPVYVSEDMVGHKLGEFAPTRTFKGHVDNDKKSKKR"
FT   CDS_pept        238722..239054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BBR47_02260"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41203"
FT                   /db_xref="GOA:C0ZII5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII5"
FT                   /protein_id="BAH41203.1"
FT                   /translation="MEAKAVARNIRIASRKVRLVVDLIRGKQVGEALAILKHTPKAASP
FT                   VVEKLLKSAIANAEHNYEMDPNSLVVGKVFVDQGPTLKRFRPRAMGRASRIHKRTSHIT
FT                   VVLNEK"
FT   CDS_pept        239068..239730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BBR47_02270"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41204"
FT                   /db_xref="GOA:C0ZII6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII6"
FT                   /protein_id="BAH41204.1"
FT                   /translation="MGQKVSPVGLRIGVIRDWESKWYADKDFATLLHEDLKIRKYVKGR
FT                   LKDAAVSTIEIERAANRVNVTIHTAKPGMVIGKGGSEVETLRKTLTDLTGKRVHININE
FT                   IKRPDLDATLVAENIARQLENRISFRRAQKQSITRTLRSGAKGIKTLVSGRLGGADIAR
FT                   SEGYSEGTVPLHTLRADIDYGTAEAHTTYGRIGVKVWIYRGEVLPARKNVATEEGGK"
FT   CDS_pept        239733..240167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BBR47_02280"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41205"
FT                   /db_xref="GOA:C0ZII7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII7"
FT                   /protein_id="BAH41205.1"
FT                   /translation="MLTPKRVKHRKQHRGKMAGNAKGGTTVAFGEYGLQAMEPSWVTNR
FT                   QIEAARIAMTRYIKRGGKVWIKIFPDKPVTQKPLEVRMGSGKGSPEKWVAVVKPGKIMF
FT                   ELAGVPEEVAREAMRLAMHKLPIKCKFVKREEVGGDAHEG"
FT   CDS_pept        240157..240354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BBR47_02290"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41206"
FT                   /db_xref="GOA:C0ZII8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII8"
FT                   /protein_id="BAH41206.1"
FT                   /translation="MKANEYRNLTTAEIEQNVTSLKEELFNLRFQLATGQLETTSRIKQ
FT                   VRKDIARAKTVLRQRELGIG"
FT   CDS_pept        240377..240643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BBR47_02300"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41207"
FT                   /db_xref="GOA:C0ZII9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZII9"
FT                   /protein_id="BAH41207.1"
FT                   /translation="MTADRNMRRTVVGRVVSDKMDKTIVVLVETYKTHPLYGKRMKFSK
FT                   KFKAHDENNTAKVGDIVEIMETRPLSKDKRFRLVRIVEEAVIV"
FT   CDS_pept        240685..241053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BBR47_02310"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41208"
FT                   /db_xref="GOA:C0ZIJ0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIJ0"
FT                   /protein_id="BAH41208.1"
FT                   /translation="MIQTQTRLAVADNSGAKELMCIKVLGGSGRKTANIGDVIVCSVKS
FT                   ATPGGVVKKGQVVKAVVVRTVSGVRRNDGSYIRFDENAAVVIKDDQSPRGTRIFGPVAR
FT                   ELRDKDFMKIISLAPEVI"
FT   CDS_pept        241103..241417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BBR47_02320"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41209"
FT                   /db_xref="GOA:C0ZIJ1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIJ1"
FT                   /protein_id="BAH41209.1"
FT                   /translation="MHVKKGDTVIVNAGKDKGKKGRVLAAYPKKERVLVEGINLVKKHS
FT                   RPSQANPQGGIVTQEAAIHVSNVSLIDPKSGKATRIGYKVLDNGKKVRYAKKSGEVLDK
FT                   "
FT   CDS_pept        241444..241986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BBR47_02330"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41210"
FT                   /db_xref="GOA:C0ZIJ2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIJ2"
FT                   /protein_id="BAH41210.1"
FT                   /translation="MATRLKEKYTSEIVPSLMSKFNYTSIMQVPKVEKIIINMGVGEAV
FT                   ANAKSLDTAIEDLQIIAGQKPVVTKAKKSIAGFKLREGMPIGAKVTLRGERMYHFLDKL
FT                   MNVSLPRVRDFRGISSKAFDGRGNYTLGLKEQLIFPEIEYDKIDKVRGMDIVVVTSAKT
FT                   DEEARELLTQMGMPFRK"
FT   CDS_pept        242011..242196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BBR47_02340"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41211"
FT                   /db_xref="GOA:C0ZIJ3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIJ3"
FT                   /protein_id="BAH41211.1"
FT                   /translation="MAKKSMIIKQQREPKFAVRAYTRCERCGRPHSVLRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   CDS_pept        242224..242622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BBR47_02350"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41212"
FT                   /db_xref="GOA:C0ZIJ4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIJ4"
FT                   /protein_id="BAH41212.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKVEIPASTIKKEIARILKEEGF
FT                   IRDAEFVEDNKQGIIRVFLKYGAGNERVITGLKRISKPGLRVYAKNNEVPKVLGGLGCA
FT                   IISTSTGVMTDKQARQAHVGGEVLAYIW"
FT   CDS_pept        242658..243194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BBR47_02360"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41213"
FT                   /db_xref="GOA:C0ZIJ5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIJ5"
FT                   /protein_id="BAH41213.1"
FT                   /translation="MSRVGRKPIVVPAGVTLTLNGTELTVKGPKGQLVRSFHEDIKINI
FT                   AENEVIVERPSDNKLHRSLHGTTRALVSNMVTGVSEGFTRTLELVGVGYRAAKSGNGVT
FT                   LSLGFSHPVEVTPEEGIEIDVPNQTTLVVKGINKERVGQIAAEIRSLRKPEPYKGKGIK
FT                   YSNEVVRRKEGKKGK"
FT   CDS_pept        243227..243589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BBR47_02370"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41214"
FT                   /db_xref="GOA:C0ZIJ6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIJ6"
FT                   /protein_id="BAH41214.1"
FT                   /translation="MFTKADKNKARKKRHLRIRKRVIGTTIRPRLNVFRSSKHIYAQLI
FT                   DDATGVTLVSASSLDKELGLNNGANVEAATAVGTLIAKRAQEKGATEVIFDRGGYIYHG
FT                   RIKALAEAAREAGLQF"
FT   CDS_pept        243608..244105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BBR47_02380"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41215"
FT                   /db_xref="GOA:C0ZIJ7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIJ7"
FT                   /protein_id="BAH41215.1"
FT                   /translation="MRIDPSKLELEEKVVAVNRVAKTVKGGRRMSFSALVVVGDRNGHV
FT                   GAGMGKAQEVPDAIRKAIDDAKKKLIRVPMRGTTVPHQVLCQFGAGKVLIKPAAPGTGV
FT                   IAGGPVRAVLELAGVGDILSKSLGSNNPINMVNATLEGLGRLKTAEDVAKLRGKTVDEL
FT                   LG"
FT   CDS_pept        244122..244307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BBR47_02390"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41216"
FT                   /db_xref="GOA:C0ZIJ8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIJ8"
FT                   /protein_id="BAH41216.1"
FT                   /translation="MAKLQITLKRSLIGRTVDQQDTVKALGLRKINSTVVKEDNPAIRG
FT                   MVFKVKHLVEVKEVEA"
FT   CDS_pept        244341..244781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BBR47_02400"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41217"
FT                   /db_xref="GOA:C0ZIJ9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIJ9"
FT                   /protein_id="BAH41217.1"
FT                   /translation="MKLHELQPAEGSRHTRKRIGRGIGSGTGKTAGKGHKGQNARSGGG
FT                   VRPGFEGGQNPLYRRLPKRGFTNISRKEFAIVSLDALNRFEEGTVVTPELLKETGVISA
FT                   LRDGVKVLANGELTVKLTVKAHKFSGAAAEKIAQVGGTTEVI"
FT   CDS_pept        244781..246076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BBR47_02410"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41218"
FT                   /db_xref="GOA:C0ZIK0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIK0"
FT                   /protein_id="BAH41218.1"
FT                   /translation="MLASLTNIFKISDLRRKILFTLMMLVVFRIGSYVPVPNVNVALFQ
FT                   QNTNQLLGLLNTFSGGALHNFSIFAMGIMPYITASIIMQLMSMDVVPKLTQWAREGEVG
FT                   RRKIATVTRYATIILGLIQSVGMTIGFNNMAPGLLNDTSVSSYALIALTLTAGTAFMMW
FT                   MGEQITEKGIGNGISILIVGGIVANIPQGITTIYTTQFADPSQNVFFSVVKVLLILLVI
FT                   LAIIVGVIFMQQGLRKIPVQYAKRVVGRKMYGGQSTHIPLKINSAGVIPVIFAVSLVMF
FT                   PSTIAQFWVDASGQGFANWIYQNFQVNKPLGMTLYAILILGFTYFYTFVQINPVQMAEN
FT                   MRKNGGYIPGIRPGKNTEVFITRTLNRLTLAGALFLMIIAILPFFFGSLANLPQSIYIG
FT                   GTSLLIVVGVSLDTMKQIESQMIKRHYQGFIK"
FT   CDS_pept        246137..246781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BBR47_02420"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41219"
FT                   /db_xref="GOA:C0ZIK1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIK1"
FT                   /protein_id="BAH41219.1"
FT                   /translation="MNIILMGLPGAGKGTQAERIVKEFDIPHISTGDMFRAAVKNETPL
FT                   GLEAKSYMDKGHLVPDEVVIGIVRERLSMDDCAKGFLLDGFPRTVPQAEALTATVKELG
FT                   REIDHVININVQREQLIERLTGRWICPVCGASYHTMFNPPKEAGVCDKDGGKLYQREDD
FT                   KIEVVTQRLDVNIAQTQPLIDYYSAQELLRDIDGEQDIQVVFAEIKSLLRG"
FT   CDS_pept        246788..247534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BBR47_02430"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41220"
FT                   /db_xref="GOA:C0ZIK2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIK2"
FT                   /protein_id="BAH41220.1"
FT                   /translation="MIILKSKAELEVMREAGRIVALTHQELAKAIKPGVTTKQLDEIAE
FT                   TFIRSMGAIPSFKGYGGFPGSICASVNEELVHGIPGKRALQEGDIISIDIGAQFQGYHG
FT                   DSAWTYPVGKISTENQKLLRVTEESLYKGLEKAVPGGRLSDISHAIQVHAEAADFTLVR
FT                   EYVGHGIGQNLHEDPQVPNYGPPDRGPRLKPGMVLAIEPMVNAGERYVRTLEDNWTVVT
FT                   VDRKTCAHFEHTIAITEDGYEIFTRT"
FT   CDS_pept        247653..247871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BBR47_02440"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41221"
FT                   /db_xref="GOA:C0ZIK3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIK3"
FT                   /protein_id="BAH41221.1"
FT                   /translation="MAKDDVIEVEGTVIEPLPNAMFRVELENGHKVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   CDS_pept        247906..248019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BBR47_02450"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41222"
FT                   /db_xref="GOA:C0ZIK4"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIK4"
FT                   /protein_id="BAH41222.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGNVMVICENPKHKQKQG"
FT   CDS_pept        248041..248409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BBR47_02460"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41223"
FT                   /db_xref="GOA:C0ZIK5"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIK5"
FT                   /protein_id="BAH41223.1"
FT                   /translation="MARIAGVDLPREKRVEVALTYIFGIGRPTSQKILSATGVDMNTRV
FT                   RDLTEDEVNKLREYIDKTVKVEGDLRREISLNIKRLMEIGCFRGIRHRRGLPVRGQRSK
FT                   TNARTRKGPRRTVANKKK"
FT   CDS_pept        248426..248827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BBR47_02470"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41224"
FT                   /db_xref="GOA:C0ZIK6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIK6"
FT                   /protein_id="BAH41224.1"
FT                   /translation="MAKRKQATATRTRRRDRKNVEVGVAHIRSTFNNTIVTITDPHGNA
FT                   ISWSSAGSLGFKGSRKSTPFAAQMAAEAAARVAMEHGMRSLEVSVKGPGAGREAAIRSL
FT                   QATGLEVNMIKDVTPIPHNGCRPPKRRRV"
FT   CDS_pept        248984..249928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BBR47_02480"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41225"
FT                   /db_xref="GOA:C0ZIK7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIK7"
FT                   /protein_id="BAH41225.1"
FT                   /translation="MIEIEKPKIEVVEVSDDNSYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVRTVQIDGVLHEFSTVEGVVEDVTEIILNIKGLALKIHSDEEKVIEIDAEGE
FT                   GVVKAGDIRADSDVEVLNPDLHIATLANGGRLHIRMTAGRGRGYVQSDGNKSEDLPIGV
FT                   IPIDSIYTPIKRVNYQVENTRVGQMTNYDKLTLEVWTNGSISPEEAVSLGAKIMTEHLN
FT                   LFVGLTDEAKDAEIMVEKEEDKKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTQKT
FT                   EEDMMKVRNLGRKSLEEVQEKLAELGLSLRSDD"
FT   CDS_pept        249985..250344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BBR47_02490"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41226"
FT                   /db_xref="GOA:C0ZIK8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIK8"
FT                   /protein_id="BAH41226.1"
FT                   /translation="MAQRKLGRRSSARKALFRDLVTDLIINERIETTEMKAKELRPIAE
FT                   KMITLAKRGDLHARRQVAAFVRKEVANAEGRDAVQKLFDEIAPRFKERNGGYTRILKAG
FT                   PRRGDAAPMAYIEFV"
FT   CDS_pept        250513..251364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02500"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41227"
FT                   /db_xref="GOA:C0ZIK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIK9"
FT                   /protein_id="BAH41227.1"
FT                   /translation="MNEDNLLALRDVSYTYDGEDGQRVPVLQGVDLTIQKGSFVSVLGH
FT                   NGSGKSTMAKLMNALLLPEGGTVLISGMDTKDGEQLWEIRRHVGMVFQNPDNQIVGATV
FT                   EDDVAFGLENMGVDPKEMRDRIDEALVSVGMESYLQAQPHRLSGGQKQRVAIAGIMAMR
FT                   PSVIILDEATAMLDPQGRMEVLNLARQLNRDEGLTIINITHFPEEAIYSDKVIVMNAGE
FT                   VLMEGKPSEVFNEVDRLKQVGLDVPFAVRLRHALQSKGIDLPFVLHQEELVEHVCKLLL
FT                   TK"
FT   CDS_pept        251340..252212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02510"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41228"
FT                   /db_xref="GOA:C0ZIL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIL0"
FT                   /protein_id="BAH41228.1"
FT                   /translation="MQITFDQVSHIYAKGTPFERVALHNISLTIPSGSFVGIIGHTGSG
FT                   KSTLIQHLNGLLMPSSGQITLGDAVITPKRRLPHAQRRDIGLVFQYPEHQLFEETVAKD
FT                   VAFGPLNFDLPTEMVEARVKESLEIVGLDYATIKDRSPFHLSGGQMRRVALAGVLAMQP
FT                   KVLVLDEPTAGLDPAGRVTILEGIYRIHREQNLTTLLVTHSMEEAARYADYLLVMEQGQ
FT                   VALQGKPEEVFMHVDRLRELSLDVPETVALVSQMNQKLPDKASLPSSLYREEELIAHLL
FT                   ERLSVPKEG"
FT   CDS_pept        252215..253012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02520"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41229"
FT                   /db_xref="GOA:C0ZIL1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIL1"
FT                   /protein_id="BAH41229.1"
FT                   /translation="MLQNIAIGQYVPGQSFLHRADPRSKLLFIILFATLIFLANNTVTY
FT                   AILIGFTLYAALLSRLSLSYILKSLKPVWILILFTVVLHIFITKGGTVYFQWGWFTVEE
FT                   QGVRQAIFISLRLGLLILISSLLTLTTSPIDLTEGLERLLGPLGKIGIPVHDIALMMSI
FT                   ALRFIPTLMEETDKIIKAQTARGANFTSGSLVRRAKNLIPIAIPLFVSAFRRAEELALA
FT                   MEARGYRGGVGRTRLNKLTFTWRDGIVAVVSVILVIVIGWWRT"
FT   CDS_pept        253009..253743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BBR47_02530"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41230"
FT                   /db_xref="GOA:C0ZIL2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIL2"
FT                   /protein_id="BAH41230.1"
FT                   /translation="MKRLRCVLAYDGTDFSGFQVQPDQVTVQGEIEAALNRVTGEDIQV
FT                   FGSGRTDAGVHARGQVIHFDTASNIPMDKWRFVLNNQLPDSIVIRTVEEVDASFHARFD
FT                   VQVKEYRYCIDNNPVADVFRHRYADHVRFPLDVDAMQQAAHYLVGEHDFTSFCSAKTYV
FT                   EDKVRTVYGLSVEKIGDEVWVTCRGNGFLYNMVRIIVGTLVEVGQGKRNPAELREILAA
FT                   CDREKAGKTAPAKGLTMWEVVY"
FT   CDS_pept        253998..254435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BBR47_02540"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41231"
FT                   /db_xref="GOA:C0ZIL3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIL3"
FT                   /protein_id="BAH41231.1"
FT                   /translation="MRTTYMAKPLEVERKWYIVDAEGQTLGRLASEVASILRGKLKPEF
FT                   TPHVDAGDFVIVINADKVKLTGNKLNDKIYYTHSLYPGGLKKTTAGAMLNKRPDRMFEL
FT                   AVKGMLPKNSLGRQMFTKLKVYAGTEHPHAAQKPEVWQIRG"
FT   CDS_pept        254456..254848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BBR47_02550"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41232"
FT                   /db_xref="GOA:C0ZIL4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIL4"
FT                   /protein_id="BAH41232.1"
FT                   /translation="MAQVQYYGTGRRKHSVARVRLVPGEGRIVINKREMDTYFGLETLK
FT                   LIVKQPLVLTETLGRYDVLVNVNGGGTTGQAGAIRHGVARALLKADPELRGALKRAGFL
FT                   TRDPRMKERKKYGLKAARRAPQFSKR"
FT   CDS_pept        254951..255691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BBR47_02560"
FT                   /product="germination-specific N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41233"
FT                   /db_xref="GOA:C0ZIL5"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIL5"
FT                   /protein_id="BAH41233.1"
FT                   /translation="MGQRGRYTVTRKGVGWILAFAVLMLLFTYEAPDRSSWQAWSLPLT
FT                   GTVIAIDPGHGGIDGGAVSKAGNVVEKEVTLAISMYLRDFLQQSGAFVVMTREEDKDLA
FT                   SPDAAQARKRKSEDIRNRVRLVNDSTPDFLVSIHVNSIPSPKWSGAQTFYSPSFKKSAE
FT                   VSYLIQDEIKRVIGHTDRVPSKTNNVFLIREVNCPAVLVEVGFVSNTEEAKRLQSVEYQ
FT                   KAMANAIYQGILRQYSGEKAPITP"
FT   CDS_pept        255803..256915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salA"
FT                   /gene_synonym="ybaL"
FT                   /locus_tag="BBR47_02570"
FT                   /product="protein mrp homolog salA"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41234"
FT                   /db_xref="GOA:C0ZIL6"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIL6"
FT                   /protein_id="BAH41234.1"
FT                   /translation="MLTREQVLEALRDVKDPEINRSLVELNMIRDIHIEGKTVSLTVVL
FT                   TISGCPLKAKIEDDVIAAVKALGAEEVHLQFGSMTDEERAALSAQLRKNQGGQTHNMTP
FT                   GQAPVLNPILAKDSNTTFIAVTSGKGGVGKSTVTVNLAVALARLGKKVGIIDADIYGFS
FT                   VPDMMNIEQRPTVIGETILPVEKQNVKVMSMGFFVEDNSPIIWRGPMLGKMLRNFFTEV
FT                   HWGEELDYLLLDLPPGTGDMALDVHTMIPQSMEIVVTTPHATAAFVAARAGAMAKRTGH
FT                   EILGIVENMAWYEAKDGTKEYVFGRGGGAKLAETLTCELLAQIPLGQPDNHPSEPDYSP
FT                   SIYGEKTEIGQLYIDMAKRVIEKCGEAVKQ"
FT   CDS_pept        complement(256971..257627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BBR47_02580"
FT                   /product="spore germination protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41235"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIL7"
FT                   /protein_id="BAH41235.1"
FT                   /translation="MRKKTMSFWLTALVCLVLTSCGGGGQAQSSSQPDYKSVKDMVLDI
FT                   LQTDEAKQSVGKMMKDDKFKQNLMLDESTVRTTLIQSMTNPNNTHIKEAFKDPKFASAM
FT                   AKSMKNEQKTLMKDLMKDPEYQKELISVMKDPEFEKNLMDLMKSSAYRQQTMQVMKDSL
FT                   QSPLFQAELMKIMTKVSEDLTKPKELKPKKKGKGKEGKGGGSGGGSSGGGSGKSS"
FT   CDS_pept        257753..258340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BBR47_02590"
FT                   /product="KinB signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41236"
FT                   /db_xref="GOA:C0ZIL8"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIL8"
FT                   /protein_id="BAH41236.1"
FT                   /translation="MSLRKYGWLFITTLLLGGLGGILVALIFDLDKLLGGSTGNFFVGL
FT                   FMYLLYGMTISIVAQMGFFAYMTINYFAKTIFKTASLWKSVQVFLILFVFFDMIYLRYT
FT                   SFGEGKGFGTYFIEPTLLLIVAIVTAYGKVSLTNKSAWIPTTFFMFVVTALEWIPALKE
FT                   DNVRATLSMLVPLLFCNVWQVMQLHRLVKRES"
FT   CDS_pept        complement(258367..259137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaB"
FT                   /locus_tag="BBR47_02600"
FT                   /product="putative polysaccharide deacetylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41237"
FT                   /db_xref="GOA:C0ZIL9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIL9"
FT                   /protein_id="BAH41237.1"
FT                   /translation="MKFIYVISAKRLKQILIIVAAIVLTAGFGYAERDSIAAFAEGAST
FT                   QAPQAIYKVDTKEKRIALTFDISWGETRALPILDVLKEKKVNKATFFLSSPWSQRHPDI
FT                   LKRIKEDGLEIGSHGHKHDNYTKYSDEEIRSQMGKADSILTEMTGKKPTLIRMPNGDFD
FT                   KRVLEIANRMGYSVIQWDTDSKDWTNPGTDVIINNVLSKAHPGDIVLMHASDSAKDTHL
FT                   ALPVIIDQLRKDGYEFVTVSELISGTSVESKEVH"
FT   CDS_pept        259262..259915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02610"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41238"
FT                   /db_xref="GOA:C0ZIM0"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIM0"
FT                   /protein_id="BAH41238.1"
FT                   /translation="MGSRLRHLWLDNRNYFFAACLLFLGGALIGYFQAPLVEEMVGKMM
FT                   GQLKEIAERIKDNGGGPLAVFWTIFSNNVFSALMMMALGILFALFPIIGMLTNGVLLGF
FT                   ILFKYSGAGVSPWLIFSAGILPHGIFELPAILFAAGVGIRLGVLSLRSVGVLIQPQKLA
FT                   RLKNDWYDTLKQFPLAVLTVVVLLFVAAIVESTITPTLLKETVGPQLQQLNLLK"
FT   CDS_pept        260031..260264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41239"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIM1"
FT                   /protein_id="BAH41239.1"
FT                   /translation="MLGFLFNTKEVQELEYLLKRELEEMLLDFSDKRIDHLVKRAMEER
FT                   YSIMFRMYARIASPNELSKYVRRRKLGEEHYT"
FT   rRNA            260478..261988
FT                   /locus_tag="BBR47_r0130"
FT                   /product="16S rRNA"
FT   tRNA            262051..262127
FT                   /locus_tag="BBR47_t0380"
FT                   /product="tRNA-Ile"
FT   tRNA            262145..262220
FT                   /locus_tag="BBR47_t0390"
FT                   /product="tRNA-Ala"
FT   rRNA            262304..262420
FT                   /locus_tag="BBR47_r0140"
FT                   /product="5S rRNA"
FT   rRNA            262536..265450
FT                   /locus_tag="BBR47_r0150"
FT                   /product="23S rRNA"
FT   tRNA            265503..265578
FT                   /locus_tag="BBR47_t0400"
FT                   /product="tRNA-Asn"
FT   tRNA            265585..265660
FT                   /locus_tag="BBR47_t0410"
FT                   /product="tRNA-Thr"
FT   tRNA            265680..265753
FT                   /locus_tag="BBR47_t0420"
FT                   /product="tRNA-Glu"
FT   tRNA            265840..265915
FT                   /locus_tag="BBR47_t0430"
FT                   /product="tRNA-Val"
FT   tRNA            265924..266008
FT                   /locus_tag="BBR47_t0440"
FT                   /product="tRNA-Tyr"
FT   tRNA            266029..266103
FT                   /locus_tag="BBR47_t0450"
FT                   /product="tRNA-Gln"
FT   tRNA            266110..266185
FT                   /locus_tag="BBR47_t0460"
FT                   /product="tRNA-Lys"
FT   tRNA            266206..266282
FT                   /locus_tag="BBR47_t0470"
FT                   /product="tRNA-Arg"
FT   tRNA            266288..266364
FT                   /locus_tag="BBR47_t0480"
FT                   /product="tRNA-Pro"
FT   tRNA            266376..266449
FT                   /locus_tag="BBR47_t0490"
FT                   /product="tRNA-Gly"
FT   CDS_pept        266622..267518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="BBR47_02630"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41240"
FT                   /db_xref="GOA:C0ZIM2"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIM2"
FT                   /protein_id="BAH41240.1"
FT                   /translation="MNKNMSIVGVPMDLGADRRGVDMGPSAIRYAGVVARLEKMGFNIE
FT                   DRGDIFVTRPHHFTETENHKYLDEVVEANEKLANVVSDIMTAGRFPLVLGGDHSIALGT
FT                   IAGVAKHVKNLGVIWFDAHGDLNTGATSPSGNIHGMPLAASLGYGHERLTNIGGYTPKV
FT                   KAENVVIIGARDLDQGERELIKRIGMKVFTMHEIDKLGMARVMDEAIAHVSKNTDGVHL
FT                   SLDLDGLDPHDAPGVGTPVIGGISYREGHVSLEMLADADILCSAEFVEVNPILDRENMT
FT                   ARVAVALMSSVFGDKLL"
FT   CDS_pept        complement(267612..267770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41241"
FT                   /db_xref="GOA:C0ZIM3"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIM3"
FT                   /protein_id="BAH41241.1"
FT                   /translation="MQRLSKKNVLLEIEMLRKELNDQYKKQACITPELITLSVQLDQLL
FT                   NKLRLHP"
FT   CDS_pept        267941..268273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41242"
FT                   /db_xref="GOA:C0ZIM4"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIM4"
FT                   /protein_id="BAH41242.1"
FT                   /translation="MDFVEKRLTQRAKRGDREAFAELIEIYKDKIFQLAYRMVGNRQDA
FT                   EDIAQETFLRVYANLHSYDDSYKFSTWIYRIATNLCIDRGRKKRPDFSLDEETEPGPGL
FT                   VFTPVF"
FT   CDS_pept        268516..269139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsiW"
FT                   /locus_tag="BBR47_02660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41243"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIM5"
FT                   /protein_id="BAH41243.1"
FT                   /translation="MECRDMICLIHEYLDGDTDELANLQLQAHIKTCVSCRQHMHELQR
FT                   AIAFVQSASHIHVSSDFTARVLAQLPAPTKANLLSGWLRNHPFLTAAAVFLFLMTGSVL
FT                   NSWFDQDDTLQVSSANLDKLKIDRERNVVVVPAGTNIDGDLVVRNGNVDVQGHVTGNVV
FT                   AIEGKVFVASTAQVVGNTESIEAIVDWIWYEVKNIGNDLLPILP"
FT   CDS_pept        269245..270069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02670"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41244"
FT                   /db_xref="GOA:C0ZIM6"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIM6"
FT                   /protein_id="BAH41244.1"
FT                   /translation="MISISMDYGDLLRYATDILLVTYVFYKIIMLIRGTRAVQLLKGIM
FT                   VIVITWFLSKYFQLTALHALMNQAFTFGVLAVVIIFQPELRRALEQLGRGKLFSRSSST
FT                   QDEEVVGRLVQEVGKSVTYMAKRRIGALIVIERETGLNDYVETGIGINGRVSSELLINI
FT                   FIPNTPLHDGAVIMRKDMIMAAACYLPLSENNSISKELGTRHRAAIGLSEVSDGIAIIV
FT                   SEETGQVSFAAHGAMNRNLTEAQLAEMLTEQLQPLSKGKSMGSRWQWRRKHG"
FT   CDS_pept        270062..271309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02680"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41245"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIM7"
FT                   /protein_id="BAH41245.1"
FT                   /translation="MDKWLNSHWFARAVALLLAIMTWMIVNLEAEQTTTPEASQPTFID
FT                   SVNLHVKYDTDRYQVVKQQRTVKVALESNNPFYRHNFFPEESWEVYVDATNLGKGTHRV
FT                   PVQYKGFPDEVKVGIIPNIVEITLEEKKTVEREVSVEKLGQVAPGYTAGEPIVKPFRAL
FT                   VRVPESQVNKVAAVKASVDLEGATSAIKTTVPLKVVDKSGNVIQGADVVPLTVEVNIPV
FT                   TSPFAKVPIKLNLTNELPNGYSLASMGMNVDEVTVYGPKEVIDGIKSNTYPGPEIDLSN
FT                   ITSDRDIELKIPLMDNIVKVEPEYLTVSLKVVPSTTKRLDKIPIRISGLSESMEAKVLS
FT                   TDGQEMSTIDFDVIGAPVVLNQLRHEDLQVVADVSNMPAGVYEVPLNYIFNQSEYIKTS
FT                   AGAPKKVTIQITNKQR"
FT   CDS_pept        271353..272699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BBR47_02690"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41246"
FT                   /db_xref="GOA:C0ZIM8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIM8"
FT                   /protein_id="BAH41246.1"
FT                   /translation="MGKYFGTDGVRGVANTQLTPELAFKIGRVGGYVLTRHKQEGKPKV
FT                   VIGRDTRISGQMLENALLAGLLSVGAEVVRLGVISTSGVAYLTRALGADAGVMISASHN
FT                   PFPDNGIKFFGSNGFKLSDEVEAEVEQYLDAAEDTMPRPTGEQIGTVLEFLEGGQKYLS
FT                   HLKSTVSERFDGLKVVLDCANGAVSSLAARLFADVDAEVITIGANPNGININDQCGSTH
FT                   PERLVEEVLKHKADLGLSFDGDADRCIAVDNNGEIIDGDYIMAICARALKAKGKLNNNT
FT                   VVTTVMANMGFFKGMEECSINTTKTAVGDRYVVEEMLRGGYNLGGEQSGHIVFLDYNTT
FT                   GDGLLTGLQLLNIIKESGKPLSELKQVMVKYPQLLINVRVEDKSKLNGNEAIAQAIREV
FT                   EEDLAGNGRVLVRPSGTEPIVRVMAEGPDAAQLEGLVNRIVDVVKQQLV"
FT   CDS_pept        273181..275013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BBR47_02700"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41247"
FT                   /db_xref="GOA:C0ZIM9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIM9"
FT                   /protein_id="BAH41247.1"
FT                   /translation="MCGIVGYIGNKQAQDIVIGGLRKLEYRGYDSAGVAVVNENGLDYS
FT                   KAQGRLAVLESRLESKPLTGSMGIGHTRWATHGKPSDENSHPHTDEKAAFAVVHNGIIE
FT                   NFLPLKEELLAKGYKFTSETDTEVIAHLLADMYDGDIVSTARRAVQRMRGAYALGIMTE
FT                   HEPDKLVAIRLASPLVVGVGQGESFIGSDIPAILEHTRDVYILNEGEMAVLTRDGVELM
FT                   NAETGEKIERELFHVEWDLVQAEKGGYDSFMLKEMHEQPQAVRDTMGARIDEENKRVIL
FT                   PELKMSDAELATYDRIYIVACGTSMHAGLVGKDVIEKWTRVPVEVAVASEFRYRDPIYT
FT                   DKTLMIVISQSGETADTLAALREAKKSNVKVLAITNVVGSSVAREADEVIFTWAGPEVA
FT                   VASTKAYTSQVVALYLFSLYLAQVKGTMAAAEVAEVVEHLSEIPGKIASMLNNDDQIRR
FT                   FAEGTKEVSSLFFIGRSLDYAVSLEGSLKLKEISYIHSEAYPAGELKHGTLALIEDNVP
FT                   VVALATQPDIYEKTVSNIVEVKARGAHVLGFATEGNHDLAKSVDEVIYMPATLPMLTPI
FT                   LTVIPLQLLAYYASVARGLDVDKPRNLAKSVTVE"
FT   CDS_pept        275836..276030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41248"
FT                   /db_xref="GOA:C0ZIN0"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN0"
FT                   /protein_id="BAH41248.1"
FT                   /translation="MKNVGYLDRTIRFIIGIVLLSMLVLVEGTWKYAGLIGIPLILTGL
FT                   LGTCIVYRILGVRTCSTKP"
FT   CDS_pept        276050..276430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41249"
FT                   /db_xref="GOA:C0ZIN1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN1"
FT                   /protein_id="BAH41249.1"
FT                   /translation="MKTYLSPANLQRIPELIKLSPEAAASYLDFEHQVYQTANTLPQKT
FT                   KELLAVTVAHVTGCPYCIDVHVKKYKALGGTMEEIMEALLVAASTRAGAILSHGVNALI
FT                   SYEEGEENAPQKGSNEGIKCFC"
FT   CDS_pept        276621..276719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41250"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN2"
FT                   /protein_id="BAH41250.1"
FT                   /translation="MKGYPYDNAVAEATFKLIKTEFVKNRRFESPT"
FT   CDS_pept        complement(276815..277468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41251"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN3"
FT                   /protein_id="BAH41251.1"
FT                   /translation="MGPPIVLFDYKRTRGGEHPRDYLQGFHGYLHVDGYVGYHKVANTT
FT                   LVGCWAHARRKFDEALKVLPSTEERYAIRKERSKPILDAYLVWLCQQRARTLPKSAVGQ
FT                   AIAYSLNQWEKLTSFLEDGRLEMDNNRSERSIKPFVIGRKNWLFANSPRGAKASAIIYS
FT                   LLETAKENQLNPFQYLNYLFEQIPQLSDVKNGEELDRFLPWSTSLPDVCHITKS"
FT   CDS_pept        277676..278089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41252"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN4"
FT                   /protein_id="BAH41252.1"
FT                   /translation="MQSAQQVLTSYFQALGSKQIDKVIELIHDEAKFIILKKEPSNKIP
FT                   LYGTFHGKEGVRNYLNLLEKSEQIEGFVLHKLIGNEEAACAWGNFRIKVNVTGKVFESD
FT                   WAIICEVEQEKIRFFQIFEDTAALEEAFDLRDR"
FT   CDS_pept        complement(278353..278952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41253"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN5"
FT                   /protein_id="BAH41253.1"
FT                   /translation="MVRSRAIPPKAPATRHAFFSLSWAVCTWESAKPCDCSKIASSCGG
FT                   ALHEMSTETRSEIEIIPAQVKVVRHVRQVYACRHCEREDVHTPVVTAPMPRPVYPGSFA
FT                   SPSILAHVMCQKYVESQPLYRQEQQFARLGLPLSRQTLADWMIYGAEKWLSHLVERMRV
FT                   HLLRQDVLYADETTLQVLREPGESSTNTVLYVAVVR"
FT   CDS_pept        complement(278939..279148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41254"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN6"
FT                   /protein_id="BAH41254.1"
FT                   /translation="MNARSEAVELKTSPSTIDLQLAPLRPFLDDKTLTEFVINGPGEVL
FT                   TEGPDGWTTHQIPAITQEWCLGQE"
FT   CDS_pept        complement(279148..279750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41255"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN7"
FT                   /protein_id="BAH41255.1"
FT                   /translation="MLTDRNYLIAQAAHVECTMPEAIDTTLPGMVSCLQAQDAYSDNGA
FT                   VVLLEKGTVYTGEMQRALVNGQSRAFLLWTRAKTPNGVVINLASPAADELGRSGISGQV
FT                   DTHFWERFGSAIMLSLIDDVGSALAASQTKGSGSGNNTVLAFPNTIQGTQSVMGDVLKL
FT                   TADIPPPTLRKHQGATVNIYVARDLDFRGVYGLKEKL"
FT   CDS_pept        280055..280270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41256"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR032428"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN8"
FT                   /protein_id="BAH41256.1"
FT                   /translation="MKRLKERNIQVIYEHLVDGRQQTELADELGITKKAVSQMVSKVWA
FT                   LHIEHGERPDGWTSISVTLGAAHTTP"
FT   CDS_pept        280619..280978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02800"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41257"
FT                   /db_xref="GOA:C0ZIN9"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIN9"
FT                   /protein_id="BAH41257.1"
FT                   /translation="MLVVAGVIHLLPLSGVLGSERLASLYGLPFNEPNLAILMRHRAVL
FT                   FGLIGSFLLFSAFQPALQSIAIVGGIISVVSFLYLAWAVGSYNPQIGRVFLVDVIVLIC
FT                   LVVGAIAHVYMLRKS"
FT   CDS_pept        complement(281010..281336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41258"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP0"
FT                   /protein_id="BAH41258.1"
FT                   /translation="MRSLRDQVISIGKQRSPRTGQIRSLQPFRQSITRSSRTIAGASRR
FT                   RLKTFSAGVSGRGCCAPGGGGAGGAPSAKARLCTSAVDPKQTFDTQTDCCQPPMLKRSV
FT                   EVLS"
FT   CDS_pept        complement(281771..282817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41259"
FT                   /db_xref="GOA:C0ZIP1"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP1"
FT                   /protein_id="BAH41259.1"
FT                   /translation="MVKIFISHATDDATMVTKLMDLLQTQFNLQRENFFYTSDEELKVG
FT                   GNWIEQIRQGMQDATLIMPIITPRYFESHFCMCELGAAWVNEQALIPIIIPPLKHSALG
FT                   STPYRSWAQSITFNSKEDIMRLAESMKDKKVGTFNSVRFNNRAEQFYNEVLSQFVEEMK
FT                   SREILTPAVLKELRTENHSLIEAYNEAEEEVKKLKAENDALRSLKDAEAVKALDHAKMD
FT                   EWQSFLDAVTIAKNELDKLPKLVTSVLYHMRKSSYDGFVGDQMDFADLQQLDSKGYIEW
FT                   DDGWKPVYTHPAVRRADNAIDALQAVIDEDPAIIQDRFEDEYEDVMFGLKYSPFWEEVL
FT                   GQDIVHSN"
FT   CDS_pept        complement(283398..283853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41260"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP2"
FT                   /protein_id="BAH41260.1"
FT                   /translation="MDHSGEGHAKRIYLVRKVGVAVMKNKSQPYTDFREMYRDIDVAAE
FT                   AYYNEFFHAYKTDGRFPEVYTIEQTKRASSAIQLLQLLEWEWNPVRLLALLSTVGAALG
FT                   IGRPIPVYDFCSMIEGAALIGTPYLDYYTKKKDILMATLEMFANEEP"
FT   CDS_pept        complement(284090..285196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="BBR47_02840"
FT                   /product="probable glycerophosphoryl diester
FT                   phosphodiesterase precursor"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41261"
FT                   /db_xref="GOA:C0ZIP3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP3"
FT                   /protein_id="BAH41261.1"
FT                   /translation="MKKLVTSLAAALAITTSFGSVSFAEADKIVIAHRGASAYLPEHTL
FT                   PAKAMAYAMGVDYIEQDVVMTKDNKLLIMHDHYLDSVTNVAEVYPDRKRKDGRYYVIDF
FT                   TLDEIKKLKTTEVFTVENGKQVQDYPDRFPLWKSNFSVHTLEEEIELIQGMNKSTGRNV
FT                   GIYTEIKAPWFHRHEGKDISLAVLQVLKKYGYVSKNDKAYIQTFDPNEAKRIRTELYPQ
FT                   LNMNVKLVQLMAETGWNETMNYENGKAVPYNYDWMFEKGAMKEIAKYADGVGPWKPMII
FT                   KEESTRDHLIITNLVKEAHEADLDVHPYTFRADKGQIPAYAASFEELLDQFYFTAGVDG
FT                   VFTDFPDRAVDFLRRAEYQSKMSKNQRS"
FT   CDS_pept        complement(285453..285749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41262"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP4"
FT                   /protein_id="BAH41262.1"
FT                   /translation="MLIIHAHLQVIPAQEEAFLQAAKALVAASQAEEGNVGYTLMKSTE
FT                   QEYHYTMVEKWKDAAAVAAHNASAHFQAFVKQAPSFFAAAMELEVFAGEPVKL"
FT   CDS_pept        complement(285781..286422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41263"
FT                   /db_xref="GOA:C0ZIP5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP5"
FT                   /protein_id="BAH41263.1"
FT                   /translation="MKNTVQRTNDFREITFGRRSVKLYDPEIKISREEMIEILAGATRA
FT                   PSSVNMQPWRFVVIESQEGKEKLAELARFNKTQILTSSAVIAVFVDMNNAEYMDEIFGK
FT                   AVELGYMPQDVKDMQLKAVKPYYANLPASDLRDVNFIDAGLVSMQLMLVARSFGYDTNP
FT                   IGGYEKDQIAEALDLDKDRYQPIMLISIGKAAKEGYPSYRLPVETVTTWK"
FT   CDS_pept        complement(286448..286867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02870"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41264"
FT                   /db_xref="GOA:C0ZIP6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP6"
FT                   /protein_id="BAH41264.1"
FT                   /translation="MTRKEFEEEQILNLLIGLTNKISPKFERCTGISSTRLAILQILCE
FT                   CNEINQSQLQKHINIDSAAITRHLKQLEVDGMVTRHKNPNDNRETFVRLSEEGHHRIEG
FT                   YKSEKRNFIQQILEGFSEDETQVLTDFLKRMQNNI"
FT   CDS_pept        complement(287100..288314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yndF"
FT                   /locus_tag="BBR47_02880"
FT                   /product="putative spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41265"
FT                   /db_xref="GOA:C0ZIP7"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP7"
FT                   /protein_id="BAH41265.1"
FT                   /translation="MKQSHHRERLLLLTSLSVFLLFLLTGCWSSNDIDKMGMGIGLALD
FT                   ASNKSNVEKKLEKQGKSPPHVDTITMTYQFINPKATSKESSSAGPQQKAYLNASQTGES
FT                   ILPIIREFSLSHDTPLFSPHLKVIVISEALLHTHRLESLLDLFLRDNEIRPSCLLLVSN
FT                   GNARDVLETKKPGELPALNLLGIVDNRNRTAKILPPVSLAKLTAKLNSESSFLLQNVAA
FT                   SNKEVKFEGAAVINGKTKKWAGFLNEMDLEGITWITGKGKGGLVRSLDKETGQLIIYEI
FT                   ETMESKITPHVDGNKISFDVHINSKGRLSENWVLNANPFENEFLKRVEKAAELEVRKLV
FT                   KNVTAKMQNHFHADVAGFGERLRIEYPKTWEKVKKDWDQTFSTVPITYFVKLTTTDFGA
FT                   SGPSK"
FT   CDS_pept        complement(288292..289401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yndE"
FT                   /locus_tag="BBR47_02890"
FT                   /product="putative spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41266"
FT                   /db_xref="GOA:C0ZIP8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP8"
FT                   /protein_id="BAH41266.1"
FT                   /translation="MLPTRNDRITTSQTAVIIINFILGAGILTLPRISVEKAKTPDVWI
FT                   SVIIGGLLAMLAGIIIVKLSQRFPEKTFFEYSQEIAGEWVGRMLSLLIICYFCMTSSLQ
FT                   VRSMAEVTTFYLLEKTPMWAIVMVFLWVALYLVIGGINCLARMLEIILPITVLFFLVVS
FT                   LMSIKIFEIDHLRPVLGLGWKPVFDGIKPTALAYTGFEIMMIIVVYMRQPNKGVKAVVV
FT                   GISASLIFYLMTVVMVIGAFSIDGVVTRTWPTIDLIRSFEITGLLFERFESLLLVLWIM
FT                   QIFSTFTLAYYSAALGLAQLFKKNMEPFLFGLLPVIYIITMTPKEINSVFALGDFVGDA
FT                   AFFLFGVMPLLLLIISGWKVGKHEAKSSS"
FT   CDS_pept        complement(289430..290923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yndD"
FT                   /locus_tag="BBR47_02900"
FT                   /product="putative spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41267"
FT                   /db_xref="GOA:C0ZIP9"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIP9"
FT                   /protein_id="BAH41267.1"
FT                   /translation="MESIAPFTDDYLSNLNLIRQEIAQNADVHIREFSFGQTASRASIV
FT                   FVDGLSDRDLIDNTILKTLMKDSVAVMVQENSSGDVSVSKDFFINHVLSIHEILECRDV
FT                   YDLRTKVLTGFTALLIEGTANALLLNTVKVKTRNIDEPVSESLVRGPRVGFTETLSENT
FT                   ALLRRHGENGDLLFLKFQVGERAKKELIIAYMKEIANPALVEEVKNRITKIKIDHVPES
FT                   GYVEQLIEDNYLSPFPQAQSTERPDRVISALMEGRVAILLDGTPFALIVPVTFSMLLQS
FT                   PEDYYERWIPSTFIRLLRFFTAFSSLLIPALYISFISFHQGLIPTELAISIISTRQGVP
FT                   FPALLEALIMEVSIEIMREAGLRLPKPIGPAIGIVGGLIIGQAAVQAGIVSPIMVIVVA
FT                   VTAISSFAIPSYNLGISLRLIRFLVMFSAAMFGLYGVILFFLLLTSHLVKLKSFGVPYV
FT                   TPAVPYRLRDWKDFMVRMPLMMMKRRPKMLHTKEPTRKG"
FT   CDS_pept        complement(290929..291054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41268"
FT                   /db_xref="GOA:C0ZIQ0"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ0"
FT                   /protein_id="BAH41268.1"
FT                   /translation="MWKTIVSNLPAWPVFIQAAVVFLVPYAISRLFHWIRTTEEE"
FT   CDS_pept        complement(291256..292620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="BBR47_02920"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41269"
FT                   /db_xref="GOA:C0ZIQ1"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ1"
FT                   /protein_id="BAH41269.1"
FT                   /translation="MLKLFKPAPPIDRLPDEQIDSEYKKLRLQVFLGIFIGYAAYYLIR
FT                   KNFSLAMPYLIEEGFTKSELGFALSAISISYGISKFVMAIFSDRSNPRMFLPAGLILSA
FT                   LISLLMGVVPYFTSSVTIMFVMLFLNGWFQGMGWPPSGRVLVHWFSVSERGNKTAIWNV
FT                   AHNVGGGLMAPIAVAGAAMFTTFSGSAASGYEGVFILPALVAIVFGFITYFLIRDTPQS
FT                   AGLPPIEEYRNDYPNKEKKTFETEFSTKEILFKYVLNNKWVWAIAIANIFVYFVRYGVL
FT                   DWAPTYLSEEKGFDMNKSSVAYFLYEWAGIPGTLLCGWLSDKLFKGRRGPAGFVFMLGV
FT                   LIAVLVYWFNPPGNSVVDMICLIAIGFLIYGPVMLIGLQALDFVPKKAAGTAAGLTGLF
FT                   GYLGGTVTANALMGVIVDASGWDAGFMLLTASCALAALVFAFTWNVRGQEVVKNH"
FT   CDS_pept        292923..294449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiD"
FT                   /locus_tag="BBR47_02930"
FT                   /product="putative chitinase D precursor"
FT                   /EC_number="3.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41270"
FT                   /db_xref="GOA:C0ZIQ2"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ2"
FT                   /protein_id="BAH41270.1"
FT                   /translation="MMYFLMRKAGVLVVLSLLLIFSLFPHSSHAMTPWTPNTVYKVGDM
FT                   VTYQEQDYKCTFAHTSLVGWEPPNVPTLWQPQGPSAPDTIPPTSPTNLSEVGKTSSSVS
FT                   LSWSASTDDRAVKEYLVYNGDTLAGISSTPSYTVTGLLANTTYSFTIQAKDAAGNVSPP
FT                   SASITVTTLSTSPNEPVSKRVLIGYWHNFDNGSTVLKLRDVSDKYDVINVAFAEPVGGD
FT                   HATMGFVPFNASVEEFKSDIALLQSKGKKVLISIGGANGTVELTTEAAKQSFITSMTSI
FT                   IQTYGFDGMDIDLEGSSLSLNAGDTDFRNPTTPKIINLIAATQTITNTFGPSFILTMAP
FT                   ETAYVQGGYAAYGGPWGAYLPVIHALRDRMNYIHVQHYNSGALEALDGRTYQQGTADFQ
FT                   VAMAEMLLKGFPIGRNPNNMFPALRENQVAIGLPSASSAAGGGYTSPADIQKALHYLVK
FT                   GTSFGGTYKLQNLAGYPQFQGVMTWSINWDARNNYSFANHVRTSLDSLSQ"
FT   CDS_pept        complement(294528..295223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ3"
FT                   /protein_id="BAH41271.1"
FT                   /translation="MLKKSMVSALGLLVATMSLSIPTQAAELTTPSQETLLRNKSTDSR
FT                   KVSGITSVSFGATKQISKSTPIPPDWVITTVMSDYYVIQYVGGASLGQTVQTVRTTPIP
FT                   KDWVITVATSDFFVWKYVGGASFGYKVQTAKITQVPENWVITLATSDFYQLMYVGGASF
FT                   GQRVQTAKITRIPENWVITQATSDFFVWMYVGGASYGTTVQTAKTTPIPPGWVITTATS
FT                   DFYILTYKG"
FT   CDS_pept        295385..295693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02950"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41272"
FT                   /db_xref="GOA:C0ZIQ4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ4"
FT                   /protein_id="BAH41272.1"
FT                   /translation="MRMDPIEIFKALSNESRLQILHWLKEPEKHFIPHEGVDMRTIGVC
FT                   VSQITEKLNMTQSTASQYLSILQRAGLIKTERIGKYTYYTRDEEKIREIGAFFSSQI"
FT   CDS_pept        295789..296994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02960"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41273"
FT                   /db_xref="GOA:C0ZIQ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ5"
FT                   /protein_id="BAH41273.1"
FT                   /translation="MSNTWKVYLLSLVSFLVGTSEYVISGILDKISDTMGISITAAGQL
FT                   VTIFSFVYAILTPVMMAITAKMDRRRLLVSALGIFVVANILSFALQGFEFFIMARVIMA
FT                   IGAGMVVVTALDIAAKISPEGKQASSIATVIMGFTASLIIGVPLGRVAAAAFEWQSVFG
FT                   FIAIAGLLAMVVLSRTIPQVKGDVPVPLSKQLALLKNPKVGLGLSVTFFWLGGYSIAYT
FT                   YISPYLLEAADISENLLSSALLAFGLASLIGSKFGGYSTDKWGVSPTLLGGMLLHVAAL
FT                   ILLSITVSISHEPFTVIAILVLWSFAAWSSGPTQQFNLVRIAPNNSGVMLGLNQSMMQL
FT                   AMAAGAGIGGIAVDQVSLSSITWLGMSGVAIAIVAALILQVMLKERVRHKPGAYETRSS
FT                   NR"
FT   CDS_pept        complement(297219..298010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41274"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ6"
FT                   /protein_id="BAH41274.1"
FT                   /translation="MLSVTPRYAVSSSVQYRSPGIHPQTKALEHDSNKKQDHLTISQQG
FT                   LQLSSGNNSPNKNKMLQSLMEQKQAMLERRNNYYADAVEKLTDPKVMKERLDEMDKQIE
FT                   EIDTQMKLIQLEEQRKARGTDEEQSKEQKASDIAPKQDESLQSSSTLHAVLTATHHLKN
FT                   MHSVKRAQITLELEAKAWEPASKDGDFTKSEELKRKAEGLDGKLLKMADEIDKRLEKSQ
FT                   DANQAEHSSNDKQADEQKKNPYLQKRMENQQVSGSTIDWIA"
FT   CDS_pept        complement(297991..298194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41275"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ7"
FT                   /protein_id="BAH41275.1"
FT                   /translation="MNISAKYIFPVSTYLKLQGIKQVKFGKLLSDTNNNQKPVIRILDW
FT                   LPFWPTTRFMKGGIIIYVVCYT"
FT   CDS_pept        298315..300291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_02990"
FT                   /product="probable methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41276"
FT                   /db_xref="GOA:C0ZIQ8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ8"
FT                   /protein_id="BAH41276.1"
FT                   /translation="MIKKMITGYKASLSKQILFLLVLLIVVPSVVLSLTLTQLARNQLE
FT                   HELLSQVESVTTMITQVLNNSYEDYSATIDSFADVQVPPGQSADTYIYDRIRNIEKDID
FT                   NVLAAFMYYDNRYYNSAKKEIDPTTREWYKEAMQHKGQVVVTPPYIDAISGGYVITFAK
FT                   TLSDGKGVAGIDVSIDHLNELVKTYKIGEKGYVSLFDQNNVTMSHPRFPQGKPLEDIRF
FT                   QVMRDGAEGSFEVDDDELREYYHFNKQNSLGLNVVSVIDWNEINQKTGPLLRTSFLFIV
FT                   LLLALIALFVWIFMKRTVRPILQLKQLTDLIAQGDLTVRSIESGRTDEIGQLQSNFNTM
FT                   SQSLSDVLRQITDHSEQISASSHHLSANSEENVQTIEQVATSMQEIASMSSDMNQSIDT
FT                   VKQSATQAQQELDDAIRILRESTEMSQLITGLANTGEESLGAARQQVNMIVEHSARSKQ
FT                   EMEELKQVAEEISGVTNFIQDIASQTNLLALNAAIEAARAGQEGRGFAVVADEVRKLAD
FT                   QTGSAAERIDSLIGEVQNRVLHMVRRTEEGVDSATAGSDLTQSVEQRFTEMYEAINRID
FT                   AHLAQVARVSERLMQSNTAMLVAFGESSAMSQATAQEVDQVAAASEEQNASMEEVAASA
FT                   VHLANIAEELQLLVQRFKLERTQ"
FT   CDS_pept        complement(300364..300945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03000"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41277"
FT                   /db_xref="GOA:C0ZIQ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIQ9"
FT                   /protein_id="BAH41277.1"
FT                   /translation="MARTREFDEEKVLDAAMQLFWEKGYEATSLSDLTSRMGIQRPSIY
FT                   STFGDKKELFEAALRRYTMSRALEIRTKLQNTPSVKEAFRHFFKEVADEEYTEGLSRGC
FT                   FCINTMVELAPHDEKFEILTREHQMYLSVIFQETIERGIQSGELDSSIDAKATAQALIV
FT                   SLIGLTVILKSRPNRSFVDNSIEVTLTLLR"
FT   CDS_pept        301196..302404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03010"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41278"
FT                   /db_xref="GOA:C0ZIR0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR0"
FT                   /protein_id="BAH41278.1"
FT                   /translation="MEEVIEKVTANSPMPRYVTLLFAVACGMSVANIYFAQPLLDHLSS
FT                   EFRIDYSIIGILITLTQIFYAVGLLLLVPLGDLLNQRHLIIGQMFLSVVALIIVGTAST
FT                   STVLFAGIAAVGLLAVVTQTIVAFAATMAAPAERGRVVGVVTSGIVIGILLARTIAGVL
FT                   TDLAGWRSVYLVSAAFLLLLVCVLFRVLPNRGREVKPLSYLKLLGSVLMLFAQERLLRI
FT                   RSVLAMLIFAAFSILWTPLVLPLSAPPLSLSHTAIGAFGLVGVAGALAAARAGKLADRG
FT                   YGQRTTGFALSLLLLSWLLISYIEQSLFALAIGIVLLDLAVQAVHVTNQSMIFTLGAEA
FT                   RSRLTAGYMVFYSIGSSAGSIASTYTYAHFGWEGVCLLGASVSGLALVYWAVTRRVSAI
FT                   SGK"
FT   CDS_pept        302503..303555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41279"
FT                   /db_xref="GOA:C0ZIR1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR1"
FT                   /protein_id="BAH41279.1"
FT                   /translation="MEIGITSFVETTPDVQTGEVMSHAQRLREVVEEIVLADQVGLDVF
FT                   GIGEHHRKDYAASSPAMVLAAAAPLTKRIRLTSAVTVLSSADPVRVFQDFATLDGISNG
FT                   RAEIMAGRGSFIESFPLFGYDLNDYDELFEEHLELLLKIQASEKVTWRGGHRPAIQNLG
FT                   VYPRPVQNPLPIWIGSGGNQESVVRAGLLGLPLMLAIIGGSPRQFEPLVQLYKKVAMHA
FT                   GHDVSRLTVGSHSLGFVAEETELAADTFFPSTQAGMNKIGRERGWAHYNRASFDAARSL
FT                   EGALYVGDPETVAQKIIHLRKQVGMTRFMMYVPISTMPHEQVMRAIELLGTEVAPRVRE
FT                   EITKWEAETE"
FT   CDS_pept        303587..304528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03030"
FT                   /product="putative arylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41280"
FT                   /db_xref="GOA:C0ZIR2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR2"
FT                   /protein_id="BAH41280.1"
FT                   /translation="MDFHRRVLPELRQTLAQFPGFQLEENLESSRAMLKNPPIVKSEHV
FT                   RTTSRMIPGAAGEMLAKIYEPVQRTGSKLPAMLWIHGGGYVMGHPDMDDALCERFVQAA
FT                   NCIVVSVDYRLAPEHPYPAALYDCYAGLTWMTDEAESLGIDLNRVAIAGASGGGGLTAA
FT                   LALMARDKGGPALIFQMPLYPMIDNRNRTASSYEIEAENATWNRKNNLAAWRMYLGEGA
FT                   DDSQVSAYAVPSRAESLAGLPPTYTCVGQLDLFRDETIEYVTRLAQAGVDVEFHLYPGC
FT                   YHCFEVFVPEAEVSQRASQSYIDAMARALHPK"
FT   CDS_pept        complement(304624..304968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41281"
FT                   /db_xref="GOA:C0ZIR3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR3"
FT                   /protein_id="BAH41281.1"
FT                   /translation="MEHYLAEQYREGLQAFGQLMPEALRAYNEFTSQCFSSGELSSKHK
FT                   HLQALAISLYSGNEHCIVYHLEAALNDGVSQKEIAETVAVAGAFGGGTTLSHGVILIND
FT                   VMEEKQGTIQ"
FT   CDS_pept        305350..306729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxG"
FT                   /locus_tag="BBR47_03050"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41282"
FT                   /db_xref="GOA:C0ZIR4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR4"
FT                   /protein_id="BAH41282.1"
FT                   /translation="MGNKELKRGLEARHIQMIALGGTIGVGLFMGSASTIKWTGPSVML
FT                   AYAIVGIFIFFIMRAMGEMLYLEPSTGSFATFGHKYIHPLAGYITAWSNWFQWVVVGMA
FT                   EIIAVGTYMKYWFPDLPAWVPGIIAMVILGIANLVSVKSFGEFEFWFAMIKIVTIVLMI
FT                   FAGFGLIFFGIGNGGNAIGLSNLWENGGFFTGGWTGFFFALSLVIGAYQGVELIGITAG
FT                   EAKDPKKTLRSAIQNIIWRILIFYIGAIFVIVTVYPWDQLQAIGSPFVATFAKIGITAA
FT                   AGLINFVVITAAMSGCNSGIYSAGRMLYTLGVNGQAPKVFTKLSSNGVPLLGTIGVLIG
FT                   LGIGVILSYIAPENLFVYVYSASVLPGMVPWFVILISQIRFRKAKGAEMDNHPFKMPFA
FT                   PVSNYLTIAFLIMVLIGMWINDETRVSLIAGIVFLAIVVISFFTLGINKAVPLDEQSNK
FT                   K"
FT   CDS_pept        306919..307443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03060"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41283"
FT                   /db_xref="GOA:C0ZIR5"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR5"
FT                   /protein_id="BAH41283.1"
FT                   /translation="MKQRNYTPIIVILTIAINTLVAILYFMPKNNDFSHLDLTFLPFFN
FT                   AVMNSFTFIFLIAALVSIVKFKNIKMHRGYIFAAFSTTALFLVSYVIYHGMAPSTSYGG
FT                   EGILRPIYYFILITHILLSVIIVPFALITTARGLNMKVEKHKKIARWTMPMWLYVSATG
FT                   VIVYLMISPYY"
FT   CDS_pept        complement(307514..307831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41284"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR6"
FT                   /protein_id="BAH41284.1"
FT                   /translation="MKRGLLIGISAVVVVAGVLSIPVEAEPSPDTRVILEHTNKRYISP
FT                   PCYEQANKTNNLAEADIRKAQELNYQPESSCTANSLAPIKQPIASVLAVNLGIKQSHWD
FT                   W"
FT   CDS_pept        complement(307973..308899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03080"
FT                   /product="putative macrolide 2-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41285"
FT                   /db_xref="GOA:C0ZIR7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR7"
FT                   /protein_id="BAH41285.1"
FT                   /translation="MSKNNVEHMLALAKNNGILVDPTTVKVNESGLDFLAIFASTIDGV
FT                   PWVLRQPRRDDVVETARYEKRVLDLVTKHLRVDVPDWQVHTSEFIAYPILGGTPMATIN
FT                   METKNYDWYLNPESLPELCIQTWAEALVELHGIHHDLARDAGIRVKQPSYARASLREKM
FT                   NEIKRVFGVSGALWDRWQKWLADETFWPAHSALVHGDLHPGHILIAENGKVTGLLDWTE
FT                   AEVSDPAIDFTVVYLLFGDTGLADFIQRYEKAGGRVWSRMHEHIVEMTAAYPVTLATFA
FT                   LKSGLEEFKIMARQALGVDENGIEITS"
FT   CDS_pept        309125..309886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /gene_synonym="xthA"
FT                   /locus_tag="BBR47_03090"
FT                   /product="exodeoxyribonuclease"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41286"
FT                   /db_xref="GOA:C0ZIR8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR8"
FT                   /protein_id="BAH41286.1"
FT                   /translation="MKLISWNVNGLRACVNKGFYEYFKEANADIFCLQETKLQEGQIEM
FT                   EIGEAYHQYWNYAEKKGYSGTAVFTKMEPLSVRYGLEEDHEPEGRVITLEFQDFYLVTV
FT                   YTPNAKRDLSRLDYRLEWEDRFRNYLLQLDGKKPVVVCGDLNVAHQEIDLKNAKSNRGN
FT                   SGFTPEEREKMTSLLAAGFVDTYRYFYPDQTDAYTWWSFMPKVRERNIGWRIDYFLASE
FT                   RLAPALLRAGIDSQVMGSDHCPVVLELGTIE"
FT   CDS_pept        310055..311374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03100"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41287"
FT                   /db_xref="GOA:C0ZIR9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIR9"
FT                   /protein_id="BAH41287.1"
FT                   /translation="MLTMNLLLIAFLIVATAFFVATEFAIVKLRPSRVDQLVMEGRKNA
FT                   LAVQKVVSNLDGYLSACQLGITLTAIGLGVLGKPTIESIISPFLTPYLPEQVVAVLSFV
FT                   IAYSLVTFLHVVVGELAPKTVAIQKAEAVSLLCAKPIIWFYKLMYPAIWVLNGSAALLV
FT                   RSFGMKPTKGHEESHSEEELRIILTESYESGKINQSEYGYVSNIFAFDEMLAREIMVPR
FT                   TDMSCLHKEYTLEQNLRIMKEEQYTRFPVISQNKDHIIGMINTKEFFLNYADDPNLDFS
FT                   KLIRPFLMVSEATPVKDLLKKMQKQRTHIAILIDEYGGTSGMVTIEDILEEIVGEIRDE
FT                   FDAEEKAEIEIVEKNSHVIVDGKVLLSEVNDLLNANINEEELDTIGGWLYSQNPTLKEG
FT                   IQWQYDDLVFTIRKKDKHRIRKIEIQKAAEVPARELQDVT"
FT   CDS_pept        311609..314620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03110"
FT                   /product="collagen like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41288"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS0"
FT                   /protein_id="BAH41288.1"
FT                   /translation="MPLIFPPQGCPAIFPGPTLDPPDPPDPPGVTGATGATGPTGATGA
FT                   TGATGPTGVTGANGAAGGDTGATGATGQTGETGVAGATGATGATGATGATGQTGETGVA
FT                   GATGATGQTGETGIAGATGATGQTGETGIAGAPGATGQTGETGIAGATGVTGQTGETGV
FT                   AGATGATGQTGETGIAGATGATGQTGETGVAGVTGATGATGQTGETGIAGATGATGQTG
FT                   ETGIAGATGATGQTGETGIAGATGATGQTGETGVAGVTGATGATGQTGETGIAGATGAT
FT                   GQTGETGVAGATGATGQTGETGIAGATGQTGETGVAGVTGATGQTGETGIAGSTGATGS
FT                   TGATGQTGETGIAGATGATGQTGETGVAGATGTTGQTGETGVAGATGATGQTGETGIAG
FT                   ATGATGQTGETGIAGATGATGQTGETGVAGATGVTGQTGETGVAGATGATGQTGETGIA
FT                   GATGATGQTGETGVAGATGATGQTGETGVAGATGATGQTGETGVAGATGATGQTGETGV
FT                   AGATGATGQTGETGIAGATGATGQTGEAGVTGVTGATGQTGEAGVTGVTGATGATGQTG
FT                   EAGVTGVTGATGATGQTGEAGVTGVTGATGQTGEAGVTGVTGATGQTGETGVTGVTGAT
FT                   GQTGETGIAGASGVTGQTGATGVTGATGATGQTGETGITGVTGATGTAGTTGATGATGA
FT                   TGTAGTAGATGATGATGTAGATGPTGATGTAGTAGATGATGATGTAGTAGATGATGATG
FT                   TAGAMGPTGATGTAGTAGATGATGATGTAGTAGATGATGATGTAGTAGATGPTGATGTA
FT                   GTAGATGPTGATGTAGATGPTGATGTAGTAGATGPTGATGTAGTAGATGPTGATGATGA
FT                   TGSLQQFHVSQNTPNTVGSSAIPLTTVATTLKTITMTGVAAGNAVWLTGIVGWQSTAGT
FT                   TSVQLQILRGTTIIFSINHHSAGNNTFEATSVNHVDLTPGTGNVTYSLVALTNDGTANA
FT                   IGAITLTGALLATT"
FT   CDS_pept        complement(314720..315271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41289"
FT                   /db_xref="GOA:C0ZIS1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS1"
FT                   /protein_id="BAH41289.1"
FT                   /translation="MASLIYHVAVSLDNFIADQAMMDGNIDSTLFLFEGEHVPDFLSEI
FT                   QEYDAVLMGAKTYEFGFKFGAKPGEPGYKGIKHYIFSNSMQFESNAEVELVKGDAIEFI
FT                   KNLKQQENGKLWLCGGGELAGALLAHQLIDQLVLKVNPVMVGEGVPLFGSAKPRLKLEL
FT                   VDMKQYANGVTKPTYNIVYL"
FT   CDS_pept        315392..316993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41290"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS2"
FT                   /protein_id="BAH41290.1"
FT                   /translation="MKQLTPKEQGLLEELYRSDERKGEILHSLGKMGSMITLTFLLPFA
FT                   LEKGEEVRKAALAAVHQITSRLRTQDFIGLDQYIRRLTPYSNRNQLEAWHELLPEDIRN
FT                   FSINDEADLSFIGICSFHRNGYVREAAIEVLLKQVTGAEIPFLLIRLNDWQPKIRYLAF
FT                   KACKVRFRPNYVKHFLESIFLLKHLSAYYNREKFSDFLEEIDAMFRHPDNRDVLRSGFR
FT                   SKDPVVRRFCFDLALNLHDIDPDEVIAAALIQKDAMIRLQTVRYLCRQDDNERLRKWLD
FT                   RIRRDVFPSIRQLALQAYVDRLPEESTDALLAALLDGHKSIREMTRFYLRDKKIDLVAF
FT                   YREKLRDAEEQVIPIAIVGVGETGVKADDQSILPFLLHENERIQRAAMKALAMLNPDDH
FT                   IEVFIRALQTNKRSASREARQILADRVELRHTDMLWEMLEKDVGLHVKKNILFLFSKMN
FT                   KADSISLLLRACVVQEKEIRDDAILHVEYWLNGYNKRFYLRLKDEQCEKISHTLEAVRK
FT                   FLPEDIAESVESLLAK"
FT   CDS_pept        complement(317037..318047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="BBR47_03140"
FT                   /product="putative homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41291"
FT                   /db_xref="GOA:C0ZIS3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS3"
FT                   /protein_id="BAH41291.1"
FT                   /translation="MDYDIFHLGDVRLQSGVTLPHAFIAYKTYGTLNAAKDNVIIFPTS
FT                   FGDQHYQNEWLIGEDKALNPNQYFIIIPNMLGNGLSSSPSNTASPYDQSHFPHVTIYDN
FT                   VAVQHRLITERFGIKKIALATGWSMGAIQAFHWAASYPDMVERLAPFAGTAKTWPHNIV
FT                   LIEGIRAALQADVAWNNGQYTAPPEVGLRTLGRVYASWGFSQPFYREECYKALGYETLS
FT                   EFISGFWEESFVPSDANDLLAMMWTWQHADISQNDRYKGDFETALRSIQARTVVMPVRT
FT                   DLYFTPEDSEYETKHIPNATFKPIESIWGHLAGFGLNPVDTAFIDNTLKELLGRN"
FT   CDS_pept        318141..318581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03150"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41292"
FT                   /db_xref="GOA:C0ZIS4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS4"
FT                   /protein_id="BAH41292.1"
FT                   /translation="MFKISEFSRLSRVSLKTLRFYDQIGILKPADIDKETGYRFYAAEQ
FT                   LVTLNRILMYKDLGFTLQQIQQLLHEEMSIDQLQGIFRQKEREVERLLEEEQARLNRIK
FT                   ERLLSIEQEGYIEQEVVFKQVEAQKVVSFRSEGTVEEIPMLF"
FT   CDS_pept        318619..318945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41293"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS5"
FT                   /protein_id="BAH41293.1"
FT                   /translation="MLSSIVLWKESERDETAFELEIGYVLKQDIALPSDKLEIRMLPEE
FT                   PMMATLVQRVEPFVPSTACIDLAKWIERNQYRIKKDQPGRENYLQSPHGGDTYVEVQIP
FT                   IESP"
FT   CDS_pept        319083..319862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41294"
FT                   /db_xref="GOA:C0ZIS6"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS6"
FT                   /protein_id="BAH41294.1"
FT                   /translation="MNRKARRFIDLSVPLDRLAKEPFPPEIQYNSHEEGAVQAAQYFGL
FT                   QPTDFPEQKAWASETVTLTTHTGTHVDAPWHYWPTSEGEPAKTIDQLPLEWFYGDGVLL
FT                   DFSEKPSGYEITVKDVKQKLAQIEYELKPFDIVLIRTDADKRYYEAHYFQSHAGVSAEA
FT                   THWLIDQEIKVMGTDGWGWDIPFSVQAADYKQNPRDGVLWAAHYVGKEKEYCQIEKLAN
FT                   LEQLPRPYGFTVSVFPVKVKGASAGWARPVAIFEEEE"
FT   CDS_pept        319867..320262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41295"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS7"
FT                   /protein_id="BAH41295.1"
FT                   /translation="MGMNKRAKVLFLLFFLGFCFIMIAYVSLIWHPALPFDSKSKREVT
FT                   ELLGENTGTIVKLTTEENVDWYGYGPQANQATAAEAMKRAVTEKGWTFIQQDGAGYFFE
FT                   RGKEKLIITSQMWTGNYVLFRIPAGVL"
FT   CDS_pept        complement(320265..320564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41296"
FT                   /db_xref="GOA:C0ZIS8"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS8"
FT                   /protein_id="BAH41296.1"
FT                   /translation="MPTPKKPAPQDADSAKTYTLLGADRSFYQSDTPGTLGGYRPRKIY
FT                   GRLDCPSAIRAITRGGYVRHRVFFADEATAIAAGYRPCAACLREKYLLWKALPL"
FT   CDS_pept        complement(320647..321765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfo"
FT                   /locus_tag="BBR47_03200"
FT                   /product="endonuclease IV"
FT                   /EC_number="3.1.21.2"
FT                   /note="protein synonym:endodeoxyribonuclease IV"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41297"
FT                   /db_xref="GOA:C0ZIS9"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIS9"
FT                   /protein_id="BAH41297.1"
FT                   /translation="MLKIGSHVSFSGKGLLNAAQEAATYGSSTFMIYTGAPQNTRRKPI
FT                   EDQYITEGKEVMAKQGVDEIVVHAPYIINLGSYKDDTYELAVRFLQEEIRRTDYIGVKN
FT                   IVLHPGAYTDKDAEYGIARIAEGLNEVLTGIKDTDVKIALETMAGKGTEIGRSFEEIAA
FT                   IIEKVEDNSRLTVCMDTCHIHDAGYDIVNDFDGVLEQFDRTIGLDRLAVVHLNDSKNFR
FT                   GAGKDRHAPIGAGLIGFDAMNYIVNHEKIRHLPLVLETPWISKEKGNERPMYEAEIALL
FT                   RGEVDKRFGNEFMDHVERLDFFFRKQDVTRREYVVGIWELLKNDAKAKKADGREPMERL
FT                   YDMVKEARLFPELTEEQINHRLTAYFAIPKYS"
FT   CDS_pept        complement(321785..322717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="BBR47_03210"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41298"
FT                   /db_xref="GOA:C0ZIT0"
FT                   /db_xref="InterPro:IPR000035"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT0"
FT                   /protein_id="BAH41298.1"
FT                   /translation="MTSGLSHSAWVDNRDEIILSVPTEFSFSQNLHYLSRASNECMFHI
FT                   QNGRLYKAIPIGQDSQVVEIHAKNDQGLTVRFLSPSLPNEKVRTEVARYVRDWFDLDRD
FT                   LVPFYELAAGDALLKQAVEKFYGLRTMGIPDLFEALSWGIIGQQINLTYAYTLKRRLVE
FT                   AFGRRVEFEGETYWLFPTAEKIAGLSVTDLDGLRMTTKKCEYLIDVAQLIVEGKLSKEL
FT                   LWDGGDYQTAEKRLTSIRGIGPWTANYVLMRCLRMPSAFPIDDVGLHNAIKFLLGKEKK
FT                   PTKAEIRELSKTWTNWESYATFYLWRFLY"
FT   CDS_pept        322887..323456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaA"
FT                   /locus_tag="BBR47_03220"
FT                   /product="AdaA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41299"
FT                   /db_xref="GOA:C0ZIT1"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016220"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT1"
FT                   /protein_id="BAH41299.1"
FT                   /translation="MLEERVTDERWQAIIHNDVSYDDQFFYAVKTTKIFCRPSCKSKPP
FT                   KRENVRVFQNASQALREEFRPCKRCKPTGERLPDREWVAQITQYIDSHYNEKLTLEHLA
FT                   DMCHGSPFHLQRTFKRLMDMTPVEYIQKKRIERARELLAHSNNQIADVAQLVGMPNTPY
FT                   FITLFKKMTGKTPSEYRQLNVKQQTT"
FT   CDS_pept        323566..323667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41300"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT2"
FT                   /protein_id="BAH41300.1"
FT                   /translation="MIGILLTQRLMDSPQPPGAFLDFWTTAYQAIED"
FT   CDS_pept        323687..324793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41301"
FT                   /db_xref="GOA:C0ZIT3"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT3"
FT                   /protein_id="BAH41301.1"
FT                   /translation="MNDTKTLREVFKKTTYQIAGHSKRDLHQLQQVLSRVDGNVEGDMY
FT                   GTGELIENFQRKMAEYLGKESAVFFPSGTMAQQIALRIWCDEKGIKKVAYHPLCHLEIH
FT                   EEDGLKELHQIEAVLLADKNSVIELDDVLGMDDDIACLLLELPQREIGGQLPAYENLEA
FT                   ISRYCREKGIRLHLDGARLLEILPYYQKTAEEVCALFDSVYVSFYKGIGGIAGAILAGD
FT                   EDFTKQSKVWKRRHGGDLISLYPYIVTAEYHFEQRKHKFSQYYEHAKELAALYNQCQGI
FT                   STRPTVPVSNMFHVHADLPKEELERIMVSLSEETGIGFTHYVRQDDESSSSYEVSIGDR
FT                   YAMIPKEELALAFEKLHQKIGEQKSNAV"
FT   CDS_pept        324884..325366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41302"
FT                   /db_xref="GOA:C0ZIT4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT4"
FT                   /protein_id="BAH41302.1"
FT                   /translation="MFSIRPYEKSDYPSIMAYDLPQEQAIYTSMPVDVIEATQNNPGYK
FT                   PYVVFDAGHLIGFFALFTPHTGNPYTPNGEAVIFKSFSIDSRYQKKGYALRVFHELANI
FT                   ARVHYPERDEIVLTVHHTNTPAIQLYKKAGLVDQGWRFAGEFGEELIFHLDLTAST"
FT   CDS_pept        325551..326054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="BBR47_03260"
FT                   /product="DinB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41303"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT5"
FT                   /protein_id="BAH41303.1"
FT                   /translation="MTHYAKNMYDFHAWANQTLINRLKELPEGVYEQEVQSVFPTVAKV
FT                   MEHIYMVDHSWLLILQGMDMQAAMDETWRQEKKITGKSLEEVEQLYAELVEQFRAFLSQ
FT                   EEDLERRIVLDNPYTRVRDTSLAEIIMQVVNHGTYHRGNITAMLRQMGYSSVMTEYALY
FT                   WYAN"
FT   CDS_pept        326267..326905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfN"
FT                   /gene_synonym="mhqN"
FT                   /locus_tag="BBR47_03270"
FT                   /product="putative NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41304"
FT                   /db_xref="GOA:C0ZIT6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT6"
FT                   /protein_id="BAH41304.1"
FT                   /translation="MSEFTTLVKNRRSANKFLTDVTITPAEIDEIMSLVKFAPSAFNLQ
FT                   HAHYVVVIDPEAKERVYEAAYRQYKVKTASAVVLVFGDKEAYQSVERINEGLLHLGVMD
FT                   QREYDHNNSSVRAMHEAGGEQFKRDEAIRNANLSAMLFMLAAKDKGWDTCPMIGFDPAA
FT                   VQEIAKVPDSFVPALMITIGKEDTSSQRVRGYRKPVGEFVSYNTFQATK"
FT   CDS_pept        326929..327876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhqO"
FT                   /gene_synonym="ydfO"
FT                   /locus_tag="BBR47_03280"
FT                   /product="putative ring-cleaving dioxygenase MhqO"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41305"
FT                   /db_xref="GOA:C0ZIT7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT7"
FT                   /protein_id="BAH41305.1"
FT                   /translation="MTQQTAGIHHITAFVTSAQNNVDFYAGFLGLRLVKKTINFDAPDV
FT                   YHLYFGNEVGSPGTAITFFPWETGRRGRVGGGQVGYTTFLIPVGAFSFWEDRLKKFGIE
FT                   YSRVERFNETYLQFTDRDGLQLEIVEREGGPASKWSFGGVPADKAIKGFGGAILYSMAP
FT                   AHTMDVLERLMGLTRVGEENGLVRFKAHGDLGNVIDVNAEPIPRGAGGAGTIHHIAWRA
FT                   VDDQDHQLWQQRAAQSGLHPTDIIDRQYFNAIYFREPGEILFEIATDPPGFERDEPFEA
FT                   LGQKLMLPEWYEPRRAQIEQGLTPITVRVLEEDK"
FT   CDS_pept        327876..328493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41306"
FT                   /db_xref="GOA:C0ZIT8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT8"
FT                   /protein_id="BAH41306.1"
FT                   /translation="MNLKHIFRKGTETEAPTLLLLHGTGGDENNLLPLADRIYPGASVL
FT                   SVRGNVLENGMPRFFKRLAEGVFDEEDLVYRTQELHEFLDQAAVTYQIDRDNIVAVGYS
FT                   NGANIAGSLLFHYPNPLKGAILYHPMVPRRGIALPDMSAIPVFIGAGTNDPICTAQETE
FT                   ELNQLLTEAGADVTVHWDSYGHQLTVKEVEASAAWFTEKFRK"
FT   CDS_pept        328784..329464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03300"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41307"
FT                   /db_xref="GOA:C0ZIT9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIT9"
FT                   /protein_id="BAH41307.1"
FT                   /translation="MKLTILIADDDPHVRELLRFYLAKEGYNVLACVDGEEASQLLEQE
FT                   SVQLAIVDVMMPGKNGWELCREIREFYDLPVILLTAKGEVRDKEKGFLAGTDDYLTKPF
FT                   EPTELLYRIKALLRRYQMVSKQIIVLNDTVIDRISHVVKVKEELIHLPLKEFELLAQLA
FT                   SFPDRIFTRDQLLELVWGGDTESDSRTIDVHIKRLREKFTEKTNDFVISTVRGLGYKLE
FT                   VRGS"
FT   CDS_pept        329461..330870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03310"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41308"
FT                   /db_xref="GOA:C0ZIU0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU0"
FT                   /protein_id="BAH41308.1"
FT                   /translation="MKSLYVRVVLTFVAIVLISGTLGFLLANEYYQRNLRAYNEQKIMS
FT                   IGQQMIDLYEHKSSLDLPAFMTHVANLNFQLYLVDENGAASQFGAPFRDQQIEPAIIQK
FT                   VLAGETYRGITEEQHGLFVTGFFENTLTNSIGLPLTAEGKKYALFVRPNIEQQFGEVHI
FT                   MFALLLAAMFVLSLVLILIFTRYLVKPIEKLSHATKKLAEGEYDIHLDISRRDEIGDLA
FT                   MHFARMTESLKQLDEMRQEFVSNVSHEIQSPLTSIQGFSQAIRSGGVTNEQRETYLTII
FT                   EEESRRLSSLSKQLLTLASLDKETGLYEPTRFRLDEQIRQVLLVLEHQWQQKKLTMELT
FT                   LPETFIVGDKQLLNQVWMNLIANSIKFTPKAGSIYIMIQKDTRIVVTIRDTGIGMSEEE
FT                   QEHVFDRFYKGDKSRNREATGSGLGLSIVQKILQVAKGGIHIQSRIGEGTTVTVSLPTG
FT                   EHPTTRTTNES"
FT   CDS_pept        330897..331337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03320"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41309"
FT                   /db_xref="GOA:C0ZIU1"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU1"
FT                   /protein_id="BAH41309.1"
FT                   /translation="MNIGMRILAAVISPLFTGLYAALIIYLYRDPSAPYGFGKEYLLGV
FT                   LISMAMNLIVFVWLSVFVDWLVSRSHLIGWKKYVVRFAGYAVIGYVPVLFQWLKSVDPH
FT                   AALFYPQATVLVFASICYSLIFVGIEAIRKRFTRKSEETRCG"
FT   CDS_pept        complement(331380..331745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03330"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41310"
FT                   /db_xref="GOA:C0ZIU2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU2"
FT                   /protein_id="BAH41310.1"
FT                   /translation="MDDICEIQCFDEEKVNRLKPFATESEGVAKIFKALADDTRAKIIH
FT                   ILSMEDELCVCDVAAIIGSSIANTSHHLRLLRNMGLAKYRKEGKLVFYSLDDDHVRHLI
FT                   SAGIEHAKEQKTIVRAT"
FT   CDS_pept        331897..332193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41311"
FT                   /db_xref="GOA:C0ZIU3"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU3"
FT                   /protein_id="BAH41311.1"
FT                   /translation="MSAQPKCPKCRSAKIDLTESINKPLYITIYAAVLAVLALIGISVK
FT                   GTPVIFLFLGLSGAFILFAVRLALEKRKVIKCKCLDCGERWQTTPTPVEASSK"
FT   CDS_pept        complement(332260..332451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41312"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU4"
FT                   /protein_id="BAH41312.1"
FT                   /translation="MLMLTAALMPTATLIFFSFFCHLFSPFSKHLFCPASNEINPQTFK
FT                   QIFNYYIIASFWFVQELI"
FT   CDS_pept        332548..334617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03360"
FT                   /product="probable heavy metal-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41313"
FT                   /db_xref="GOA:C0ZIU5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU5"
FT                   /protein_id="BAH41313.1"
FT                   /translation="MDCSSCAKSLEKHMHTLPAVKEVNVNFSTGKMQLVADGLGEDAVV
FT                   KEVAKAGYSAMLLTRRTAKAVPKTDQAGTTLTVISGVLLALGFLGSLSSGIPPLVVTVL
FT                   YALSIISGGYRPARSAFYAIKSGSLDMNVLMSVAAVGAALIGEWLEGATVVWLFSIGNL
FT                   LQTKSIEKTRDSIRNLMDLAPPEAWVKVGESLTRKPVEDITVGQVIVVKPGEKIPLDGV
FT                   IVHGTSSVNQAPITGESIPVDKLVGDSVFAGSVNESGAVEIKVTKLVEDTAIARIIHLV
FT                   EEAQEKKAPTQAFVDKFATIYTPIVLVLALLVIVFPPLLGLGTWGEWFYRGLELLVVAC
FT                   PCALVISTPVAIVSAIGNAARNGVLIKGGTFLEKAGAITAIAFDKTGTLTEGKPQVAAV
FT                   IEMEGSEDDVVSIARTIEERSSHPIALAILTYAKQKQIASQSGQDFKAIVGKGASAVIG
FT                   TETFYAGKPALFQELGVDLSAWQTKVESLQSEGHTLVVIGTATKLIGMIAVADTIREIT
FT                   VSAIGKLKAAGIEDIVMLTGDNTGTAKKVASQTGVNRYFAELLPQDKVEAVKRLQQEGK
FT                   VVAMVGDGINDAPALASADLGIAMAGAGTDTAMETADIVLMADNLEKLPHTMKISRKAL
FT                   TIIKQNIWFSIIVKLIALVLIFPGYLTLWLAVLSDTGAALLVILNSMRLLRMKG"
FT   CDS_pept        complement(334676..336679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03370"
FT                   /product="probable ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41314"
FT                   /db_xref="GOA:C0ZIU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU6"
FT                   /protein_id="BAH41314.1"
FT                   /translation="MGKVLEVKDLHVSFDTYAGEVKAVRGVSFDLEKGETLAIVGESGS
FT                   GKSVTSQALMRLIPSPPGRIPKGQVLFEGRDLVTLSEKEMQDVRGRDISMIFQDPMTSL
FT                   NPTMTIGNQIMESFIKHQKLNRADARSRAIELLEMVGIPFAKERVDQYPHQFSGGMRQR
FT                   IVIAIALACNPKIIIADEPTTALDVSIQAQILELLKELQKKMGTSIIFITHDLGVVANM
FT                   ADRVAVMYAGKIVEIGKVDEIFYDPKHPYTWGLLGSMPSLDSSDDELMSIPGSPPDMFK
FT                   PPVGDAFAARNPFALKVDLEYEPPMFKISDTHYAATWLLHEMAPDIKPPASAVRRKVNS
FT                   DEATEAPVSTKKTFNYENREKLVEVKDLKQHFDLGNGHTLKAVDGITFDIYKGEIFGLV
FT                   GESGCGKSTTGRTILRLYDATGGEVLFNGQSVHGKKTLEEKKWLNRKIQMIFQDPYSSL
FT                   NPRLTVSDIIAEGLDIHRLANKEARIAKVHELLETVGLNREHANRYPHEFSGGQRQRIG
FT                   IARALAVDPEFIIADEPISALDVSIQAQVINLLKRLQKEKGLTYLFIAHDLSMVKYISD
FT                   RIGVMYRGRIVELAESNRLYENPIHPYTKSLLSAIPLPDPDYERNRKRIVFDDQEYLRD
FT                   QGEERVLREVERGHFVACTQKEFERYGGGVLV"
FT   CDS_pept        336805..337623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41315"
FT                   /db_xref="GOA:C0ZIU7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU7"
FT                   /protein_id="BAH41315.1"
FT                   /translation="MKIIITIILYSLTVVKKFFSALHTHAESVFLALPNDSPVILCIKA
FT                   AEYWLIGRVTLVNKLNGPKEIALTFDDGPDQLWTPRVLDIFAHYQVKATFFCVGQMVKY
FT                   NPTILERIVKEGHIVGNHSWDHPDFTKIPLLAVHEQVERTSDQIEKVVGVRPRMVRPPY
FT                   GAVNEEVIQLLVASDYEMILWDIDSWDWKGLTGPQVARNILGHVTPGAVVLQHSAGGTK
FT                   DTLKGSMDALPYIIEVLSEQKYTFSTVSAMFQLAAYRERTCPVEKRRRGR"
FT   CDS_pept        337693..338658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41316"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU8"
FT                   /protein_id="BAH41316.1"
FT                   /translation="MSKADNMLSILWLLKTGKRMTAKQLAEILEINIRTVYRYIDSLCA
FT                   SGVPIISDAGHNGGYSLLQQFNEAPLFFDLNEQKALIHAAAFAQEAGYPFGADLHRAIS
FT                   KLKRYTNEEQRDAIDRHSIGFEVIQPPVDPSLESTLQELELSVANGYTLSIEYQKAYQT
FT                   TRQMRHIDPYGLVYWKGNWYIVAYCHLRSTIRSFRADRVHEIQRTEGSFQRPPEFSARH
FT                   FFLSNLLPEADKQGNTILIKIKGRPQSLADLCRHWYLGHTVMERSEAQVIFQVDEQMAH
FT                   SILPHYLLPYGKSIQVEEPAYVKERLAAIAADLFLFYQST"
FT   CDS_pept        338743..339258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41317"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIU9"
FT                   /protein_id="BAH41317.1"
FT                   /translation="MKHEALRLYEYHVWANEKVFKRLQEVPEGVSEQEVPSVFPTITQT
FT                   LAHILKTDYVWLLAMKGDSYEEVGPKVGVLLQELKGKNVHELRKLFAESAQQFRDFFGQ
FT                   ISMEDTAPYTHPALGTVHARYADIVQHVANHGTYHRGNISAMLRQMGHAGASSDYIFYL
FT                   FETSAVEQ"
FT   CDS_pept        complement(339542..340555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41318"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV0"
FT                   /protein_id="BAH41318.1"
FT                   /translation="MKRYVLPFFSSLIAITFVTGCTSASEQLTVKDPTPSAPENTGTSP
FT                   ADATKGEKPADDLLKQFTVLAAQAKEANELTAFLDQHLAKTDTKTADQLFFALDQYYEK
FT                   HLPTINDNFKALLAQPGNAEKLYALQYPYDFNKLEGDDSFKQWLLNQTEGGLVLKATND
FT                   MSFYWQVDYKVLQKYAASLGEEGKDYLSIQETETGKPYLGDGKLQITRAELGPRMVEVE
FT                   EYLVNYRSSPRAVKLRTLYIDYLKTYLSDYRYDAIDEATMKLLPAVTEEYQNFAKKYEA
FT                   TKTGQIVKDYLSEVAKNKDVVFEPGKPGESIIGERKPNLSQFLNGLEVRIAHTMNP"
FT   CDS_pept        340812..342461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03420"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41319"
FT                   /db_xref="GOA:C0ZIV1"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV1"
FT                   /protein_id="BAH41319.1"
FT                   /translation="MNETQALVQQFTEKTMAEAIFKLRDITWLKAKGYDRLRQQFTHSH
FT                   ILLVVTGGRGRLRLENEEYQLRQDAIYVCPPMLTFGIVPDSADHLEMYMLRFDVFMETK
FT                   DRHRRFQALREKDLFPFRGEISVQSAGQLPVYCDLIQNLWKQETALERFRGQHTFQELW
FT                   YHIVKHAHFSATDAGMALEQARAHMEEHYSENVTIEQLARIAEVSPKYFVDLFKKTYGI
FT                   SAMDYLAELRISRAKQMMVQSHAKLRDIAHQVGYNDEFYFSRKFKKAVGVSPTLYMKSR
FT                   QRKIAAYGSTIIGHLLALKMIPYAAPLHPKWTAYYHHSYRNDIPVHLSAFRINQNWKAN
FT                   IETLRDAMPDVIIGLDETSLEEQEQLNEIAPTLYVPFEERGWKEQLQLMADFLGESVEA
FT                   NHWLCEYEKKVKRARTKLQQVLGDETVLIVRVLKNQIFVHCNRSMNEVFFQDLQVKPAF
FT                   VSKQKEYDQLVTAQELAALAPDRLLLLVCQEAETLACFQALKASGPWQEIEAVRNNRAH
FT                   VITSDPWREYSATAHERIVEESVKLFSGDRPC"
FT   CDS_pept        342574..343578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuA"
FT                   /locus_tag="BBR47_03430"
FT                   /product="probable iron-uptake ABC transporter substrate
FT                   binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41320"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV2"
FT                   /protein_id="BAH41320.1"
FT                   /translation="MKKIYLGLSIAALTLALTACGGGKEAANNTTAPTTAPATTATAEK
FT                   PADEDNKAETRTIKYLDKEYTVPSKTERIAIVGSMESMEDSLVLNVKPVGAISVGGKFP
FT                   EMFAPITGEATSIGEKIQPNLETILSLKPDVILGSSKFPPEMAEKLNKIAPTFPVSHIS
FT                   TNWEANLQLLGELTGKQAEAEKALNEYKSGIEAAKAKLGDGMKDKKALVIRLRQGNINI
FT                   YPEKVFFNPALYADLGLTAPEEVKAAKAQEIISMEKFTQINPDYLFIQFSPDENKDKPN
FT                   ALEDLQNNPIWKSVNAVKNGNVYVNVVDPLAQGGTAWSKAQFLNAAVEKLSAK"
FT   CDS_pept        343598..344605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuB"
FT                   /locus_tag="BBR47_03440"
FT                   /product="probable iron-uptake ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41321"
FT                   /db_xref="GOA:C0ZIV3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV3"
FT                   /protein_id="BAH41321.1"
FT                   /translation="MQSKKATSMIILAVSPVVILLTILLSIHYGAKPIDAGTIYQAFFA
FT                   FDEGNVDHQIVMHSRLPRVLGALMIGAFLAISGALMQGMTRNYLASPSIMGVSDGSVFA
FT                   VTLCMVFIPSATSVTMITMSLIGSALAVAMVLAFSRLLPNGLTPVGMAVIGTITGTFLS
FT                   SISAAISTYFQVSQNVSFWYNARLHLLEPELVKLAVPFAIVGIVIALLLSKSITILSLG
FT                   DEVSRGLGQRTVMVKVLATTAVVILTGISVALAGKIAFVGLIIPHITRFLVGLDYRWII
FT                   PCAGLLGGIFLALSDVLSRFMNSPFETPIGVVTAFIGVPFFLYLIYKRGGGKHA"
FT   CDS_pept        344598..345617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuC"
FT                   /locus_tag="BBR47_03450"
FT                   /product="probable iron-uptake ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41322"
FT                   /db_xref="GOA:C0ZIV4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV4"
FT                   /protein_id="BAH41322.1"
FT                   /translation="MPDRKARFRLLLLVNIALILLAIYISLTNGVFDMTVMDVIRTLLR
FT                   MDPVAEFDLVIFDFRLPRIVIAASVGFGLGVAGTVIQGITRNGLADPGILGINAGAGAA
FT                   IVAFMFFFGGQFMEASWYSIMAMPLFGLTGGLLAAGLIYLFAWRNGALDPQRLILVGIA
FT                   IGSGLGAVSLYLSLKMNPNDFEMATVWLSGSIWSANWTHIAGMLPWLVILIPVLMRKVH
FT                   ILDLLQLSEESVKNLGVSVEKERNILLLSSIGIVSACVSVSGGIGFVGLMAPHIAKRLT
FT                   GIQHRYALPLSGTIGMLMVVAADFIAKTVFTPIELPVGIVISIIGVPYFFYLLSRRKK"
FT   CDS_pept        345636..346967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41323"
FT                   /db_xref="GOA:C0ZIV5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV5"
FT                   /protein_id="BAH41323.1"
FT                   /translation="MKGQLLADVCHHRALLVYLPPSYDKSTSRFPVMYVHDGGDLFDPA
FT                   FSTALDAIEDKFAEGKIPELILVGIQPGNRRDDYTPWFSKAISLERNIDFGGQGDAYLS
FT                   YVANECKAYIDSKYRTDPRPEKTGIIGFSLGGLISMYAAHQYPDVFTKIGSISGSYWYE
FT                   GMVSFMREKKMYHPGLRIYMDVGSKEGAKKQNIQKQMVPLTKEAHQILADSGFTADQLV
FT                   LFMDEGADHLSKYANARFPGALQWLWNEKEETEMELTKLIRERRSIHRFTDREVDPALV
FT                   TELMDTAVWAPNYHMTQPWRFIVTYGEGKKRIAEAVRIMKEKREIDPSKKKEVGDKFYN
FT                   KIMAIPMLMTVIMEESPNLITRQDDFASTSIVIHNFSLLAWEKGIGLTWETYPWIHEPE
FT                   FREAMGIRPGEKVLGNLHIGYPAAIPNAQPRIPAAERITLVDKA"
FT   CDS_pept        347245..348471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03470"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41324"
FT                   /db_xref="GOA:C0ZIV6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV6"
FT                   /protein_id="BAH41324.1"
FT                   /translation="MSNVLKNRYVRAILLSAVLLQIGVWVRNMAILLYVMDHTGGDPFA
FT                   VSMISVAEYAPIFLFSFLAGTFADRWQPRKTMVWCEVLSALSVVGVLLTFVFGSWKAIF
FT                   FATLISAILSQFSQPSGMKLFKLHVPGEQLQVGMSAYQTIFAIFMVFGPIVGTFVFQQW
FT                   GMEVAMVITAVAFLAAAGVLYLLPPDRVEKGEQQETALLGEMVSGIRYVFSSRVLSMLG
FT                   FCFLAVGFSLGMIQPLGIFIVTEQLQLPKESLQWLITAQGVGMIAGGAMTMAAAKTIPP
FT                   QKLLVMGLLGNAVAVAICGMSTNLWLTLVAQFIAGLLLPSIQIGINTMLLKNTESTFIG
FT                   RVNGILTPLFTGSMVVMMSITGVLKLYLPLAVIYGIAAFLMIIGLSFILPLYRMREGNV
FT                   VQSTEQTGT"
FT   CDS_pept        348503..348886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41325"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV7"
FT                   /protein_id="BAH41325.1"
FT                   /translation="MVHEQISSIESLKMVAAVRELAMRLPEVTEQVDAFGHTSFRVNDK
FT                   PFVILGEGGTEGPSFSVKVLKTTQEILLAQEHFYKTPYIGHHGWVSILDKNVTSYDEIE
FT                   DYIREGYMCAAPKRLVKQLQHLP"
FT   CDS_pept        348961..350310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03490"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41326"
FT                   /db_xref="GOA:C0ZIV8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV8"
FT                   /protein_id="BAH41326.1"
FT                   /translation="MSKLLEVVFENAHEPMIVTDKDGKILLLNRSYREFLNVQDVIGQP
FT                   VTDVIENTRMHIVGQAGVAEIADIQQIKGQNMIAHRIPIMDEGKVIAVLGTVLFQDVQE
FT                   LTALAAMVAQLKDELTYYKKELRRRMGATYHFDQIVGYSQKLQELKKFSQKVAKSDSTV
FT                   LITGESGTGKELFAHAIHAESKRKMGPFIRVNCAAIPDSLLESELFGYEEGAFTGAVRR
FT                   GKKGKFELANHGTILLDEIGDMPLPLQAKLLRVLQEKEVERVGAVRTTPIDVRVIASTN
FT                   SDMLQSIKEGKFRADLYYRLNVVSLSIPPLRERLEDLPELVSNLLKQLGESTGVAVRAI
FT                   DEEVWHVLRGYSWPGNVRELKNVLERALHLMEDDILKKEHIWLPVSDEGTPSSLSVSTH
FT                   AVRPLKQILEEAEQEALRQAMQQAGGNKLNAAKLLQISKSSFYEKWEKYQ"
FT   CDS_pept        350716..352098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03500"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41327"
FT                   /db_xref="GOA:C0ZIV9"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIV9"
FT                   /protein_id="BAH41327.1"
FT                   /translation="MIIEVLSILVSLGLLMFFAYRGYPVIVFAPIFTLLAVVLSGISLL
FT                   PSYTETFMTNAANYVKSFFPIFLLGAIFGKVMELSGAASSIAHTIVRALGSNRAILAVV
FT                   LACSILTYGGVSLFVVAFAVYPFAAAIFREANIPKRLIPGTIALGAFTYTMDALPGTPQ
FT                   IQNIIPTTYFGTDAYAAPVVGTIGAIMVFIGGMLWLERRRKQAVAAGEGYGEGHTNEPE
FT                   LIKNESYMNIWVAILPLALVLVGNYMFSRGIWTVETWYDPAILKESFKIEKVKNVVSSW
FT                   SLIISLCLGIIAAILINVKQVKNKLASGLTAAAMGSLLAIFNTASEVGFGNVVKTLPGF
FT                   KFIQGWIMGASDHPLVSEALAVNVLAGVTGSASGGMSIALEVMSKQYLEMANAAGISPE
FT                   LLHRIASMSSGGMDTLPHNGAVITLLAITGLTHRQSYKDIFAITVLKTAVVFILAFAVS
FT                   IF"
FT   CDS_pept        352165..352950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxjF"
FT                   /locus_tag="BBR47_03510"
FT                   /product="putative 3-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41328"
FT                   /db_xref="GOA:C0ZIW0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW0"
FT                   /protein_id="BAH41328.1"
FT                   /translation="MEKLLEQQVAVVTGAASGIGLEIARTFAEEGARVVILDLNGEAAE
FT                   AAAAQLQKEGHEAISFGCNVTDEVQMQACIQQTVQIFGRLDILVNNAGLQFVSPIEEFP
FT                   TAKFEQMLSIMLTAPFVAIKHVFPIMKQQGHGRIINMASINGLIGFAGKAAYNSAKHGV
FT                   IGLTKVAALEGAAAGITVNAICPGYVDTPLVQNQLADLAKTRNVPLEKVMEEVIYPLVP
FT                   QKRLLQVKEVANYAAFLASKKASGVTGQAVVIDGGYTAQ"
FT   rRNA            353276..354786
FT                   /locus_tag="BBR47_r0160"
FT                   /product="16S rRNA"
FT   rRNA            354853..354969
FT                   /locus_tag="BBR47_r0170"
FT                   /product="5S rRNA"
FT   rRNA            355086..358000
FT                   /locus_tag="BBR47_r0180"
FT                   /product="23S rRNA"
FT   CDS_pept        complement(358014..358121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41329"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW1"
FT                   /protein_id="BAH41329.1"
FT                   /translation="MYVLAEIQKKLHSPLLLTSNREYSFSPHSFKTEYA"
FT   CDS_pept        358262..358936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03530"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41330"
FT                   /db_xref="GOA:C0ZIW2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW2"
FT                   /protein_id="BAH41330.1"
FT                   /translation="MLILAVEDEKALLQTIAGVLADEGYQVDMADRGDDGLLLAERGIY
FT                   DLLVLDIMMPGMDGLSLVRTLRTKGIMTPVLFLTAKDSVESRVEGLDAGADDYLVKPFA
FT                   AEELTARVRALLRRQGKQNTEGELAYGPLSLKINEYDGFVDDEPMKLTTKEYELLKYFL
FT                   QNREQILTRQQIFDRVWGIDSEANYGVVDLYVHYLRKKLGAYEGFIRTIRNVGYILKKE
FT                   NK"
FT   CDS_pept        358933..360228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03540"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41331"
FT                   /db_xref="GOA:C0ZIW3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW3"
FT                   /protein_id="BAH41331.1"
FT                   /translation="MMFRKTRIRLVTLNVVVVLLLLNGLGSAVYYTMKYRLYSQVDREM
FT                   TKVSQRLAVDALPRLHRIEDDPFPYNRQERKKFNDLDRRYVLLVWDSFGRVIGTAFSDR
FT                   LEPEEYAKFQHNGKADGIETKTVNGQIYRMQTVTVPKKVVVGNRIQTAYQFQLIYNLAP
FT                   EQNVLDSLLYVVMIGDIISIVIAIVAGWFLARRALIPIQVSWEKQQQFIADASHELRTP
FT                   LTAIMVNLERLFKHPDHTIEQESEKIMIGMQEAKRLSRLVSDLLTLARSDSNELQIMNQ
FT                   TLRLDEVAIKCTQVFAQLAIAREIRLETDIQQPIEMVGDQERLHQLMVILLDNALKYTN
FT                   EDGRIYVSCKKEGGRVSILVKDSGIGISKEDIPYLFDRFFRVDKMRSRATEGTGLGLSI
FT                   AKWIVDAHHGKIQVSSEVGIGTSFLVTLPIKP"
FT   CDS_pept        360369..360656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41332"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR008326"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW4"
FT                   /protein_id="BAH41332.1"
FT                   /translation="MNMTITKAAVAWFREEWGCKEGDSIRFFVRYGGVSTVQDSFSMGI
FT                   AKELPNEIGISAVEDGITFYMEKDELWYMNGKGLVVDYRPETDEVEFKLD"
FT   CDS_pept        360800..361711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41333"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW5"
FT                   /protein_id="BAH41333.1"
FT                   /translation="MRLLDSYLELGITGMARAAVAGWFDGHYGAALLAGYFMDREHDLP
FT                   EHVKEGIERTCESFRKQKPEWFVPLDQDEKADPSLLQHVIDGLQQNVKQLRTSGHGLAL
FT                   GVLALKALRERPDMITPTVVDGLVRILQATTEDRKDRYWGIENYHGMTIDDVKDDDVAP
FT                   YHTTAEMAERAFDELHLVIPPRDINGVRYHLASEVVHNITQAHALTDLERFGYEDIVKP
FT                   GIVNHRLQIYLNRHVPPFTLEDEVKEPAFEEIFSPLYWERLYSDPHALKLPYAALDLLK
FT                   RFPSEKRALAERNLCKLLTITD"
FT   CDS_pept        complement(361787..362935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03570"
FT                   /product="probable O-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41334"
FT                   /db_xref="GOA:C0ZIW6"
FT                   /db_xref="InterPro:IPR010197"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW6"
FT                   /protein_id="BAH41334.1"
FT                   /translation="MKIERVDLQRIKIPLNSPFETSMGVETHKECILVRAYSGAHVGFG
FT                   ESVAMDVPVYNEEDVDTVWYMLEKYLIPQLFSREIEHPDDVSRLFSWMRRNHMAKAALE
FT                   GAVWDLYAKMNGLSLSQALGGTRTTIDVGVSIGIEPTIEKLLQRVEGFIRDGYKKIKVK
FT                   IKPGFDVEPMRAIRNTFGPDVPLMADANSAYTLADMEMLKALDGFGLIMIEQPLAHDDI
FT                   IDHATLQRELKTPICLDESIHTVEDARKALELGSCRIINIKIGRVGGLTDAKKIHDLCE
FT                   KRGVPVWCGGMLEAGIGRAHNIAMASLSNFTIAGDTSPSHRYFAEDIVTPVIDFAAPGM
FT                   LAVPTTPGIGFDINESAIRNALIEHKSYYANRESTTTVIPTW"
FT   CDS_pept        complement(362956..364095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BBR47_03580"
FT                   /product="probable amidohydrolase amhX"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41335"
FT                   /db_xref="GOA:C0ZIW7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW7"
FT                   /protein_id="BAH41335.1"
FT                   /translation="MRTTIKQLQPAIFSLYEHLHQHPEISWEEVQTTSFIADFLKKHHC
FT                   HVTTFDDVTGVVGEWGDLTPGKLTVGVRADMDALWQEVNGVFTANHSCGHDAHMTMALG
FT                   VLMVLQAMDVQLPGRLKLIFQPAEESGNGALAMVNKQVVDDIDFLYGVHLRPIQEIPRG
FT                   TAASAIMHGAAGTVFGHIKGADAHGARPHLGVNAIEVAAAIVEQLKGIHLDPLVPYSVK
FT                   MTQLSAGSKSSNIIPGSAQFHLDLRAQTNEVIHALFARVEHILQHVSRLYEVELSYEIT
FT                   ERVYAAEVNEEARLIMADAITQTFGAEKLEPPIQTPGAEDFHYYTKERPQLRATMLGLG
FT                   CGLTPGLHHPQMTFEKEALLDGIEILARTVLNTFERQSK"
FT   CDS_pept        complement(364165..365574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03590"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41336"
FT                   /db_xref="GOA:C0ZIW8"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW8"
FT                   /protein_id="BAH41336.1"
FT                   /translation="MSTHPLKPAKKRFSVPHTYAILFIIIILAALASYVLPAGEFDRVK
FT                   DAASGKTIVVNGSYHPVESDPVSFFDMFKAIPEGMQKGAQIIFYIFIVSGVFGIIRQTG
FT                   AIEAGINKGVRHLEGREKLLIPASMFLFSIGGFTMGMAEESIIFVPIGIALARAMGFDA
FT                   VTGTAMITMGAAAGFMGGMINPFTVGVAQSLAQLPLFSGLTFRAVVYVFVLAFAIWYVM
FT                   RYAYRVKADPTKSVLYGVENHASQEQATVDIPDLNARHKLVFLVMVCGLAFNVYGVFKY
FT                   EWFLTELTASFLIMGLVAGLVGGLSVNTLFDSFVAGARAVTFGALIVGFARAITVVLED
FT                   GKIIDTMINSLTSAIGHLPDAVTVLAMFVIQAFLNLFISSGSGQAATTMPIMVPIADLL
FT                   GIQRQIAVLAFQYGDAVTNSIIPTSSALMGYLAVAGIPYEKWVKFIWKLLAGWAVIASI
FT                   ALIVAVTIGVS"
FT   CDS_pept        complement(365754..367967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03600"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41337"
FT                   /db_xref="GOA:C0ZIW9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIW9"
FT                   /protein_id="BAH41337.1"
FT                   /translation="MLIPPARVIAFSIFYLLLKHISLPPNQSLSFLSIQANPSDYSQAL
FT                   CYHEITKHSRLFKQRRCSMDHTIVLIAKGTDTLEFLLKELRAYFEPYCKVVGYASHEHI
FT                   PDLSGVDHVFITTKSPELYTVARQAVADSVPITVLNRFFELHKMKALMQIPPGTTVPVM
FT                   NNSPVSAQEVIQNLLEANVDHLNYVPFHPGCTFDDLEFQYAIIMSVPDVPLPPHVEVID
FT                   LGFRKISIHDLIDTGRKVGVPSEWEREYLSAFIVEMSELAKMLGTSYAEVQKLNSQLQS
FT                   TFQAVKDPVIACNEQGLITFINDVAVELFCPHASTIVGQPYTVLKEHSLLQPFFEQDDQ
FT                   EDALVAIDHKQFIVSSQSIRRRHEHLGFVCTLKDVTEIQRLRTTLTLRGHTATYSFSDI
FT                   KGQSQPLLQSIELGKKMAKNNQTILLTGENGTGKELFAHAIHQHSLRKNGPFVAINCAS
FT                   LPENLLESELFGYEDGAFTGARKGGKPGLFEQADGGTIFLDEVGDISGAIQVKLLRVLQ
FT                   EKQVIRVGGTGILSVDCRIIAATNRDLEDAVSQGSFREDLFYRLAVLPIQIPALRERIS
FT                   DIPLLIDEHLEQQGIRKTWSPEVMELFYRHDWRGNIRELKNVVDYAITVSEHPVIGIQD
FT                   LPKRLTDSLFKKQQTASIPNLDDNRDLDILYCLHHYYVSNKPVGRYQLAHSPELQSVGW
FT                   TESALRHKLKLLEQQGLVRSGTTRQGTSITPAGIELLRKHGRI"
FT   CDS_pept        367966..368637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03610"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41338"
FT                   /db_xref="GOA:C0ZIX0"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIX0"
FT                   /protein_id="BAH41338.1"
FT                   /translation="MEDRLVPEVLQMIGEVVPDGVSIAISDGSQYLYYQPSSNIDLKIT
FT                   PGDLVPIGSATHQALLEMGKVGHQVESRIFGVPYYGLSLPLVRNGQVVGCITAIYPPQS
FT                   VPLTNPEARLSFLVGKGEAGWLPIPLTEIVYISSHDGKTLLHTASGSYANKYNMAELEY
FT                   MLPQERFVRCHRSYFVNMESIGFIHPHFHSTFLLEMKDKQKTRVPVSQSYASSFRQLLG
FT                   F"
FT   CDS_pept        368780..370291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03620"
FT                   /product="putative acetyl-CoA hydrolase/transferase"
FT                   /EC_number="2.8.3.8"
FT                   /EC_number="3.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41339"
FT                   /db_xref="GOA:C0ZIX1"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIX1"
FT                   /protein_id="BAH41339.1"
FT                   /translation="MWERLRDKRLADKIVTAEVAAGWIEDGMTIGLSGFTRAGDAKVVP
FT                   LALAELAKKENKPFGVNVYTGASLGSDVDAVMAEAGIINKRLPFQADPVMRKKINDGSM
FT                   MFVDQHLSHTAEAIRQGAIDAVDYAIVEAVAITEEGMIIPATSVGNSNIFVENAKHVII
FT                   ELNMAQSVELEGIHDIYTPAKQGEREPIPLTSVDQRIGTAGIPVDPDKVKGIVLTNQLD
FT                   SPSTIVEPDEETAQIAAHLIEFLRQEVKEGRLPNNLAPLQSGIGSVANAVFNGFLDSEF
FT                   TDLTVFSEVLQDAVFDLLDAGKISFASGCSITLTAEKMKHVTENFAQYRDKLLLRPQEI
FT                   TNHPELIRRLGLIAINTAIEADIYGNVNSTNVSGTRMMNGIGGSGDFARNARLGIFVTK
FT                   SIAKGGNISSIVPFASHVDHTEHDVDIIVTEQGLADLRGLAPRQRAIKIIENCAHPMYR
FT                   DQLMAYYEEALTRGGHTPHVLEKAFSWHVRYAQEGTMLEKKPALV"
FT   CDS_pept        complement(370375..371541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03630"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41340"
FT                   /db_xref="GOA:C0ZIX2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIX2"
FT                   /protein_id="BAH41340.1"
FT                   /translation="MPKKFLILLLALGEFMIGTAESIVTGIIGMIADDTHVSLSLAGQL
FT                   VTAFSLAFAFGAPVLIALTAGVERKKLILWTLFSFIVANLLASISQSFSLLMVSRILLG
FT                   LCGGIYTVVALAQAANMASPEKKGSSIAIILMGFSLSLVLGVPLGTMLGDIWGWRPVFA
FT                   LIAVLTLIPFFAILAFLPKQQGEETVPLRKQLAALRNKRVIHALCISLFFVTGYSTVYT
FT                   YITPLLQSTSAMTTAWVSTTLFLAGLASVAGSRIGGVSTDKWGIRTTLYVSLLLHAAIL
FT                   LILPLSSQLFTWAIITVMFWVAAVQTTVPAQQYYLITLSPHSSQVALSMNTSVFQLGLA
FT                   LGAGLGGVIVDHVGIVHISWVGGLLVLVGFGFAWVSFAQEKRQKSLQA"
FT   CDS_pept        371699..372139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03640"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41341"
FT                   /db_xref="GOA:C0ZIX3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIX3"
FT                   /protein_id="BAH41341.1"
FT                   /translation="MDQIDYKIMSLLHENSRIPFAELGRIIGMTQPAVKERVRRLEEQG
FT                   IITGYHASISQEKLGKHTTAFVMFRTKQCAAFIDFCKQSPEVTDMYRISGEYNYMLKVV
FT                   TRSTEELVAFSERTGDFGFSYTLIVLTAPFEQKMMLEEEKIF"
FT   CDS_pept        complement(372216..373247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbdB"
FT                   /locus_tag="BBR47_03650"
FT                   /product="cytochrome bd-I oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41342"
FT                   /db_xref="GOA:C0ZIX4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIX4"
FT                   /protein_id="BAH41342.1"
FT                   /translation="MTDTIIAITLLWIFVVIYSVAASFDFGAGFWSMIYLNREKTKATQ
FT                   IANRYLSPSWEVVNVFIVLIVVALVTFFPGATYTLASLLLVPGCLVVLLMLIRSTFMVF
FT                   SHLIHRYDKMLSIVSGVTGILVPALLISVLPVTQGGLSRTINGVESLDWGLFLTSPHVY
FT                   SFIGLAVSSTLYLSSLLLADYSFVAGEKQAFSVYRRDAVFLGPITLLAALVTVMTMQME
FT                   AKWLYERILDYLPWLIASAVCFFISYIALLVPQDRRYFGIHLPRIAVIVATTQYLLASY
FT                   AYGAARLPYIVYPNVTIESSFTHPDTFHALFICYLVGFAILVPGFIYFWRLFMRDEQYV
FT                   RQK"
FT   CDS_pept        complement(373244..374578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbdA"
FT                   /locus_tag="BBR47_03660"
FT                   /product="cytochrome d oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41343"
FT                   /db_xref="GOA:C0ZIX5"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIX5"
FT                   /protein_id="BAH41343.1"
FT                   /translation="MTRAIFGTTMAFHIIFATMGVGLPLMILLVELLFWRTRDRDYEIM
FT                   AKRWTKAQAILLGVAIPSGTIAGVQLSLLWPGFMAIVGKVISLPFQIEIFAFFVEALFM
FT                   SIYVYAAHRLSRNMRLLSLFMVLLGATASAILITNVHAFEGTPTGFRMVDGQIVDVDPW
FT                   KAFFNPSFFVTAGHVTVSAYMTGAFIVAGVAAWKMLRAEKGSRVYLYHQKALLAGLIVG
FT                   GTFSLLTALNGHESAQLLHEYQPEKLAAAEGLFETQAYAPLAIGGFTDPETKKVKYAIE
FT                   IPWALSFLAANRFDEVVVGLDDFPKELWPPLYIHTLFNGMVIIGSLLIFVGFIGFAWKK
FT                   LLKRSQYPRWVLWVFVVSGPLALLGIEFGWIFACTGRQPWVVYRVMKTVDAATQAAGIS
FT                   TLFWIFLSVYVFFAIITLLVFRSYFGRHPLELDPPEQPKVDGGTA"
FT   CDS_pept        complement(374742..375515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41344"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIX6"
FT                   /protein_id="BAH41344.1"
FT                   /translation="MEIRVYTKNEQAKGHFGDGEIVENKPIGFPHEGSVVKRVGPLFYW
FT                   AWAKSLKTFEIPLHPHSGFEILSYVLTGTVGHRDTLGNLQEVSTGGAQIMQTGSGAYHA
FT                   EDLGKDTEMFQIWFEPHLAQTTKQPPTYHQYDHEEFPSEDVDGVQVKHIIGSSAPIQLV
FT                   TDSFMSDITIPAGKSYAKELPAGYAHAVVIVEGNGSVAEKATVSENHTPATKGDFVVLS
FT                   TEESNTAIYTASTDAPLRLVLIQVPTEVDYPLYRK"
FT   CDS_pept        complement(375570..375956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfP"
FT                   /gene_synonym="mhqP"
FT                   /locus_tag="BBR47_03680"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41345"
FT                   /db_xref="GOA:C0ZIX7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIX7"
FT                   /protein_id="BAH41345.1"
FT                   /translation="MLDTGLLLIRLVIGLTFAGHGTQKLFGWFGGYGLKGTGGWLESIG
FT                   VKPGVAMAFVAGLSELVGGLMFAAGVGIWPSAILLAFTMLVAILKVHGQNGYWVTQNGF
FT                   EYNLTIIAVVIGVALIGPGAYILF"
FT   CDS_pept        complement(376032..376658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azoR"
FT                   /locus_tag="BBR47_03690"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41346"
FT                   /db_xref="GOA:C0ZIX8"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIX8"
FT                   /protein_id="BAH41346.1"
FT                   /translation="MSKVLFIKANDRPVEQATSVKLYEAFTKAYKETHPNDEIVELDLF
FT                   AENLPYYGNDMLTAMWKAGNGIELSADEQKRADLVNKYLNQFTAADKVVFAFPMWNFTV
FT                   PAVLHSYMDYLSQAGKTFKYTAEGPVGLMGDKKVALLSARGGVYSEGPMAQMEMANKYV
FT                   RTILGFWGVNNVTEVIVEGHNQFQDKAAELVAAGVEKAVKLAESF"
FT   CDS_pept        complement(376799..377245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhqR"
FT                   /gene_synonym="ykvE"
FT                   /locus_tag="BBR47_03700"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41347"
FT                   /db_xref="GOA:C0ZIX9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIX9"
FT                   /protein_id="BAH41347.1"
FT                   /translation="MSDKPLRNDPLDLFVVLSRSYNWVTAHSNRHIREHGLNPTEFGVL
FT                   EVLFHKGPQPLQQIGEKILISSGNITYVVDKLEKKQLLIRKPCSADRRVIFAELTEKGH
FT                   QFLSEIFPPHQLAIEKAMEGLTPEEQRQAIELLKKLGRTAQATY"
FT   CDS_pept        377449..378537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41348"
FT                   /db_xref="GOA:C0ZIY0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIY0"
FT                   /protein_id="BAH41348.1"
FT                   /translation="MQILHHIRQNPFITQQELADLIGISRSAVAGYIAQLTKRGEIKGR
FT                   AYVLRDEGMIACIGGANLDRKARGKQQVRLHSSNPVTIMESCGGVARNIAENLGRLGCN
FT                   TSLITSVGEDKEGEWLLQETKKHGVHISQVWRLPTQRTGTYTALLDIDGEMVVSLANMD
FT                   IYDALTPEMFAEKWSHIAAAHVVFIDTNIPADCLAYIIERCREENILLFVDPVSSIKAK
FT                   KLPQQLDGVEAILPNREEAELMAGMKITTIEECAEACRKIREQGVKHVIVTLGEEGIYY
FT                   QSEDVEEHMLPYPTEVVDVTGAGDAFASGLLYGIVNGESFQRACRLGLAASALTLQTEQ
FT                   SVSPLLKAEQLELAVEQFEKER"
FT   CDS_pept        378541..379467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41349"
FT                   /db_xref="GOA:C0ZIY1"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZIY1"
FT                   /protein_id="BAH41349.1"
FT                   /translation="MKQYLTFTEEVRHALENNLPVVALETTIISHGMPYPQNIEMAKEV
FT                   EQIIRDNGAVPATIGIMDGKIKIGLTDSELEEFATNKNVAKVSRRDFAYILASGKIGAT
FT                   TVAATMIAAEMAGIHMFATGGIGGVHREGEITWDVSADLTELAQTDVAVVCAGAKSILD
FT                   IGRTLEYLETQGVPVVGYRTDEFPSFFARKSGFGVDMRIDTPEEVGKMMNTKWDLGLKG
FT                   GMIIANPVPESDALNHEEIEAVIQKALAEAKENNIAGKQVTPFMLDKVKKLTEGKSLAT
FT                   NIALVKHNAEVAAKIAVAYQKEANQGK"
FT   CDS_pept        complement(379544..380452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03730"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41350"
FT                   /db_xref="GOA:C0ZIY2"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIY2"
FT                   /protein_id="BAH41350.1"
FT                   /translation="METKSRQIILVGTICYTILILFFMFFAFNRLDGATSVDGYTFILA
FT                   PEGVPLTFPELTYSWIVDFGNVAAFIPFGILFPLLYRVRFGKFISLFVLAIFVLETVQA
FT                   LTYLGSFDVNDVISNTIGAAIGYVAYRVGFSSNLSYKKLMASALTIVVLVFGVMVVSEI
FT                   LQKREGPVQSLTVMKEMTGTTPITENFPSFSVAGERIEPKMNVYSSEGESTKTYNYILG
FT                   NQKNVWLSFYFGIPDNGGSKGEAKIIVDGQELAQLNEQSYQGAEALREMPFNEVNEITI
FT                   IVSGNAKLWDVGIRGMQHWWE"
FT   CDS_pept        380674..383094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="BBR47_03740"
FT                   /product="copper-transporting P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41351"
FT                   /db_xref="GOA:C0ZIY3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIY3"
FT                   /protein_id="BAH41351.1"
FT                   /translation="MSAKTAEATVAISGMTCAACALRIEKGLGKMEGVETANVNLALEK
FT                   STVVFDPTKTNIDDIRSKIESLGYGVVSDKVELNISGMTCAACSTRIEKGLNKTAGVLK
FT                   ANVNLAMETATVEYDSSQVSVTDLIQKVEKLGYQATRKEDGKEEEKVDRRQEEIKRQTR
FT                   KFWISAILSLPLLWSMVSHFSFTSFIWLPESLMNPWVQLALATPVQFIIGAQFYVGAFK
FT                   ALRNKSANMDVLVALGTSAAYFYSLWVAINSIGAHGGHMLELYFETSAVLITLIVLGKL
FT                   FEMKAKGRSSEAIRKLMGLQAKTAVVVRDGVEMTIPVEEVRLGDVVHVKPGDKVPVDGI
FT                   VMEGQSAVDESMLTGESIPVDKAAGDTVIGATLNKNGFLKVQATKVGKETALAQIIKVV
FT                   EEAQGTKAPIQRVADSISGIFVPIVVGIAILTFLIWYFFVIPGNFGEALEKAIAVLVIA
FT                   CPCALGLATPTSIMAGSGRAAELGILFKGGEHLETAHHLDTIVLDKTGTVTKGEPELTD
FT                   VIAIDIEEQELLSLVGAAEKNSEHPLAQAIVRGIADKGITVADTGSFEAIPGFGIRATV
FT                   SGKEVLVGTRRLLEKHQISYQAVSDTMLALERSGKTAMLAVVEGKLAGLIAVADTIKPT
FT                   SKQAVQRMKAMGLTVIMMTGDNRQTAEAIAREAGIDHVIAEVLPEGKAAEVKKLQEQGK
FT                   KVAMVGDGINDAPALATADVGMAIGTGTDVAMEAADITLMRGELTSVADAIEMSKLTIR
FT                   NIKQNLFWALAYNTLGIPIAAIGLLAPWLAGAAMAFSSVSVVLNALRLQRVKL"
FT   CDS_pept        383159..383359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copZ"
FT                   /locus_tag="BBR47_03750"
FT                   /product="copper chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41352"
FT                   /db_xref="GOA:C0ZIY4"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIY4"
FT                   /protein_id="BAH41352.1"
FT                   /translation="MTNITLNVEGMSCNKCVARIENTLKDLGAEGKVNLAEKKVEVSYN
FT                   ESNLTLDAVKEAIEDQGYDVV"
FT   CDS_pept        384645..385871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="BBR47_03760"
FT                   /product="probable glycine betaine ABC transporter
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.32"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41353"
FT                   /db_xref="GOA:C0ZIY5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIY5"
FT                   /protein_id="BAH41353.1"
FT                   /translation="MSKMKVHQLTKVFGKQPELALKLLAEGRTKEQIYKQTGQSIGVNQ
FT                   VSFEVEEGEIFVIMGLSGSGKSTLIRLCNRLIDPTSGSIEIDGEEIVAMKATALREVRR
FT                   KKLGMVFQNFALFPQRTVRENVEFGLEIQQVPPGLRQEKAREALALVGLTEWENAYPDQ
FT                   LSGGMRQRVGLARALANNPDILLMDEAFSALDPLIRKDMQDELLELQMTMKKTILFITH
FT                   DLHEALRLGDRIAFMKDGQIIQIGRPEEILADPADEFVRKFVEDADLSRVLVAENVMKR
FT                   AEAITPDKGARVALQLMMDNGVSSLYVVDKKRTLLGLITAYDVSLAISTGDSLEAIMKT
FT                   DLPTVSPDARLHSLFPMMADLHVPIAVVGEQQRLLGVIVKGAVLGGLVGKVNVQEHQRA
FT                   EVMSDGRRA"
FT   CDS_pept        385855..386694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAB"
FT                   /locus_tag="BBR47_03770"
FT                   /product="probable glycine betaine ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41354"
FT                   /db_xref="GOA:C0ZIY6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIY6"
FT                   /protein_id="BAH41354.1"
FT                   /translation="MDVVPKLPIGGWMEGFVEVLGQYKGVLFDPVAIVISTMVTYCSTV
FT                   LAEIPSLILILLLGAAAWVFAGRASMVFTVVGLSLIHNLGYWDETMETLGLVLTATMIS
FT                   IAIGIPVGILCARHDTFRNLVTPILDLMQTMPAFVYLIPAIFFFGLGEVPGVIASVIFA
FT                   LPPIVRLTNLGIRQVPAEMEEAADAFGATGWQKLVKVQLPYAKSTILAGVNQCIMLALS
FT                   MVVIAAMIGAKGLGADVYRAVSQVDIGRGFEAGLSIVIIAIVLDRLTQHAGKKERNT"
FT   CDS_pept        386694..387626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAC"
FT                   /locus_tag="BBR47_03780"
FT                   /product="probable glycine betaine ABC transporter
FT                   substrate binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41355"
FT                   /db_xref="GOA:C0ZIY7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIY7"
FT                   /protein_id="BAH41355.1"
FT                   /translation="MNKIVPAFLAGMMGATAWLAGCSSQNTNTQIPTATVVGPIASETS
FT                   DNALGEKLDYKIIGIDAGAGSMVKTEEVMNLYGLDKWQLVEGSDAAMTAALIKAYEAKE
FT                   PIIITGWTPHWMFKKMDLKYLEDPKNGFGGAEQIHTIVRKGLKEDQPAAYQFLDKFWWE
FT                   PADMESVMVQMIDGKDPEVAAAEWVKNNEAKVAKWVEGIQPVQKEKLTLAYVAWDSEIA
FT                   SSHVVEHVLEQKLGYEVELSQVQTGPMWAGVAIGDVDGMVAAWLPSTDTSYLKKFGGQI
FT                   EDLGPNLDGTKIGLVVPSYMNISSIEDFQ"
FT   CDS_pept        387645..388055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41356"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIY8"
FT                   /protein_id="BAH41356.1"
FT                   /translation="MKHYFVMGRGEAFTSFVQTLCCDSLPAFWGRNPGAFSLTVGSGDK
FT                   TIQRFLPISFDECYRDQESLLLYHSVYIFPDEWAEGRDFVTLFRQLGSCRIFVMTQEHR
FT                   NAMLYKALGANHVIVSQPGYKGYGWLAEQMSG"
FT   CDS_pept        complement(388112..388480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41357"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIY9"
FT                   /protein_id="BAH41357.1"
FT                   /translation="MAISNKKKLEAEISEAFIKFQRELIGRGPQEAKTYIVGDMVIARF
FT                   KGVLTVEEKHLSSHDKGRRIVKEMREVLREMYSEESEEIVEKLTSCKVLSSHSDISTKM
FT                   GERIEVYVLDKDLEKMLG"
FT   CDS_pept        388973..389197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41358"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIZ0"
FT                   /protein_id="BAH41358.1"
FT                   /translation="MTVVTYKKIAVFLKKETGDKTQRRQLQVGWALGRPMSTFSPKQRI
FT                   VFICREKAGDFFRLFIFRSVKCGDPSGES"
FT   CDS_pept        389665..391338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="BBR47_03820"
FT                   /product="potassium-transporting ATPase A chain"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41359"
FT                   /db_xref="GOA:C0ZIZ1"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIZ1"
FT                   /protein_id="BAH41359.1"
FT                   /translation="MDFIQIALVLVVLFVLAIPMGRYLARSFSLETTRLDRVFGGLEKA
FT                   IYKLSGIRVADMTWKQYAMAVLVSNISMVAIAYLLLRLQGMLPGNPSGIAAMEPLLSFN
FT                   TAVSFLTNTNLQHYSGESGLSYLSQMLVIIYLMFTTPATGIAVVMAFMRGLTGQRSIGN
FT                   YYVDLVRAHTRVLIPLAIVVTLLLVSQGVPQTMEPTATATTISGTEQQIARGPVASLVS
FT                   IKHLGTNGGGFFGVNSSHPFENPTPLTNVIEILSMFLIPAALPFAFGFLAKSRKQGWVI
FT                   FGAMFVMFLAFLITAYANEGIGNPALERAGLSQEMGSMEGKEVRFGIAQSALFTAVTTA
FT                   ATTGTVNNMHDTLTPLGGLVPLGEMMLNCVFGGDGVGTINILMYAILAVFLAGLMVGRT
FT                   PEFLGRKIEGKEMKLIAIAILVHPLIILAPTAIALATEMGSSAVSNPGFHGISQVLYEY
FT                   TSSAANNGSGFEGLGDNTPFWNISTGLVMLFGRYVSIITMLAVAGSLLAKTPVPETMGT
FT                   LRTDNSVFTVILIATVVIVGALTFLPVLALGPIAEWLTIR"
FT   CDS_pept        391412..393451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="BBR47_03830"
FT                   /product="potassium-transporting ATPase B chain"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41360"
FT                   /db_xref="GOA:C0ZIZ2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIZ2"
FT                   /protein_id="BAH41360.1"
FT                   /translation="MSRTRTVALPKDLYQRAFVESFKKLDPRVMMKNPVMFVVEIGFFI
FT                   TLLLTFVPNLFGGASDPFYNGVVSLILFVTILFANFAEALAEGRGKAQAESLKKTKQDT
FT                   QAKKVGKDGRVQVVSSTELRKGDLVIVEAGELIPSDGEIVEGVASVDESAITGESAPVI
FT                   KEAGGDFSSVTGGTRVVSDRIRVRVTTDPGESFLDRMISLVEGAKRQKTPNEIALNTLL
FT                   VSLTLIFLIVCTTLLPIANYVHAAIPVATLIALLVCLIPTTIGGLLSAIGIAGMDRVTQ
FT                   FNVIAMSGKAVEASGDINTIILDKTGTITHGNRMAAEFVTVGNTKSTELNRVAAQSSVH
FT                   DETPEGRSVVELAKKQGLAPAELELPGSEGVEFRAETRMSGTNLANGVIIRKGAVDAIK
FT                   KYVAEQGGNIPADLDEKANRIATAGGTPLAVVEGNTILGLIYLKDTVKPGMRERFEELR
FT                   RMGIRTVMCTGDNPLTAATIAREAGVDDFVAEAKPEDKIALIRKEQAAGKLVAMTGDGT
FT                   NDAPALAQADVGLAMNTGTVAAKEAANMVDLDSDPTKIIEVVAIGKQLLMTRGALTTFS
FT                   IANDVAKYFAIIPAMFMLAIPQMSALNIMGLATPQSAILSALIFNAIIIPILIPLAMKG
FT                   VKYTPMSATKLLSRNLVIYGLGGIIVPFVGIKLIDLILSGLNLI"
FT   CDS_pept        393487..394050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="BBR47_03840"
FT                   /product="potassium-transporting ATPase C chain"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41361"
FT                   /db_xref="GOA:C0ZIZ3"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZIZ3"
FT                   /protein_id="BAH41361.1"
FT                   /translation="MILKNLRLSLVLLLICGVAYPLAMTGVAQVVMPAQASGSLITDGS
FT                   GKVVGSELIGQTFTDPKYFWGRISSIDNNASGSGSNNYAPSNPALIERTQKDIAAFLAA
FT                   NPGVKQEDIPADLLTNSASGLDPHISPKAARIQVERVAKARNLEPVQLQALIEANTEGR
FT                   SLGVFGEPRVNVVKLNLALDELKK"
FT   CDS_pept        394072..396402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="BBR47_03850"
FT                   /product="sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41362"
FT                   /db_xref="GOA:C0ZJR1"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJR1"
FT                   /protein_id="BAH41362.1"
FT                   /translation="MVEQFRRKSPEEILQSISRMHRGRLKIILGAVSGAGKTYHLLMEG
FT                   QTLKKKGIDVVVAGSVEATHPKLAQKREGLEQIEPIIWYSLGEAKHDLDVAAIIERDPE
FT                   VVLVDGLAHRNRSDAPRPTRLDDVQFLLNNNISVIATVNIYELAGMKEMAERLTKAEVR
FT                   IDQCVPEDTLAMADEVKLLDVTPEAILKRLQEDDRNPTRTKHPLFRRDNLHMLRELALR
FT                   FVATGVNEDLEDYREKHGMVGASGATEKVLVSAQYHWNGSILVRRGQQVAKRLGGELLV
FT                   VCFLPLSKKLTKEEATFKRSIGKLVDKVGGTFEEQMLAREKDVANELVAYAMENNVTRI
FT                   VMGQSKRTRWDEIWYGSIVHKILRQTKNIDILIVADRSERDGERVMPTKREQAVTVNPY
FT                   RRLSDEEMQQEIGKIKRGTLKVYVGAAPGVGKTYTMLREGNELAENGIDVVIGLLETHG
FT                   RKETIEQVGGLPLIPRKRIPYKNVTLEEMDTDEIIRRNPEVVLVDELAHTNVPGSAYEK
FT                   RYHDVEKILAAGISVISTMNIQHLESLNDSVEQITGIRVRETVPDHILHQADEVELIDI
FT                   SPKALRQRMREGNIYAMEKVEQSLTNFFKTGNLIALRELALREVADDVDERLEAWERRT
FT                   LRGPWRQQEVIFVCVNLRADSERLIRRGFRIAYRLKASWHVAYVQDHPSLTEEEETQLA
FT                   KLKALTERLGGRFERYEAPSRRKVFTKLVWHMNEKGTTQVVIGQSARTRWKEILEGSVI
FT                   QRLLREVRHMDVLVVADHAPDMM"
FT   CDS_pept        396415..397140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41363"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJR2"
FT                   /protein_id="BAH41363.1"
FT                   /translation="MGTEKEGQWDQSVADAYSRLECLIREPTTEADLFSRLIRVYLEEE
FT                   EVRIRQKLKRKSSQRISRVMHERVGEFLSGQLSGLSFQVIDGLLFIKREEQLVGALKCI
FT                   PDLGSYDTPSWNATLARFTKQYQKRFNLAPEKLLFVICSLAKSLDAAHAKELTGIDVWC
FT                   GAALTTPAYRDALQMYVSKCVEVMDALPQPVHQVYFLSADVHPNALACQLLRGEKASLP
FT                   DRWLRPSVGDLIQFLQGRL"
FT   CDS_pept        397204..398046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41364"
FT                   /db_xref="GOA:C0ZJR3"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJR3"
FT                   /protein_id="BAH41364.1"
FT                   /translation="MASIPHFTGAYISGTELAPDALRTAGLIEQLQQNGLEVQDVGNLH
FT                   LPDELPRHNIPPVRNWPAPRMLWDLLQKDAQEWLNTDDFVLMLGGDCSLVVATAQAHQA
FT                   IHQEKAYLLVLDGHLDALVPSASRCIGAAGMGLWFLLQDRGQWIEPSGWDAERIRLVGC
FT                   QQMPAETFGVEVMTLAQLTEGSIVERVSHTLQSIPPDAKILVHFDVDIMHKDAMPAAYS
FT                   PSDIGLSLSEAEALVATVLRDSRVTSMEMTEFSGARDTTGEYARRLVELLARALAARA"
FT   CDS_pept        398208..399539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41365"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJR4"
FT                   /protein_id="BAH41365.1"
FT                   /translation="MKKMALCVAALAVVVSTGILVSPSFFTSSPAAVVNAAPSVNTSLF
FT                   VSQKAGDPGILQAAQNGFTQPLDLKVTDQGFILEAKEVLADPLRISIIAGVKDKDGKAT
FT                   DVYWDNFHTPTHEYQEITIKDKAGKVLHSSSPNQVSWKTNQIGDYILFEHELRSYFDDG
FT                   NKLPDELVVEFHMKKMGSTKGNWQLSVPVNLKKAKAATKTVAVNQSHTSLQGFQFDLRE
FT                   ITFAPSGTEVVIDSNNKDFSYQLVNEKGVVLGAWDSAVAIHDESIQKNVINTMKWRESA
FT                   PVEKGLRQFHYFHDLKESNGLTFKLHAVYTEEEPGFSVKLDPASVGAKPVTAEKNGTRF
FT                   TFHKVSKGSGEDRHNIEFEGTLAEGVVGIFPFDTWYVTDEKGKKYSAVCHIEESANQNG
FT                   RMKVRGNLEIEEMKSLPKQMTITFDSMLKEHRDVSFAVPLLTGK"
FT   CDS_pept        399663..400229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03890"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41366"
FT                   /db_xref="GOA:C0ZJR5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJR5"
FT                   /protein_id="BAH41366.1"
FT                   /translation="MPDDRELIEQIQAGNHQLYSQIIDRYNGKIVTYLYKMIGNMPDAQ
FT                   DLAQDVFTKTFYLLKDYRPEHKFSSWLYRIASNHCLDEIRRRKRTEQTAIVEEQIVDPE
FT                   TPETALLKKERDAQLEHSIMLLDEEYREVFVLHYLQRLSYREISERLSLTESAVQMRLF
FT                   RARKEMKKSLTKTMGGGDVHEMLHV"
FT   CDS_pept        400210..401868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41367"
FT                   /db_xref="GOA:C0ZJR6"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJR6"
FT                   /protein_id="BAH41367.1"
FT                   /translation="MKCFMFNQWKLYANGELPPAASKGLEQHAVECPQCQIKLQEWVDH
FT                   MLEEEFSTYPEVPVPDTFTDEVMRKLFEAAPARTARKRSSRTRRQRGWDIVKKTGLVVA
FT                   GLTALVVTGTVVSPTFANYVNSLFQIEKDADNGMKNAVDKGFVQKLEQKVTDQGITFEA
FT                   KEVMADSMRIAVIYDVYDQNGKQIKIGEDGHLLNAYLIDSTGKDWLEDDGPTLGGHGKY
FT                   FIVEQPLNTIFESAEATPNMLTLKLEQTEIAGKKGKWSLEIPIDMKKAKEATKTVVFQD
FT                   TAFHSPLGMEIELEKIEFSPSATRLMLETTLAKSAYVEVEREMEEVTLEGERSNITEKY
FT                   KDPILSGNDIAYEITNEKGDVVAAWDNPFLDEGITKEKNVLRLMGAVGRSQGDYEMKWW
FT                   HTFGPIQGEQKLKLQLKKIYEKKWASSKFDLAPAELNKRSATFKDETGSTFTFSAFSFE
FT                   SGSDNKPGVAVLTVEGTLGKDVVNTQSWDVKDENGQSHPVRLKTNSTRDKDGRVHVKGK
FT                   LEIPRMEKRPKSLSVTYKEYAVEHPVNWEVPFEIK"
FT   CDS_pept        402058..402624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03910"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41368"
FT                   /db_xref="GOA:C0ZJR7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJR7"
FT                   /protein_id="BAH41368.1"
FT                   /translation="MPDDQELIEQILAGDHEQYRQIVDRYKGKIVGYLYRMIGNMPDAQ
FT                   DLAQDVFIKTFYRLHDYRPEYRFSSWLYRIASNHCFDEMRKRKRTEQVEIDEEQLIDPD
FT                   TPETTLLKKERDAELERSIMLLDEEYREVFVLFYLQRLSYREISERLSLSESSVQMRLF
FT                   RARKKMKDSLEKTMGGGAIYEMLHV"
FT   CDS_pept        402605..404266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41369"
FT                   /db_xref="GOA:C0ZJR8"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJR8"
FT                   /protein_id="BAH41369.1"
FT                   /translation="MKCFMFNQLKLYVNDELAPAESKGLEQHVENCPQCQKYLQEWVEG
FT                   MQEVDFSDIPDALVPDTFTDEVMDKLSDAVPPRSTRKHSSRTRRQRGWDIVKKTGLVVA
FT                   GLTALVVTGTVVSPTFANYVNSLFQIEKNADSGMKNAVNKGLVQKLEQKVTDQGITVEL
FT                   KELLADSMRIAVIYDVYDESGKKIEDHNLNAKLIDQNGKDWFEDDGGDNWGSHGEFFIT
FT                   ERFLNEIFESTEATPDQLTLHLEQTEIADKTGKWSLEVPIDMKKAKEATKTVAFKDTVF
FT                   QSPQGLGIELKNIEFSPSATRVMLDTTFPKSAYLEVERTSILYDRKNPQGAIVTEKERD
FT                   PAFSGENMMYEITNEKGDVVAAWDMKSLDDELDNKENVLFTPRTEEEAEERPEGDVLNW
FT                   WHTFGPIQGEQKLKLELKKIYEKKLASPTFDLVPTELDKKAATFKDETGSTFTFSSFAW
FT                   EPGNGEDLGEAVMTIEGTLGKGIVENRDWSVKDENGKTYAASVSTESTRDKDGRVQIKG
FT                   EISIPRLKQQPKKLTVSYATYMMEHDVKWEVPIEIK"
FT   CDS_pept        complement(404326..404955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03930"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41370"
FT                   /db_xref="GOA:C0ZJR9"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJR9"
FT                   /protein_id="BAH41370.1"
FT                   /translation="MGFLRKYWSDFGLLVAVGVGLYLMIQWGTIPIIERLLWLSFIAIL
FT                   VHQYEEYRWPGYFAGLFNGLIFKSSHPERYPLNPQSAMIINLVIAYVFYLVPLLFPTVI
FT                   WLGLAPILMGFFQFIWHGVFANLKAKTLYNPGLFAVIFFHIPIGVWYIRHIISTGMVTT
FT                   SDWFIGTGYFIVAVYILIVKGNIWLKDENSRYTFTRQQLGPYVHKS"
FT   CDS_pept        complement(404975..405565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03940"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41371"
FT                   /db_xref="GOA:C0ZJS0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS0"
FT                   /protein_id="BAH41371.1"
FT                   /translation="MSQADKNTETKAKILQSTLDLIKMEGFESVTVRKIAADSGTNVAL
FT                   VNYYFGSKDRLINEALSAFLGSFTATFDILDNTSLLPQERLKQFLMSYVQIIQQYPELV
FT                   SRIFSLGGAVFTSQYEYGQFLKSIGFVKIERVLKEITHEENHEVLMMMIMQLFGAIFLP
FT                   ALLKSILSTGAGIEIASVEQQIDLLFARYFHEK"
FT   CDS_pept        405731..406423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytaF"
FT                   /locus_tag="BBR47_03950"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41372"
FT                   /db_xref="GOA:C0ZJS1"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS1"
FT                   /protein_id="BAH41372.1"
FT                   /translation="MSGWLALLLVSLAISMDSVSVGLTYGLRNMRMPFLSLVVVSGCSF
FT                   AVVYGVMLVGSSLTEWLTPEIGQYIGAAVLILMGLFTLWRLIETRSGTEVQESTAASNN
FT                   AVVAEEKQEEQEPIVLLSQFRIFGVMIQILKDPSKADTDRSGHIMGWEAVMLGLALSLD
FT                   AFGAGISLTFLGYSPLLVALCIAVMSALLLVVGIALGSRAGKASWLTRLTWLPPILLIC
FT                   IGVAKSLK"
FT   CDS_pept        406531..409335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yloB"
FT                   /locus_tag="BBR47_03960"
FT                   /product="cation-transporting ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41373"
FT                   /db_xref="GOA:C0ZJS2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005782"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS2"
FT                   /protein_id="BAH41373.1"
FT                   /translation="MDTQPIRKWYTLAAADVTEALHSDAAQGLTQQEAERRLAKQGANQ
FT                   LAEQKRKPLYSVFVDQFKDFMVLILFIATLISYFLGEYLDAIAIIAIILINGILGFIQE
FT                   AKAERSLQALKELASPMARVIRGGNISMIPASRLVPGDLVQLEAGDRVPADLRLLLANR
FT                   LEVEESALTGESVPVGKNVKRLETAQASTVPLGDQKNLAFMGTMVTGGTGSGIVVATGM
FT                   STEIGKIAHLMNTAEEAETPLQLRLEQMGKILVVVALLLTIVVIAAGVWHGHELFTMFL
FT                   AGVSLAVAAIPEGLPAIVTVALALGVQRMIRRNAIVRKLPSVETLGCASVICSDKTGTL
FT                   TQNKMTVTEVWHSDSTYEVSGSGYAPEGAFHYLGKMVSPARDGALTQMIRIADRCNNAR
FT                   LTCEEQSTRNLLGMGKASRFWQVIGDPTEGALKVLAAKALGGNTERTTPKNQGQRVEEL
FT                   PFDSDRKMMSVVEKGMDGVYSLLTKGAAEALLARSTHILWKGELIPLSATLRHQVLEQT
FT                   EHMAGKALRVLGFAYKTLQGYRPGQPIGSLENNLVFVGLAGMIDPPREEVRPAIDLCHQ
FT                   AGIKTVMITGDHKVTAEAIARQIGLMRGYGEVLEGRELDGMSDEQLAEYAERVTVYARV
FT                   SPEHKLRIVRALQSQGHVVAMTGDGVNDAPAIKTSDIGIAMGITGTDVTKEAADLVLRD
FT                   DNFATIVAAVEEGRNIYDNIRKFIRYLLASNVGEILVMFFAMLLGLPLPLVPIQILWVN
FT                   LVTDGLPAMALGIDQAEKDTMYQKPRNKAENIFSRGLGWKIISRGFLIGAMTLLAFWLT
FT                   LKENPNDLVHAQTVAFVTLVMAQLIHVFDCRSQYSVFHRNVFENKYLVWAVLSSIVLVI
FT                   GVVYMEALQPIFKTTDLNLRDWALILVTAGVPTFVAGIGGVLTGSRQRTSKEKKPAMRT
FT                   VRPD"
FT   CDS_pept        409366..410082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yunB"
FT                   /locus_tag="BBR47_03970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41374"
FT                   /db_xref="GOA:C0ZJS3"
FT                   /db_xref="InterPro:IPR014197"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS3"
FT                   /protein_id="BAH41374.1"
FT                   /translation="MRVRRGGWKRRRRRIFAGILLIIVVLIVLFIVVERRVEPTLMLIA
FT                   QAKAEQVAKLAITDAVTKRMTQQGVDVNEVVIMEKDESGSIKAVNFNFKEYSRIVGETT
FT                   ARIQNRLKEFEQEHVQTTIPLGLATKNVFLEHIGPDIPVSFVPIGAVKTKLETKLKQAG
FT                   INMVLVTVYIYVEVDLRVIIPFATKQQTVTTEIPVSEALIVGKVPTYLYDNPSGKPDVP
FT                   MPRTDQVPSNPIPSQP"
FT   CDS_pept        410209..411183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03980"
FT                   /product="protease inhibitor BBRPI precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41375"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS4"
FT                   /protein_id="BAH41375.1"
FT                   /translation="MKTIRTGMMTIAALAALGTSVVSATSEPVKELSVNINGQAIAQDA
FT                   IFDKGQQTVLVPLRPVAEALGFKVSWNDKEKAAEVQRGAITSYAKEGEDRYPFAKMYKT
FT                   LGAEPRVLNGSTYVPVKFVDEILQADVNVTDDTVTVVEDEIAPMRTGTITNINKSDKGY
FT                   SVTLNIYESGIILHLTADTKITDEAGKVLKPEDLKLGMAVDATTEKFMAMSLPPQTSAL
FT                   SITVKGGLETQDILGTAGKVASISADKDGNYKMLVEGRGITGTSQEKINLNITEKTVII
FT                   NARDNKVLSPAELKEDMQVVAFYGPMMTKSLPPIGTAEKIVVE"
FT   CDS_pept        411280..412377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_03990"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41376"
FT                   /db_xref="GOA:C0ZJS5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017203"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS5"
FT                   /protein_id="BAH41376.1"
FT                   /translation="MIVSKGGAMGTSSEVLSLMQSIFANVSDAILVIDQEGRIVKANAA
FT                   LEQMTGWTEEELIRDKHICELCLGMATCMEETSCADCFFKRVQMPSFEMRLRTKSGVDY
FT                   PVAASSARLEDESQGKLVMILRDMSAQQRVEKERYQYKLTNFAIQAQEEERKRIARELH
FT                   DGVGQALYSILVGLNVVRQRELSEPVMQHVAELVNMTSKAMEEVKRMALELRPSALDDL
FT                   GLLPALRSLMKRVEKTFHIQVELHVQGEKRRYSAAMETALYRIVQEAMTNTAKYAKASH
FT                   LGIMFENREKEIVVTIVDDGVGFEVEKTLKIGKGLGVFGMKERAQLLGGTVDIRSAPEE
FT                   GTTVIVRIPVPKEGVEDEHSCLDRR"
FT   CDS_pept        412349..413005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04000"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41377"
FT                   /db_xref="GOA:C0ZJS6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS6"
FT                   /protein_id="BAH41377.1"
FT                   /translation="MSIRVLIADDHAIVRSGLGMLINAQEDMEVVGYAADGKEACEKAW
FT                   EVRPNVVLMDLSMPPGENGLTATARLKETAPDIQVLVLTMHDDEEYLFRVLQAGAAGYI
FT                   LKSAPDLDLITAIRSVNQGMAYLYPSATKSLIEEFLQMVKNGEEQAKYDILTDREKEVL
FT                   VLIAKGFSNKEIAEQLTVSVKTVESHKAHIMEKLHLRTRPDLVRYAIKKGWLDFE"
FT   CDS_pept        413203..413370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41378"
FT                   /db_xref="GOA:C0ZJS7"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS7"
FT                   /protein_id="BAH41378.1"
FT                   /translation="METQVNKAEKGKKSKSSKLQTDQEDLKGTFVAVLIVGGIILVGWL
FT                   GVFGLFLDRA"
FT   CDS_pept        413394..413861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbaB"
FT                   /locus_tag="BBR47_04020"
FT                   /product="probable bo3-type cytochrome c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41379"
FT                   /db_xref="GOA:C0ZJS8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034214"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS8"
FT                   /protein_id="BAH41379.1"
FT                   /translation="MHLHRYEKIWLMLGAGGLALFIVLLCVNAFAMGMAPPSNMEMIDP
FT                   EKVTETPPFDKPGLKQVGDNEYDAYMTAFAFGFSPTKMEIPVGATVNFHVTSPDVIHGF
FT                   QIPETNINFMVLPGHISSATHTFDKPGEYLILCNEYCGAGHQVMATTIIVK"
FT   CDS_pept        413877..415550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbaA"
FT                   /locus_tag="BBR47_04030"
FT                   /product="probable bo3-type cytochrome c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41380"
FT                   /db_xref="GOA:C0ZJS9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJS9"
FT                   /protein_id="BAH41380.1"
FT                   /translation="MVIARKVEDTLPHVPVQRSAARLSLAYVWVAYIAFGLAAVAGMVQ
FT                   GMVRGGIMELPSWTNYYQILTAHGVLMALIFTTYFIVGFIFSGVARTTGGSLHGAALKF
FT                   GWAGWILMTLGTLMAVVTILLNEASVLYTFYAPLKASPYFYIGSALLVVGSWLAGFGVF
FT                   ASYRKWKRENKGKTSPLFLYMGVTTYILWITATIPVAVEVLFQLIPWSLGLVPTINIML
FT                   SRTLFWFFGHPLVYFWLLPAYMAWYVCLPRIIGGHIFSDSLSRLAFICLLLFSIPVGFH
FT                   HQLMEPGISPAWKMIHVTLTLIVVIPSLMTAFSMFAIFETTGRKKGGVGLFGWFKKLPW
FT                   TDVRFFAPFVGMLFFIPGGAGGIINASNQINAVVHNTIWVTGHFHITVGAAVALTFFGV
FT                   TFWLIPALTGRQLTKTANRMGMVQTVFWAVGMFLMSLAMHTMGLQGAPRRTDYTTYMDH
FT                   PLALGWMDYQRLMAFGGGLLFVSAILLILILLYLTFYAPKGNTEYPIAETETTQEVPKI
FT                   LERWPVWIGLVAFLIILAYGYPILQQIQHQAPGSPPFVTW"
FT   CDS_pept        complement(415608..416363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04040"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41381"
FT                   /db_xref="GOA:C0ZJT0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT0"
FT                   /protein_id="BAH41381.1"
FT                   /translation="MKYTDNIVIVTGGGQGIGRAVATMYATEGAHVVIAEYNRAAGEET
FT                   ASLINSTEAVKGTAHFEHIDVSVPAQIEQLMRTVDERWGRLDALINNAGLSVWESPYEL
FT                   TVEAWDHILNTNLRSVFLASREAAKIMRRHGGGAILNLCSTRAHMSEPHSEAYAASKGG
FT                   ILSLTHALGVSLGPDGIRVNAISPGWIEHRDYAALRPGDHAQHPVGRVGTPDDIARACL
FT                   FLTQKDNDFITGTELIIDGGMTRKMIYEP"
FT   CDS_pept        416491..417123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04050"
FT                   /product="putative NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41382"
FT                   /db_xref="GOA:C0ZJT1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT1"
FT                   /protein_id="BAH41382.1"
FT                   /translation="MNTELKITAEQVMEARHSVRKYDPNGKIPQGELNEILRLAASAPS
FT                   AWNLQHWRFLVVTDPAIKEKLLPIAYNQQQVVDAYATIIILGDLEAYKSARPVYDEALA
FT                   KGYVTEQVRENMIAQIEGAYNNNPEIARDEAIRNSSYAAMQLMLAAKAKGYDTCPMGGY
FT                   NRDALIKELNIPSRYLPTLMLTLGKASVQAYSTSRFGLDQLVIQNSF"
FT   CDS_pept        complement(417120..417230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41383"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT2"
FT                   /protein_id="BAH41383.1"
FT                   /translation="MTLRKKQTCTMKQRKKLTLAAYICGVDEFFAVGTRY"
FT   CDS_pept        complement(417449..417559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41384"
FT                   /db_xref="GOA:C0ZJT3"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT3"
FT                   /protein_id="BAH41384.1"
FT                   /translation="MSKNEGVMLVEVYQALTLMFMFGMFILALLTYLKKK"
FT   CDS_pept        complement(417748..419172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04080"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41385"
FT                   /db_xref="GOA:C0ZJT4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT4"
FT                   /protein_id="BAH41385.1"
FT                   /translation="MATCGERTSQMKGIKSRLVLHFGLILLLIVLLLEGLFYWAVHTYY
FT                   IGTATEALVTRSTTFTNFINKYATGYRLKDKARYILENVSNQEYAKIEVLDPGGKVILN
FT                   SYGFQTSEIINTPDVMDALKGQSGLYIGKSPQSRERVIAVSNPLTYSGEFVGVLRYTIS
FT                   AEPLYQAVNRIALYGAGVGTGVVILAFALSLLMAKRIVDPIEDLTNAAKQMAEGNFSVR
FT                   APKRFDDEVGTLADTFNYMATEIGKNEKLKNDFISSVSHELRTPLTSIKGWGETLISGG
FT                   LEEPEETMLGLEVISKETDRLIGLVEELLDFSKFQSGEMKLSRVPMDVRELLQDLHLQF
FT                   SVRAHAKQIELKLETPPTPLIVMGDPNRLKQVFVNLLDNALKFTPQNGSIVIAASLSAD
FT                   RLLVTVTDTGEGINPEDLPHVTEKFFKGRSKLSGSGLGLAICKEIIQLHAGRFSVSSAL
FT                   GQGTSIMVDLPLLANQ"
FT   CDS_pept        complement(419129..419836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04090"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41386"
FT                   /db_xref="GOA:C0ZJT5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT5"
FT                   /protein_id="BAH41386.1"
FT                   /translation="MKVLLLEDEKSIRDFVRINLKREGYEVIEAGTGEEALDLADQQTD
FT                   IVIAILDVMLPGIDGFEVCGQLRKKYPRLGIIMLTAKSQELDKVMGLEFGADDYVSKPF
FT                   SPAELLARVKALHRRLTPIPEAEDKNEINIAPFRLLLDERKLIRTEQEIDLTPKEFAII
FT                   KLLAENANKAISRDEILTAVWGQFFVGDLKIVDVNIRRIRQKIEDDPAHPAFLETVWGY
FT                   GYLWRKDVPDERH"
FT   CDS_pept        complement(419874..421238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41387"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT6"
FT                   /protein_id="BAH41387.1"
FT                   /translation="MKKAWLVTTALCASLVSGCGLTDTPNELMRAPSADGDQKSINQAV
FT                   MQFLPAGSQLSVPLHPAEASAVSLQDLNGDGVAEVVAFYKTEKTDYEIGVLVLTQKQGN
FT                   WEKLSSFTGVGSELDYVSFQDLTGDKIPEMLIGMGGGEDLNKELSVYSLANNMTQELMK
FT                   QPYTIMAVGDLTGDNQEDLALVVLDKNNFTSKAELYGAANGTIAKKTELALDGYVNGYY
FT                   QAIIGKASPTRNGLFIDAGLGAHSASTELLLWDNGQLSNPLAKIEGEMDLTFKPYSLES
FT                   EDINGDGIIEIGTKIQPAGTEDLAMAEIPWVSSYFQWDGKTGLKHIEDHYQNYSQGFDL
FT                   KIPAKWGEKYTISINHDTNPLLVRFQYYGANGKNKAELLTLQSIPQNEWIKFESGLKQK
FT                   QVPYILLKEEGKQVLIAILPQTTPTLGKAALAEYRSMQLTAEEIRQLYKPMTNRE"
FT   CDS_pept        421493..422449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41388"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT7"
FT                   /protein_id="BAH41388.1"
FT                   /translation="MKAWHKTMAAVLCSGTVLMASGVGADPVQATGTQSQAFAPVVLLQ
FT                   PEQNIPFTIQFVDGFVAKVTNTKTKATSTVDISDNKATYVKQGIYHANGKLQKATNGYT
FT                   EKLVELVPFRDAKGNLRYMGKQILHGLNTEDRLAVATSVWNVVDKQPQLLQVTVQKADW
FT                   DNMPSTDVTINSGFSMSSDSTFVLDTKYADVTGDNIKDHIFLVGDKMGVSMNQTAHNLR
FT                   VVVREGKDNQQTFISVGKHDSGILPKLAITDGNADQVKDILVTMPTATGHVYSQLTWKE
FT                   NRPQPVVDQGKLNDRQAYQPVIGVYGEAVGMNKAKKQ"
FT   CDS_pept        422619..423833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciC"
FT                   /locus_tag="BBR47_04120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41389"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT8"
FT                   /protein_id="BAH41389.1"
FT                   /translation="MNMIEKKIPVTVLSGYLGAGKTTILNHVLNNRDGLRVAVIVNDLS
FT                   EVNVDASLIISGSGLSRVDEKVVELSNGCICCTLREDLLTEVERLALEGRYDYILIEST
FT                   GVGEPVPVAQTFTYVDEENGINLSSLCRLDTMVTVVDAYRFWHDFSSGENLLDRGQAVG
FT                   EEDIREVADLLIDQIEFCDVLILNKCDRVAPDDLIQLEAILRKLQPHARFIRAVRGQVD
FT                   PQAILNTHLFDFETASQSAGWLAELQKEVHTPETDEYGISSFVYRSRRPFHPARFEKWL
FT                   EDWPEEIVRAKGFFWLATRNDVAMTLSQAGPSIEIGTAGYWTAALSAEEQQAILVEEPD
FT                   WQQTWHPVHGDRTTELVFIGIDLSQEQIVKHLDACLLTDEEYEADWSNLPDPLPTADAV
FT                   IETTL"
FT   CDS_pept        423858..424007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04130"
FT                   /product="probable 50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41390"
FT                   /db_xref="GOA:C0ZJT9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJT9"
FT                   /protein_id="BAH41390.1"
FT                   /translation="MRVNITLQCTETGDRNYITSKNKRNHPERLELKKYSPRLKRYTLH
FT                   RETK"
FT   CDS_pept        complement(424009..425166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="BBR47_04140"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41391"
FT                   /db_xref="GOA:C0ZJU0"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU0"
FT                   /protein_id="BAH41391.1"
FT                   /translation="MKIVIAPDSFKGSLTAKQVGEAIRSGIQRALPQSELIVKPMADGG
FT                   EGTIQCLVDATDGRILTATVKNPLGEDISAEFGILGDGVTCVIEMAAASGLYLISAADR
FT                   DPFVTTTYGFGQLITAGLDQGCRKFILGLGGSATNDGGAGMLQALGYVLLDQNDQPLSF
FT                   GGGELSRLSRIDTSQVDKRLTDCHFVIACDVTNPFVGPNGASHVFGPQKGATPEMVLQL
FT                   DDYLRHFADLIEKTRGIAIHDLPGTGAAGGVAGALLAFLNGQLRSGIEIVIETTGLAEA
FT                   MDKANLVITGEGQVDFQTAQGKTPCGVAQVAQRYGIPVIVLAGSIGNGIDTLYEKGVSA
FT                   VVSITNKPMTLDQSMLEAASLLEQTAEQVMRIATIPLQHSVNRIF"
FT   CDS_pept        complement(425256..426419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerN"
FT                   /locus_tag="BBR47_04150"
FT                   /product="Na(+)/H(+)-K(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41392"
FT                   /db_xref="GOA:C0ZJU1"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU1"
FT                   /protein_id="BAH41392.1"
FT                   /translation="MLIFQLAVILIASKIAGDISVRLGQPSVLGKLLIGIVLGPTVLGL
FT                   VTDTEILKEISQIGVILLMFIAGLETDIDEFKRTAKSSTSVGIAGIVMPLALGYGAGIA
FT                   IGLSNIEAIFLGLLLSATSVSISVQTLKELGKLKSREGATIMGAAVIDDVLVILALAFL
FT                   MSFAGGDVNLGMVVLKKVAFFAIVIALSWKVVPWVLKKFAPLQVTESVISAALIICFLF
FT                   AYFAEYTGVAAIIGSYIAGVAISLTNYKTEVTHKVETISYAVFVPVFFTSIGVTAQFSG
FT                   ILENLGLIVLLSVIAIVSKLIGGAFGAKITGFPWKNSMAIGAAMVSRGEVALIIAAIGL
FT                   ENNLLTQDMFAVLIVVVLLTTIVTPPMMKWFFSKTTQPEEMALKKNA"
FT   CDS_pept        426650..426994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41393"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU2"
FT                   /protein_id="BAH41393.1"
FT                   /translation="MAKISKENAEHYHWGDQCDGWHLVKGQELSVIHERMPGNTAEVRH
FT                   YHERSRQFFFVLSGQAMLEVDGVRNVINRQEGVEVPPGVKHQMKNEGAEDVEFLVISQP
FT                   TTRGDRIQEN"
FT   CDS_pept        complement(427045..427179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41394"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU3"
FT                   /protein_id="BAH41394.1"
FT                   /translation="MIAKYIGEALLFIVGLPIFAYQTFEGIHALADFFAQVSDFTNFK"
FT   CDS_pept        complement(427206..427496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41395"
FT                   /db_xref="GOA:C0ZJU4"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU4"
FT                   /protein_id="BAH41395.1"
FT                   /translation="MEDMLLLLFSLEDFFALVAIFVGCFTSAFCLRQCCLQNRALPQNV
FT                   TDMYRPPINTLLVETYPMAARQPQRLRLFRRMQHTDSEMDTYGSFVLDRVA"
FT   CDS_pept        complement(427595..428008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04190"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41396"
FT                   /db_xref="GOA:C0ZJU5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU5"
FT                   /protein_id="BAH41396.1"
FT                   /translation="MLDQIDLSILALLRKNSRLQWKDIGEQVHLSGQAVGNRIRRMEQQ
FT                   GIIQGYTTLIDEAKIAPFLTALVTMFMTTTDHSLFTRFIKSRSEIVQAHRISGEGCYSM
FT                   VVHVQDQEALNHFLDALLPFGNYRVNLSINKLK"
FT   CDS_pept        428127..428885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41397"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU6"
FT                   /protein_id="BAH41397.1"
FT                   /translation="MQIQLVRHATLRVEYAGQTFLVDPMFSSKGELPAVPNTPNQRPNP
FT                   GVELPISVEEVLAGVDAVLVTHTHFDHLDEAAIRLLPKHLPVFCQPPDREKLVQHGLEQ
FT                   VIAIEEAYTWQGIHLHRTGGQHGTGEIGQQMGQVSGFVLQRAGEQTLYVAGDTIWCEEV
FT                   EQAIAEYRPDTIVVFAGAARFLTGDPITMTKEDIVHVANAVPDSRILVAHMETWNHCLL
FT                   SRRELNECLQEKQLSGRVHVPQDGEIISFQ"
FT   CDS_pept        429036..429629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41398"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU7"
FT                   /protein_id="BAH41398.1"
FT                   /translation="MAHEQLETYVVEKPEQAMALLNPLRAEILSRLAEPASAAEVARGI
FT                   NEIPQRVNYHLKALEKVGLVRRVGSRQVRNLVEVLYLAIARTYVLSEGLNWGNDTVQQM
FT                   KDQGSLSHLVQTAERIKRDAMLLLERSDQEVEVPSASLNASIQLASAEQRSAFVEEYVQ
FT                   LVNQLVAKYQPKEKGQETYQVVLAVYPKQGGDEA"
FT   CDS_pept        429626..429883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41399"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU8"
FT                   /protein_id="BAH41399.1"
FT                   /translation="MKAHVVESNKSKPVIVWENRIQPQSDQVIAMPSRNGNGVVVEREA
FT                   AVQTWSVGPASNPAVVTQVSSGFNKKSMAVPQATSMRMAA"
FT   CDS_pept        429919..430500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="BBR47_04230"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41400"
FT                   /db_xref="GOA:C0ZJU9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJU9"
FT                   /protein_id="BAH41400.1"
FT                   /translation="MNLIPVVVEQTSYGERSYDIYSRLLKDRIIFLGSAIDDQVANAVV
FT                   AQLLFLAAEDPKKDIHLYINSPGGSVTAGMAIIDTMKFVAPDVSTICTGMAASMGAMLL
FT                   VAGAPGKRYALPNAEVMLHQPWGGSQGQASDIKIAADRIMRHRHMLYTIISERTGKTVE
FT                   QIEKDADRDYFLTAAEALEYGLIDKVIEKL"
FT   CDS_pept        complement(430615..431250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41401"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV0"
FT                   /protein_id="BAH41401.1"
FT                   /translation="MKKILIMLSLMLVLVTSGCNKDAADISEDEIRMLAYTYSENVFNN
FT                   YRYVGSISDFLGNANGKEITLESLQMYVNGYKQGNSRMKIYESVENIISLYLAKHYNEQ
FT                   TIAKLFDANRKLTQLTRQLNDLLTEEHIAAKLTANEIIELRERIDDLLIYVYPEQEQDE
FT                   TGINLYTLITKPEKLLEKYTVTDIDIFFMNVNNAMEQLNNFLEQVGKT"
FT   CDS_pept        431457..433142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04250"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41402"
FT                   /db_xref="GOA:C0ZJV1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV1"
FT                   /protein_id="BAH41402.1"
FT                   /translation="MKIRTKIILAFGVILAVMFGSGTYMHLQMLAMKASYTQIIEEEKL
FT                   LTDLREMQFIMTGRNNDERAYLLTGDEEFRKELKGKAAKVDSLFAKMNSTLESSHHREK
FT                   MEEAMGLYKSFLESSDKAVEAQDNGLHKEAIAHHFGQERQSRITLDSVVSGLVEEVRNE
FT                   IEVDRQELEENEGISAMIQLFFNAVGILVAIVVGGFLIRSIVAPLHRVNKQLHEIADGK
FT                   GDLTQELTVFSKDEIGQLAGSFNRMLANLRELISQVRGHAQQVAAAAEQLTASSKQTSQ
FT                   ATEQIAITIQEMTEGTDRQSQNVEESQQEVEEISAGIEKIAERAQSVSAAAASTSELAT
FT                   EGDRTIQQSVSQMNGIGETMENLTALVGGLGKRSEQIGQIVEVITQISGQTNLLALNAA
FT                   IEAARAGEHGRGFAVVADEVRKLAEQASASAQEISQLVASIQMETTNAVLTMEKGSQEV
FT                   ADGMGGVARAGEAFSQIRDAVVGVTNEIQEVSIAAHTLTESTGKVGQSMQMIATVAQSA
FT                   VSHSVEVSSATEEQLASMEEIYASAASLASLADDLEKLIGHFKV"
FT   CDS_pept        433490..433852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41403"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV2"
FT                   /protein_id="BAH41403.1"
FT                   /translation="MKRFRFDQQVGKIIDRYNSVQATISRVMRTPDSVSIGCIHLEAGG
FT                   IVGYHPATCPQLFLVVNGEGWVRGEGTERIPIQSGQAAFWITGEGHESGSETGMTAIVI
FT                   EGDGLDPESFMSLLET"
FT   CDS_pept        433942..434376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41404"
FT                   /db_xref="GOA:C0ZJV3"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="InterPro:IPR016956"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV3"
FT                   /protein_id="BAH41404.1"
FT                   /translation="MTWKTHMVLGAIAGYCAYPSWKGSVIGATMALVPDIDQANSKLGN
FT                   LMGPLSKMLQKGFGHRTVTHSWVILFLPFLLFGDSLAAMAALWGILSHLVSDMLVGRIQ
FT                   LLWPLRVGWLGIPVSKSMYRTVDRIVFYVAIVYIVIKGYQ"
FT   CDS_pept        complement(434542..436191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41405"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV4"
FT                   /protein_id="BAH41405.1"
FT                   /translation="METATNVNPPRKSKKKAWLIAGAAAVVVLGGLGTAYAKYDLFKSA
FT                   KTIYLQAEAESMMKFSSDVSKAYGEYQDYMKPYLEKPVHSTTELSDIALDATIPDPQAQ
FT                   KILDMLGKAKIVMQSNIDEQKNQQSGNLEVHLQDKKLASLEYFMNDSVMGFKLPEFYSK
FT                   YAYMDLKDRDALKQKLGGEELPKRFVRYSDLNEAINFNQDELKTVMTPYALLYADSIKD
FT                   SQVSIKKDVSFSEEGLKEDAREITVTFNAQEGAALTKQIAEKAKADQKLFDLIYSRYHN
FT                   VATLMLDSGYKVEEISKEEFKKDYEQAFDDIIKDTEDTNAKSTEQLKMVVLVNSDHQIL
FT                   SRKLLVDDKGKKDQLVYNSVSYDKGAETYYRYSLHNLSDQQNGEMSFTYRATKEKDKTK
FT                   GKFSILMKETDQPILDLSTTFDTTKQDKKTTGKYDFALVAADEYSSNPVALTGNVTVNE
FT                   TKTDNGVDSDGTVKVNFSNPTPDMPKGFSFKLKSKAEFGKALEIPAMTADNSINFVTVS
FT                   DQQMMEAQQEVMQNADKFMNEHAELVQQFMGP"
FT   CDS_pept        436406..437320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04290"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41406"
FT                   /db_xref="GOA:C0ZJV5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV5"
FT                   /protein_id="BAH41406.1"
FT                   /translation="MDFRVLQTFMVAATTENFHQTAEALFIAQPTVSQHIRQLEKELGI
FT                   KLFERVGKRVRLTAAGKRYLPHAKGLLQQWHSSMEDLQAWRQGYREKLQLAVSPIIARA
FT                   RFSHLLHRYTKLCPDVDISIKIVDSVEIGPLVQNGQADLGLTRMVPGEFQLSTYLLYED
FT                   PIVFAVPHSGGDMEAPLPDWEQEVQANRLLTHNHPGYWDELLLLLRQRGLSLRTMAVSQ
FT                   VDITKRFIEDGLGVSFLPRTAVDRDLFENRFIELPTPGLVLPKVASYLLVPKAGISEPA
FT                   QHFMEILHSLYPPMPLVQPGGRT"
FT   CDS_pept        437427..438506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04300"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41407"
FT                   /db_xref="GOA:C0ZJV6"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV6"
FT                   /protein_id="BAH41407.1"
FT                   /translation="MQAEPITQKDRIYSIDIVRGLALFGILLVNLPSFIMYSEDVRMPI
FT                   EAGIDAWIRLSYDLFIQTKFFGIFSFLFGLGFYIFMSRAEQRGQKVFRLFSRRLFAMFF
FT                   IGVIHVILWFGDILTVYALLGFLLMPFYRRKSSTILAWAASLGGVYMLTQGVALVQTLN
FT                   GQEVYPFVASLQTTLIPIFVMFLFGLYAGKRGFIAQIREHKPLLKRIATTTLAISLPIA
FT                   AGIVCASGVVFGSKLEQVNKILVDLSTLPMALCLIASLFLLLDRESARKVLQPFAYTGQ
FT                   MGLTTYLGQTVIMTILIPLFGITAMPLSSWLLLALPIYAFQLLASWLWLKRFNRGPMEK
FT                   LWRFLTYGRKKKAVPAPAN"
FT   CDS_pept        438606..439709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="BBR47_04310"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41408"
FT                   /db_xref="GOA:C0ZJV7"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV7"
FT                   /protein_id="BAH41408.1"
FT                   /translation="MTKQHPLAIGLDGIAVAETDLSLVDGINGLLVYRGHWARDLAIHH
FT                   TFEEVAHLLWFGHLPSEQELTDLKDKLKANRELPEHVKGILKLIPADVDMMSVLRTGVS
FT                   ALGSSSHGFPPTIDEVIALAAKMPTIVAYRFACLEGLEPLAPNPELDHTANYLYMLKGV
FT                   KPNAAHVRALDAYLILTQEHGMNASTFSGRVVSSTESDLISSITAAIGTLKGPLHGGAP
FT                   SEVTEMIEAIGTKENAEPWLRNKLESGGRLMGFGHRVYKTIDPRATALRVVASELSSND
FT                   PWFDLATHVEKVGLQLLEEYKPGRKLNTNVEFFAAAVMRAVGLDDNLFTPTFAVSRVVG
FT                   WSAHILEQAGNNRIIRPQSNYIGTMPE"
FT   CDS_pept        440361..441389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjM"
FT                   /locus_tag="BBR47_04320"
FT                   /product="NADPH dehydrogenase"
FT                   /EC_number="1.6.99.1"
FT                   /note="protein synonym:xenobiotic reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41409"
FT                   /db_xref="GOA:C0ZJV8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV8"
FT                   /protein_id="BAH41409.1"
FT                   /translation="MALLSTPFQFKGLSLKNRIVMPPMCQYSVDAHDGTPTDWHFVHYV
FT                   SRAVGGTGLIIVEMTDVEPDGRISNGDLGLWSDEQIPAYARIVSEVHKYGAKIGIQIAH
FT                   AGRKAEDAEVPVSSSAIAFPGGRYKTPRALTTEEVKQMVVKFQDSARRAVEAGFDTIEI
FT                   HGAHGYLVHQFHSPLTNQRDDEYGRDKALFGVEIIQAIKEVIPADMPLIMRVSAVEYVD
FT                   GGYGLDYSTELCRRYKEAGVDIFHISSGGEGPIGSAGRPGVHPGYQVPLARAIKQALDV
FT                   PVIAVGNLDDPQVAEASIGNGDTDLVAVGRGMLRDPYWALHAIHELSADELQPPKQYSR
FT                   AF"
FT   CDS_pept        441523..442125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04330"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41410"
FT                   /db_xref="GOA:C0ZJV9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJV9"
FT                   /protein_id="BAH41410.1"
FT                   /translation="MRIAMSSSKSLTSSEKLMIAAIDLIAERGYNGVTTQEIATMAGLS
FT                   EKTLFRHFGSKRNLLESAFDRFHYTEGLTKLFAEKLTWNLREDLLLISRTYHEMMNRNR
FT                   KMILISIKDEAHLPGFRERTQKHPQQLMVLFTDYFKEMGKKGKMIQTNPEAQATAFMVM
FT                   NFGAFLNDLDGTSNFSGVSLDAFIEESVEVFARGLTP"
FT   CDS_pept        442200..443579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04340"
FT                   /product="probable tetracycline resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41411"
FT                   /db_xref="GOA:C0ZJW0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW0"
FT                   /protein_id="BAH41411.1"
FT                   /translation="MEATKTQQNRDILIRILMFTLVISSMSALVFNIALPQISKEFGLS
FT                   IAQVSWLSTAYGLLYAIGTVTYGKLADRYKLKNLLTFGLLVFTAGSFFGLVSDSFAMAL
FT                   FGRCLQAVGAAVIPATAMLIPLRYFPPESRGSVLGRTAVGLALGGALGPVVAALIVSFA
FT                   HWRWLFSIPLLILLTLPFYRKYLEDEEIASGGKFDWVGGSLLAISVTSLLLGVTNGSWW
FT                   FALGSLVTLLLFVLRIRSVADPFVQPKVFANKPYTIGILMAFLINGMGISLYYLSPLLL
FT                   AQVQQLSTSWIGFVMVPAAIASALLGRVGGKLADRRGNVFLYFVASSLLIGCFGLLSTF
FT                   TSASVIGIALFLILGNVGQSFMQISMANSISRTLTKEQAGVGMGIFSMLSFISMGIASA
FT                   VYSKVIDLGATTIWNPLNPYTSGLIYSNIYWMMTLMHVCLMVFYYFQFGKAKRQSLLAD
FT                   S"
FT   CDS_pept        443651..445036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04350"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41412"
FT                   /db_xref="GOA:C0ZJW1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW1"
FT                   /protein_id="BAH41412.1"
FT                   /translation="MRELSAIRFTEGEPLFIQIYHFIKDEILRNQITYEEFLPSIRSCA
FT                   QSLAVSKNTVEVAYQLLVSEGYVTSIPKKGYQVTYKAGLPSRRHVTEREDSSIPQIRYD
FT                   FRYGNIELGTFPFHPWNKLRNKLISYHQRTYMVEGLAQGEYILRKELSKLLHETRGVLA
FT                   TPEQIIIGATPQQLVSIVVQLLDREKHVIGVENPGYDGARNTFLNGGYRVHGISLDADG
FT                   VSIEELRQSGASVMYVSPSQQFINKMRMPLEKRNQLTLWAQSLSHFYLVEDDYEWEFKY
FT                   QESYIPSIQSLSPQKVVYIGRLSKALLPLINVSYVVLPYELLSRFHQRVPEYDQPVSRL
FT                   DQLTLAAYLSDGYWHRHLQHMRKNYGEKREVFLQAVARYMDGRVEIEGKDTGLHVFLTV
FT                   KSQCTEAELMERAYQKGVKVYGTARYWLHDTREQPTVLLGYGALTPDDIQEGIRLLASA
FT                   WFE"
FT   CDS_pept        445139..445912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41413"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW2"
FT                   /protein_id="BAH41413.1"
FT                   /translation="MKFIFDLDGTICFKGQPISTNILDSLLALEQAGHTVGFASARPCR
FT                   DMLPVLDERFANHLLIGANGAMTHHRGSLQGSMPIPDRLAHEIISILDDYRAQYFIDDS
FT                   WNYAHNCVSAHPFLSYIDPNRTASRVDVDQLNAVLKILILSCDRYEELVARIRELDVTL
FT                   HYHSAEGILDLTYRGVNKWAALNRFDVAGEPFICFGNDMNDLPLFEKAHHSVLVGEYEP
FT                   LLALAKEKIAMDDYVEQSIIAKLRELGERYELALP"
FT   CDS_pept        445936..446628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41414"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW3"
FT                   /protein_id="BAH41414.1"
FT                   /translation="MNPLLEKRHQALREAETKAEFLFTTIEEKGIIRSGVTEKEINKEI
FT                   YELAFQLFGIKKYWHKRIVRAGKNTLYPYRESPPNLTVAPEDIVFLDFGPIFEDWEADL
FT                   GRTYVLGNDPVKQKLRDDIEKAWDEGKAYFLSKPDITSSELFAYMCELAKAYGWEYGGP
FT                   HAGHLIGEFPHEKIQGDDIVNYIHPDNHKPMREPDHNGHPRDWILEVHFVDREREIGGF
FT                   VEKLLTVE"
FT   CDS_pept        complement(446808..447389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41415"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW4"
FT                   /protein_id="BAH41415.1"
FT                   /translation="MKRLFFSVVCIGLLSGCGFATQGQEIHQQNTPIVDSEAPKKHPEV
FT                   SKIIIQRGKEIFVSGVSPICDGLLENSMDLYTVAYRRDGKLIGTKDEKELPFLQESQPY
FT                   LQGSLDEGESTQDHTYIRLVREPFIPEVGVNEFPRKDIVLFLEPTTPNAAFVGVQNPQK
FT                   LKEWKIYRVEDYGVWLKKQIDLELNLSKGL"
FT   CDS_pept        complement(447939..448754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41416"
FT                   /db_xref="GOA:C0ZJW5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW5"
FT                   /protein_id="BAH41416.1"
FT                   /translation="MKQLGSLLLAEIIKEHRHSFHSKMIYFSLLVWPVINFVTAYYSFA
FT                   PFQMGADSPLARFISYEQLPLFLLTGYLGYIFYWCLVQSSWQMSFERQAGTMEMIFISP
FT                   VNRLAFLYGRSLSSLIEGVWLFFCFVLLALFFVDGIQLSGWWAPPLAFLILLVSAIVWG
FT                   GFLCVLFLFSRDASFLYTVLDEPMLIFSGVRLPPMAFPVWAKVISFCFPLTYALQLIRE
FT                   LLMEGATLQAMLPSMGLLAAVLLVLVTATVVLLKLAEKHMKKTGNMVMY"
FT   CDS_pept        complement(448751..449737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04400"
FT                   /product="probable ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41417"
FT                   /db_xref="GOA:C0ZJW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW6"
FT                   /protein_id="BAH41417.1"
FT                   /translation="MLIAENLRKVYRVKEKKGWFRQQWTEVEAVADLSFRMVPGKIIGL
FT                   LGINGAGKTTTIKMCSTLLTPTSGTITVDGYDAVKDDRFVKAKVNMIAGGERMLYWRLT
FT                   GRENLQYFGSLYGLQGHELRNRIDSLLLQVGLYEAANTPVERYSKGMKQRLQIARGLIN
FT                   DPRYLFLDEPTLGLDAPIARQLRKHVSELASQHGKAILLTSHYIHEVEELCDEVYIIDK
FT                   GRLVAHDTPEHLIKSLHLDTALQVVIPSLSDSLDYDLRQLAQDYDGSREIAETDEQTWE
FT                   VTLRGKTDMTTPLLSLLAAHQSPVLHLSTQQPSLEDVILHMADRRGA"
FT   CDS_pept        complement(449759..450646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04410"
FT                   /product="probable ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41418"
FT                   /db_xref="GOA:C0ZJW7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW7"
FT                   /protein_id="BAH41418.1"
FT                   /translation="MSSSICLFPDLSLHLLHHIPQNGGNNVFHVAKATFIRNTRVMIRA
FT                   YPWSFVIGHIFSGVYTVLFAFFAYHYVFAGQLDENFAHLAGSSDYLSYAILGGAFYAFA
FT                   VSTLMNVSRSLITELREGTLEAVLLTPSLRRGYFLGNVAQQLMRTLFEFSVIVLVGALF
FT                   GLTLSQTNVWSAVLVWILSTGAFFCQALVLGSLMLWFRDTYITQNTLFAVMAFVSGVTF
FT                   PIPYLPEWVQPLGLIMPLAPALDAFRQCVIQGAPLHAVSPQLFHMTALSLVYLVMGVWG
FT                   IRRMEKRVMESIFG"
FT   CDS_pept        complement(450570..451667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04420"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41419"
FT                   /db_xref="GOA:C0ZJW8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW8"
FT                   /protein_id="BAH41419.1"
FT                   /translation="MQDLPDWLRKHLHVAYIPGYEFFLSLHVLAKPEHHTSRLHWAEEL
FT                   LTALPAPLLKKLHYFSSMSNQFLDAMDFLAPWEECFEHSVEAALERVQAMDAGEFAQLM
FT                   IGPVYHPRQLHTWMQGRTDEIFEELKPEHREFLRHPLSTKRSFLEFCYDYLPFFQKEER
FT                   RIEPWLVRAVHEAQEQIKLDPIPFLSQVHPRLKVHENFLQFHKAKTYTFGYSELARVHL
FT                   RVSTFVAPHLLLGIYDDHISVCLSVDVPGTRATSVIPADFISKMKVFSDPTRTAILKSL
FT                   LAHPYCTQQLADLHNISEPAVNKHLNLLVDTGFIWSERRGRYVFYRAIASRLEQLAVDL
FT                   HEFIDMPVPGLVSPPASSHPPERRK"
FT   CDS_pept        complement(451820..453148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04430"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41420"
FT                   /db_xref="GOA:C0ZJW9"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJW9"
FT                   /protein_id="BAH41420.1"
FT                   /translation="MTLSLIGRWTLAFWLEAMLTGVFLVLFGYMTAGFGQLLTFCLVAA
FT                   TLLMAGGWLYYGGGGRFMLHLLLYPLVFFIGMGSFYLYDSWFIALVLAAVYFWRVQSAA
FT                   SKGYRHDSLQRRFVLALMAGLMQLVIAVLYTSIADPGSYTLAASFSMLVFITLSYMLVA
FT                   IVAFVLREGSLPTRLPARISLLLGSQVLGTRFLLIAGYLAVSSIILGLIYWIWSWIKGP
FT                   VSDGLYTLFEPVLIFIVELFEQLYEKANQKQAGMKVLMESTGQKADHPVVQIQLGESLF
FT                   SILQPYLIIAFILVCVILLGRYIWKRRFKGTITLEKEVAAAQNTILTTVPPSSREESAE
FT                   NGSAKWFKQPVGPEDDPTRYAYYQFLVLMEKQGVPIELHETPQEFFNRLREHPLLDAGQ
FT                   LDAVARITRYYQQYRYQEKALPEADLTAMQQAVQTLGARFSET"
FT   CDS_pept        complement(453145..454335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41421"
FT                   /db_xref="GOA:C0ZJX0"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX0"
FT                   /protein_id="BAH41421.1"
FT                   /translation="MITKQTFHVIGFVLLLFAVFSGHWFFFLFGGFFFFLPAAQDWWAK
FT                   SMSKWVSLEWSSDQTRVLSGTPVHITVRLHNRSWLPLPATWLRFTLPEHVSVEGADEVR
FT                   ILNHRTSVRLRFDLPMRQSATRTLTLIPNKRGTVWLTDVQSETLPLLGEEPTAMTLSVS
FT                   FSLLVYPLPLALSPVVLAESEPDGNRLSRQRQQDDVTFQRGIRSYMPGDRFKHIHWKAT
FT                   AKTGSLETRLFEFTAHPNWRIVGHILPSYEPMMQKYNDITNERTISCLAALAGLCRRKS
FT                   VGYELYLTVKQRGREHFHLPAGSGKTHHLHVMTQLAQIHHFVTTPLAPVLRRLEGAHGK
FT                   EAILIVTPRMDPSVQASAERLIQCGHQVAVLDVSSDPVIIQRFQHARLKKRSVMMG"
FT   CDS_pept        complement(454340..455278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41422"
FT                   /db_xref="GOA:C0ZJX1"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX1"
FT                   /protein_id="BAH41422.1"
FT                   /translation="MIHPTLDNLQHAISSVIVGKESQIRLLVTALLARGHVLLEDLPGM
FT                   GKTVLAKTLAQAIGGSYNRLQFTADLLPSDVVGLHVFNQRTSEFELRKGPVFADVLLAD
FT                   EINRATPRTQSGLLECMEERQVTIEGVTLPLPSTMLVIATQNPIESEGTYPLPEAQLDR
FT                   FLFKLSLGYGTREDAKEILRRFRSGSPLEAVEPVITVDQIAALQREVTTVHLSQPVEDY
FT                   IIDLTEATRQHRSVEVGISPRAMLALLRSAQAYAFVSGRTYVLPDDVKVVFPSLTAHRI
FT                   RLSMEAELHVTEQEVVEQILTSVPAPVEESV"
FT   CDS_pept        complement(455327..456553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04460"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41423"
FT                   /db_xref="GOA:C0ZJX2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX2"
FT                   /protein_id="BAH41423.1"
FT                   /translation="MSQTAVQASVWQQRSYRWIVFGQLISELGASLGTLANSWLIYQAT
FT                   GSQGAVGQMWLLYFVPSLAIQLVAGPYIDRFDKKRVMLFSQWMRAAAFCLSFAVITSGT
FT                   ESLWPLYFTALINGLVQPLYVPASQSLLPALVKREQLLQANAYLDSVLRIALITGPPLA
FT                   GILVASIGGESVLALVAISYALSGFFLVLCPLAPADTANKKQSWYVMFKAGLAVFWEKP
FT                   LLLWLGLYSALVQFAVGVTLVLNLPFVAGELQGTSFYVGLFLAGYPLGYFFGSLLVPRF
FT                   RSSLGQPLIMLGSLVLGGLSFVAIGFTHDIWLAITIELLAGLFAPFFQVHSTSLYQLHV
FT                   PSELMGRVLSVRLLIVRATMPVGIWLGGQLSDQVGIRPLYISVGAVIVLAALTGLLFRK
FT                   FVTNRIFHI"
FT   CDS_pept        complement(456550..457599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04470"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41424"
FT                   /db_xref="GOA:C0ZJX3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX3"
FT                   /protein_id="BAH41424.1"
FT                   /translation="MKILNIGSERTTYRVELSYSPLFEAALGIAAATYDQLHHTMEHPP
FT                   TYWRQLLDELSPSVRQEVNYAKEHNTWKTLLQLLDLCPFADLDSFLSYVRELSIEQLRY
FT                   EALPYLGENRQEARRKAAQGSKDDCAALQEACSAHLFFESYIEHITSVDGEVLRSHILG
FT                   LMEGWYTTHIKPHEEKIVRMLERDWSQKQSKLGKLNPEAFVEYATGSSYLPEPAVTRVL
FT                   LIPQAIYRPWTVQADAVGTKIFYYPVADENLHDAVDPYQPPPSLVQALKALGDEHRLRM
FT                   VKMLAEKDLSLQEITDQLSMAKSTVHHHLSMLRSAHLVEIAGSRYRLRRHTLDKLPLLW
FT                   DEFLDRSTP"
FT   CDS_pept        complement(457754..459058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metY"
FT                   /locus_tag="BBR47_04480"
FT                   /product="probable O-acetylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41425"
FT                   /db_xref="GOA:C0ZJX4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX4"
FT                   /protein_id="BAH41425.1"
FT                   /translation="MSDQQQWKPETLAVHGGQEVDPVTGSRAVPIYQTTSYVFRDTEHA
FT                   ANLFGLKEFGNIYTRIMNPTQDVFEKRVALLEGGVGALATASGQAAITFAILNIAHAGD
FT                   EIVASSSLYGGTYNLFAHTLPRLGIKVHFADQSNPENFRAYINEKTKAVFCETIGNPRI
FT                   DVADIEAIARIAHENGVPLIVDNTFATPILCRPFEHGADIVVHSTTKFIGGHGTAIGGI
FT                   IVDSGKFDWNNGKFPGLTKPDPSYHGVVYTEAVGPLAYIIKARVQLQRDIGAAVAPINS
FT                   FLFLQGLETLHLRIERHSQNALAVAQFLANHSAVEWVSYPGLESDSQRELAQKYLPKGA
FT                   GAILTFGIRGGVEAGKTLIESVKLFSHLANVGDSKSLIIHPASTTHQQMTEEEQAAAGV
FT                   TPGLIRLSVGTEAIDDILSDLEQALQRALQLSTVG"
FT   CDS_pept        459568..459879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41426"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX5"
FT                   /protein_id="BAH41426.1"
FT                   /translation="MSHGVKEMTPQELLEKLEAKEELQVIDVREVDEWNAGHIKEAKLI
FT                   PLGFLPHRIDELDKNIPIVMVCRSGARSNTATEYLSAQGYDVANMVGGMLAWPGEVEQ"
FT   CDS_pept        459933..460586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41427"
FT                   /db_xref="GOA:C0ZJX6"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX6"
FT                   /protein_id="BAH41427.1"
FT                   /translation="MGQAGRKQPMSEGAQLQQESAMKKHWFPVLAGIIILAIVGVFGYN
FT                   YMTKEKIEVLKPIADFTLDNSDGTTYTFHSSAGKVRLVEFMFTKCPDICPATTFNMAKL
FT                   QDQLKEKGLFGDKVEFVSISFDPDNDTPEVLQDYAAKFKADQSGWKFLRGDAQAVEKVT
FT                   KDFGLMVIKQPDGSYAHTARMFLVDGDGNMRRAYGMAANMELEVMMKEMVQLAD"
FT   CDS_pept        complement(460583..460921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41428"
FT                   /db_xref="InterPro:IPR024987"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX7"
FT                   /protein_id="BAH41428.1"
FT                   /translation="MQTARRLFRYRNMMPLLSTVLFLLIFQPFPTYAEPPYAKWGRLAM
FT                   QETMKRYPNAQIVDYLHVGRKQKTPTTSEETFKLLLQESNRRWALLVHIEFVNQTEEVV
FT                   NISYEETR"
FT   CDS_pept        461024..461794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04520"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41429"
FT                   /db_xref="GOA:C0ZJX8"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX8"
FT                   /protein_id="BAH41429.1"
FT                   /translation="MHYLLIPLFGVPVLVGVLTAIFQKPPFWKKWGLTIASAVLIYGGC
FT                   FAANVYWQVKYGIPVLPTESDLEVFFYFCILLVFVCILLYIGFLITMRKQFWKMNLVFL
FT                   CTAFGLFSFFAAAFLGMGPFLKKAEYVIVVQKAKDQWKEAKMDNEKPIDLALVYSRQEC
FT                   TKNCVGYPYSSLILVRNQSDQRVEIDLKLRLKNKSGNVLKEVEAIPLKLASGEITEVWT
FT                   GDSYAKHDFWARASAVTDERVADLEYQYSIIDRR"
FT   CDS_pept        461893..463563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykqC"
FT                   /locus_tag="BBR47_04530"
FT                   /product="ribonuclease J 1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41430"
FT                   /db_xref="GOA:C0ZJX9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJX9"
FT                   /protein_id="BAH41430.1"
FT                   /translation="MLGGKRLSDVKIFAMGGLGEIGKNMYCVEYEDEIIIIDCGVKFPE
FT                   NEMFGIDLVIPDISYLKDNQHKIKALLLTHGHEDHIGAIPYILRQIKVPIYGGRLTLGL
FT                   VKAKLEEHRLQNEVKLIPISEDTEIPFAKLKATFFRTNHSIPDSLGVVLYTPEGMVIHT
FT                   GDFKFDMTPVGQTTEYGKIARIGASGDVLALLSDSTNSERPGFTMSERTVGEGILDVVR
FT                   KARGRIILATFASNVHRLQQVVDAAEQCNRKVAVIGRSMEKVFLIGQELGYIQMPEGML
FT                   IDIKHIDNYADNQVLIICTGSQGEPMAALTRIASGSHRTVSIYPEDTVIISASPIPGNT
FT                   INVSRTIDKLYRAGANVVLSHAFDIHASGHGSSEELKLMLNFIRPKYFIPIHGEYRMLK
FT                   THSKLAQQVGIEESNIFIMDNGEVLNCNREKAWLSKVQAGIVLIDGSGVGDVGNIVLRD
FT                   RKHLAEDGLMVVVVSLDMKNFKILTGPDIVSRGFVYVRGSESLIQEATQLVRGRLQEAL
FT                   DKKIKEWSELKSQINEVIKPFIYEKTGRNPMILTILMEV"
FT   CDS_pept        463643..464071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41431"
FT                   /db_xref="InterPro:IPR009474"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY0"
FT                   /protein_id="BAH41431.1"
FT                   /translation="MMSYEAYMSQVIQPMRDELTRNGFQELRTAEEVEQALPNAKGLTL
FT                   VVVNSVCGCAAGLARPAVVHSLNHATKPDNIFTVFAGQDKEATAKAREYFEGYAPSSPS
FT                   FAIMKDGKIMTMIERHQIENNELATIAGLLTNAYDTYK"
FT   CDS_pept        464714..465421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04550"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41432"
FT                   /db_xref="GOA:C0ZJY1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY1"
FT                   /protein_id="BAH41432.1"
FT                   /translation="MNKLVVITGVTRGLGREMVERFHEAGWTVAGCGRSEKEVQGLREQ
FT                   FGEQHHFSVVDVSVMEQVEKWAEEVRAEVGVPDLLINNASIINRNSPVIGLEANEFSRV
FT                   MDINVNGVFYVIRAFLPFMVQRANGGVVVNISSYWGRYGEAFLSPYCASKFAIEGLTQS
FT                   LAAELPEGMAAVTLDPGGSIDTAMLRSCSPEDVDSAPNPVEWSRVAVPYIIGLGPQDNG
FT                   KSLTCPPVRKRTN"
FT   CDS_pept        complement(465533..466762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04560"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41433"
FT                   /db_xref="GOA:C0ZJY2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY2"
FT                   /protein_id="BAH41433.1"
FT                   /translation="MISPSVFLNRYPREAIFFLIASFINSSGSAFMWPLTTLYVHTILQ
FT                   RSMTEAGFVLMIQSLAGIFGQFIGGSLFHRLGAKRLIVGALIFQGLIQFSIPFVQSWPA
FT                   YLILMMGLGFTFNLSFPAIQAFIGFRWKEQRRELFNIVYVGNNLGMAIGTALAGVIATL
FT                   SFQLTFWFNSTSTLLFALFFFLFMKNISHQELVGENLEEQQKHHVKNSFTLLFRYQLYL
FT                   FMALGAALIFFSNTVWNTGVAPYITEQGMPLSSYSWLWTINGIIIFAGQPITSWIKRLL
FT                   NQSLSAQLVVSAIAYAVGFGCMLVYHGSYYAFVVGMVITTFGEMLISPTIPTFISEKTG
FT                   ENAPFYLGVVGAITTGGRLLGPLAMGFMYDHGGIHPTLFLATLVSAGSVLLCLLHAYFH
FT                   RENRAEVAKY"
FT   CDS_pept        466949..467935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04570"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41434"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY3"
FT                   /protein_id="BAH41434.1"
FT                   /translation="MKIWKRVLLLLLVVIATTAGYYGYSFYQFAQNIQEPNIAPPSGGN
FT                   STKAAEIPEWDGKERVNILLMGVDRRGMKNNGLPRSDSMMLVSIDPTGKRYDMFSILRD
FT                   TYVDIPGRGSSRINSAIVEGGPELAMETVSQFTGLQVDRYVITDFEGFKALIDAVGGVQ
FT                   IDVEKNMYYHDPTDKGVYDINLKKGLQKLNGDKALQYVRFRHDATSDYTRTERQRKLMT
FT                   AVVDQMKNGTTLMQLPTILKEVTPYVQTNISSVDMLKLSALGLKLNTLEPGNYQLPPMG
FT                   MFRESHRAGSVLVPDVDQVQSFIQEKIAPPTEASDQPVGEKKSSTQN"
FT   CDS_pept        468006..469457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04580"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41435"
FT                   /db_xref="GOA:C0ZJY4"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY4"
FT                   /protein_id="BAH41435.1"
FT                   /translation="MDRESARNWFTHTSDLVTEHIDEPEGRVRLFYLSTMADAKVVYSE
FT                   LIPKLREICLEESEIAVIAQHLGVSSSNRVFDDGEAIERLLSGHIVIQVEESSYGLAFP
FT                   SDGTVGRNIQAPEIETVVLGPQIAFVEELNVNICIIRKYMSTPRLFHERLSVGKTIPMN
FT                   VSMLYLSGTADEENVNTVRQRINDLELDTSLDSTILAQHIADNEKSLFPTLQQTERPDR
FT                   AIHGLRQGQIAILVEGSPFALLGPTTLLQFFQSPDDYYLRWSLATFNRLMRTFAMILSL
FT                   ILTPIYVAALTYHYEMVPADLLLSLAQSRSRVPFPPLWEALLMELIIELLREAGARLPT
FT                   KVGQTIGIVGGIVIGQAIVQAGFTSNILIIIVALGALSSFIAPSYMIGSTIRVVRFPMI
FT                   FLAGVLGALGIVVGFSFLASHLLRQTSLGRPYMYPIYPVRFSDWKDGFIRAPLSSLSER
FT                   LKFFNPKRISRFDRDRAKEKKDIDE"
FT   CDS_pept        469469..470593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04590"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41436"
FT                   /db_xref="GOA:C0ZJY5"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY5"
FT                   /protein_id="BAH41436.1"
FT                   /translation="MKINIDVSKDNTITAFLAGVLVHGTQIGMGILGFQRIIAKEAGHD
FT                   AWISVILAALFTHLTVMIINKTLQKYPSADIYGIQEDVFGKWLGTGISIIYLTYFFVSA
FT                   GVILRTYIEVVQTWMFPNLPTWVLSGIILFLAFYTVVGGIRVVAGYAFFSFMVTIWMIF
FT                   ELYFPLKFARWEYLFPVMDTSLENLFNGMIAMSLTSAGFEILYVVYPYLQNKERVHKSV
FT                   QLAVLVTYLIYLFVMIVALVFFSQGQLMRTIWATLNMQKMVYLPILERFELVVISLWLL
FT                   VILPNIMLYLWASARGLKRLFGFNLRHSLYWIIPVIYVASLSLLSRQQMSRMTTIYSHI
FT                   TLYIIYVYPYFLYLMVWLKKRKQRVKPTSKGESA"
FT   CDS_pept        470593..471726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04600"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41437"
FT                   /db_xref="GOA:C0ZJY6"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY6"
FT                   /protein_id="BAH41437.1"
FT                   /translation="MLPKRLLALWCSCILVLAGCSDRQIFDETGLATAVGYDLLKDGDV
FT                   RGTAIMPSINPEAKEKIQVFSAIGETSKGIRDRINLQSDKRVLGGQIRVALYNEKLAKR
FT                   GLGSIVDTLYRDSSISSRVYLCLFEGETYDMLTHPYSEEGNIGIYLYRMIEQNIEGEKI
FT                   PSSTMHEFFRSYYDKGIDPIMPFIARKGNELQIKGIALFRGERYVGWITPKEAFLIKLM
FT                   HGKFRIGSYDTSVPAHIFGEMPKNRGSKKDRVQLVFDTISSHSKIELTQVSPPIFDIHI
FT                   RLNARILELTLPLKLENARLMKIMEHALEEELGKELQKVVHKLQDLNVDPAGFGIVYRS
FT                   NRRGKANMTQAEWRKMFKEATFRFHIKSTIIRNGVMD"
FT   CDS_pept        472050..473063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="BBR47_04610"
FT                   /product="methionine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41438"
FT                   /db_xref="GOA:C0ZJY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY7"
FT                   /protein_id="BAH41438.1"
FT                   /translation="MIQLRHLHKSYQVQGKTIPALTGIDLSIEQGEIYGIIGHSGAGKS
FT                   TLIRCINLLERPTSGEVIVDGVDLTKLDEGKLQEKRRAIGMIFQHFNLLSSSTVGENVA
FT                   FPLKLAKRSKAEIDKKVNELLKLVGLEAHKDKYPSQLSGGQKQRVGIARALANDPKVLL
FT                   CDEATSALDPQTTNSILALLLDINRKLGLTIVLITHEMHVIRSICDRVGVIDGGKIVES
FT                   GNVLDVFLRPKHPTTQEFVEQVADSTELREAVEHEKASGNRTIARVTFLGEKTYQPILF
FT                   QTMQETGTVFSILQGTISRMKDTPYGQLVIELEGDVAQNQKTIETLRQRGLEVEVI"
FT   CDS_pept        473064..473729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metP"
FT                   /locus_tag="BBR47_04620"
FT                   /product="methionine ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41439"
FT                   /db_xref="GOA:C0ZJY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY8"
FT                   /protein_id="BAH41439.1"
FT                   /translation="MDWTFENVDWAEIGEGTMDTLTMLGFSTLFTVLIGLPLGIILFLT
FT                   SRGQLLQNRTFYTIASFVVNVLRSVPFIILMILLIPVTKMIVGTSLGVLGAIPPLVFGA
FT                   APFFARLVETSLREIDKGVIEAAQSMGASNWQIVWNVLLPESRSGLIAGITITTVTLVS
FT                   YTAMSGVIGGGGLGDLAIRYGYQRFQTDVMVVTVVILLVMVQILQSLGDRLVLKFSRK"
FT   CDS_pept        473790..474629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="BBR47_04630"
FT                   /product="methionine ABC transporter substrate binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41440"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJY9"
FT                   /protein_id="BAH41440.1"
FT                   /translation="MKKLVVSVLSTVLAFSLAACGGKTETAPAPAEGGAQGGKQEVTLK
FT                   VGASPVPHAAILKFIQPKLKEQGVNLVVQEFTDYVQPNVQVNEKQLDANFFQHKPYLED
FT                   FNKGQNMNLVPVVAVHIEPFGAYSKKIKSVDELVDGATIALPNDPTNSGRALALLEKNG
FT                   LIKLKEGAGISGTVKDVVENKKNLKFKEVEAAMLPRVLEEVDLALINTNYALEAKLVPT
FT                   KDALFIEDKDTPYANFLVARPDNKDSEAIQKLAKELNSPEVKKFIEDEYKGAIIPAF"
FT   CDS_pept        474818..476464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04640"
FT                   /product="probable oligopeptide ABC transporter substrate
FT                   binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41441"
FT                   /db_xref="GOA:C0ZJZ0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ0"
FT                   /protein_id="BAH41441.1"
FT                   /translation="MKQNLKLFLGAMLVAGSVLAGCSTSTPSTTTPPAEGNAASAEKPA
FT                   NAKSQVFRANIVSEPSTADPGLAKDATSGAIIRATFDGLTRFDANAKPVNSVASDVKLS
FT                   DDKLVYTFTLRDSKWSNGDPVTAHDFVYAWKRALGKTFGAEYAYQLYYIKNAKPIHEGK
FT                   ANPDELGARAIDDKTLEVTLENPTPYFLELTAFYTYYPVNQKVVEANPKWANEAATHVS
FT                   NGPFKMTAWEHKSKIVLEKNEHYWDKDVVKLDRIEFAMIEDDNTALSMFENGELDWAGQ
FT                   PLGGLPTDAIPTLKEAGKLVVHPKATMYWYKMNTTKGPLSNVKIRKALAYSVDRQTIVD
FT                   NITQVGQVPTMGMLPQSMIIKKDGYFKDNDVETAKKLLEEGMKELNVTTLPPITLSYNP
FT                   SDRHKKIAEAIQDQWKQKLGIDIKIMVKEAAVHLQDMHELNYEMGRIGWNADFNDPMNY
FT                   LEMFRDGKTGNNDTGWEDPRYQELLKQSSVETDPEKRKQLFAEAEQIFMDAMPLIPLFT
FT                   DVDVWVQSDKVKGVQVDGLGFIDLKWAEMTE"
FT   CDS_pept        complement(476521..476970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41442"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ1"
FT                   /protein_id="BAH41442.1"
FT                   /translation="MDLRFDFYIGATPEQVWHALTSDEGVKSTFFGCTIRSTFQVGDEM
FT                   AYVGPGKAGDDTVHVYGKILQFEPHHIFSFTEHPGPAYYENHAELQSRVTITLEPVGGC
FT                   TKLTLIQDQWTENHPSHASASNNWPMMLSSIKTYAETGKTLDFGF"
FT   CDS_pept        477086..477889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04660"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41443"
FT                   /db_xref="GOA:C0ZJZ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ2"
FT                   /protein_id="BAH41443.1"
FT                   /translation="MENQTAKLPKGVLHALIGQKKFSLARYEPSAGISYFVQHYWVVRW
FT                   DLRTEQPHLQTVLAHPNVNLVFEKGASGIFGVARTTSSHLLKGQGQVFGVKFRPGGFYP
FT                   FLNAPISKLSGTSTSLEAVFGVATDQLEKEVLSLPNDEQMMKRVEAFLFEHLPKPDPNV
FT                   ARISEIVRMIQADRSVLKVEDAVQLTGMNMRTMQRLFDRYVGVSPKSVIQRYRLHEAAE
FT                   QIDQGTVRDWLDLSTSLGYYDHSHFIRDFRAIVGVAPNEYRQAQI"
FT   CDS_pept        478131..479756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04670"
FT                   /product="probable oligopeptide ABC transporter substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41444"
FT                   /db_xref="GOA:C0ZJZ3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ3"
FT                   /protein_id="BAH41444.1"
FT                   /translation="MKKSVFAAMSSILVLSAALAGCGGGGEKAGEQGGASKEQTSGPKE
FT                   LRMNMMSEPPTADPALAEDSTSSAVLRATFDGLTRIGEDGKPHPSVAEKIDVSEDGLTY
FT                   TFTLRDSKWSNGEPVTAKDFEYAWKRALNPKTAANYSYQLYYLKNAEEYNKGKAKADDV
FT                   GVKAKDDKTLVVTLKNPTPFFLELTAFYTYYPVNQKVVEGSDKWAGEAKTHVGNGPFKM
FT                   ETWEHKSKLVLVKSDTYWDKDAVKLDKLNFSMVEDANTELSMFDNDDLDWSGAPLSSLP
FT                   TDAIPALKESGQMQTRPIAGTYLYKFNTEVPPFNNAKIRKAFAYAIDRKSIIDNITQAN
FT                   QEPAMGLIPPTMAVATSPYFKDGDVEAAKKMLEEGMKEEGITKMPTLTLSFNTSEGHKK
FT                   IAEAIQDQWKKALGVDIKLENKEWKVFLEDVNQGKFQIARSSWTGDYNDPYTFLDLFKD
FT                   KDGGNNDTKWENPKYKELLNQSALEKDPEKRKQILAQAEAIFMDEMPAAPIYYYTHSYV
FT                   KKDKVKGVVLDGLGFADWKWADIQ"
FT   CDS_pept        480180..481829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04680"
FT                   /product="probable oligopeptide ABC transporter substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41445"
FT                   /db_xref="GOA:C0ZJZ4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ4"
FT                   /protein_id="BAH41445.1"
FT                   /translation="MKKNVFVAMSSILVLGAALAGCGGGNQAAPADNNASGAKTENSAP
FT                   AGSKVLKLNLHSEPPTADPGIAEDTTSSTIITATFEGLTRVGKDGKYNPAAAESYTVSE
FT                   DGKKYTFKIRDNKWSNGDPVSAKDFEYAWKRALNPKTASNYAYQLYYVKGAEAYNKGKG
FT                   KVEDVGVKAIDDKTLEVELANPTPFFLELVAFKTYFPVNPKVVDGNEKWATDAKTVVGN
FT                   GPFKMDSWEHKSKLVVSKNDNYWDKDNVKLDKIEFSMVEDENTELSMFENGELHWAGSP
FT                   TSALPTDAIPALKDSGKMTTQPIAGTYFYRFNTEKPPFNNAKIRKAFTYAIDRQSLIDN
FT                   ILQAGQLPATGYVPPSMALTKDGFYKDNDIEAAKKMLEEGMKEEGLTKFPALTLSFNTS
FT                   EGHKKIAEAIQDQWKKNLGVDVKLENKEWKVYLDDVHQGKYQVARAGWLGDFNDPINFL
FT                   EMFKEKDGGNNDTRWENPKYKELLNQSALEQDPEKRKAILAQAEQILMDEMPIMPIYFY
FT                   TQSWVKDDRVQDVIIDGLGAVDYKYADFVEKK"
FT   CDS_pept        481964..483559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04690"
FT                   /product="probable oligopeptide ABC transporter substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41446"
FT                   /db_xref="GOA:C0ZJZ5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ5"
FT                   /protein_id="BAH41446.1"
FT                   /translation="MKKSVFVVLSSALVFGGMMTGYEGAVQAAEPKVLRMNLQSEPPTA
FT                   DPGIAEDTTSGTIITAIFEGLTRLGKDGEVHPAAAESYTVSKDGKTYTFKIREAKWSNG
FT                   DPVTAHDFEYAWKRVLDPKIASNYAYQLYYVTGAEDFNKGIGKAGDVGVKAIDDKTLEV
FT                   ELTNPTPFFPELVAFKTYFPVNKKVVEGNRKWADEAKTVVSNGPFKMETWEHKSKLSVV
FT                   KNEKYWDKANVKLDKIEFTMVEDENTELAMFDNDEIDWAGAPTSGLPMDALPVLREAGI
FT                   LKTQPIAGAYFYRFNTEQAPFTNAKIRKAFAYAINRESITADILQAGQVPATGYVPPSM
FT                   ALNKDGYFKDSDLEVAKKLLVEGMKEEGISKLPPITLSYNTSEGHKKIAKEIQAQWKKN
FT                   LGVDIKLKNSEWKVYLDDVHQGNYQIARGGWLGDFNDPINFLEMFQEKDGGNNDTRWEN
FT                   PKYKELLNQSALEQDPAKRKAILMEAEQILMDEMPIMPIYFYVNSWVQNENLKDVVIDG
FT                   LGDIDFKYADLTKK"
FT   CDS_pept        483688..483945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41447"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ6"
FT                   /protein_id="BAH41447.1"
FT                   /translation="MDIGSLLNIVKSIPKEKLRTDAGIKEVIREMARKSGKKLTEQEVN
FT                   SYAAQFRQMQKTENVGSLLNKLSKKGVTAKDLENIKKRFR"
FT   CDS_pept        484122..484463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41448"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ7"
FT                   /protein_id="BAH41448.1"
FT                   /translation="MKNTLGRLKQAPPKGTGERRSLLFGGRRNTAQVEAVPPPQKPAIS
FT                   IEDLLPLLPHLGDAIPQLKNPKVADSIKVLSNPAVISLIQQFLANGGLNMIKKPVQQVS
FT                   RQERRGFFR"
FT   CDS_pept        484636..486291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlU"
FT                   /gene_synonym="cwlV"
FT                   /locus_tag="BBR47_04720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41449"
FT                   /db_xref="GOA:C0ZJZ8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ8"
FT                   /protein_id="BAH41449.1"
FT                   /translation="MKRRFYPLLFALLVLLLIPGWAVAASSASEEAVNLVIGGQAVNAE
FT                   VPPVIKNGRTLVPVRVIAEGLGANVDWKEATRTAVITKGTQQLSLTLDSRTAVLNGKQV
FT                   KLDTPPVISQKRMLLPLRFVGESLGVTVGWDNSKRTVIANETPQVKLNGKVPTQPIKLY
FT                   QVEDTMYASAQAVAEQVGQKGFTWKRPERGMTIDDQLVLPLRQLEDELGGSFTWDKKNS
FT                   QVEIDRLNILKGVSENGDRVRIETTIPVIPQSFVMTGPHRIVLDLPQTALDDDLIDDLK
FT                   RQDEKNDSVGESEETASAADEDQGTDSDSDGLNQAEQATEEPLITNLRYSQYSASPDTV
FT                   RVVIELNQKSTYELAYTKDGIEVKLAPKPKKTGYLIVVDAGHGGKDPGTKGSAGNNEKD
FT                   YNLAVSNKIVALLKQYPEFQVVPVRTTDVFYELSERVAVANELDADLFLSIHANAFEKP
FT                   TAAGTETFYYNENSKDFAQLVHKYLRGATQFPDRGFKKSGFYVIKNTKMPAVLTETGFL
FT                   SNPQENAQLTNPAFQDKIAKAIVAAIREYYESYQ"
FT   CDS_pept        486306..486854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41450"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZJZ9"
FT                   /protein_id="BAH41450.1"
FT                   /translation="MKKSRVIWMAALVMLLLAGCGQNATETPQPTTPVEQPSGSNTDPS
FT                   TTEPTLKKQMVTVYYSDNNVMELQKEEQEITFAEDIEKYKKTLALLETPVKPDVHVPLW
FT                   RDFKYHSITIDKGTLTIDADSKNKFNMGSSGETMALDALKNTFFQFSEVKEIVFLEDGK
FT                   KVETLMGHVDLSEPLKRDN"
FT   CDS_pept        complement(487433..487636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41451"
FT                   /db_xref="GOA:C0ZK00"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK00"
FT                   /protein_id="BAH41451.1"
FT                   /translation="MERLALLFVIIGALNWGLIGLFQFDLVASLFGGAESIVSRIVYTL
FT                   VGLFGVYAIKFLFTDREETPTR"
FT   CDS_pept        487822..488757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04750"
FT                   /product="probable phosphate ABC transporter substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41452"
FT                   /db_xref="GOA:C0ZK01"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK01"
FT                   /protein_id="BAH41452.1"
FT                   /translation="MKKLSKMFIALTCVGALLAGCGSGNTAQTQTPAPAQKPAQEQSNS
FT                   GSTTKTSGEPVTAVGSTALQPLVEQAAKDFMAKNAGAQIQVQGGGSGTGLSQVASGAAT
FT                   IGNSDIFAEEKKGIPANELVDHKVSVVGMAAAVSPKVKVDNLTKQQLIDIFTGKITNWK
FT                   EVGGDDMKITLVNRPKSSGTRATFSKFALDGKEEAEGITEDSSGTVRKIIAETPGAIGY
FT                   LALSYFNDTVKALKLDGVEANAENIVTNKYPVWAYEHMYTKGEATGDAKAFLDFILTDE
FT                   VQKKTVTELGFLPITDMKVERDAEGKVTQK"
FT   CDS_pept        488847..489794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04760"
FT                   /product="probable phosphate ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41453"
FT                   /db_xref="GOA:C0ZK02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK02"
FT                   /protein_id="BAH41453.1"
FT                   /translation="MSHRTEGINTERKSMIAQKMLTTNKRQKTENITGRTIAMICAGLL
FT                   VIVVLSITYFIASKGLSTFFVDGVSFKEFLTHVKWDPEGEPSSYGVLPFILGSFFVTAL
FT                   AALIAAPLGIGAAIFMTEIFPGFGKKVLKPVIELLVGIPSVVYGYVGLTLLVPFIREQF
FT                   DVLGFSLLAGGLVLALMILPTITSVAADAIEAVPQDLRNASLALGATRWQTIWNVVLHS
FT                   ALPGCLTAIVLGMSRAFGEALAVQMVIGNTTKLPSGLFEPISTLTSGITLNMGNTIQGT
FT                   PYNNALWSMALLLLAMSFIFIVILRLLGRKRLAK"
FT   CDS_pept        489795..490685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04770"
FT                   /product="probable phosphate ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41454"
FT                   /db_xref="GOA:C0ZK03"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK03"
FT                   /protein_id="BAH41454.1"
FT                   /translation="MKARLMDRAATVVLTLIAVLIIGTLVGLLGFILSQGWHKLNLDFL
FT                   TSPPDIVNAGGGIGPQLFNSLYLLVLTMLIALPLGIGAGIYMAEYAPDNKITQFIRMSI
FT                   EVLSSLPSIVVGLFGLLVFVNMTGWGYTLFGGALALTVFNLPLLVRVTEDALRNVPRSQ
FT                   KEASLALGITKWRTIVSVILPAALPGILTGAILASGRVFGEAAALLFTAGMSSPNLDFT
FT                   DFSMNSTTSPLNPFRPAETLAVHIWKVNSEGLTPDARDVADGAAAVLIIAVLLFNLSAR
FT                   WFGNWVYKKMTSGSN"
FT   CDS_pept        490705..491478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04780"
FT                   /product="probable phosphate ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41455"
FT                   /db_xref="GOA:C0ZK04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK04"
FT                   /protein_id="BAH41455.1"
FT                   /translation="MSVLTMQETIIQTNNVNVYYGEKHAVKNISMDIEKNSVTAFIGPS
FT                   GCGKSTLLRSLNRMNDLVPSCRVEGSIIVDGIDINSSQVNIESLRQVVGMVFQRANPFF
FT                   KSIYENIAFAPRFHGMTNKRDLDELVESSLQKAALWDEVKDRLRDSALSLSGGQQQRLC
FT                   IARAIAMQPTILLLDEPASALDPISTMKIEELVMQLKDEYTIVIVTHNLHQAARISEKT
FT                   AFFLMGELIEMDETGKIFTSPESEKTEDYISGRFG"
FT   CDS_pept        complement(491551..491979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04790"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41456"
FT                   /db_xref="GOA:C0ZK05"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK05"
FT                   /protein_id="BAH41456.1"
FT                   /translation="MNSLQTYPAKGDVWTLDKRSIHFYVIAFFVLLAMSLVTFIKVFDQ
FT                   SHYLRYLFVAIFFVGLIVGYVRYLMKVKSENMKHQSKWYRYGFLLAFALIYMAIKYGVK
FT                   AVVGYEASSEDYGTVIAFFFLGLFITYYGFYSRYLRKI"
FT   CDS_pept        complement(491995..494040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04800"
FT                   /product="probable methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41457"
FT                   /db_xref="GOA:C0ZK06"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK06"
FT                   /protein_id="BAH41457.1"
FT                   /translation="MPDIRKPWGRSSFHYRSIFTRLFAGIMGMVVCMMAIAAFFISYQS
FT                   EATLNEKTKQQLHEASGAALQKVHSRVYDIVTALQSFASTYKNSKITNSQIFGIFTDLS
FT                   TSNPTISELQIVTTDGKYLTFPGSPLDSSYDPRKMDWYEGALNQPLQGVFISDVFQFSK
FT                   TEFPKIAVSLPLRNEDEEPVGVVVAFVSVPKLSESIGQIKLGETGYAMIVDQQGKLVAH
FT                   PDQSYALQRPLLTELAIVQNVIAGQSGYEPSRINGVDSFAAYQFAPSLKWGVIVAQSVS
FT                   EVKQEVRRLQLTILAVSLVGLAALALMLYVYVRRIIKPIKEAQQKMSAFSEGDLLQTMH
FT                   VQSNDEIRQLADSFNRMSEQIRTIIGKIQYVISDVKQVADHVGKGSSHSHAMQSEVVSV
FT                   TERLAQEMDNQQEQIDDIHATMAGITQEMSRITDSMEKAIVQSQESRQQNAKAATSIDL
FT                   LKENMHSISEDMKASMHAMSSMRESMGDINEMLGLISAISKRTKLLSFNARIEASRAGQ
FT                   AGIGFSVVADEIRLLSDQTEEASARIQKVIESGEERMEHVAACLQTTDHATVNGIQTLH
FT                   QAASIFHNTIQLSEALTAQFESIRMLTGTISTQSLAISQRVDNLSASAQQVVSGTQQAV
FT                   AANQESLSLSEQFLDDSLRLTEIVEDLEQTIKFFRAGETTLSLKNS"
FT   CDS_pept        494271..495023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04810"
FT                   /product="putative phosphate ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41458"
FT                   /db_xref="GOA:C0ZK07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK07"
FT                   /protein_id="BAH41458.1"
FT                   /translation="MSVISVRELNLFYGNKQALYHINLDVESDSITALIGPSGCGKSTF
FT                   LRTLNRMNDSVPNTKITGTVKVFDEDIYSSRVEVERLRKNIGMVFQHPNPFPKSIYDNI
FT                   TYGPRLHGMNDRNKLDELVETSLKAAALWDEVKDVLKKPATGLSGGQQQRLCIARALAV
FT                   QPQIILMDEPTSALDPISTAKIEELLEELKNRYTIVIVTHNMQQAARISDKTAFFLNGE
FT                   LVEFDSTPTIFQNPRDKRTEDYITGRFG"
FT   CDS_pept        complement(495088..495426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41459"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK08"
FT                   /protein_id="BAH41459.1"
FT                   /translation="MNVLEPIELNKGTPGQPCPIAKTLDVIGTKWTFLIIRDLLIEGTL
FT                   RFSDLLKSMDGISPKTLSLRLKELEEHGILERKVFPEVPPRVEYTLTEKGKRLEGIFIE
FT                   LKRFGLHL"
FT   CDS_pept        495597..496220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41460"
FT                   /db_xref="GOA:C0ZK09"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK09"
FT                   /protein_id="BAH41460.1"
FT                   /translation="MIPLTKKMSSIAGIAVIFGTMLFTTACATDSKTSAYDKQTAVLSA
FT                   KTDVQLLKDLPQPVSMTIDSSLDSTKATEMVQAAQRFYGFWNTGNEELIAQTVSPSFID
FT                   NTLPKGRPQGPDGLLFASRNFRKAVPDLQCKVEDLLVVGDKVTARLSFTGTSKGEFMGK
FT                   PLVGKPIQFMAIDVLRIQDGKLVEDWHLEDNLTFMQQIGVLAEN"
FT   CDS_pept        496249..496800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04840"
FT                   /product="putative modulator of drug activity B"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41461"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK10"
FT                   /protein_id="BAH41461.1"
FT                   /translation="MKKILIINGHQKYGSSEGKLNQTLTDHMVRLLEKENHVRTTIIQN
FT                   GYQIEEEHEKFLWADMVIYQTPIYWFSVPGLMKTYMDEVYAYGLFFKGANQYGRGGLLT
FT                   GKKYMFSTTWNAPEKAFNDPTQFFNGESLEDAISHLHRVQEFLGMQPVKSFACYDVIKN
FT                   PQIDRFVSELEAHLKQVLSF"
FT   CDS_pept        496835..497548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41462"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK11"
FT                   /protein_id="BAH41462.1"
FT                   /translation="MLHNQKIVIIGGSSGIGLETAKQAVALGAGVIIASRSEEKLQKAK
FT                   ESLGSKASAYTLDITDEQQVQAFFEKVGTFDHLVVSAAETSGGSFLQTDTAQARKLFDN
FT                   KFWGQYYAAKYGAPKISTNGSITLFSGVVAYKAMIGSSALGAVNAAVSNLGQTLALELA
FT                   PIRVNIVSPGIIDTPSRSKMPEDVRENFYATLADKLPVKRVGQAKDVAQSVLYLLQNSF
FT                   VTGTVLHVEGGHILL"
FT   CDS_pept        497655..498947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04860"
FT                   /product="putative arsenical pump membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41463"
FT                   /db_xref="GOA:C0ZK12"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK12"
FT                   /protein_id="BAH41463.1"
FT                   /translation="MVWISCFLFLITLTLVIWQPRGLSIGYPAVGGALLALAIGVVTIG
FT                   DVAEVTSIVWNATLALIGIIIISLVLDEVGFFEWAALHMARFAKGNGRLMFVYVILLGS
FT                   LVSALFTNDGAALILTPIVLAQVRALKLDGKTVLAFVMASGFIADTSSLPFVISNLVNI
FT                   VSADYFDIGFAAYAAKMIIPTLFSIGGSLLVLYLYFRKSIPAQIDLSHLKNPEEAIRDH
FT                   RMFRLAWPILAVLLIGFFISESIHTPVSIIIAGAAIIFCLAARKSEAIAMRRIMKEAPW
FT                   VVVVFSIGMYVVVWGLHNAKLTDLVKDALDWFMGHGLLATTLGTGFLAAALSSVMNNLP
FT                   TVIFNALAIAGTQADGVLREAMIYANVIGSDLGPKITPIGSLATLLWLHVLGRKDVTIT
FT                   WGQYFRTGVILTVPTLMFTLLGLYLTLVYFS"
FT   CDS_pept        499080..499469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04870"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41464"
FT                   /db_xref="GOA:C0ZK13"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK13"
FT                   /protein_id="BAH41464.1"
FT                   /translation="MWHGWPIERVLILFTGLAFALIAVQVTLFHSRQNFRHWAMWIPVL
FT                   ELPVFAVTAIVLSFVNAGWLRWVFALMMVVGMVGGLYGAYLHTVGVGQRVGGYSQGQNF
FT                   LVGPPVILPLLITAMSALGLLALFW"
FT   CDS_pept        499497..500099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41465"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK14"
FT                   /protein_id="BAH41465.1"
FT                   /translation="MEKPGRYPSYDVWDQHTEWDAHTRKVVGARRMPAIANQFFTKHES
FT                   LLLQTVVGVLVNDHRLEVLTFVVEHLDNTTASNIGESQRKVGIPPKKEFYRSGLKGIDA
FT                   ESHAAYGTDFVALKLDQQEAVLQHVANGGIQNQEAWKDFAPADFFKRLLHDTVSAYYSH
FT                   PLVWSDIGYGGPAYPRGYVRVEKGLTDPWEAKTNDES"
FT   CDS_pept        500086..501705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41466"
FT                   /db_xref="GOA:C0ZK15"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK15"
FT                   /protein_id="BAH41466.1"
FT                   /translation="MTSHDHHTITHRPTPVDQRKYADDADVCIVGAGAAGGVLAYELAK
FT                   AGLRVVVLEAGPFWDPQHDFASDELSMRRLAWQETRLVAGKDPLRLGHNNSGRGIGGGT
FT                   VHFTGVFLRFHESDFKTKTVDGVGEDWPITYQDLAPYYDKIEREIAVSGPNHFPWGSFQ
FT                   GPYPYPVREPISANAQLFREGCEKLGIESVVAPLAILSGPFDGRPPCINRGFCNQGCMP
FT                   NAKYSGLIHHIPKAIAEGAEVLADCMVTEILMAGDRVGGVLFNHNGLTYRQMARVVILA
FT                   GFVVETPRLLLSSANAQFPQGLANSSGWVGKAIMPHSSHDVYGRLPEEVRLYKGTPVLA
FT                   LTQHFYETDRERGFARGYTLSAHGSRPVGMAAAIAAEREDGSYLWGKQLRETMLDYNMY
FT                   ARITLVGEVLPHPDNRVTLSGEKDEYGMPIPTVTFSYQENDKQLYKHAIGQMNRIIEAM
FT                   GGHPEHVVSDTAHLMGGCRMGNDRETSVVNEYGQSHDIPNLFIAGASTFVTSSGSNPTN
FT                   TVMALAARTADKIIEAMKKQDV"
FT   CDS_pept        501802..502137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04900"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41467"
FT                   /db_xref="GOA:C0ZK16"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK16"
FT                   /protein_id="BAH41467.1"
FT                   /translation="MEMDLMQVLFLSETYKLLGDKTRLTIMALLQVQSLCVRDLVEILQ
FT                   TSQPSVSQHLAKLKTHGLVKERRKGPWVYYSVNTECSPEVKQILSNLPDMSPVVKQKSA
FT                   ASEPSFG"
FT   CDS_pept        complement(502159..502410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41468"
FT                   /db_xref="GOA:C0ZK17"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK17"
FT                   /protein_id="BAH41468.1"
FT                   /translation="MAHKVIIYTQVTCGPCQEEKMWLTSNNIAFEDRDIRQNEAFFQEA
FT                   IQLGASMTPVTYIEKENGEQIVIHGFDKEELKKALDLN"
FT   CDS_pept        502581..502829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04920"
FT                   /product="small acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41469"
FT                   /db_xref="GOA:C0ZK18"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK18"
FT                   /protein_id="BAH41469.1"
FT                   /translation="MPKQNNQAGMGQANQASQAANTATEFASETNVSEVRRQNQQSAQR
FT                   SASKGAATEFASETNVSEVRRQNQQSAAQQSSGQVTE"
FT   CDS_pept        502982..503368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BBR47_04930"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41470"
FT                   /db_xref="GOA:C0ZK19"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZK19"
FT                   /protein_id="BAH41470.1"
FT                   /translation="MIIGTGVDIVEIERIATLIKRQERAIKHFLTTDEQQLLHGKSETR
FT                   QAEMVAGRFAAKEAGAKALGTGIGAVLSFLDMEILPNHLGKPVMTIKNEVYSKLDLDPT
FT                   RVHIHVSISHSQSHAIAQVIVEER"
FT   CDS_pept        503633..504670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="BBR47_04940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41471"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK20"
FT                   /protein_id="BAH41471.1"
FT                   /translation="MKRVALPLVLLLVFTLFLGGCFGQKTPEDVVSDLNGALGKMTGYK
FT                   SQAVLTMQTGSTPMEYDVQVWYEKPTNYRVALTSKQRGITQIILRNNEGVFVLTPHLNK
FT                   SFRFQSGWPENNGPLYLYETLAKSIIDDTERQMKMEEKQYVFEVKANYSGNRSLTKQKI
FT                   WLTEDFKPTHAEIMDASMNPLVRIDFTDFSFNPMFDKDAFDKERNMTTSSLTTIPTMAQ
FT                   TNGQVVKQPNSQFGVIVPTYMPEGVKQGDIEPVTRDGERKVILTYKGTYNYKVIEGRPT
FT                   AASVSYEQGMPVNLGFTVGVLAQTGENQRLLTWELDGIEYTIAGDLPEEEMVNVAQSTY
FT                   GLSAK"
FT   CDS_pept        505068..506399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04950"
FT                   /product="putative transposase for insertion sequence
FT                   element IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41472"
FT                   /db_xref="GOA:C0ZAV5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZAV5"
FT                   /protein_id="BAH41472.1"
FT                   /translation="MSKNRISFTEHEIHMLEKNQNVLRVTGKNITYSSMFKFTAVQAYR
FT                   EGQTPIEIFLQAGFPLEIIGRHTPKKCLHRWRKVYTTFGEAGLIEERRGKGSTGRKSEG
FT                   ELSAEEKLRRAEARIRLLEAENELLKKLEALERQTNKTLSSPERFQLISLVLRKHGLKR
FT                   VTRYLCQIAEVSSSGYYRWCSAEEQRQIREEADERDFLLIKEHFETRKGRAGVLVIKMR
FT                   LERMNGAVMNHKKIRRLMQKFKLVTLIRKANPYRKMAKATQEHRTCPNLLKRQFDQGIP
FT                   EKVLLTDITYLRYGTGQWAYLSCVKDGATKQILAHYLSSTLELSLVKRTLDLLIKRLDG
FT                   NVHPDAIFHSDQGMHYTHLTTRRLIAEAGFKQSMSRKGNCWDNASMESFFGHMKDELEY
FT                   KDCVSLQELRQRVNEYVTYYNSERYQWTLKKMTPDETRNHLIAA"
FT   CDS_pept        506778..508151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41473"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK22"
FT                   /protein_id="BAH41473.1"
FT                   /translation="MFSKTKMGMLMGTMAVVLSLGSIGGAMAADSAKPTSLNKPVEVKF
FT                   KTGKMGHHGGVGFKENKELLSLLKLDADKLKEELAAGKTLAAIAQAQGVDTADVVALLV
FT                   DQQEAKLKGAVTAGKLTQEQADKLSENLSDRVKEQVENSKPDKGFGRGGFIGGFEKNEE
FT                   LLSLLKLDADKLQEELKADKSLATIAEAQGVSVDDLVALLVKQQETKLKEAVAAGKLTQ
FT                   EQADKMNEKANERVKEMVQNTHHGRGPGREMGFEKNQELLSLLKLDADKLQEELKAEKS
FT                   LATIAETQGVSVDDLVALLVKQQETKLKEAVAAGKLTQEQADKMNEKASERVKEMVQNT
FT                   HHGRGPGKGMGIEKNEELLSLLKLDADKLKEEQKAGKSLATIAKEQGVEVDDVIKLLVG
FT                   QHETKLKEAVKAGKLTQEQADKRSEELTAMVQKMVDGSFEKVVFPKHEKEKKDQKETM"
FT   CDS_pept        508337..508777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41474"
FT                   /db_xref="GOA:C0ZK23"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK23"
FT                   /protein_id="BAH41474.1"
FT                   /translation="MKKPSNEVLYQEASTYKDMLLRKSWKMRINETVMFVLGMMILAQF
FT                   FPTNDTRFKVLVFAIAIAVVGLSPFMYKSVLRPVYKLTKTHLIISLSGQEKSYPLSEVE
FT                   QIYEGRHFYLVGGKKESLMVSRQFLSHLNERLFYYKKGNKRR"
FT   CDS_pept        508780..509982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="BBR47_04980"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41475"
FT                   /db_xref="GOA:C0ZK24"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK24"
FT                   /protein_id="BAH41475.1"
FT                   /translation="MKSFCRDTWVEVDLDAIRANLETFKRHLPEKTDIMAVVKADGYGH
FT                   GAVHVGKEALASGADSLAVALLDEALILRRAGITAPILVLGYTPVESIVTASELEVELT
FT                   AYSVEWITEANDILQKNDHKPVGIHVKTDTGMGRLGVRTKEDLLAVVGALEECSKLKWT
FT                   GIFTHFACADEPDTTHVRRQHDLFQSFLQALREANKKLPTVHCCNTAAAIAFPDWGYDT
FT                   IRLGIGLYGLYPSLYMKERADVILTPALALKTRIAHVKKADEPFTVSYGATHTAQPDEW
FT                   IATLPIGYADGYSRLLSNRGEVLYNGTRYPIAGRVCMDQIMVSLNSTEAAVNDEVVLYG
FT                   KQGDEEISLDEIADLLGTINYEVPCMLNYRIPRLYLRDQKVTDVFHPLTMKHSSHENVN
FT                   I"
FT   CDS_pept        510213..510512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndoAI"
FT                   /gene_synonym="ydcD"
FT                   /locus_tag="BBR47_04990"
FT                   /product="antitoxin EndoAI"
FT                   /note="protein synonym:endoribonuclease inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41476"
FT                   /db_xref="GOA:C0ZK25"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK25"
FT                   /protein_id="BAH41476.1"
FT                   /translation="MVGGGFVLSKSNTKRIMISLPQHLLQEVDGVIQKEKSNRSEFIRQ
FT                   AMHLYLKERKKRTIRETMQKGYMEMAKINLNMASEAFGAEEEADHTLVRLVSGV"
FT   CDS_pept        510516..510866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndoA"
FT                   /gene_synonym="ydcE"
FT                   /locus_tag="BBR47_05000"
FT                   /product="endoribonuclease EndoA"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41477"
FT                   /db_xref="GOA:C0ZK26"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK26"
FT                   /protein_id="BAH41477.1"
FT                   /translation="MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQIRTIDKQRLTDKITHLDDEMMDRVN
FT                   ESLQISLGLIDF"
FT   CDS_pept        511075..511503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /locus_tag="BBR47_05010"
FT                   /product="serine/threonine-protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41478"
FT                   /db_xref="GOA:C0ZK27"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK27"
FT                   /protein_id="BAH41478.1"
FT                   /translation="MVVADYSPETINIEQESDIVTARQVGRNMSKLFGFGTITQSRIAT
FT                   SISELARNIYLYAGAGAIIISPIEREGMIGLQITANDNGPGIPDIRQALDDGYSTSGAL
FT                   GAGLPGVRRMMDEFEIHSTLGEGTRVVVVKWSDQAKEE"
FT   CDS_pept        511509..512510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="BBR47_05020"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41479"
FT                   /db_xref="GOA:C0ZK28"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK28"
FT                   /protein_id="BAH41479.1"
FT                   /translation="MVTRSFQEEYVKILRDYLSAQGEDQLYGAQQLGKWMLSQDISPEE
FT                   ITDLHAQALEQLGEVPEFVRSSFSILTEVMIEYGNEHRSVNSWRNRHQQMESEIAVAKA
FT                   MQQSLLPSEVPVYSELEIGVVSIAAKQISGDYYDFIEQSEGRFGVAIADITGKGMPAAM
FT                   CMSMVKYGLDSLGQMELGPDEMLHHLNRIVGRNIDPSMFVTMMFGSYDSKKHCFRYAMA
FT                   GHEPGFLYRSAEGKFYDLEGRGNALGLCPNSEYEVQEICLEINDVLILLTDGVTECKNN
FT                   RYYLQREELVHHLQKEVGESAQKMANGLYNRLLLLSQFNLLDDYTMIVLRRT"
FT   CDS_pept        512536..512862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /locus_tag="BBR47_05030"
FT                   /product="anti-sigma-B factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41480"
FT                   /db_xref="GOA:C0ZK29"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK29"
FT                   /protein_id="BAH41480.1"
FT                   /translation="MDLLIQTTSLETEHRVVLGGDIDAFTAPKVKETLMSLVTKPDINH
FT                   ITVDLEAVEYMDSTGIGIFIGIMKECFQRNRTFEVHKMSPRVERLFRITGLYDHIAIRK
FT                   GESE"
FT   CDS_pept        512862..513356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="BBR47_05040"
FT                   /product="serine-protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41481"
FT                   /db_xref="GOA:C0ZK30"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK30"
FT                   /protein_id="BAH41481.1"
FT                   /translation="MGPNRPQADVIQLTLPSKAEYLGVARLTVSGIANRMGFSYEEIED
FT                   IKLAVGEACTNVVRHAYKETENPGSIHIQCHVYEDRLMIEVSDQGVGFSNELIAEQLTP
FT                   IYAGKSLEDLDEGGLGLYLIHTLMDEVETRSESGVVVSMTKYVRQDGVAGNDWTISEAE
FT                   I"
FT   CDS_pept        513325..514113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="BBR47_05050"
FT                   /product="RNA polymerase sigma-B factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41482"
FT                   /db_xref="GOA:C0ZK31"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK31"
FT                   /protein_id="BAH41482.1"
FT                   /translation="MTGQSRKQKYSPEELKELIHLYGETKDPTIQEQLVRAYTPLVESL
FT                   AKKFVRGQVMYEDLVQVGLIGLLASFRRFDPSFERTFESFAIPTIVGEIKRYIRDKTWS
FT                   VYVPRRVKELSPKIKRVVDELTIKLQRSPQIADIANSLGVSEEAILETLEMGRSYHSLS
FT                   MDSELEADLDGNTISLLDLVGTMEEGYGAVEQNLMLERALQILDHREKEIIQLTFYQNL
FT                   SQKQAGDIMGMSQMHISRLQRRALGKLREALRVEQLETAT"
FT   CDS_pept        514211..516373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcI"
FT                   /locus_tag="BBR47_05060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41483"
FT                   /db_xref="GOA:C0ZK32"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK32"
FT                   /protein_id="BAH41483.1"
FT                   /translation="MELTLMIQTIAQDTGVKPHQVERTVALLDEGNTVPFIARYRKEMT
FT                   GQLDETQIRAIEERVRYLRNLSVRKEEVVRLIDEQGKLTDELRAAIERATKLQEVEDLY
FT                   RPYRQKRRTRATMAKEKGLEPLANYLMSLPKAGNPEEEAKPYINPEKGVETTEQALQGA
FT                   MDIVAELLSDDPEIRQWVRQRSVQKGLLLTEQKAEEADEKNVYQMYYAYSEPLKKVVPH
FT                   RVLAINRGENEGILKVSIEAPVAEILAWMQKRTIPRDTVARDLLTVTVEDAYKRLIAPS
FT                   IEREVRAELTEAAEERAIHIFAENLRNLLLQPPVKGKVVLGVDPAFRTGCKLAVVDETG
FT                   KLLEVAVVYPTPPANKVAEATVKVKQMIETYGVTVVAIGNGTASRETEQFIATLLKELK
FT                   REVMYIIVNEAGASVYSASALAKEEFPDLDVAERSAASIARRLQDPLAELVKIDPKSVG
FT                   VGQYQHDVSQSRLADSLQFVVESAVNHVGVDVNTASPSLLQYVSGISRQVAGNIVKKRE
FT                   EIGMFTERSQLKAVPRLGAKTYEQCIGFLRVMDGANPLDKTPIHPESYEATHQLLSMLG
FT                   ISAQEIGSENCKERVQSLDVKETAAKLGIGEPTLQDIVDSLLRPGRDPRDELPKPLLRS
FT                   DVLQLSDLSVGMKLQGTVRNVVDFGAFVDIGLKNDGLVHISRLKKGFVKHPLEVVTVGD
FT                   IVDVWVVEIDEKRQRVGMTMIAPTEG"
FT   CDS_pept        complement(516399..516521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41484"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK33"
FT                   /protein_id="BAH41484.1"
FT                   /translation="MPQWMRRQLQRAFNGKDVRQIRVLNSCWFLYLEKNGGRPD"
FT   CDS_pept        complement(516598..516936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41485"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK34"
FT                   /protein_id="BAH41485.1"
FT                   /translation="MRYLLLQSSDGLQFVSLPETHMYQLIALLKRLYKEIDKLTITERP
FT                   ELPTVLADCADVERLGNELSIVDGLEYVSGLERRFAALQETEYPLISLLTEIRALQAQL
FT                   EYLHEEEE"
FT   CDS_pept        complement(517060..517164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41486"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK35"
FT                   /protein_id="BAH41486.1"
FT                   /translation="MAKGLGKKFAGYLLYQHLQFRIGHLISSASFFSP"
FT   CDS_pept        517093..517554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcK"
FT                   /locus_tag="BBR47_05100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41487"
FT                   /db_xref="GOA:C0ZK36"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK36"
FT                   /protein_id="BAH41487.1"
FT                   /translation="MTDTELQMLVEQISSEFFAKPFRHQARFNSRLRTTGGRYLLRSHD
FT                   IELNPKHLQEHGVEELIAIIKHELCHYHLHIEKRGYRHADRDFQLLLRHVGGSRYCQQV
FT                   GSGRTTLPYRYELVCKECGMSYKRKRKMNPSRYRCGRCKGKLLLRELTM"
FT   CDS_pept        517651..518667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="BBR47_05110"
FT                   /product="thiamin-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41488"
FT                   /db_xref="GOA:C0ZK37"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK37"
FT                   /protein_id="BAH41488.1"
FT                   /translation="MAHDEFSLIRQWTSRSAGQEGNGLTVGIGDDAAVFSPAPEMEVVA
FT                   CCDAMVETVHFLKKTMNPSDIGYKAVISNVSDVAAMGGVARYALVSIAVSPQWTPDECQ
FT                   QIYEGIYEACQAYGVRVIGGDTVSAPDALHLSVTVLGEVEKGRAIRRSQAKPGQLVFVT
FT                   GHVGTSAAGLHLLLQGETAERGVSASWETLMDAHQRPVAQIKAGRLLLESGACSALNDV
FT                   SDGLASELWEIAEASGVSILVDAATVPIHDEVREYARHVEKDPLEWAFYGGEDYQLVGT
FT                   LAKSHYEAVSKQFAVSGVRFTVIGEVVEKRHDPELMLQRDDQQLPLPKAGFNHFRSG"
FT   CDS_pept        518664..519143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiB"
FT                   /locus_tag="BBR47_05120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41489"
FT                   /db_xref="GOA:C0ZK38"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK38"
FT                   /protein_id="BAH41489.1"
FT                   /translation="MKEMSYTWRLTGAQETQRFAEQLASLLEPGDFLAMEGDLGAGKTT
FT                   FTQGLAKGLGVRQVVNSPTFTIIKEYQGRLPLYHMDVYRVGDDPDSLGLDDYFFGEGVC
FT                   VVEWASLIEDVLPTDRMTVFLRREGEEQRMIELVPQGNRYVKLCKEFDFDARTGD"
FT   CDS_pept        519124..519846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiC"
FT                   /locus_tag="BBR47_05130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41490"
FT                   /db_xref="GOA:C0ZK39"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK39"
FT                   /protein_id="BAH41490.1"
FT                   /translation="MRVLAIDTSNLVLSVAVVEEERVLAEMTTNQQKNHSVRLMDCVSE
FT                   LLDATGTAPEELSGFGVANGPGSYTGVRIGVASAKSMAWSLNVPVIGVSSLEVIAMNAT
FT                   GFSGLIVPLFDARRGQVYTGCYCSEGMEAVRAQSTEQIILLREWLPLLRDLAQGEPILF
FT                   LGEDVRLHRETIVQELGDQAQFASPAFNHPRAAHIGYVALRKLQEGGNAHELVPEYLQL
FT                   AEAEAKWLAQKQAGAVKE"
FT   CDS_pept        519851..520306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05140"
FT                   /product="putative ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41491"
FT                   /db_xref="GOA:C0ZK40"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK40"
FT                   /protein_id="BAH41491.1"
FT                   /translation="MSQPIDLEYRYMTMQDVGAVAELERLAFTTPWPHDAFVNELTRNP
FT                   NARYVVVAHQNRIIAYCGMWIVIDEAHITNIAVHPLYRGKKVGLALMIKMMGVAKLQGA
FT                   HSMTLEVRPSNTVARNMYIKLGFKEHGRRKRYYSDNNEDAIIMWVTL"
FT   CDS_pept        520306..521388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="BBR47_05150"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41492"
FT                   /db_xref="GOA:C0ZK41"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK41"
FT                   /protein_id="BAH41492.1"
FT                   /translation="MNKTYTSRYEKRIQQKYEAHKESGAPTYILGIETSCDETSASVIR
FT                   DGREVLSNVIASQADIHKRFGGVVPEVASRRHVENITLTIEEALTEAGKTLDDIQAIAV
FT                   TYGPGLVGALLVGVAAAKAISMARGIPLIGVHHIAGHIYANRLVQEMEFPLIALVVSGG
FT                   HTELVWMKEHGQFEILGETRDDAAGEAYDKVARALNMPYPGGPHIDRLAHEGEANVPLP
FT                   RSWLAPDSYDFSFSGLKSAVLNTLHNAAQRGETIEPANLAASFQDSVTEVLVEKTIRAA
FT                   RSHGAKQVLLAGGVAANRGLRERLQARCEAEGIPLVIPPFSLCTDNAAMIAAAGFIKYE
FT                   KGQFEGLDLNGVPSLSLSEQ"
FT   CDS_pept        521692..523929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05160"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41493"
FT                   /db_xref="GOA:C0ZK42"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK42"
FT                   /protein_id="BAH41493.1"
FT                   /translation="MRKKLALICLSFLILFLATNIGKPLVAKEKQQVIMLFVEGMSFHD
FT                   LEQLKKLSTVDKWLDGAGAGALSIRTPGTRTAANGYLLMGSGGQALYSEKSGTGYHLFE
FT                   ALSSRETAGERAQELGGDEAQEVARSSIIFPGIFRLLADNREKPYSAQIGLLGTVLAAN
FT                   NIQVALYGNGDFEDIRQRHAVLFAMDQQGRVPTGDISAKSMEHLRGYPYGIKTNYTYLL
FT                   EKIHSEHQAGLIIAQLSDLNRLYQLSADMDQGQFTQQYQRALRDLSFFLDQLLEKRKPH
FT                   QRIVLASPAVNHVATKEKTLLTPVFIWGEKANGVLTSATTRQSGLVSGLDMVPTILSWL
FT                   DVPIPKGLAGHVIRIEKGNGLTALQNQVGKIHHTYATRPAVLYTYVMLQIVIVGCAVVL
FT                   WWFGRKREGSGLLRLRRGIRLALLALLWFPALLLAESLLDWQVTGAVVLGGLIMTALIA
FT                   AFWQETHALPRIVMTVSGVTTAILLLDGWTGAHLMRQSYLGYDPVIGARFYGLGNEYEG
FT                   VLISSTIMLVASLYERMTGGQKELRREQKWLPAVSAAIYSVVLYYMVAPSLGTDAGGFL
FT                   AGLIGFTVALSRLEGWRIGKKGLLLLAGGLVMGVCGLMAISLMSDQPLTHVGRLSEQIV
FT                   HGEWAEVGQMIERKLAMNLRLIRVSIWSKAFVVSLIALGVLTLKNDRFLHHLAKDTPYL
FT                   VKGFAGVIVGALAGLFLNDSGIVTAATCITFLVVPALYAALEEPAQERCST"
FT   CDS_pept        complement(523938..525872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05170"
FT                   /product="probable ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41494"
FT                   /db_xref="GOA:C0ZK43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK43"
FT                   /protein_id="BAH41494.1"
FT                   /translation="MILLQAEHIEKTYGIETILQDISLQIQTGERVGLVGVNGAGKSTL
FT                   MKILAGELSYDKGIIRIPKDVTLGYLAQNSGLESERSIWDELLSVFSHLQKEELELREL
FT                   EAKMGDPAILADEKRYQQLLENYSHRSEAFKEKGGYSYEGAIRGVLHGLRFADFDYTTP
FT                   IRTLSGGQKTRLALAKLLLQSPTILLLDEPTNYLDIETLTWLETYLQNYQGAILVVSHD
FT                   RYFLDKLVTVVYEIERTRATRYVGNYSRFLDEKAARLEQDLKRFEKQQEEIAKLEDFIA
FT                   RNIARATTTKRAQSRRKTLEKIDRLDKPIMNNKSVHFSFDVAKMSGTIVMKANNVAIGY
FT                   PDAVLSQGLTFEIEREERVALVGPNGIGKSTLLKTIVEQLPKLRGDIHFGSNVTIGYYD
FT                   QEHRNMNERNTVLGEIWDEYPNMLEKEVRTLLGNFLFSGDDVQKKISDLSGGERARVSL
FT                   AKLMLKQANFLIFDEPTNHLDIFSKEVLENALYDYPGTILFVSHDRYFLNKIATRVLEL
FT                   TGDGVTSYLGNYDYFVEKKQELEELAAEQAALPAKKQGGTATAQPEKSSYELDKEVKRR
FT                   ERQRQRRLEEIEVTIQKREADIVKWEEELCLPEIYSDHVQAKERNDQIHAAKEELEQLY
FT                   DEWSTLSEE"
FT   CDS_pept        525980..526558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41495"
FT                   /db_xref="GOA:C0ZK44"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK44"
FT                   /protein_id="BAH41495.1"
FT                   /translation="MDQKTNKKQLRSHILERRKSMSAKEREQLSREVCDHLLSHERLAD
FT                   AKAIMAFHPFGDELDILPFLHEAKKRGQDIWLPLTNVAARRLIPYRYTGTDMLKQGVYG
FT                   IWEPDPALAEEADVSHLDAIIVPGVAFDSKGGRMGYGGGYYDRFLATLKKLPFLVGVGF
FT                   SIQVVEHVPLESHDVLLDAVVTEKGLLHF"
FT   CDS_pept        526690..527205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="BBR47_05190"
FT                   /product="putative molybdopterin biosynthesis mog protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41496"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK45"
FT                   /protein_id="BAH41496.1"
FT                   /translation="MSKWKVGVISASDSIARGDRVDDRMPIVRHLTREWLQVDVAVYRA
FT                   VSDDMEDLQEHMIELVDREKCDLLIVTGGTGLSPRDVTPEVTAWVIDRPVPGLAEEMRR
FT                   AGLKQSRRAMLTRAVAGTRGNSLIINLPGNPKGVEICFNAIGDMLSDALHILQGTGEAN
FT                   EDWGGLHW"
FT   CDS_pept        527217..528200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41497"
FT                   /db_xref="GOA:C0ZK46"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK46"
FT                   /protein_id="BAH41497.1"
FT                   /translation="MREVPVREAIGMMLPHDMTQILPGEFKGRLFKKGHVVTEADIEPL
FT                   LSIGKEHIYVLEMPEGYIHEEEAGIRIAKAVSGTGLTLTPPYEGKVSMKASRTGLAKIN
FT                   EEAVHALNQLEGIAFSTIYGDQVVHPGHTLAATRIIPLIMEESRIIELEQLAKQFDEPI
FT                   VQVKTFQDKRVGLVTTGGEVFSGRIADKFGPVIRNKVEALGSTVVDQRFAPDDKEAIEQ
FT                   QIQSFLAEGVDLILVTGGMSVDPDDRTPGAIAGVGAEVVRYGTPMLPGSMLMVAYKGEV
FT                   PILGLPGAVMHETFTSFDVFLPRILAGERIVASDMTRLGYGGLRKC"
FT   CDS_pept        528262..528654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05210"
FT                   /product="probable sec-independent protein translocase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41498"
FT                   /db_xref="GOA:C0ZK47"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK47"
FT                   /protein_id="BAH41498.1"
FT                   /translation="MSSIGIPGLILILVLALVLFGPKKLPELGRAVGHTLKEFKNATRS
FT                   LTSDDEDDDEEKKRKELASKEVSVAKTTPVVADKEAAERERIEREVREKMEREVREKIE
FT                   RERLEKEIREKLEQERLQLEKEQKNA"
FT   CDS_pept        528691..529452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05220"
FT                   /product="sec-independent protein translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41499"
FT                   /db_xref="GOA:C0ZK48"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK48"
FT                   /protein_id="BAH41499.1"
FT                   /translation="MTLVEHLTELRKRIIWVLAVFIVALIVGFFLAGPLVDYLKQEPIA
FT                   DGVPIVSLHPSDALRVYMQVAFLVGAVITLPVALYHVWRFVSPGLEEQEKRGTLYFIPA
FT                   ACFLFIIGVLFGYYVVFPMVMQFMTGITASMGADPNYGIAQYFGFMFNMVIPFGILFQL
FT                   PIIVMFLTRLRILNPMRLAKARRYAYFALAVVGITLTPPEIVSDILVTIPLLLLYELSI
FT                   WLSRIVYRKQLKEQEAWEQEYGSLETNEPVQ"
FT   CDS_pept        529356..529979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41500"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK49"
FT                   /protein_id="BAH41500.1"
FT                   /translation="MAIPDCLSQAIKRTRSVGTRIRQFGNKRTRSITSMRKVFCPEWQR
FT                   AFLVFRQKLRNTKDVMIREVLNMWRLIVCLALLFSGSTANAAGLGEPIELFDTDKQRVV
FT                   ASFENTTGFQEEAKQILQSVSGRVLEFNPSLDSAMIVKIPLVPPKPIKLKSANLDAMIA
FT                   EMFVIMPKKGERRPWLILHTKEYETVVVEFIEKVDDLRKQVKLP"
FT   CDS_pept        complement(530047..531366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41501"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR029410"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK50"
FT                   /protein_id="BAH41501.1"
FT                   /translation="MHKWLWIGLIALGVFGISRLFTSDTTSFIRVNLNPASIYWDGREI
FT                   VASEKPGYYMEKGKEIPASLEYEGTLYVPLSMISRHLNKPIGWDEASQSAWVGQPPVFS
FT                   VGQPEKQNTPDAVPASLTLPQKPATVKPPASPVREEKPNTIFDIALGMSSEEVHKRLGE
FT                   PARKEPSSLGYQWWVYNHEPARYIQVGIANNKVVDVYSLAPTAKLGNIGVGTSQQSLER
FT                   QLAVQNIVSFSFQGAQIQITNQKQQRPLVMKDGTPYIYYLDKQNGNKVTAVRMMDAQML
FT                   LRGSFYETKWTYQGQAPNFDPPPLRVGEREQVNAASERQILDLVNVSRYRYKLPPLQWN
FT                   EKAADVARKHSMDMESNNFFDHISATTGSNPFDRMKSASLAYSMAGENIAAGYTDAIEV
FT                   HEGWMNSPGHRKNVLEKGFTQLGVGVYTDYFTQTFLTPNK"
FT   CDS_pept        531632..531916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BBR47_05250"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41502"
FT                   /db_xref="GOA:C0ZK51"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZK51"
FT                   /protein_id="BAH41502.1"
FT                   /translation="MLKPLGDRVVIEAISKDETTASGIVLPDSAKEKPQEGRVIAVGSG
FT                   RVADNGERIALEVKEGDKVIFSKYAGTEVKVDNNEYLVLRESDILAIIG"
FT   CDS_pept        531972..533603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BBR47_05260"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41503"
FT                   /db_xref="GOA:C0ZK52"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK52"
FT                   /protein_id="BAH41503.1"
FT                   /translation="MAKQVKFSEDARRSMLRGVETLANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAYENMGAQLVKEVATKTNDIAGDGTTTATVLAAAMIREGLK
FT                   NVTAGANPMVIRRGMEKAVRAAVEEIKSIAKPVENKSSIAQVAAISADDPEVGNLIAEA
FT                   MEKVGKDGVITVEESKGFVTELEVVEGMQFDRGYASPYMITDTDKMEAVLNNPYILITD
FT                   KKISNIQEVLPVLEQVVQSGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPGFGD
FT                   RRKAMLQDIAALTGGEVITEELGLDLKSTKLEQLGRAGKIVVTKENTTVVEGAGDKASI
FT                   ESRVTQIRQQIEDTTSDFDREKLQERLAKLAGGVAVIKVGAATETELKEKKLRIEDALN
FT                   STRAAVEEGIVPGGGTTLINAIKAVEAINVGGEEAVGVQIVLRSLEEPVRQIAANAGLE
FT                   GSVIVERLKKEAVGIGFNAATEEYVNMLEAGIVDAAKVTRSALSNAASVAAMFLTTEAV
FT                   IADKPEENKAPMGMPDMGGMGGMGMM"
FT   CDS_pept        533808..534590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41504"
FT                   /db_xref="GOA:C0ZK53"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK53"
FT                   /protein_id="BAH41504.1"
FT                   /translation="MSKRWISFDLDGTLMQNPFGAWVFPEIARVISIQLGREHDIVSEM
FT                   VAEHEQRMSQKRYVEAYDWDDILASRCDAWSIEKMIDIESLVRKHSVMPKVKLLEDGIL
FT                   QMLEEIKKRGFSLAVVTNGFYKFQAPVMEALGLLEYFDEIITPERAGTGKPDPVILQKL
FT                   QGEVIAHVGDRLDHDVQLANRSHVTSILIERNLPEELLKLQPRMRANDHGMPLFCLEKW
FT                   RRECKNLLLLELPELFMPRMVIHSMGELLSALDEQGMG"
FT   rRNA            534890..536400
FT                   /locus_tag="BBR47_r0190"
FT                   /product="16S rRNA"
FT   tRNA            536463..536539
FT                   /locus_tag="BBR47_t0500"
FT                   /product="tRNA-Ile"
FT   tRNA            536557..536632
FT                   /locus_tag="BBR47_t0510"
FT                   /product="tRNA-Ala"
FT   rRNA            536716..536832
FT                   /locus_tag="BBR47_r0200"
FT                   /product="5S rRNA"
FT   rRNA            536949..539863
FT                   /locus_tag="BBR47_r0210"
FT                   /product="23S rRNA"
FT   rRNA            540090..541600
FT                   /locus_tag="BBR47_r0220"
FT                   /product="16S rRNA"
FT   tRNA            541663..541739
FT                   /locus_tag="BBR47_t0520"
FT                   /product="tRNA-Ile"
FT   tRNA            541757..541832
FT                   /locus_tag="BBR47_t0530"
FT                   /product="tRNA-Ala"
FT   rRNA            541916..542032
FT                   /locus_tag="BBR47_r0230"
FT                   /product="5S rRNA"
FT   rRNA            542149..545063
FT                   /locus_tag="BBR47_r0240"
FT                   /product="23S rRNA"
FT   tRNA            545117..545192
FT                   /locus_tag="BBR47_t0540"
FT                   /product="tRNA-Asn"
FT   tRNA            545200..545290
FT                   /locus_tag="BBR47_t0550"
FT                   /product="tRNA-Ser"
FT   tRNA            545315..545391
FT                   /locus_tag="BBR47_t0560"
FT                   /product="tRNA-Met"
FT   tRNA            545400..545484
FT                   /locus_tag="BBR47_t0570"
FT                   /product="tRNA-Leu"
FT   tRNA            545499..545572
FT                   /locus_tag="BBR47_t0580"
FT                   /product="tRNA-Glu"
FT   tRNA            545607..545682
FT                   /locus_tag="BBR47_t0590"
FT                   /product="tRNA-Val"
FT   tRNA            545761..545837
FT                   /locus_tag="BBR47_t0600"
FT                   /product="tRNA-Met"
FT   tRNA            545915..545991
FT                   /locus_tag="BBR47_t0610"
FT                   /product="tRNA-Asp"
FT   tRNA            546027..546102
FT                   /locus_tag="BBR47_t0620"
FT                   /product="tRNA-Phe"
FT   tRNA            546121..546196
FT                   /locus_tag="BBR47_t0630"
FT                   /product="tRNA-Thr"
FT   tRNA            546201..546275
FT                   /locus_tag="BBR47_t0640"
FT                   /product="tRNA-Gln"
FT   tRNA            546281..546356
FT                   /locus_tag="BBR47_t0650"
FT                   /product="tRNA-Lys"
FT   tRNA            546424..546505
FT                   /locus_tag="BBR47_t0660"
FT                   /product="tRNA-Leu"
FT   tRNA            546557..546632
FT                   /locus_tag="BBR47_t0670"
FT                   /product="tRNA-Gly"
FT   tRNA            546641..546717
FT                   /locus_tag="BBR47_t0680"
FT                   /product="tRNA-Arg"
FT   CDS_pept        546914..547867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41505"
FT                   /db_xref="GOA:C0ZK54"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK54"
FT                   /protein_id="BAH41505.1"
FT                   /translation="MNPIKLEQVNPAIASLIDNIEKVLIGKRSAIELMVAAVLANGHVL
FT                   LEDVPGVGKTMMVRALSKSISGDFKRIQFTPDLLPTDVTGVAIFNQKSLEFEFRQGPIF
FT                   ANVILADEINRTSPKTQSALLEAMEERSVTIDGVTYRLAEPFFVMATQNPLEYEGTFPL
FT                   PEAQLDRFIMQVSLGYPTVEEEMRMLSRFSAANPLEELQPVMTTAELAELQRQVSAIKV
FT                   SEGIKEYIVRLCHRTREHHHIYLGVSPRGSLALFRAVQALAFVRGRDYVIPDDVKELVP
FT                   VVFAHRMIVKPEARLEGATVDRVLAMILSETRVPVS"
FT   CDS_pept        547882..549087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41506"
FT                   /db_xref="GOA:C0ZK55"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK55"
FT                   /protein_id="BAH41506.1"
FT                   /translation="MRQQRWGKLKAIALVLVTYVFAKFQGGFSSWFLFYSSLVFLLYEI
FT                   VAYVLMFTKLEVERELDRNRLQDGEDVIVTIRLRRRIWFPLGWNMIMEPLPARLAGVYE
FT                   PHRQLIFPWFKREVEFRYVIPNVPRGYYHLDECVVSGGDFFGFFERRKVYSISQEFLVY
FT                   PKYKELTHWALGDGSFSGTVHVSHRRSDDVAAVRGVRDYHRGDRLSQIHWRASARGTGL
FT                   KTKEFEHQAMNQAVFFLDVEKASYQGKPVHLFETAVKLAASLIAYANRNQYHYGLVYKQ
FT                   TDRISIPPGLSHAHFLRVFDQLARVAPEGQELFARIVGREALEQPQGVTLIIITPHVEK
FT                   TLISRLVTLAQKGRRVQLFLMQNESTISHEQKQALQLLGANKVTCTSIHMDDQEWKRIG
FT                   GA"
FT   CDS_pept        549080..551326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebA"
FT                   /locus_tag="BBR47_05300"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41507"
FT                   /db_xref="GOA:C0ZK56"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK56"
FT                   /protein_id="BAH41507.1"
FT                   /translation="MHRLMSVWRRPTIWEWVLALFLFLMLREWLIPLQTLTDTGILWPF
FT                   YAIVGGVIIIDLLIPYRWLTLPIKALGLIVLLHATLFDKPFFDSEWIGQLYGQMIHDLP
FT                   LAFQQDWASMSILSRNTMFDLVLVLLATMLTYLVLEQRQGLWFVFLTELYLAVLDTFLP
FT                   YDASAGVVRTLIIGFLMLAISHLMKMMNMATLAGKRSRIMLNSLMASVLVIMACISIGY
FT                   AAPKSGPSWPDPIAFLTGKGKDTPVGVMKKVGYDNNDERLGGPFLQDNTLVFIAKTNEH
FT                   SYWRGDSKDVYTGVGWEKGDREYESILDPQTYTWENTLFQGLETKKVQATLEFKGPQQF
FT                   PTVFYQGQLKKVSNYAPPEATVVYDKMNQQLEVRAGKINLVQLSEKNGRPEYGPNPLLL
FT                   KLNQYKVETEVPIVSEKAVTNAGTNYPDDIKERYLQVPASVPPRVRELAATITKDAKTP
FT                   YDKVRAIENYLRSSGKYKYETKDVPVAPEGQDFVDHFLFDSLRGYCDHFSTSMAIMLRT
FT                   LDIPTRWVKGFAPGERVGTDAFNYETVEVRNKDAHSWVEVYFPGVGWVPFEATSTFMSP
FT                   VRFNYDLVTSKPEIPVPLPNLANQTDSDRGNGRFNELEEGDSPAGSGIKIPWQVNAGLA
FT                   VVVVAAGIIVWRRKQDIQLWWMRRQLNQERSSEFPDRYHLLMRMMERVYTRRQPGETLR
FT                   EYVGRMTLPADKRQDLRYLTELYERTVYGYKQMEQNARTIAEQILERLIRQLKP"
FT   CDS_pept        551605..553146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BBR47_05310"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41508"
FT                   /db_xref="GOA:C0ZK57"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK57"
FT                   /protein_id="BAH41508.1"
FT                   /translation="MMDKSMEMVVVLDFGGQYNQLIARRVRDLGVYSELIPFNTPVEKI
FT                   KEMNPKGIIFSGGPASVYEEGAPTVDPAIFDLGLPVLGICYGMQLMSHLTGGKVERAGK
FT                   REYGKAELRMQQKHGLYDKWDTSEIVWMSHSDKVVELPTGFVIDAVSDSCPVAAISNIE
FT                   RQLYGVQFHPEVVHTQKGTEFIGNFLFNVCGCEATWSMTTFIEDELVRIRETVGNKQVL
FT                   CALSGGVDSSVVAALIHKAIGDQLTCMFVDHGLLRQGEAEGVMETFGEKFSMKVIKIDA
FT                   RERFMSKLKGVSDPEQKRKIIGNEFIYVFDEEAAKLTDMDFLAQGTLYTDIVESGTATA
FT                   QTIKSHHNVGGLPEDMKFTLIEPLKALFKDEVRKLGTELGLPDEIVWRQPFPGPGLGIR
FT                   VLGEVTEEKLKIVRESDAILREEIAKAGLDREIWQYFTALPNMTTVGVMGDVRTYSYTV
FT                   GIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVDNVNRIVYDVTSKPPATIEWE"
FT   CDS_pept        complement(553214..553699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41509"
FT                   /db_xref="InterPro:IPR028921"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK58"
FT                   /protein_id="BAH41509.1"
FT                   /translation="MSYMDAWEQIIAEQERERDRLRVNRVTVRVEGMKKSKHNVHQKEK
FT                   VIEYGFVERDLYDENLIGRFELYFADRDTLLQQDRFGDEFAFGELTDEHAVATAIFSYL
FT                   AEHYSQFLEETPFAISYNPIAEAWIIEGTLPPGWLGGVIYIALAKENGKLLMMYGTK"
FT   CDS_pept        554115..555491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbuG"
FT                   /locus_tag="BBR47_05330"
FT                   /product="hypoxanthine/guanine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41510"
FT                   /db_xref="GOA:C0ZK59"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK59"
FT                   /protein_id="BAH41510.1"
FT                   /translation="MRKYFEFDKLGTNYRREIIAGITTFLAMAYILAVNPFILSGADLP
FT                   PDLKANYPAFGAVFTATALAAALGTLLMGIFGRLPIGQAPGMGLNAFFTYTVVLTMQIP
FT                   WQQALAGVFLSCTIFLILSLTGVREAIIKAIPQSLKYAVSAGIGLFIAFIGLKNAGIIV
FT                   ANDATFVALGHLTFYHEGMKPEAILAAKNALLAVFGLIVTVILLSRKVNAGIFIGMLIT
FT                   AITGMFFGLVNLPEQVVSAPPSLAPTFGAAFEYLGNPSALFTVNMLIVVLTFLFVDFFD
FT                   ATGTLLGVASQAGLLREDGNLPRPGKALASDAIAGMAGAVLGTSTTTAYVESTAGVAAG
FT                   GRSGFTAVVTGIMFLLALFFSPILAIVTPAVTAPALIIVGVLMASHIAKVAWDDLDEAF
FT                   PAFLTILLMPLTYSIATGIATGFIVYPVMKVMKGKAREVHPAMYVLFFVFLAYFIWLRE
FT                   "
FT   CDS_pept        555786..557087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="BBR47_05340"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41511"
FT                   /db_xref="GOA:C0ZK60"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK60"
FT                   /protein_id="BAH41511.1"
FT                   /translation="MENEVLKTVKGTKDFMPQEQMQRNWIRRTLEAVFETYGCKPLETP
FT                   MLQHYELLASKYGGGDEILKEVYRLNDQGDRELGLRYDLTVPLTKVVGMNPEMRMPFKR
FT                   YEIGKVFRDGPVKTGRLREFIQCDVDIVGTTSVLAEAELLSMAFEAFKRLGLDVYIEVN
FT                   NRKLLSGVLQELGVPVERAGDVMLSLDKLEKIGVDGVRDDLRERNVEESLVLAITSFLQ
FT                   EGVITLDLLKERFTSPLVQEGIRELREMLAYVTGAGVAGELRFSPFLARGLGIYTGIVY
FT                   EIFLQDGSMTSSIGSGGRYDQIIGRLLDDGREYPAVGISFGLDVILAALANRNTEEQRA
FT                   ADVLVIPLGTEASSLGLANRLRESGIRVELELTGRRLKKALDYANKEGFAFALIYGENE
FT                   VNSGQVVVRDMREGTEQPVPLELVEKWLSDKLSG"
FT   CDS_pept        557147..558643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41512"
FT                   /db_xref="GOA:C0ZK61"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK61"
FT                   /protein_id="BAH41512.1"
FT                   /translation="MKKWVSLVGCSLLFLTWMLPVNAEEGTALTRKPLYQADVRIDPIK
FT                   KEVAGTVTITFWPKDPTRAYLHLYPNVFTEEHQGMLWEELLGNGPTLGTYTNKKLLVDG
FT                   IAVASKQTKDLNIFEVPLEGQTGPRTIVMEFEMTLPRNDGRMSYDDHSLWLGNWLPVLA
FT                   VYDKEGWHLDPYEPVGDPFYSENADYEVNVTLPKEYQLASTAPDMAAKQVSTREGEKRI
FT                   QLGAENVRDFALVVMDASYQRTETKVGETVVRTWWRKTDDPETAEQIHEAAAKSLAYFH
FT                   HQLGAYPYTEYDVVRTGGAINGMEYPALVFLDGRHFFSGEETGIVTVVHETAHQWFYGL
FT                   LGNNQVKEAWLDEGFTEYVTLSYLSQQDPLLGAERVRRRLGQGTSVQYYVAEEQRPWQA
FT                   LSAFPNNQSYSDLVYSRTSSMLWLLQGAWGEERVHDVLKQYVEKYRYQVVTGKEWGAFL
FT                   SEMAGEDAGAFLDYWLKVDMSQQEQAAAWLERQRLKHQKK"
FT   CDS_pept        558663..560201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41513"
FT                   /db_xref="GOA:C0ZK62"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK62"
FT                   /protein_id="BAH41513.1"
FT                   /translation="MWRKHWVVIVAVGVVLTVFLNIRPWTGQAGVDAQEIVPIGHKQAA
FT                   VTYKADVQIDMNKHMVKGMLTARFFPKDDQAFFHLYPNAFSANAALSGENWEAVLGKQR
FT                   EPGGIRINEVRVNGKSVGVQYAGKTNMLLQVPLPARTSNAETVVEMNFQLEVPYNNGRM
FT                   SYHDHAMWLGNWLPILAVKDVGGWRLDPYSAIGDPFYSDVANYHLRVQLSEGYQLATSG
FT                   LESVAVITETRPQRLKIYEVDAWNVRDFALVVMDDTYQPISGKVGETIVRTWVQISDDP
FT                   QNVERIHETARESLDYYGKQFGVYPYKEYDVVKTGGFFGGMEYPGLVFIAQEYFDRSDA
FT                   MGEAIVAHETAHQWFYGLVGNDEVREAWLDEGLTDYATMIFLQQKSPTRSQAYIQMRLG
FT                   QARAAEGYANQGVTAKSSVEAFPDWRSYNDLVYGRAGAMWWNLKEEWGVERLHQMLRQY
FT                   VRDHQYKQANGEQISLLLTTAAGADASPYLDYWLQVELEKAEAANDWVEKGKHE"
FT   CDS_pept        560383..560871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BBR47_05370"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41514"
FT                   /db_xref="GOA:C0ZK63"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK63"
FT                   /protein_id="BAH41514.1"
FT                   /translation="MLQPLVGVIMGSTSDWETMKEACAILDELQVPYEKKVVSAHRTPD
FT                   LMFTYAETAKSRGLEVIIAGAGGAAHLPGMVAAKTELPVIGVPVKSSNLNGLDSLLSIV
FT                   QMPGGVPVATVAIGKAGAINAGLLAAQILGIKYPDVQERFVQRRDDVRNKVLEASELE"
FT   CDS_pept        560868..562031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BBR47_05380"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41515"
FT                   /db_xref="GOA:C0ZK64"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK64"
FT                   /protein_id="BAH41515.1"
FT                   /translation="MTTKDRKQIKPGSTLGILGGGQLGRMIALAGRAMGYRFVTMDPTA
FT                   DAPCGQTADRQIVASYDDVEAAMQLASVSDVISYEFENVDAQVAEVLESRAYVPQGSRL
FT                   LRITQNRIREKTAIREIGIPVAPFCVVNSLEDLQDAVRELGLPAVMKTATGGYDGKGQW
FT                   VLRSEAELAEAYETLSKAGAELIVEQFVPFQMELSVVAARNPAGELAVFPVSENIHQEN
FT                   ILHLSIVPARISAEVAARAEEIARTIVEKLDVVGLIAVELFLTEDGQLYVNELAPRPHN
FT                   SGHFTMDACVTSQFEQHVRAVCNLPLGSTELLSSVVMVNILGEHLQPVIDQIDKLPRTA
FT                   KLHLYGKAESKAKRKMGHINVLAPTVEEALTLIDELKIWTNTSEVLS"
FT   CDS_pept        562028..563323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BBR47_05390"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41516"
FT                   /db_xref="GOA:C0ZK65"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK65"
FT                   /protein_id="BAH41516.1"
FT                   /translation="MIERYSRPEMRAIWTEENKFKAWLEVEILACEAWSKLGVIPEEDV
FT                   KKLWDKATFDINRIYEIEEETRHDVVAFTRAVSETLGEEKKWVHYGLTSTDVVDTALSY
FT                   LLRQANEILEKDIQDFIEILADKAREHKDTVCMGRTHGVHAEPTTFGLKLALWYEEMKR
FT                   NLARFQAAKKEVAYGKISGAVGTYANIDPFVEAYVCEKLGLSAAPISTQTLQRDRHAEY
FT                   MATLALIATSLEKFATEIRGLQKSEMREVEEAFAKGQKGSSAMPHKRNPIGSENICGLA
FT                   RVIRGHMLTSYENVSLWHERDISHSSAERVILPDATQALNYMLRRFMNIVKNLTVFPEN
FT                   MKRNMDRTFELIYSQQVMLKLIEKGMSREQAYDTVQPRAMQAWEEQRSFRAIVDEDATV
FT                   SSTLSKEELDECFDYRYHLKHVDTIFQRLGLI"
FT   CDS_pept        563494..564069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41517"
FT                   /db_xref="GOA:C0ZK66"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK66"
FT                   /protein_id="BAH41517.1"
FT                   /translation="MNPLLLSFPEQFETQRLLIRAPQWGDGQFVNEAIRESVNEMRPWL
FT                   PFVKNLPSIDDSEAYVRKARINFLERTDLVLHIFEKNTGQFVGSSGLHRFDWNVRKFEI
FT                   GYWLRTSRTGEGLMTEAVKGIVAFAISELEANRLEIRCDTRNNASIAVAKKVGFTLEGT
FT                   LRNVNLNDSGKLTDTHIFSLAKGYEYHL"
FT   CDS_pept        complement(564218..564337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41518"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK67"
FT                   /protein_id="BAH41518.1"
FT                   /translation="MIAVVIIDLPFRDPYELISLYGRNEAGTIELYFRKLTLL"
FT   CDS_pept        564321..564836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05420"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41519"
FT                   /db_xref="GOA:C0ZK68"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK68"
FT                   /protein_id="BAH41519.1"
FT                   /translation="MTTAIMYPKLNHQQIYEDYSAKIYRYFRYRVKNVWDVEDLTTTVF
FT                   IKVYSKLEQYDGRHPFGAWIFRIAHNALIDYMRKKRESPVDQDTFSNMVATDKLPEECL
FT                   LNQETTEGLWDKVHTLTKDQRNVIALRYLGDLRMNEIAEILGKTEASVKILHFRGIKKL
FT                   QQLMTEQA"
FT   CDS_pept        565406..566104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxdJ"
FT                   /locus_tag="BBR47_05430"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41520"
FT                   /db_xref="GOA:C0ZK69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK69"
FT                   /protein_id="BAH41520.1"
FT                   /translation="MSTIMIVEDDPKINQLLQEQLEKYGFQTVNVEHFDRVMEVFTQSR
FT                   PDLVLLDVNLPKFDGFYWCRQMRQESNCPILFISARESKMDQVMALENGADDYITKPFD
FT                   YDVVLAKIRSQLRRAYGQYAPQEGERTVEVAGLKLFLERMELSMYETKIELSKKEALLL
FT                   EALMNQHPRVVSRERLLEKLWDEQFVDENTLNVYITRVRSKLKDLGLEGAVETVRGSGY
FT                   RLRATWEEGQ"
FT   CDS_pept        566101..567117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxdK"
FT                   /locus_tag="BBR47_05440"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41521"
FT                   /db_xref="GOA:C0ZK70"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK70"
FT                   /protein_id="BAH41521.1"
FT                   /translation="MKLFLRDQWPFAAFFLVQLILLIMIFALDGYWNESLMIYVMFLSI
FT                   FFAGAFLVVRYLSHRTIYQRLSKPVESLEELTQTYGNSPLCRAMDDISQEQYRLYKEQL
FT                   HAYENKQRDHTTFIQQWVHQMKTPISVIHLLLQNEDDPTAESVREEVDRIKRGLETVLY
FT                   IARLDRFEQDFLIEPVTLRSLVQNVLAENKRLFIRNQVYPEVKVDENWRVESDDKWLAF
FT                   VLNQLLTNAVRYSAGKSNKVTIRAYERGAHAILEVQDYGIGIPAEDIHRVFKPYFTGEN
FT                   GRKYPESTGMGLYLVKEICGRLHHGVEMESEVGEGTTVRIVLSAIVPTLQESKIAES"
FT   CDS_pept        567185..567955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxdL"
FT                   /locus_tag="BBR47_05450"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41522"
FT                   /db_xref="GOA:C0ZK71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK71"
FT                   /protein_id="BAH41522.1"
FT                   /translation="MEMLAVNSLSKIYGGKVTYRALTDIDFSIRKGEFVGIMGPSGSGK
FT                   TTLLNMISTIDTPTSGAVLLNGTNPHHLKKDKLALFRRRELGFVFQDFNLLDTLTIGEN
FT                   IVLPLTLDNEKVAVMEEKLQSVAEKLGIQDILEKRTFEVSGGQRQRTAIARAIIHSPSL
FT                   LLADEPTGNLDSKSSRNVMETLEAINKRDNTTMMMVTHDALAASYCHRVIFIKDGQLHN
FT                   EMYRGESRQVFFQKIIDSLSFLGGNTYDLSTIRV"
FT   CDS_pept        567930..569816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxdM"
FT                   /locus_tag="BBR47_05460"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41523"
FT                   /db_xref="GOA:C0ZK72"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK72"
FT                   /protein_id="BAH41523.1"
FT                   /translation="MTFRQFACNNVLRNKRMYAAFFMSSVFSVLIFFVYAMFIFHPEII
FT                   GQEIHESVATGMMAAEYVIFLFSFFFLFYCVGAFLKKREKEFGILFIQGMTPLQRNMLI
FT                   FMENMLIGIVSIAIGIGVGLVLAKLFFQFAGFLLAVKALGFYFPWKAIGLTVVAFLILY
FT                   AAISLFTVLVLRSRSLLDLLQGSGRPKREPRASLVLSLVAVALLGMSYALALTADGVNV
FT                   LVLMLPVIALTTVGTYLLFTQLSVIFIDFLKKRRTFYWKRTNLLTLSDLAYRMKDNARM
FT                   FFLVSIVSTVAFCAIGTLAALAGSIQITVMKINPFAFEYQSKQSDVERAKHLSLIETSL
FT                   QQGGFSFEKYQVAMRVLPEPINEEKIGVVKLSDYNRLAVASHSPELQMTNGEVFVMLNW
FT                   IGDSVASKTLQVGNAQLAVKTDTNMTPLIKGLEFERLAVVPNQVYDQLPKAKEEQRFVY
FT                   EVPRWKETQDLSLKLQDEISHFDENYSFSARAPYYHTMKQMANMALFIGLFVGVLFFVA
FT                   AASFLYFRLYTDLEYDKRHYGSLSKIGLTDAELTRIVTTQIALLFFVPIVVAIIHSMVA
FT                   FVSLQSLLKLILVASVFKPTAIVLCSFVVVQGVYFWIIRNRYLFHLKQSMNR"
FT   CDS_pept        569889..570359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaD"
FT                   /gene_synonym="gde"
FT                   /locus_tag="BBR47_05470"
FT                   /product="guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41524"
FT                   /db_xref="GOA:C0ZK73"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK73"
FT                   /protein_id="BAH41524.1"
FT                   /translation="MERETWMGQAVQIAFENVRDKVGGPFGALVVKDGQVVGRGRNEVT
FT                   TSNDPTAHAEIQAIREACRHLETFQLNDCDLYTSCEPCPMCLGAIYWARPRNVYYACTK
FT                   EDAAHVGFDDQFIYEQIVLPHEERSIPFQRIDLANKRSPFEAWSQSLDRIEY"
FT   CDS_pept        570563..571039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05480"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41525"
FT                   /db_xref="GOA:C0ZK74"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK74"
FT                   /protein_id="BAH41525.1"
FT                   /translation="MEETFRRSLYPDLDDIDYGIIRALQGNARLPFTQIAKDLGVTEKT
FT                   IRMRVQQLQDEGALSLVGIVNPVKAGFHVQAMIQVAVDAEKLDDVVAALMETVEIRLIV
FT                   LTSGEYQLFTQVLVTSNEELSQFLLKKLHKIPGISKTNVINELKILKSKYNFIR"
FT   CDS_pept        571064..571645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05490"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41526"
FT                   /db_xref="GOA:C0ZK75"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK75"
FT                   /protein_id="BAH41526.1"
FT                   /translation="MIYWQLFLAFFRIGIFGFGGGPTMVPLFYTECVKKYKWVTDEDFS
FT                   DNLALGNALPGPIGTKLAAYIGYRVKGWKGALVANIAVVMPIVLVMIGLLQVIYQWKDA
FT                   PGVYGMIQAIGPVIAVMTGVLTWEFLSKGWKGASSKAGVSLSLALSLVALLFLDWHPGI
FT                   VVGIALTVSFAYSTWSVRKRKDKDGKEGVA"
FT   CDS_pept        571642..572175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05500"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41527"
FT                   /db_xref="GOA:C0ZK76"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK76"
FT                   /protein_id="BAH41527.1"
FT                   /translation="MIYLQLFWAFFISNILGYGGGPPSIPLIQNEVVDHYQWMSVQEFG
FT                   EVLAVGNALPSPIATKLAGYIGYQVAGVPGAVVALFATVAPTAIAMVLLMGFINLFRSA
FT                   PQVKAMTQSVRPVVTVLLGTMTYQFLMGAVEGIGWMQTGILTVASYLLLETWKVHPAFV
FT                   ILGAMAYGFVFIRP"
FT   CDS_pept        complement(572197..572373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41528"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK77"
FT                   /protein_id="BAH41528.1"
FT                   /translation="MSQHSGGEEKAQFSSTLTRQQGGITDRLHLKKGTVEPKPPYGRKF
FT                   LKEEVFDKRGPLF"
FT   CDS_pept        572447..574057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05520"
FT                   /product="putative gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41529"
FT                   /db_xref="GOA:C0ZK78"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK78"
FT                   /protein_id="BAH41529.1"
FT                   /translation="MVDYDAMEYPYASKRVTTFAKNGMVATSQPLAAQAGLDILKKGGN
FT                   AVDAAIATAACLTVVEPTSNGIGGDAFALVWIKDELHGLNASGPAPQGISIEALKAKGL
FT                   KEMPTYGWTPVTVPGAPAAWAALSKRFGRLPLTEVLQPAINYAENGYPVSPTLAHNWDV
FT                   AYRKLSQQCNGEEFAHWFSTFTPDGKVPKAGEIWKSPGHAKTLRQIAETNAESFYRGEL
FT                   ADKIDAFSRDCDGYLRKEDLAAYEPEWVKPIGVNYRGYDVWEIPPNGQGMIGLMALNIL
FT                   KGFVFDAKDTTETYHKQIEAMKLAFVDGLKYITEESKMKVSKEALLSEEYAATRRALIG
FT                   HEALTPEPGQPKTSGTVYLATADGEGNMVSFIQSNYMGFGSGVVVPGTGIAMQNRGHTF
FT                   SLDPAHDNCLEPGKRTFHTIIPGFLTKDGKAMGPFGVMGGFMQPQGHVQVVMNTIDFHL
FT                   NPQASLDAPRWQWMEGKTVELERHFPEHLALALERRGHTIKWAQLGNYFGRGQIIWRDE
FT                   NGVLSGGTDMRADSSIAAW"
FT   CDS_pept        574098..574427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05530"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41530"
FT                   /db_xref="GOA:C0ZK79"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK79"
FT                   /protein_id="BAH41530.1"
FT                   /translation="METLPPSVWSVYYICILITIISGIAYLIRKQRPLFSMITIFFSIV
FT                   GPIVFFLQSLVRGSGTEIDNLLYHLTQGDIWAMFVILAFMEIVAWYLTLAKDLFSKREP
FT                   NNRVS"
FT   CDS_pept        574620..574991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05540"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41531"
FT                   /db_xref="GOA:C0ZK80"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK80"
FT                   /protein_id="BAH41531.1"
FT                   /translation="MNTILIVDDTAFTRLVLRNMFEKLGIEVVAEADSGEEAVRNYCLY
FT                   RPSLVIMDITMPGMNGLVASRKIIELDKNAKIIICSAVARRDTVIKAIQAGARDFIAKP
FT                   LQFERIEWAVQHLLETDSR"
FT   CDS_pept        575288..575707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05550"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41532"
FT                   /db_xref="GOA:C0ZK81"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK81"
FT                   /protein_id="BAH41532.1"
FT                   /translation="MNSILIVDDTAFTRRVLRNIFETLGLHVVAEAASGEEAVRNYCLY
FT                   KPSLVTMDITMPGMNGLTASRKIMELDKDAKIIICSAVSRNDTVIKAIQAGARDFIAKP
FT                   LQLERIEWAVQKLLGTGVDDCCGDRQEKQIAEVLA"
FT   CDS_pept        575704..577908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05560"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41533"
FT                   /db_xref="GOA:C0ZK82"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK82"
FT                   /protein_id="BAH41533.1"
FT                   /translation="MKVLITGGYGFIGSFVAERFYKEGYKVFILDNLSSGNQRNVTFPH
FT                   KAYELDVADKKCDEVFKSNKFDVVIHLAAQVSVAASMEDPLLDTNTNILGLVNMLKLSS
FT                   KYGVSKFIFASSAAVYGMNECTPLLEDSGCDPVSVYGINKHIGEMYCRKWTEMYGLQTV
FT                   AFRLANVYGPRQSAGGEGGVISTFLTQINHGKEIVLHGDGSQTRDFIYVEDVADAIFRS
FT                   VTTDDTGVMNLSTNQESSINELIDILGANQPLQGISRREKRPGDVDKSVLDNTWAKRRL
FT                   DWIPMYSLAEGLEKTAQWYQETVAEKEQEQESEAKKAIHWLRSWDARPYLENILAFLLV
FT                   VFATVGTVNSGVFDLKLIYIVLIGAIYGTKQSLLSVILACGLFIGESLHNGRDVVSLLY
FT                   DANVLFHIAVYFIIGIAVGYSIDKRNRDVLSKELQKQALEDKYDFLKDIYNDVLMVKQE
FT                   LQQQIVNSEDSFGKIYNITKELDSLEPERVLQKSVKVLERIMKSDEIAIYTMNQNGSFL
FT                   RLMAKSNKAGFDLPRSLKMSEHAYLTELMTMKKIIVNKELRHDMPLIAAPIFDKGKMVA
FT                   VVTLQQLGFENFTMYTQNLFQVAVQLISSALSRSLRYLNSTQKDRYLDDTPILIPAYFS
FT                   AMVKNKRDAKQQLNTDFTLLAVDFAQMDHHTLATYIASSLREADYMGMDEAGNVYIILS
FT                   NSNEQEARIVIDRLGRLGIASRIVQEKDQDRFSLKDGAYV"
FT   CDS_pept        577901..578863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41534"
FT                   /db_xref="GOA:C0ZK83"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK83"
FT                   /protein_id="BAH41534.1"
FT                   /translation="MFNLVLLHVLVSVGYSWMQSRGKNKQVLIMRMLVTGFLPIFGLLL
FT                   LGITDVYKRTSKKNVNELMLESDLLKLAEGSNIFRRADMEKEMNIVPVEDILFLNDTST
FT                   RRKMLIDVLKEQTIWQIGTLETALQNEDSETVHYAAAALTEMRRNLQLQLQDLSVKYEE
FT                   NKQELAVLRAYADVLKKYLDSSLLDQRTYVKYSYTYSFVLESLLDIYQEEESYFVDKIN
FT                   CELGNQSYEKAEQYCQLFHEYHPESEQPYVMSLKRFFTIRDYAGFVAEMNRLKSSSVKI
FT                   SHATLMMIRYWNDEQDSNWAEVAVTQEIGTKLKEMSDTK"
FT   CDS_pept        578944..580767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41535"
FT                   /db_xref="GOA:C0ZK84"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018695"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK84"
FT                   /protein_id="BAH41535.1"
FT                   /translation="MKKNIYIILIFVAILGITIEATRSQFILQVSSNKSGGSGKEADEP
FT                   KQNAISQEEIAKLVRERFLILHDSKDESSMAIARNVEQVLRYMKKEYELADVKQFSKPD
FT                   PQYMTVIVTIENLDMLANLDAMMQYAHNGGNVFFSRTPEYNDSLYRIYRKLGINSINLP
FT                   IVTNGIQMTSNLLIKGEDAKIGADAIVNSSIPVELNRQAKVHAVSADNMPLLWETRYGQ
FT                   GKLMVYNGTNMQSAMNRGLIAGGISLLNPDFMYPIFNMKVMYIDDFPAPFRQGIEPSIY
FT                   REYRKDIPSFFRDVWWPDMIKLAADYDVTYTGAIINTYNNRVAPPFTDEEGTDSNNLIT
FT                   YGRDLLKMGGELGIHGYNHQSLVTDQETASHYEYKAWPDEASMTESLTYLDNYIKKVFS
FT                   AYDIQTYVPPSNVLGEEGRRALKKSFPDLRIIASLYAESDSTHEYIQEFSVAEDGIVEL
FT                   PRITSGYSRTDIHDWYITNAITSIGVFSHFVHPDDVLDKERSNNKSWSELVKDFQLMLE
FT                   ELYEQYPWLRSQTASEAATSLESYLQTDVYISHTDKKVTGYMNNFSEDMYYILRTNKKM
FT                   TSLVNCTVEKIEEGVYLVHTTGAKFEIGLEE"
FT   CDS_pept        580771..582177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41536"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022622"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK85"
FT                   /protein_id="BAH41536.1"
FT                   /translation="MKICLIAEGSYPYITGGVSSWIHSLIASMPEHEFIIYAIGAEEKN
FT                   RGKYVYQLPENVVEIKEVFLDAYLKEEAAPGKRLGLTEDEQQALLSLLDGSKGDWHALF
FT                   SVLSGSKVPSVAELLTSKDFFEVIQRLCEQKYPQIPFTEMIWMIRSMVLPLCQIIQNGM
FT                   PQADLYHSVCTGYGGVAGSLGKYLHAKPFLLTEHGIYTREREEEIIKASWIKGHFKDIW
FT                   IDYFHNLSACAYSYADEVITLFERNKEIQIELGCDPSKVSVIPNGVKVSDYADIVEEKK
FT                   DDTITIGAVVRVVPIKDIKTMLHSFGLVKEQVPHARFVIMGPTDEDEEYYTECLQLVDS
FT                   LQLESVTFTGAVNVKEYLGKMDMLVLTSISEGQPLVILEGMACRKPFVTTDVGSCRELL
FT                   YGNGDSYGSAGITVPVMHFTQIAQAIITLCQNEPLRRRMGRCGFQRVSEIYTHENFLAG
FT                   YRKMYRKYEV"
FT   CDS_pept        582183..583583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05600"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41537"
FT                   /db_xref="GOA:C0ZK86"
FT                   /db_xref="InterPro:IPR031617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK86"
FT                   /protein_id="BAH41537.1"
FT                   /translation="MAGIGFELKKMFRNKGYLSSVKAYAFSSLVTVGPMLICMVMITVL
FT                   QQVLLQLNVSYLERMSFLAAVVYAFVFSLLVTCGFSMVISRYIADKIYLREYNDIIASL
FT                   YGVIAVCLGLGGILGGAFYWLAPLPSGFKLVAYLLFVELIVVWLQSAYLSALKDYMRII
FT                   RGYLAAVSVTLLAAFLLSYLTELEKGIAMLISLDLGFFIMIVLSMVHLESYFPKRERNY
FT                   FDFVKYMKKYPSLLGVGLFCSLGFYVHHFIYWLGSPLQEVVADTYVIAPFYDVPAFYAS
FT                   LSILPTMVMFVVSVETAFYEKYRAYYGTILGTGSVQDIKRAKTDMVQTLMQELSFMMEV
FT                   QLFFSFVALALGITLLPHIGFTSEQMERYNILVIAGYLYAVMFVVVLMLLYFDDRKGAL
FT                   AVTTLFLISTVVITIAMLPLHNYGFSFFIASFLALVAGLGRLIYYLKNIDYYTYCLQPL
FT                   FVKGKRME"
FT   CDS_pept        583615..585339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotH"
FT                   /locus_tag="BBR47_05610"
FT                   /product="putative spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41538"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK87"
FT                   /protein_id="BAH41538.1"
FT                   /translation="MKKKRFILSLLVAFGVVTTGCTQDVPEQPVSDNPSATSQVAPTQQ
FT                   LNEGLIENRSVYDQDVDGSIVHLYVTVVNEENSKLKTTTFTELNLAPSGRNEKGEDLQA
FT                   KVIMQEGTAEGPTQGHFGFGETRANGTIELRGESSRRAEQKSYKIRLFESAGYWRDQRN
FT                   INLSKHKSDMTRVRQKLSFDYFEQMPNMTSLRTQFVQVKIKDLTKKNPDRDFVDYGLFT
FT                   QIEQPNKTFLQAHGLDRNGNLYKAIDFEFHRYEDQIKLATDPTYDKKAFEKILEIKGSE
FT                   NHEKLIAMLEDLHNSAMNTQDFLDKHFDRDNYYTWMASNLLMGNHDTAVHNFYLYSPSN
FT                   SNKWYFLPWDYDSTWGFFEEELKRSPEKGLGPWQFGLSEYWVSNLHRRVFKDPENIKAL
FT                   NEKVEEVSKIITKEQTEKYLQSYYPIVSKYVLQLPDLYNLPLDVSYFHKEQALLSGEPE
FT                   RNKKRYYERQENPMPFFMGEPRKEGDKLIFAWDHSYDLQGDDLTYDFAVSYDPAFTKIH
FT                   AQAKGLTGVQYTINDPGKGRFFWRVIVRDSKGNVQTAFDRVEPEDAIYHGVKEFVLK"
FT   CDS_pept        585336..586070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41539"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK88"
FT                   /protein_id="BAH41539.1"
FT                   /translation="MKGIQSTGIQLGNKRLRHELKYYLRLSHYEPLRQKLRLIATPDPH
FT                   SVSEEGYHIRSLYFDDYHDTALYEKNYGVFQRKKYRIRIYNKSDAVIKMERKSKFGGYI
FT                   CKESASITRDEYEQILAGDVEFLRETESAVLRDFYLSCKNHLFRPRVITDYVREAYLVR
FT                   EGNVRITFDKYLKANVNSLDIFDEHIMMVRAIHQPMMIMEVKYDQFLPFNMRLLLQNLS
FT                   NQRSAISKYVICREETKKYYNL"
FT   CDS_pept        586093..586779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05630"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41540"
FT                   /db_xref="GOA:C0ZK89"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK89"
FT                   /protein_id="BAH41540.1"
FT                   /translation="MDTTNTITFQDIIKKSVLKMDQFASISIIDTVIGLVLSGVLGLFI
FT                   YYIYKKTFRGVVYTHTFNITLVAMAMLTCLIIMTISTNIVLSLGMVGALSIVRFRTAIK
FT                   DPLDIVFMFWSISVGIATGAGVYPVSVLGSLVVAGVIVVLSKRQMRDVAYLLIITYQDE
FT                   ANDGVKYQLNKLKYTLKSKTVNKEMVELIVEVKIKGDNTAFVQDISEVEGVKNVSLVSY
FT                   DGDYAP"
FT   CDS_pept        complement(586852..588246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41541"
FT                   /db_xref="GOA:C0ZK90"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032267"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK90"
FT                   /protein_id="BAH41541.1"
FT                   /translation="MKLRSVLYSVLLATFCILPSSAAASSYGTATYSPKQTQDVLRNPY
FT                   MGLAPDSGTSNLEQEHTLVYANLTWRMLEPTKGDYAFDEVEDAIRFDEWTEKDVKFILR
FT                   IVMDIPHTKSDMEIPDWLYNEIGGDNDNFEDGEWYRNDYGKGYSPNYSNPLIIKYHKQL
FT                   IDALGERYKDDPRIAFIQLGSVGHWGEWHTDTSIPFPATEVTDQYVQPYLDNFPDSMLL
FT                   MRRPHPVAKEYKLGLFNDMFGNKEDTDSYLSWIQKGYVSWLTKETMPAMPDFWKYAPSG
FT                   GEFSPSDSLNSYFDRSSINQVISQAKASHISWLGPNTPAQFEKDSEQQQYLDRFLNTIG
FT                   YRFSITKETHAKAVQPGESLAITMDWQNRGVAPFYFPWILELSLTDENGEIVTKTKTDE
FT                   DIRKWLPGTKTVKQSLKIPDDLPEGTYTLCVAILDPHTEEPGIQFAMEGKRADGRYTLG
FT                   KVQVRD"
FT   CDS_pept        complement(588279..589430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41542"
FT                   /db_xref="GOA:C0ZK91"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK91"
FT                   /protein_id="BAH41542.1"
FT                   /translation="MRALLVDDEQLPLMHLQRLLEKDVGGVKVVGAYTNPLEAIDQAIS
FT                   LQPDVVFLDINMPRISGLEIGERLQGIDNSPEIVFVTGYDKYAVDAFELCALDYIMKPV
FT                   QLQRLQKTMDRLRERIKSAKEATPVKEESVVSIQCFNSILFHQPNQEPQEIKWRTNKAR
FT                   ELFAYLLHHRNKMIDKDSLIELLWPDYDGSKGVTQLYTTIYLIRQTLKRYGLHTISINK
FT                   GNLEGGYKLTIDSATIDVEEWENRLKQIPPLSLANMQEYEQLLAAYTGDYFGDYDYLWA
FT                   EYERERLRRMWLSLAKTMSSFYLGHGRVREAINVNQRIQNLHPLEEDSYMILMQLYASL
FT                   DDHAAVEEQYQLLTSRWENELGSAANEHITKWYHIWKQETEQK"
FT   CDS_pept        complement(589586..589906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41543"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK92"
FT                   /protein_id="BAH41543.1"
FT                   /translation="MQEYVELTELLTDIEGHPLSLLFIKTANCGVCDVTYVRTVELLKQ
FT                   YPQVKSMVASMEKMPNLSGEFLVFTAPAILLFMDGKEVFRQARFVSFDKLENVLKLTVD
FT                   AT"
FT   CDS_pept        590130..590585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05670"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41544"
FT                   /db_xref="GOA:C0ZK93"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK93"
FT                   /protein_id="BAH41544.1"
FT                   /translation="MLLSMYVIIPILFVMVVAMYTDLRSRLIYDWLTLPGIVYFLLVHA
FT                   CLHPEKWLSYAMGAIVLGGISLLMAVISKGQMGGGDIKLLALVGAAVGWQAGLVVLMLT
FT                   YLLAGVSVLPIWVISKMTGRMKLNREIPLAPFIAGGTSLMLVMVRYY"
FT   CDS_pept        590688..591527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41545"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK94"
FT                   /protein_id="BAH41545.1"
FT                   /translation="MLESKRRAIIFLVLSFLLAALAGFLFLQKIKDMNAQLGEMVEIYE
FT                   ANADIPSRALIQPDQLTVREIPKKYADDSYVIDKASLKNQVTIVPLSKGDIITKNIMKP
FT                   ANVVRDENNRLVTVFSSNNIVFDQELEALDRVDIIISHEVSGKPVTEVFMKDVPVAMVA
FT                   KSENSFKGVALELPFEEAPKFIHQQHYAQMVRILKANVGKGDLGIPDPFVEPTPEQTKP
FT                   PGKPADAKPGTPVVMPPAAQPAGQPAVQTPPTAPVQPQSKPTSVPPQPTNQPPKTGG"
FT   CDS_pept        591531..592688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41546"
FT                   /db_xref="GOA:C0ZK95"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK95"
FT                   /protein_id="BAH41546.1"
FT                   /translation="MNKDMKILVVADYDSVKDMLREILSVYEQVRYTTSSEVKKEIDRI
FT                   GPDVVLLVQPEDGAGVELVQYIQGELPEGIVIYLTERQDFVLLRDVVRAGAVEYIVMPD
FT                   ELNLLSDRLDKISDLSLIKQRKKGADVSGKAFVRGRGKVYSFYSGKGGSGRTQLATGFA
FT                   QALKLESTASVLLIDLNLQYGGVETFLSFENNRTLGDLMPVMDEINEFHIRNVAQRENY
FT                   SKLEVLVSPRDAETAENMSEAFVTRLIRASRRSYDFVILDLPTHMNELTFAALSESDMI
FT                   YYVMNLDTPSVQIYQLVEDLFKRLRIDTAGRLEVIVNQVGRDNELNVSDLKGLFNAPIT
FT                   AEISRDHQGVQAAVNQGRPLQKEPNEKKLSPAAKDIRKWVLKKLS"
FT   CDS_pept        592702..594090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41547"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK96"
FT                   /protein_id="BAH41547.1"
FT                   /translation="MALFRRKQEQTAPGDEAKQTTLAATLAAPSFNPYIDELAEHYKTR
FT                   LLRETNLERLTSLGSDEMRLAIERLVSQYMSEEKVVIPRNEKDILLTRLINESVGLGPL
FT                   EPLLADPEITEISINGHNLVYVEKRGRLELTDLKFRDEEHLRHIVDRIVAPLGRRIDES
FT                   SPMVDARLKDGSRVNAVIPPISLNGTLVSIRKFRKEPFLMDDLMQFGSFSEAMSQFIQA
FT                   VVEAKMNVLISGGTGSGKTTLLNATAKAIPHYERVITIEDSAELKLTHPNCIGMEARPP
FT                   NMEGTGEVTIRQLVRNSLRMRPDRIIVGEVRGPEAFDMLQAMNTGHEGSLTTVHANSPQ
FT                   DAFNRLEGMVVMAGMDLPSSIVREYIVSALDIIVQVTRLSDGTRKIVSISEVAKTEDKR
FT                   VEVNEIFRFQRKGIGAKGEVLGYFTATGVIPRCLERLQVFGINLDESMFRAEGGKQRDH
FT                   AYSV"
FT   CDS_pept        594074..594994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05710"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41548"
FT                   /db_xref="GOA:C0ZK97"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK97"
FT                   /protein_id="BAH41548.1"
FT                   /translation="MPILFSFAVLFGIWGMYEYLGYRAKKTEWKKKAEEWFEVKGKRKS
FT                   VVIVWGDKFDQTPYAKEIQKKLIKANFALAPSEFYGILIVGTMVLAFLLSNVVNISFPF
FT                   NFMIGAVVMYLIQNVLFFVRRNKYQERLNEQLSEVCRLLANSLRAGLTLSQGISLVAKE
FT                   MNYPAGDEFSRMARELQLGVSFDRALSDMEKRIPTREFRIFTATLLIQRRAGGNLSQVL
FT                   QEMAETLEDRRIVNQEIKTMTAEQRYVSILVPIMPVALVLMMNTMNKGFIDPLFSGFGL
FT                   FLLGLFVIGTLLSYILVKKVTNIKV"
FT   CDS_pept        594999..595934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05720"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41549"
FT                   /db_xref="GOA:C0ZK98"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK98"
FT                   /protein_id="BAH41549.1"
FT                   /translation="MDALIITCVFLFLLLFAICLKEWYRYSIEKQKLLAHVHEMSGHKN
FT                   YGVRKQETSSERLVKRLLRYGDDYAVMGQRINFFSESHEVEDWLLRAGRPLDLTVAQFQ
FT                   GVKIFMALLGIIAGTLFFILRFPFSHLGLIAWPLIGYFLPILLLKKKARDRQHQLRYDL
FT                   PEFLDTVSVTLQAGVSLDQALREVIKFFDGPIREEFSRFNQELDLGVQREKAYEQLLRR
FT                   NDNPEFQMLIKALIQGMRLGVPIAVTFKAQAENMRRIRKELIKEKAAKASPKVTLITTF
FT                   IVTPTAIILIGGLMVLNILDNFSLFSDIMP"
FT   CDS_pept        595960..596247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41550"
FT                   /db_xref="GOA:C0ZK99"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZK99"
FT                   /protein_id="BAH41550.1"
FT                   /translation="MPVSEMGVHSSLFFHYPNHEGSRFYMKSMMLKWYVKSQGALRNEK
FT                   GAQAIEWIALAGVVIAVFGAVMAYFDKDPTLVGESIGDTLSNIIKKLDGN"
FT   CDS_pept        596377..597810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41551"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA0"
FT                   /protein_id="BAH41551.1"
FT                   /translation="MRLVKGIIAVILLLSLLTACSQEPDTSQNAEGQNPSAPPSTETPP
FT                   TQSQPPDQTGDPNAEMTQEEKVKALEAMAQEGMPLKRETTEDFVNSPPGRFSGVSYDNN
FT                   REEVLSELKKFPTVEKPDEEMMNKYYLALLGLFAQSYPDPQQIIDELKMASFGNPDIDD
FT                   PRFKFKESYNVEIILDASGSMAAKSNGKTRMDAAKEAIQAFAESLPEQANVALRVYGHK
FT                   GSGKESDKTLSCGSSELVYGMQTYNKEKLTQSLNQFQPTGYTPIAYSLQEAKKDLSKLP
FT                   GDKNTNMIFLVSDGIETCDGDPVEAAKQLAQSEITPIINVIGFGVDGPGQQQLKEVAKA
FT                   AGGRYVLIQDQKELQDEFNRGKEIANKWKEWKANASYQAVSTRSSRSIDISHFALKWSR
FT                   IAKRENHDLTSAIMTMDASNIISDEFADQLRKLNDEQLEIAQKKADELEQFLDTLNEKS
FT                   YKEAVDAINQKFAQNTKTN"
FT   CDS_pept        597865..598983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41552"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA1"
FT                   /protein_id="BAH41552.1"
FT                   /translation="MAAATFAVLILLMNLFPLVGLAASMQYQGLQYEAPKWDQPNLESP
FT                   QWEHNPQTPQWEKINPQTPDWEKLNPQAPNWDWTNPQAPNWDQINPQAPDFQGPNVNYS
FT                   NPQAPKATVPAPNLQMPSSQHPGIDPDSSKPMTETLEYGAVKWTIKDVMGGTLAYSADL
FT                   LMNGEVDMAAGLRGKGMFLGDLAIKGLDLAFKNTPYVNTVTGLGVDSLDGMSAWGNYQF
FT                   VLAQLPNNSFRDIFQGGQLTNSANPSGVRMPGIVKGLNVGVAAISLPFDIMDTVGTFGM
FT                   AFDPSQNEATQNEKFVDGVGNFGSVLMDAGVIASVIPGGQAVGGVLVVTGAVLWGLSKL
FT                   VKYADKLAGGAITRGIRDGVGKAVGWVKSLFA"
FT   CDS_pept        598999..599853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41553"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA2"
FT                   /protein_id="BAH41553.1"
FT                   /translation="MKVVNTPQVQAQIERNKRFLERTELYNYPAYVNGQYYYHVAYWKW
FT                   GKKDAVGYLVLRPDGEVVRRHEAEPVVKLFLVHAHAGRKIKNNLAMDKEKPIEMYEQKY
FT                   EYLRALLPSYQDKMDTVLRQDAEKLIDVCKTMMESRDQLRAIYTRGMDLLNQFFARNYV
FT                   IAGEETALRDVLFESDYILYDRIRKQVLIKDSVDRLYQLFQSNRVELDRVQEQKRKKLS
FT                   DLLSVYKDKTLRNIADESVKGFETHTTGKHESFHSVEQLREAHEKLNMTILENGLMDKL
FT                   RNP"
FT   CDS_pept        599877..600599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05770"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41554"
FT                   /db_xref="GOA:C0ZKA3"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA3"
FT                   /protein_id="BAH41554.1"
FT                   /translation="MHPFKESIRFYARNIESLLLLSAVLVVPFFIIHNFTLNYLNLIAA
FT                   ITGAKFVASFFNLFLLLLFLLILQIPFAQYVQSDLDGDERPIRKAFRTFFEHSFSVFVF
FT                   GIVFSFLVSIGMMLFMIPGLILMVLFYLTPFFVVLKKQSAWRSWRAAMEMGKKHFFQIF
FT                   GLLLLVSVVEWLISLAGLFLVTSITATFGAVMFIELLLNVIVLPFFAVMFMIYVNKWKD
FT                   EAARAEAAVAGGLLLDER"
FT   CDS_pept        600634..601035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41555"
FT                   /db_xref="GOA:C0ZKA4"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA4"
FT                   /protein_id="BAH41555.1"
FT                   /translation="MRLKKIVSNEKGSVTIEFIAILPFVFLIMLICWQFLVGVYGVIIS
FT                   QSAANEAAKVYAITGNSGEAMQAAKNVVNAAGGYISFNDCDIKGNGSGYFTAKVGVQME
FT                   LAFLPDWLYIEKEDRYISFDREMKSRVMN"
FT   CDS_pept        601036..601704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41556"
FT                   /db_xref="GOA:C0ZKA5"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA5"
FT                   /protein_id="BAH41556.1"
FT                   /translation="MVRILRHLQNERGNMTIFTLTIYWFMFMLVFVALFNFSTVFVDKE
FT                   QASNSAQQASIAAVKDIYDEMIVAIMAYDASITRLKNPNFVWPRVEAATSQLKASHPDW
FT                   AASEIKYGAIDLALNSALPGNPELQFYVYAGLQNATSRIPGVVAKVLSDNKATLTGSSV
FT                   KLFNSDNRIEVTTSVKYESESMGFDFIPAYSEQIYQTGESRRIGFIDEVSGWVNLHIPM
FT                   "
FT   CDS_pept        601677..601931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41557"
FT                   /db_xref="GOA:C0ZKA6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA6"
FT                   /protein_id="BAH41557.1"
FT                   /translation="MGESAYSYVGTANIGGNGMTSKLQKMQRFWNVVTVIIYGVFLPMS
FT                   CLFMALGEKLPYALLFFMFALPYIEQAGMEHLRRKEMSR"
FT   CDS_pept        602200..603513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41558"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA7"
FT                   /protein_id="BAH41558.1"
FT                   /translation="MRNTKMRMSLLFNSILIMLLLTGCSLGAIGAGTGIGQNQGPQTTQ
FT                   ELIASQPGPLAGTQFFHAAYPHRTEIIQILDKMPTVVDGMNDAYLDLYWNQLLTLFAED
FT                   YLSPQMVVDRWRMASYGSPDIEDARFQFRENFNVEIILDASGSMAGKIGDKTKMQLAKE
FT                   AIQEFAEALPEDARISLRVYGHKGSNADEHKQLSCGSSEMVYPLQAYDAKRLEQALDMF
FT                   EPTGWTSIAHSLRLAQEDLAGFEADKNTNVIYLVSDGIETCDGNPVAVAKELSQSKIMP
FT                   LLNVIGFDVNAEGQKQLKEIAHASEGLYANVTNREQFKQELERAKEIAQKWEQWKRDAL
FT                   TEADAVLIDRKKWVDAYDQDWYEKNWRESLNIGMAIEYLSASGKIGNEAREYLTGKRQE
FT                   REALATQSKEELTNYLVSLTTETYQEMREEIEDKYSGN"
FT   CDS_pept        complement(603576..604136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41559"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA8"
FT                   /protein_id="BAH41559.1"
FT                   /translation="MKKLAWLGTVLLVFLLVGCSSSSPDTVQGLGKEEAGQIAAAAVRQ
FT                   YYQVDVNTTDREITLEDPANSVYRGVPVHAILKREPVNGDVHGFHAIIEPRSKQILSLS
FT                   IDVIGINGEIATKTMTEADLEKTASDFIRSKNLLVANSFQLVKASDAHSNDAKRYFYYT
FT                   DGLNDVAIGVDPGLKQVVTFTYD"
FT   CDS_pept        604342..605118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41560"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKA9"
FT                   /protein_id="BAH41560.1"
FT                   /translation="MNAIELNQALQMYVRTETFPVGVSIQKEEAALPSKAKRPVRDLGY
FT                   PITICQAVGFSRRYGWSIAMNGADLSCPIAQVAFGYEEQPAFYTEGHLACGMYTDSLEN
FT                   GAKSELDVPKFSAEESGYYVSFPLERAQIEPDVVVIYGNAAQVMRLVAGMLYKRGGSIP
FT                   STFSSRADCADIAIKPIQTGQPQVIVPCYGDRLFAQTQDHEMAFSFHFRDAAELVEGLV
FT                   GTQKGGIRYPIPSFLRYQAEFPTTYQKLAGMFGEKN"
FT   CDS_pept        complement(605115..605636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41561"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB0"
FT                   /protein_id="BAH41561.1"
FT                   /translation="MNTKEIVTKFEDVTNHYLHELEGFTMEQLLQKPSEEEWSIGQMYL
FT                   HLIQSARYFHLGNVEKCRQGGPAVTEAGAQKSEIGQTIFAQGSFLPVRVKVPASPEYTP
FT                   AQPESKEQLRDGLISVLAQMKELEPTLDEIPVHHTVAHPAFGSLTAKEWFAVVEMHYRH
FT                   HLLQLNRLKG"
FT   CDS_pept        complement(605701..606648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05850"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41562"
FT                   /db_xref="GOA:C0ZKB1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB1"
FT                   /protein_id="BAH41562.1"
FT                   /translation="MNKTDRLLAIVLELQRKGTLRAEDLAATFETSVRTIYRDMQALSE
FT                   AGVPIVGAPGQGYSLMEGYFLPPVSFSVEEAVALLIGADLVEQAFDQNFGNSARAVQRK
FT                   VEAILSADVGEQARRIRSTFRLVSPRANNLREQEKAHAQLLHDAIISERKVRFRYRRGT
FT                   PGEGDDRETVRDVAPYGLVLVRGSWTLLAHCDLRQDIRRFRLSRMSGLIVLEERFILPD
FT                   DFHFADYKPLDDRYLEVQIVISPTIADRVKESGNFFIEEITEHPDGFLVRLRVRQIEEI
FT                   LSWVLGLGADAVVLTPESLRSRIREDAQKLFERY"
FT   CDS_pept        606793..607653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05860"
FT                   /product="probable D,D-peptidase/D,D-carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41563"
FT                   /db_xref="GOA:C0ZKB2"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB2"
FT                   /protein_id="BAH41563.1"
FT                   /translation="MKKRVFWLVILSLFGYIVFQKITEGPPNVGGHMETVSEATGVEYQ
FT                   SIQITKDQIYQGDLLLVNKDYPVHEAGVKNDVIRLSKHEELLQGYTLLDHRLEVSERVA
FT                   KVFLEMVKAAQQDNVSHFILNSGYRGKEEQEKLYEEMGPAIAMPSGYSEHNVGSALDIG
FT                   STQMKMEHAPEGKWLEDHSWKYGFILRYPKDKVAITGTVFEPWHFRYVGLPHSAVMKEN
FT                   NFSLEEYLDYLKDKRSISVTNEGKIYEINYYPVDEEMMIKVPISSNYEISGDNIGGVIV
FT                   TSYVN"
FT   CDS_pept        607675..608727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05870"
FT                   /product="ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41564"
FT                   /db_xref="GOA:C0ZKB3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB3"
FT                   /protein_id="BAH41564.1"
FT                   /translation="MKKLTVAILFGGCSSEYEVSLKSTSSVLESLCLEKYEVILLGITR
FT                   EGQWLRYTGNIESIRNDSWHQSEKCVPAFLSPCRQVRGIVTQENGAMTVTKVDVVFPIL
FT                   HGKNGEDGTVQGLLELAGIPFVGCHTLSSAICMDKDIAHTLAEGSGIKTPRSVAVYPNT
FT                   DLATVQAATEPLGFPLYVKPAKAGSSIGITKAYSLSELFFGIENALQHDDKVVIEENIT
FT                   GFEVGCAVLGNREVIVGEVDEIELLQGFFDYTEKYSLETAHIHVPARIDEELAHKIKQT
FT                   ATHLYQVFGCRGFARVDMFVTPDGDIVFNEVNTIPGFTSKSRYPSMLRAAGISYKELLD
FT                   TLIMLALEED"
FT   CDS_pept        608731..609528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05880"
FT                   /product="probable D,D-peptidase/D,D-carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41565"
FT                   /db_xref="GOA:C0ZKB4"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB4"
FT                   /protein_id="BAH41565.1"
FT                   /translation="MTQPHVFTVTLNSDNLHHGHLILVNRQYPIRWQTDDGILLNRMRL
FT                   IDGAHNNMMLENTAAKMFAKLLKACNAENAIVPVSGFRSKAEQTDIYDQSFLENGQVFT
FT                   SKFVARPNESEHQTGLAIDVGEKKEVIDFICPSFPDHGVCRMFRQRASQYGFIKRYDKD
FT                   KEQLTGISDEPWHFRYVGYPHAVLMEKLQLCLEEYIEYVKNYEFHQEHLLVDEENMEIY
FT                   YVKATDTVTHIPVVAGERYEISGNNVDGFIITVFHQEARNERG"
FT   CDS_pept        609515..611239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05890"
FT                   /product="probable amino acid racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41566"
FT                   /db_xref="GOA:C0ZKB5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB5"
FT                   /protein_id="BAH41566.1"
FT                   /translation="MNVGSEKQYGGLDRFGIIAAILVIAIHTFPLLSISEWADFTLRQT
FT                   IARVAVPFFFMCTGFFFMQKLGSDRNRNASMLKQLLWKVGKLYLLSILLYFPVNVYEGY
FT                   FTDGFTLLTAVKDLLFNGTLYHLWYFPGIMLGVCINTFLYTRLSTWNAFWVTLLLYGIG
FT                   LLGDSYFGLVHFTLVTVLSFVLSVLAMKAIQRFRGGKPDQTGRAWADIHLPHLQHNVRE
FT                   IQQVLPKDCAMMAVVKAQAYGHGGWQIARFLNKLGIDHFAVATIDEGIELRKKGVKGEI
FT                   LVLGYTDERRIRQIARFKLTQTVVDDEYAQTLNGYNVKIPVHIKIDTGMGRLGESWEYT
FT                   EKIAAMYRYKHLQVCGTFTHLSVADSLEASDIAYTKNQIDRFQNVIEQLKEKGINPQKL
FT                   HVQSSYGVLNYGELQYDYARMGIALYGMLSKQGDKVKTSIDLRPVLSLKARVVQVKQVE
FT                   KGAPVGYGRAHTAQKDSKIAIVSIGYADGVPRMLSQVGATCLIRGKRRPIIGFVCMDQL
FT                   IVDISDIEEVQRGEVVTFIGRDQEEEITAEEMAQSCKTITNELVSRLGERVKRVYHD"
FT   CDS_pept        611282..612373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05900"
FT                   /product="probable two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41567"
FT                   /db_xref="GOA:C0ZKB6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB6"
FT                   /protein_id="BAH41567.1"
FT                   /translation="MAKGRHSFRFKMLGLLGFGMLLAGIVTYLLYKVLQFYYRVGVKYE
FT                   DPITQVRYFIREMGDINFFLIVFAPIAILFFYLLTKRYAGYFREISTGIHYLASGDFTR
FT                   HVHIPSNDEFAEIAKDINLASEMLQKAVERGDFAESSKDQLVLNLAHDLRTPLTSVLGY
FT                   LDLILQDEQMTQEQMRHYATIALTKSHRLEKLIDELFEITRMNYGMVTIEQKVIDLSEL
FT                   LVQLNEEMYPSFEKNELVARCTVAAQLVIVGDGELLARVFENILTNAIRYGGDGQFIDL
FT                   NAYREGDEVVVQIMNYGDQIPEEALPHIFEMFFTGDKARTHQGGGTGLGLFIAKNIVEK
FT                   HRGTISVQSDLIRTCFEVRLPYG"
FT   CDS_pept        612497..613114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41568"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB7"
FT                   /protein_id="BAH41568.1"
FT                   /translation="MNKYTWTLIGALIVAGISSATWAEAINQGDKEALQAYKKMEQARN
FT                   QENQPLSKSSRNATLSDFSIQGAVLPEADKIRNYNDTNMQGLLSSTDEKLSFIMEEDEV
FT                   KGIVIATDTEPIMAGGEKTGPELFDLYENMKNTLGEDVNITYFSYSGGFIFVATDREGE
FT                   ESLWLDRRASTFLDLPSHKQLKSEEVVEKVRESAESVDEEKT"
FT   CDS_pept        complement(613182..613769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41569"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR014258"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB8"
FT                   /protein_id="BAH41569.1"
FT                   /translation="MKRLGTIAIATLGLGFVLSGFSNTASAATTCPQYGYQPYMQPVQP
FT                   QMQAPYAAPANQQQPAQQPVKQANQQMDSSSVGKQVTDLVNQERAKAGLKPVELDASLN
FT                   KVAQAKAADMSKNNYFDHTSPTYGSPFDMMKQFGVSSMTAGENIAMGQRTAEEVMNQWM
FT                   NSEGHRQNIMNPSFTKIGVGFVNGYWVQEFIG"
FT   CDS_pept        613844..613945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41570"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKB9"
FT                   /protein_id="BAH41570.1"
FT                   /translation="MAIHPMQISHLQVKKLPRTSIREEVSAVLFGMT"
FT   CDS_pept        complement(614159..615274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41571"
FT                   /db_xref="GOA:C0ZKC0"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKC0"
FT                   /protein_id="BAH41571.1"
FT                   /translation="MADPRINELASRLVRYSLHLQKGEKVLIENTGLQPELVRALVRES
FT                   FAVGALPLVTLKDQEVMRALYQGTSEEHMALMAKYEYDRMKDMDAYIAIRAYDNINEYA
FT                   DVPDDKMGIYARVLYQPVHTNERVPNKRWVVLRYPNKSMAQLSKMSLESFEDFYFSVCN
FT                   LDYAKMSAAMTPLKELMERTDRVRIVGPKTDLRFSIKGINAIKCDGKRNIPDGEVYTAP
FT                   VRDSVEGTIFYNAASIYNGITFNDVQFTFKEGKIVEATSSNTKALNDILDTDEGARYIG
FT                   EFAIGFNPHILHPMLDILFDEKIAGSFHFTPGNAYTVADNGNRSSVHWDLVQIQRPEYG
FT                   GGEIWFDDVLIRKDGRFVLPELEGLNPENLI"
FT   CDS_pept        complement(615370..616569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05950"
FT                   /product="probable NADH-dependent butanol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41572"
FT                   /db_xref="GOA:C0ZKC1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKC1"
FT                   /protein_id="BAH41572.1"
FT                   /translation="MFPFEVSFPTKIYFGIGELERLGQEAKSLGQKALLVTGGNAAKRT
FT                   GLLDRAKALLQEAQVAYLVFDKIEPNPRTATVDAGAALAREHQCDFILAIGGGSVMDAS
FT                   KAIAAAAVSGRPIYDYMRGNPSGSGQLLVPVQEALPIMTVPTVAATGSEANHISVLTHW
FT                   DTHEKSSINGPALYPKIAILDPSVTFTVPARVTAESCADIFSHLFENYLISAEGTYVQD
FT                   GISETLIRLVVEHSITAIQQPDNAEARSTLLWASTLGISPFTAGGRGAGMPLHGIEHPL
FT                   SGIYDMAHGRGLAILSLPYFEQMILQDRPERLARMGRHCFGVTVENESEAARATIDAVR
FT                   RWYERMGITERLSDFGVTKQSLVQMAEEAVRIGGRGIGYLPSSRKLNESDVIAIYEACL
FT                   "
FT   CDS_pept        complement(616722..617846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_05960"
FT                   /product="putative transposase for insertion sequence
FT                   element IS605 family"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41573"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKC2"
FT                   /protein_id="BAH41573.1"
FT                   /translation="MMLRKKSFQFRIFPNHEQAVLIEKTLGCSRFVFNRFLARWNETYK
FT                   QTGKGLTYHSCSAQLPQLKKEQPWLQEVDSTALQSSLDNLADAFSRFFKKQNEVPRFKS
FT                   KKNRVQSYTTKHTNGNIRIDGNQIKLPKLGWVTFAKSREVEGRILNATVRRNPSGKYSV
FT                   SVLCEVPYSPYIPVGKEKTIGIDLGLKDFATFSTVEKIRNPKYLLLYEKKLNQWQRKLS
FT                   HRQKGGKNYEKARRKVAILHEKVANTRNDFLHKLSTRLIHENKVICLEDLQVNHLIKNQ
FT                   KLAKSIADASWSTFRAMLTYKAEWYGRTLSFVGKQFPSSQLCSTPNCGNRSKDVKNLNL
FT                   REWTCSNCGTRHDRDENAAINIEREGLRLLCLTT"
FT   CDS_pept        618210..618929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BBR47_05970"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41574"
FT                   /db_xref="GOA:C0ZKC3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZKC3"
FT                   /protein_id="BAH41574.1"
FT                   /translation="MEKQEQLYEGKAKRIYRTSLPDQYWVEYKDDATAFNGEKRAQITG
FT                   KGELNNRITAIFFTMLKERGIDNHFVRLLSATEQVVRKVEIIPLEVVVRNIAAGSLAKR
FT                   LGMEEGTVLPQPVVEFYYKDDALGDPLVNASHIKVLGIASESDQATLERMGLAVNEVLV
FT                   PYLRERNITLVDFKLEFGKTADGEILLADEISPDTCRFWDSVTNEKLDKDRFRRDLGNV
FT                   EEAYKEMLTRLGGDVHV"
FT   CDS_pept        618922..619170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="BBR47_05980"
FT                   /product="phosphoribosylformylglycinamidine synthetase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41575"
FT                   /db_xref="GOA:C0ZKC4"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKC4"
FT                   /protein_id="BAH41575.1"
FT                   /translation="MFKAVVYVTLRESVLDPQGHAVKGALHTLGFDEVNNARIGKYMEL
FT                   ELNTPDRAQAEERVREMCEKLLANTVVEDYRFDIVEG"
FT   CDS_pept        619175..619867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="BBR47_05990"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41576"
FT                   /db_xref="GOA:C0ZKC5"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZKC5"
FT                   /protein_id="BAH41576.1"
FT                   /translation="MRVAVIVFPGSNADVDLFNAVEDVMGVPVDYVWHSDTDLSKYDAI
FT                   LLPGGFSYGDYLRCGAVARFSPVMEQVVKAADEGKLIMGICNGFQILTEVGLLPGALLR
FT                   NRSLKFRCKLSELRVENNDTSFTRDFAAGEVIQIPIAHGEGNYYCDEETLAKLKANKQI
FT                   VFRYHGENPNGSLEDIAGICNERGNVLGMMPHPERAVHSWMTSDDGRRMFTSILKTWRE
FT                   QNSVTTHA"
FT   CDS_pept        619848..622091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BBR47_06000"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41577"
FT                   /db_xref="GOA:C0ZKC6"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKC6"
FT                   /protein_id="BAH41577.1"
FT                   /translation="MSQLTHKEPTAEQIADQKLYKEIGLTDEEYQRVVEILGRKPNWTE
FT                   TGLYSVMWSEHCSYKNSKPVLRRFPTKGPRVLQGPGEGAGIVDIGDNQAVVFKIESHNH
FT                   PSAIEPYQGAATGVGGIIRDVFSMGARPIALLNSLRFGELKSPRVKYLFENVVAGIAGY
FT                   GNCIGIPTVGGEVNFDPTYEGNPLVNAMCVGLIDHEKIQKGVASGIGNPVIYVGASTGR
FT                   DGIHGATFASEELTEESEKKRPAVQVGDPFMEKLLLEACLELIDTGIVVGIQDMGAAGL
FT                   TSSSSEMASKAGNGIEMNLDLVPQREAGMSAYEMMLSESQERMLVVVEKGKEAEAIAIF
FT                   DKWGLASAVVGKVTEDSKLRLLHQGEVVAEVPVDSLANDAPVYHRPSAVPAYYEANANV
FT                   DVLAAIQEPKDLNGTLKSLLAQPTVANKAWVYEQYDHIVRANTAVKPGSDAAVVMVRGT
FT                   RKALAMSTDCNGRYVYLDPKVGGAIAVAESARNVVCSGAEPLAITDCLNFGSPEKPEVF
FT                   WQFEKSCEGMSEACVALDAPVIGGNVSFYNERSGDAIYPTPTVGMVGLITDVDHITTQD
FT                   FKNEGDAIILLGETFAELGGSEYQKMATGSISGRPPQIDLTKEAAVQKLVLTAIRQGLV
FT                   NSAHDLSEGGLGVALAESCFGKGVGAQVTLTSEMRIDALLFSESQSRILLSASGEQAAA
FT                   ILALAGELGVPAENIGTVGGDHLVVNVNGTEAINASTQEVKAAWKDAIPCLIG"
FT   CDS_pept        622076..623494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BBR47_06010"
FT                   /product="amidophosphoribosyltransferase precursor"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41578"
FT                   /db_xref="GOA:C0ZKC7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKC7"
FT                   /protein_id="BAH41578.1"
FT                   /translation="MFDRLIWDKLNEECGVFGIYNHKEASQLTYLGLHALQHRGQESAG
FT                   ICASDGEKWYKHRGMGLVSEAFGKGDLEKFSGHIAIGHTRYTTAGSSKIENAQPLFFRY
FT                   AQGSMAVAHNGNLVNAAVLRKELEAKGSIFQTTSDTEVIAHLIARSECKDLPGAVKDAL
FT                   QYIKGAYALLVMNENQLVIALDPNGLRPLSLGRLGDAITVASETCAFDIIGAQYWRDVQ
FT                   PGELIVVDKNGITESKHTETTQRSICTFEYIYFARPDSDIDGINVHMARKRLGKQLALE
FT                   SAIDADVVTGVPDSSISAAIGFAEATGIPYEIGLIKNRYVGRTFIQPSQELRERAVYLK
FT                   LSAVRKVVEGKRVVMIDDSIVRGTTSNRIVRMLREAGAKEVHVRISSPPVMNSCFYGID
FT                   TSSREELIASTKSVEEIRQIIEADSLSFLSIEGMIDAIGRTDSAPNRGHCLACFNGEYP
FT                   TEIEFEEALPALKC"
FT   CDS_pept        623551..624591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BBR47_06020"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41579"
FT                   /db_xref="GOA:C0ZKC8"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZKC8"
FT                   /protein_id="BAH41579.1"
FT                   /translation="MSEAYKQAGVDIDAGNEAVERMKKHVKRTFRPEVMTDLGGFGALF
FT                   RLDTKKYEKPILVSGTDGVGTKLKLAFAMDKHDTIGIDAVAMCVNDVVVQGAEPLFFLD
FT                   YLAVDKVIPEKIEAIVKGIAEGCSQSGCSLIGGETAEMPGMYAEGEYDIAGFTVGVVDE
FT                   SKMITGASVAAGDVLIGLASSGVHSNGFSLVRKVLLADKGMSLHDHVDVLGKKLGEELL
FT                   TPTRIYVKQVLSVLESHEVKALVHITGGGFTENIPRVLPEGMQAVINVGSWPVLPIFEL
FT                   VQGAGNISYPDMYKTFNMGIGMMLVVKPEDAVSVMEKLQELGEQAYLIGNIQAGERKVV
FT                   YNGVEW"
FT   CDS_pept        624588..625193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BBR47_06030"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41580"
FT                   /db_xref="GOA:C0ZKC9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKC9"
FT                   /protein_id="BAH41580.1"
FT                   /translation="MRKLAIFASGSGSNFEAIVQAVQDGKLAGVEVALLVCDKPGAKVL
FT                   ERAERLGIDAFVFQPKEYADKASFEQEIVAQLQKREISLVVLAGYMRLVGDTLLSSYEG
FT                   KIINLHPSLLPAFPGKDAVGQALAYGVKITGVTVHLVDAGLDTGPIIAQIPVAVQEADT
FT                   AETLAARIHAVEHELLVKVIGYLAEERVKLEGRLVQLT"
FT   CDS_pept        complement(625254..626189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41581"
FT                   /db_xref="GOA:C0ZKD0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD0"
FT                   /protein_id="BAH41581.1"
FT                   /translation="MLNIYKTNTLGKIEELQQFEKGCWIHLTNPSEQEKQQVVRELSID
FT                   LHFLQDALDDEEIGRIDKEGNRVKLYVDIPVSTKEATKDNYTTVPLGIMVTEDYILTVC
FT                   LVETAVMNEFVQGKVKSFHTHMRNRFVLQILSNTSHDYLHYLKKINKQTETLEKSLRQS
FT                   TKNNELLTLLELQKSLVYFSTSLETNSLLISLLRSGSYLKMYEEDKALLEEVKIETKQA
FT                   IKMTEIYTAILGNIMNGFGSVISNNLNRVVKLLTSITIVITLPMVIGTFYGMNVGLPFQ
FT                   DHPHAFTIIMIMSTAITSVTALLFWRKKYF"
FT   CDS_pept        626615..626992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41582"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD1"
FT                   /protein_id="BAH41582.1"
FT                   /translation="MSGDFVSNLLDKLSQKTGRQWTLNDIMKLAEKMPKGGANVDALLD
FT                   ELGNMGFEVPEETKERVRDRVKDGNSISMEELGNIMPKEVKAKSRKSKKPIKPIRATAK
FT                   GKSVSLSDRIKRLSGKGKKKR"
FT   CDS_pept        627173..628723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BBR47_06060"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41583"
FT                   /db_xref="GOA:C0ZKD2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD2"
FT                   /protein_id="BAH41583.1"
FT                   /translation="MSVKKALISVSDKTGLIPFARRLVAAGVQIISTGGTASLLKAEGV
FT                   PVIGISEVTGFPEILDGRVKTLHPNIHSGLLAVRDSEAHVQQLKDLGIETIDLVVVNLY
FT                   PFKETIAKPDVTYEDAIENIDIGGPTMLRSAAKNHAFVSVVVDAADYEKVAEEIEANGD
FT                   TTLETRRKLAAKVFRHTAAYDALISRYLSEQVGELLPESYTVTYEKAQDLRYGENPHQR
FT                   AAFYREPLSDQLSIGNASQLQGKELSYNNINDADAALAIVREFAEPAVVAIKHSNPCGV
FT                   GIGADIRSAYQKAYEADPVSIFGGIVAANRPIDRDTALAMKEIFLEIIIAPDFTEEALA
FT                   VLAEKKNLRLLRISALNEPAKKVDNLFRVAPVAGGALIQDFDYKQLEENEIQVVTDRKP
FT                   SEEEMAQLKFAWKVVKHVKSNAILLAKDNMTIGVGAGQMNRVGAAKIAIEQAGALASGA
FT                   VMASDAFFPMGDTVEAAAKAGITAIIQPGGSIRDQESIDACNRAGIAMIFTGTRHFKH"
FT   CDS_pept        628803..630080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BBR47_06070"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41584"
FT                   /db_xref="GOA:C0ZKD3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD3"
FT                   /protein_id="BAH41584.1"
FT                   /translation="MKILVVGGGGREHTIAWKLLQSSKVTKVYCAPGNGGTAQIAQNVP
FT                   IGVHDFAALVQFVKDEGIDLTVVGPEDPLLAGIVDFFQERNLPIYGPNQKAAMIEGSKS
FT                   FAKSLMKRYEIPTSAYESFLDYESASAYVREQGAPIVVKADGLAAGKGVVVAETVEEAE
FT                   EALRQIMQESVFGEAGARVVIEECMFGEELSLLSFVDGETVKPMITSQDHKRIFNEDRG
FT                   PNTGGMGTYAPVPQMSAELVDEIVKTIVQPMASGMAKDGIPFKGILYTGLMITEQGPKV
FT                   VEFNARFGDPETQVLLPLLETDLLDIFVGTINGELDAVDVTWQKGSAVCVVMAAPGYPG
FT                   EYPKGALIHGLGQANEGATVFHAGTKETEEGIVTSGGRVLGVVATGADLAQARETAYAK
FT                   VQGISFDGAQYRTDIAARAMKYQQKG"
FT   CDS_pept        complement(630142..631350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06080"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41585"
FT                   /db_xref="GOA:C0ZKD4"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD4"
FT                   /protein_id="BAH41585.1"
FT                   /translation="MGESRERLWTRDFVLLTVCNLLLFLTVQMQTPTFPAYVKETYQAN
FT                   DFVVSLVISLFSLAAVIARVFTGEALKTKSSKLLAIVALGFVAIFSAGYYWAGSIVFFL
FT                   LLRILVGIGFGMGSTTFPTIVSNVIPARRIGEGMGYFGLSTSLAMALGPLIGLGVLNGF
FT                   GFGSMLMVLVLLVAIIFPLMHFIRAYNQLPVSSGNTQTVTGIRRFYDKKLLLPAGLNFC
FT                   LSITYGGILSFLALYGKEAHIENVGWFFLTNALAMVLIRPFSGKLYDRKGHIAVLPPGA
FT                   IFVGISLLLLSLTTTESLLLVSAAFYGLGYGMIQPSIQAWMVKVVTPEQRGMANGLFFN
FT                   SIDLGIAVGSMLLGVIATHSSYSVMYRWSAACLLLFLIVYFLSQVAAAKAKKAAIAGEN
FT                   VGM"
FT   CDS_pept        complement(631362..631745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06090"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41586"
FT                   /db_xref="GOA:C0ZKD5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD5"
FT                   /protein_id="BAH41586.1"
FT                   /translation="MIHYVSLFLKEFDLTTEQFAVLYRLREEEGINQKELAQRSAKDQP
FT                   SMTRILDTLAKKGFIEKTLSEQDRRAYIITLSPKGREWLEQAIPVEAQAVADILEGISP
FT                   EKLAFLREILLEINENINRKTTD"
FT   CDS_pept        complement(631917..632051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41587"
FT                   /db_xref="GOA:C0ZKD6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD6"
FT                   /protein_id="BAH41587.1"
FT                   /translation="MLVGSQMYEWMSHNFFVIATIIGVIGVMGYYFFRTSRKRGRYRQ"
FT   CDS_pept        complement(632070..632609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41588"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD7"
FT                   /protein_id="BAH41588.1"
FT                   /translation="MHKNVGRTDAMIRITGGLLGLAYGIGKMSRRPSKTPWLLMAFSAM
FT                   KVAEGATRFCPMYAAMGINTKKGNGMQGMMDQLKKKGVQMAVNQFTRSMNIAPIKDSNT
FT                   SQDDESNTPATTNKANIQYSTSPQLSKNQEKHSINIQQNTKLTPEDQLLEKAAREIISF
FT                   RSQENNNSSTRYPTYT"
FT   CDS_pept        632801..634558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41589"
FT                   /db_xref="GOA:C0ZKD8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD8"
FT                   /protein_id="BAH41589.1"
FT                   /translation="MRVRAISDRDYLNMIRVSRRQAPASLWIKGASVLNVYTKEWQEHH
FT                   VAVAGERIAYVGEKEPLVDDQTVIIEAAGQYLVPGYMEPHAHPFQWYNPYTLADFALQT
FT                   GTTGMVSDTLMLMQLPFSQTAAIMDSLAAHPVKQFFWGRLDPQTGKAHPSFTKENLARM
FT                   LEHPRVIQGGELTNWGGVLQEDETLLFGLKHTRDLGKRMEGHHPGASYETLNIAAAAGI
FT                   TACHEAIHAADLLSRIRLGMYATLRHSSIRPDLPELVKGWLELGVPWSSRMMLTSDGST
FT                   PPMHRDGFMDSTLRVAMEAGMPPEEAYVMATLNPAVYYGLDAEIGGIAPGRIADILLLT
FT                   AKDQPTPSIVIANGQRVAEKGTLLVPTVQPQWEEASLRLADPLKKQAHSDWFRLRPDAD
FT                   GKTPVLQMLNAVITRLSLEDMPVDQDGYVSLQHDPQLALIAIIDVTGGNRTMAVLHGFG
FT                   EHLEGLASTYSASGDWIVIGRDPQAMAQALERIREIKGGVVLIDQGKIICECPLPLAGK
FT                   FASAPMEEVISMGENLVNQLRSKGHVHLDPIYSLLFFTATHLPYARLTATGIVDVKSGQ
FT                   IVVPALPLP"
FT   CDS_pept        634795..636024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06130"
FT                   /product="probable branched-chain amino acid ABC
FT                   transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41590"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKD9"
FT                   /protein_id="BAH41590.1"
FT                   /translation="MKKRSYVGVLSAVLAASMALTGCAGNSSGGSNASGGQSQPAPGNS
FT                   GGGTTEGGLIKIATQSPLSGSNSAIGDAIKTGAGYALEKRKEEFKALGFDLQLFPQDDQ
FT                   GDPKIGVSNAEMLISDPDVYGVVGHYNTGVAIPSSVKYDEGKLVMVSPANTGVKLTEEG
FT                   KKTVHRICARDDAQGPKAALYAKTTLGVKTAYIIHDKTAYGQGLSDQVKMQFEKDGVQI
FT                   LGFEGITQGEKDYSAVLNQVTVKNPDIIFFGGLYPEGGILIKQAREKGFKGYFMGGDGL
FT                   DSSDMIKIAGNAVEGVVFTSVAGDVTQTEEGKKWAEEYKKATNKPLETYSVYGFDSMNV
FT                   ILNGVLEAAKANGGKKPTREQVLDAVHKTKDFQGQFTKVTFDEKGDNTNADVFIYKFAK
FT                   DKSIFVGKAE"
FT   CDS_pept        636086..637132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06140"
FT                   /product="probable branched-chain amino acid ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41591"
FT                   /db_xref="GOA:C0ZKE0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE0"
FT                   /protein_id="BAH41591.1"
FT                   /translation="MLAPFLRENTSSQRSECRKFVQVYKGNEGWESMINILPQVLVDGL
FT                   TLGFMYAVVALGYTMVYGILEIINFAHGDIFMVGAFIGTEVLLISDALGALEGMNPFVA
FT                   LFITLIIAMVLTGALGVGIERIAYRPLRGAPRLVPLISAIGVSFLLQDLVRFTEALARN
FT                   EFYLNSPALFTGSIPLGSIATIPTKGLIVIVIAIIMMIALTLFVNKTKWGIAMRAVAQD
FT                   QSTASLMTINVNKVIMLTFLIGSSLGGATGVLFAQNYGTIDPYIGFILGLKAFTAAVLG
FT                   GIGNLRGAMIGGVLLGLLESLSGAFMGPLTNGAFGAEYKDVFAFSILILVLLFKPEGLF
FT                   GEAVKEKV"
FT   CDS_pept        637142..638425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06150"
FT                   /product="probable branched-chain amino acid ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41592"
FT                   /db_xref="GOA:C0ZKE1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE1"
FT                   /protein_id="BAH41592.1"
FT                   /translation="MANLAWKSFKGIPLVFTLIWIVGFSSALYLMDKSVIAFLGILSSI
FT                   VLVYYTNTTKSIKMAIGAIVLLLIIPLVAGENRYYMEVASQVGIYVAMALGLNIVVGFA
FT                   GLLDLGYVAFFAAGAYAYAIFSTSQANEFIAGNLFPLSGEWFWPFLIVGLIVAAVFGIL
FT                   LGLPVLRVKGDYLAIVTLGFGEIIRIVFNNLDKPINITNGPQGITPIPSPELFGIKMGT
FT                   PFYFYFIVLFVIAFIVLANIRFEHSRLGRAWIAVREDELAAQSMGISLLNTKLAAFALG
FT                   ASFAGVVGVIFAAKQTFIDPTSFTLMESIGILVMVILGGSGSIPGVVLGAAFVTILQVQ
FT                   LLKEFSNFLHSLQNSGIISLPNQLDPSKFQRLIFGIMLILVALYRPNGLIPAKRKKNDL
FT                   DAIKKSEFGKEKLGILGRLSQLTSGKQS"
FT   CDS_pept        638447..639223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06160"
FT                   /product="probable branched-chain amino acid ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41593"
FT                   /db_xref="GOA:C0ZKE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE2"
FT                   /protein_id="BAH41593.1"
FT                   /translation="MALLEAKNLTKRFGGLVANQDVSIDIEKGTITAVIGPNGAGKTTF
FT                   FNMITGFYEPDEGEILLNGKSIKKLRPDQIASRGITRTFQNIRLFKEMTALENVMVGVH
FT                   SRLSAGILGILFNSKRVRQEEERTRVEAYQLMEYVGISHIANEAAGSLPYGLQRRLEIA
FT                   RAMATNPQIILLDEPAAGMNPRETVEMTDFIRRLKKELDLTIILIEHDMKLVMGLSEYI
FT                   HVLDYGRKIAEGTPEQIRNNPNVIEAYLGKSASDVS"
FT   CDS_pept        639238..639945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06170"
FT                   /product="probable branched-chain amino acid ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41594"
FT                   /db_xref="GOA:C0ZKE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE3"
FT                   /protein_id="BAH41594.1"
FT                   /translation="MALLELTNVHTYYGGIHALKGLSITVNEGEVVTLIGSNGAGKSTT
FT                   LKTICAQTRAKEGKVIFNGKDITQMRTHDIALAGIAHVPEGRRIFPKLTVRENLEMGAF
FT                   SVSDKKVIEEGIERAFAYFPRLKERVSQKGGTMSGGEQQMLAIARGLMMKPKILMLDEP
FT                   SMGLAPILVEQIFDIVTELNKEGMTILLVEQNANQALSVAHRGYVIQTGEIILQDDAQT
FT                   LLMNPQVREAYLA"
FT   CDS_pept        640028..641488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06180"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41595"
FT                   /db_xref="GOA:C0ZKE4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE4"
FT                   /protein_id="BAH41595.1"
FT                   /translation="MLDISPRFVEGSEPLYLQLYRYFCTEIQGRRLISGTRLPSVRALS
FT                   GFLQVSKTTVESAYHQLMAEGYIESRERSGFYVVDVDWDGPVPVPTGKGQQPAKTAYVQ
FT                   ITPSTPSAVPIQYDFHQARVDAEHFPFDRWRKYTNQCMQEENKHVLYYGDRQGEPQLRE
FT                   ELARYLGRARGVQATPEQIVIGAGTQVIISLLGFLFGTRGQAVAMEEPGYHGVRTVFSH
FT                   LGYDVRPIRLTEDGIDVEALSESGARLVYITPSHQDPSGIVMPYAKRLKLLHWANQTGS
FT                   YIIEDDYDGEFRYHGKPIPSLQGLDTQGRVIYLGTFSKALLPSIRMSYMVLPQALLAVF
FT                   QEKLADFDQSASRIHQETLALFMKNGDWERHIRKMRTLYRKKHGVLLQCLQEQLGAYIR
FT                   IKGQDAGLSVTVEVKSESTPQQLTQFAAASGVRVYPTAHKWIHPQENGLPAFQFGFGGQ
FT                   TIKEIEDGIRLLKRAWEPYLHKDMGQVF"
FT   CDS_pept        641959..643311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41596"
FT                   /db_xref="GOA:C0ZKE5"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE5"
FT                   /protein_id="BAH41596.1"
FT                   /translation="MGGEKRSSRKASTHSSVRKKASPKLTGRIVLPGNAPYHGRRGCFN
FT                   SFPKVIVYAQKKQDIVNAVRWARHHHVPVRYRRPGHPYDKRVPNYKGAMVIDISEMHRR
FT                   EMVNKGSRRILTQPIGPSPDRLIGQKRSILEGGLTDVPGILVGHAEDESGRTGCTVILC
FT                   PSGAVPGVDVRGGFPGTIQTDAIRPGTATDVVQGVLLTGGSNFGLAAASGVMNWLAQNG
FT                   IGAPTEAGPLPTVPGAVIFDLIYAKGARRPDAEMGYIASEEANSGPVEEGSVGAGAGAT
FT                   VGKIYGTPMKGGVGTASWKIPGGPVVAALAVVNAVGDIWDQDHIIAGALRPNGTFVNQT
FT                   RAILEGIPPGTSGSRNTTIAVVATTGRLTKAEAGRVATLAHDGMARAISPVHIQSDGDT
FT                   VFCLATGTDTSGLTGDSAVTAIGTTAAVVLEEAIIRGVKAANSIRPRHGGK"
FT   CDS_pept        complement(643559..644107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41597"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE6"
FT                   /protein_id="BAH41597.1"
FT                   /translation="MKKGVIITSVFALMTIIPSACAMFSGGQHTEVSDHHTVSKPEVIP
FT                   LQNLSKHGFAASLDADAPLELPDGYKLSEAIYNEPPKKFGNGVAPNVEKQKEIVLKYVN
FT                   ENNNEDWFEHTVKKGRISIGDEGVKPIEIQGVEGEILEIPDQKVIVLSWHKDGVSHYIL
FT                   SKGDLGKDDLMKVAESVRN"
FT   CDS_pept        complement(644182..644445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41598"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE7"
FT                   /protein_id="BAH41598.1"
FT                   /translation="MTEVKKIAYKKLIHQAFLDLKNSGTFDEATFYRNFRIVHAFHTLT
FT                   EFIVIDFVGFNEDEFWARVDALASQFDLHHYRKIFDEAVMER"
FT   CDS_pept        complement(644764..645303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41599"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE8"
FT                   /protein_id="BAH41599.1"
FT                   /translation="MRKTYLLLSSLLFCSLFVTDAHAASQQGTVAPVPPQVIVPTSSKD
FT                   KQGNTLEKSMAYVKTLQVKNGKLLVSLDYVQWFFGEAAVKAYRQDHPSEKEDYPMPYYI
FT                   RNSSPKIRTFEVSPKASFTLQTNSTQKDGNFHWNEAVNTDTFKKFVLSKGIPYQIPFHV
FT                   EVKNGIITKVTEQYVP"
FT   CDS_pept        complement(645539..646300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06230"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41600"
FT                   /db_xref="GOA:C0ZKE9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKE9"
FT                   /protein_id="BAH41600.1"
FT                   /translation="MDQVLSSVRNGCRLLKIFLDSPKELGVTELSKKLQLSKGAVHKLL
FT                   STLESEGFIRQNEKTKQYTLGYTLLELGTKVLTNHDIVDFSKPFLDQLVSRTNELAVLC
FT                   VQDSKDAIYVAKEDSLHPVRFTVESFRRFPLYSTSAARVLLAYQPEEFQDEILQEHPLK
FT                   SYTPHSYTSVEQIKEDLVTIRRRGYEISSNRRNTGVTGIAAPIFDSTGHVTASVSVIGP
FT                   SDRVMPKQEEILQETLATVRAMSAQLGYRMS"
FT   CDS_pept        646531..647649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06240"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41601"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKF0"
FT                   /protein_id="BAH41601.1"
FT                   /translation="MKKKALSVLSIFALTGSLLAGCGSSTPQTSAPAPAAGNNSGTEAQ
FT                   AQLEDTLVVAGNGATVEKMMKDEVFKKFNEKYPNVKLTYVSGVSTEIVAKVKAQKNAPQ
FT                   IDLTIVEGGEQEKGRQEGLWETVSATDIPNMKNVPEDLRVTEDSGVVVNFTPMGISYNA
FT                   DLVKEKGLPVPKSWNDLAKPEVKGYITMTDVASNFGRSTMIMLAYANGGSEKDIEQGFK
FT                   KMETIAGYMPTFAKSAAQLQQNLQNKSSAYTTWTMARSLTQKEAGVPLEFVFPEEGGNI
FT                   VPNVATLVKGSKSPKAAKAFVDFLLTDEIQTMYATKLYYNPATSVKLPDDVAKTLEFDR
FT                   TKVVNFDYSVVSKETSAWLDRFNKEIAPKTGK"
FT   CDS_pept        647667..648752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06250"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41602"
FT                   /db_xref="GOA:C0ZKF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKF1"
FT                   /protein_id="BAH41602.1"
FT                   /translation="MIDVELRGIMKKFQSNVVVQNFNLQVEQGEFISFLGPSGCGKTTT
FT                   LNMIAGFLDPDGGDLLIKGQRMNGVPPYKRELGMVFQTYSLFPHMTVAENIAYGLKLRK
FT                   VNKQEMQERVNRVLGLVKLPNVADRYPKQLSGGQRQRIAIARALVIEPSLLLLDEPLSN
FT                   LDAKLREELRDELKRLHHEIGVTTIFVTHDQEEALALSDRIVVMNHGFVEQIGTPLEIY
FT                   NQPASEFVHTFIGKTNRLEGEVIGMDGDVLTLRTTGGMLVKAAKQQRTVALHEKVIIFI
FT                   RPEKIKLTDTAVSEEANRVKGYLQLASFLGSYTECEVKVGEHTLSAKVQMTDSSVDRQE
FT                   GQTVYCQWNADDVLVMPAGRG"
FT   CDS_pept        648756..649598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06260"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41603"
FT                   /db_xref="GOA:C0ZKF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKF2"
FT                   /protein_id="BAH41603.1"
FT                   /translation="MSKRLSVTLLTAPAMILLLGVFILPMLMMLLLSFQDENQAFSLHN
FT                   YSLFIQDPYYLEILWRTIRVSLWTVLVSLLLGFPVAMYMAQATGKMRGIVTMLILAPHL
FT                   ISVVIRNFGWVVVLGEKGWINETLISLGLIDQPLRLLYNELGIVIGLTDSFVAYMVLAI
FT                   ATSLYAIDPSLNKAASILGASRVRTFFSVTLPLCLPGIIAGTTLVFSLSMSAFVTPALM
FT                   GGTSVKVLPVIAYEQIMATLNWPLGAALAFLLLGSTILLVTLYTKLIETKRYKEVFAS"
FT   CDS_pept        649595..650395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06270"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41604"
FT                   /db_xref="GOA:C0ZKF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKF3"
FT                   /protein_id="BAH41604.1"
FT                   /translation="MKKINVLGLITFFVLVLVNLPFLVIIPSSFTAAGYLAFPPEGFSW
FT                   QWYEMILDRPEFIDSLWISLKLATVTAILATFLGTLAAFALSKYKFRGSGIINALMLSP
FT                   LTVPSLIIGISALLFFTRIGIAGTFTGLLLAHMLISIPYVVRLVLTGLSSFDYTLEKAG
FT                   YMLGAHPFRVFWDITLPLLRPAIVSGMIFSFLTSFDNVTVSLFLVAPDTTTLPLAIFTY
FT                   MQETLDPLVASISSVVILLSLVFIVLLEKVYGLERLFGLNSQSH"
FT   CDS_pept        650408..651544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41605"
FT                   /db_xref="GOA:C0ZKF4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKF4"
FT                   /protein_id="BAH41605.1"
FT                   /translation="MSIHTYVQENMPHYLQLLEESVNMDSPSRDKQLGDRMAGWFALQF
FT                   QRLTGGVAELIPNKTYGDQVRCTLGNGEKQILIIGHYDTVWLEGEAARRPFAIRDEKAY
FT                   GPGVYDMKAGVLQAMFAMRALVKLDRLPADKKIVLLLNSDEEIGSPTSRRLVEEEAARS
FT                   VASFVLEPPTEPSGALKTWRKGSAHFTLAVSGISSHAGVDHQKGVSAIEELARQVQFLH
FT                   ALTDYEKGTTVNVGVIKGGIGSNVVADSAEAEIDVRFISMEEALRIEKVMSELTPVLAG
FT                   TNISVTGGIRRPPMERTEETGKLFSLAQSISINELGMALEESGTGGVSDGNFAAACGVP
FT                   TLDGLGVKGGYAHSPDEWIELGEISTRATLLARLIEEV"
FT   CDS_pept        complement(651636..651923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06290"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41606"
FT                   /db_xref="GOA:C0ZKF5"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKF5"
FT                   /protein_id="BAH41606.1"
FT                   /translation="MDPFIHSLSLLTFMAILIEAVTEILKNAFPVLKDRFTYILSILIG
FT                   ISLSLAFQVNPFGLEGSGYYVSAVLAGILTSRGANYLNSFVKKLNTSSKQ"
FT   CDS_pept        complement(652102..652455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41607"
FT                   /db_xref="GOA:C0ZKF6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKF6"
FT                   /protein_id="BAH41607.1"
FT                   /translation="MIQTLLNSSTLPLVVSSALTAIVTYLVARHNNKKELMITDRQQIS
FT                   QENQQIRQELRQEMDKLREELHVWRNRCMELETIVQEWRDKYTTLVVERQQLEYRVKEL
FT                   ETELKTYMQARIS"
FT   CDS_pept        complement(652589..655519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41608"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR041352"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKF7"
FT                   /protein_id="BAH41608.1"
FT                   /translation="MTLPIKLKRGLKANLPSAASAGEPLFTTDTKELFIGTGDGISAIG
FT                   TDPTLAERVGKLEKYRSSVSRTYTETFTSPKVDIEKTTAWYSTNGVRTSKIPSITENFT
FT                   DLSAVDQINSYGVTFDTENALVRLSNTLEGVVVSSALPVVGVDKLTVQSDYMLPKALGV
FT                   TATKKVTGEKVSKFPHLEPTILVDRLNRTWVISFVDREGIYAVVTNPDDSLAFEGYLYS
FT                   YSGTGYYVASSITNAVVDHNNNVWIAAALTSMPGLLISITPDFQAFLTPISVKGNTSIN
FT                   TSTPFLKLHVDKNNRIWYSWGYSTNLYYGCVNSDGTFFIPTTSLAFTPSMVVDNVVMVE
FT                   DRTKGYVCFITRGFSINTVRALRLNYDGTNPTHFSSIGKASSKWLNATHDESTGITTIL
FT                   CVDNNAPIVHRLNLSTGASTTFPLTGFMAIDHSLPIGFVLQDKIMRVFYHQQTVGSTRL
FT                   ISIDVATLSVVEPDTLIQSGTNTTRISGCIDGKGRLTIVINTTEYSSSNYSLIKMLRYD
FT                   TVPTSVTFQISPDGASWFPLSLGEELTLPTKTDQLIMKIKMQSPNYGISPTIRSYRISL
FT                   GGAAGEITQVYTSSTLPSVTPISRVTLTANQILDGGEILWEVSNNGGGSWQSAELGQEI
FT                   EFANPINSDLRVRATLHSPASESSTPSIRDFTVTSANLLLNPSIADSNLPQRVIDLETN
FT                   LLKTNFQLITYMNATKYGLKNMVIDTFTDLSGVDIPNSQAVYDHTQKKFTTGIVDIVPP
FT                   MTANDAPAPFIVSADSVTGGAVFHMFDRNFASGWSTTAGGHHWIKIFLDNPAQIVDRYL
FT                   LSGGAKYAPTSWQLQGSNNNTTWDTLHSVSGYVWNQYEGNEFTIPTENIKPYQYYRFYS
FT                   TSSQYGSGVTQIQELRLQKAVDQNHLQSKPENTTTPPNKIVIVGDETVNGGSIKYQASR
FT                   DGGNTWSDVPAQTLTDISSQPVGTQLVVKAIITGNAELNAWGYYYE"
FT   CDS_pept        complement(655519..658125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41609"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZKF8"
FT                   /protein_id="BAH41609.1"
FT                   /translation="MATVGDQLAAPESGWKRYDNTYPSIAYNGTWTKRTGYAGSYELTD
FT                   TYTSTAGDTATFDFVGTKIRIISFFWNNFTAYAKITIDGVAHTFSERSAANTPQVIVFE
FT                   KIGLSEGKHRVELKLNSGTDYLGIDAIDIDDTGSIEFPIGVQLTAPAQGWKRYDDGDPS
FT                   IKYLGTFVRESNQSFYGGASNYATSADFKIKFNFIGTKIRIIGNMYQNKFTNVPITIDG
FT                   TTEAFSQYGDLKFQALLYEKKGLDNKKHTVEITLPSYSGSIGFDPNNMNVKNIQIDAID
FT                   IDADGRILHPDEVVDVKDLTVGKRIRFNYLAPAGAFGSISIGKEMAGLLPNVPATSANG
FT                   DGYFIMYGTNHKGDKLLMADRNIQTISWDSLNTAGIASGSGLPIKNLHTIPGLSGYSSA
FT                   VCKVSASTEYDTASYHAWKAFDGSESTYWTSTAATETTEEILKIEYSTPTRITSYYLYT
FT                   IYSPKKWFFEASNDGTSWDILHNGNEVSSWHGLKKTFSFKNDKAYTQYRIRVSERYVWN
FT                   GLYYVGFYTAQLFTSSDREITLRLPTGGVNASDKDNEWDKYMTDDQIWNNVNHGSWTST
FT                   TDQSNSKARVIRGYNGLQNWTSGSTDLTTPGRGFRPVLLIESINNNRFLILDGTDVKTY
FT                   TSSGWETVGTAPPTDEMFLNKGMLGLSTCAPYLKDLTDKSNLKILVSKPKREPTVAHLT
FT                   GVPVPKIVKMKNDTSFLGVAKINSLTLSGTEKGVLRVAISTDSGTTWEAKQKNGSWTKV
FT                   DVTNLSDFKAGAMTIDNFNSISEWDEKIGQARNLRCAFYFEQSSSTDETSLDSLTMDVD
FT                   LLDSWDMAMPGVDYKYGYNRNSNLRVLLLSDGDYKINVGFGGSSGSTITEVDGGTF"
FT   CDS_pept        complement(658129..658911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41610"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z483"
FT                   /protein_id="BAH41610.1"
FT                   /translation="MKKMPLPATNGQLRSKVSDMQIGDYVKCWYSFHGTSGSLSDSPAG
FT                   ILVGLGTDTFSTAEEKPLAGESTTNNSKLFYFVKVAKGLLIADRVCQHSISWDALNAGK
FT                   VIQGNPYSFSTSSNISQGYASSENISGTLRSLTGGVAYADANENKTLDARLSNGTCFPV
FT                   NNEYDKYLMGFPQSMIKNGYTVDDVFHYKVRFTTTQDTTMTGSRISSTGTIEVQDNTWR
FT                   VGRGSEDNFPIWKGLGMGKTSIAYASTGFRPVFEYKEV"
FT   CDS_pept        complement(658964..661783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41611"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z484"
FT                   /protein_id="BAH41611.1"
FT                   /translation="MSVRITRTGTEVVLDHNELANKGKRTHAEIDSYLQELDDARENKP
FT                   SLQDKFRELKDKDAEQDRQLDAVKGAVSTFQTGLNTLSSAVSAAEAKNQTQDLRLSQVE
FT                   QKNAQQDQAILKLQSDVSSNPNAEVVAARRDRDGKTFPSLKARLDDMQGKIGSGGGGGN
FT                   NGGASSSSFDLQTPINILLNTFRDAETHNRPAYRQNNMYVDVFSDSSGIDIEKSSSFAI
FT                   KDGIVSPGLYDTNIIMSSPTEPAPYHVTSSSETSGYPGWMGINGNVTDSFYTDGAIPPA
FT                   EGHWWQIDFFVPKIITKVAIRAIGISAGQYGLATFTLQGSQDNTNWTDLYVGSHANTGS
FT                   ELEHSFTNTSAYRYYRLAKLRSYRSANTIIYTGWHEIKFYEIIDAVTLVTKAVNVDRSP
FT                   KKLITTAEYTDTVTFDLTLDGTTWVHNIDLNKLLDTSSLKGTNLQLRANIPATGSLKSL
FT                   GFTWYDDSMLVEMPGKEGGGGDRSSTKPLVDVVAATNILRNAYRTLEGANQGASVRHNL
FT                   YADTFVDTSGIDASKSESYQIGNGKFIKSAGAVYSWQTLGVQTASSVGDYNNKNTTYRP
FT                   FKANGTTSNYSVEKIADDNAAVSPGGYSDYWLQSGTSADLFMKWVTPVEVSKIILWMNG
FT                   NYGVDHNYCDHQIFVKNPSTGNWETVTPRINLASKTDKGVHGDGSWHYPVILDYLINEV
FT                   KVTVWNKSTYMTITEIQILQASAKNPVMVSKPIPLAKAPTHLVLDAEYEGNISIDLSLD
FT                   GGTTFTAGVPLNQLVDLSTFLPGNSLVIRANLSEKAVLNSIGCIWYDKDTLPTYTDTVG
FT                   GSSGGNVPGNGNSMMQVEKYGVTASPASPSEVNITIPYTSDYKLPPIEVLKFTPGEQNC
FT                   TEEIAAFSSNEATNFDHDNYMELDGTLRLKTDYSIELIEDVVLPSGNRVYSLSLDVNHF
FT                   SRIEQIKVN"
FT   CDS_pept        complement(661804..662952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41612"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z485"
FT                   /protein_id="BAH41612.1"
FT                   /translation="MSVVSRRKSGFLFEDSFDTLTLDSKWNMTPNDSSRWSLSDAPGSL
FT                   RLKGGAEPLQLFLDTLTPVKQFVLDMKNSYNPKASGSTGGLTVFINHNDFFHVEEYYDA
FT                   SQGTAKTFPWLRLIRDYNTYTAYWSEDGAIWHIIGSEEFNRLAPKIGIFLNSSATDDYL
FT                   DIEHVRVFSLPTLTVSNLSPGIRVELLDSTGAAVDSKTCRTSQTSIHFDMTQHPIPFTG
FT                   SLRFAEADGKTIISSSDQMEMWGGDEYDFSPSLTLFFIDGEGKEVHLQDNTEEFLGHML
FT                   QGQYREVKMIARNTMHHGTFTGIQGVLTSYAGTDQYKRLVDVATDKNGVPGTWGDAFTL
FT                   PDTAAGNEQVFWTRISRETDPSLVDKTTHVHFGLNLSAVYTK"
FT   CDS_pept        complement(662965..667590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41613"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z486"
FT                   /protein_id="BAH41613.1"
FT                   /translation="MGNVTFGKMRSSLVEGAFHPNHPDNPDSPNRPRAEDRYAGYQNPL
FT                   LGDPGKGQIGRWQTVNLDSLESVIDQMIEQFVRDKIWYAKVRCREALWNMYRRLEWWVN
FT                   QQIDPQKNDYQRTLLMVRDCIYKILKNAEQPDGTHQNVSLPVCPAPYYHHFSGYYLNHY
FT                   DAIDKEVPTFDMRTLPLSDKFHGLFRYVSSTEDQEWKMVHSVGSNEMAGNENIMKLDVT
FT                   TLKHGNSSKVTFQWRFKKQGFIRFKYMASTAPGDGLLFFINNNQVGGEWNQNNSWQEAK
FT                   FHVKPGQTYKFDWFVRRMSDRRFGQNAVYVKDVECVEVVQSLDEQTPPDVDTLGDAAYH
FT                   IPGWEWITFSDKSIMTTYFSGINDTLSRKVQRVIDAECAGDFSFQYEMGVDNPPYTDES
FT                   SLFFDEEFDSRTQSGEGVRGSTAVSHHGWQWLLDGRSSTTQENSAVISYDVEIGDNCSV
FT                   NLTGDVQLICPPLEIDHYEERITNVTDPINFSFTGENRWEWETIRGLGSGIYMKDPIVS
FT                   GNGDATYTFDLEADGWIEFSFTTGLRDTERLLVIINDVQELEATGDEWEKNVQLPLVKG
FT                   RNTVIFRIQDDLTEEPLEETYPGEFSYRSSSGKHKTPMGSYIDVDREWKTDKNSSYTKE
FT                   DRAENIYDIFLNPGSSFEFSEELELKSLVDESKEDEYEVIFSENFNDRDKYAREIRVDD
FT                   NWEWEDIVTRYHGEGHGGDGVLKVENKDGTKNRLYVENIALHEPGFVKFEYGGSFSKYE
FT                   NLSLYSNNRLIWSENKSTSDPLGHTVVVPLNRGKQTLKWVFEDYDEVEVEDPNSGYKPP
FT                   TKPAPSTGGEQCYPAGTYTHPAIYGPGSKPPHKSHLKFDWGYQYDLSEPVKVYYDASGS
FT                   VPIAHGTYRDDFTIRRFIDNSSITKAIYSEQLEIYSGKGFDVPNAFDVPVEWIFRPIPD
FT                   ASNKTPIHYENTYVLTSEQVTNNSYPSVYWYAVFDSVGNERLTVGFDYQYYCYEIDNRQ
FT                   GNKNGRQVSTLRIASNAAVAEYKRETNSHIYATRRGIRWSTPSIPRTGNIMMNVGKLQN
FT                   PYKIRDWSSSKPHSSQEFYCNKPGTYCIAFEFQSFLGKSSKVGKDKIPYYIAIRNLKLQ
FT                   SNKQRKFSNDFDNTQVQLTVTDLSNRTIIDSALLTTEGKGWVEKSIKYELPLNSHYRID
FT                   YTLLKGLSHRGGKDDNGGCFLLKNGTVQEIWKSYCKDKLGSIYPKDNSPYEPNLPPPTK
FT                   VIIPDDSWCWIDTIEIRQSKRSKPCRDAYVRVRVYDEDNGTIISEEKYSDFDDVQTIKA
FT                   AITNDSDEGKNYSIRIKFYTDCDAEARLSNGEYTFHDKLPLPKSSAFVYNFKTTANVPI
FT                   WMGGCNGSNIQVNIYDQTGNKLQNTTVNLSGNYDFTLENLSNPNVTKVRVEITTEQKGE
FT                   ISEWTGKSYLTTFKLRNFKATENWTIVPSPFNSQLDFFIDGVLRGSYTNAGGTPVFQVD
FT                   RGRHTFTWVFTAKGTTEVWDYCNIDYIKLTNWICDKVLVTPYCDPGSGDKCVEALIKCL
FT                   LAIWKQRPEACVIGKRIWLFT"
FT   CDS_pept        complement(667635..670892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41614"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z487"
FT                   /protein_id="BAH41614.1"
FT                   /translation="MNHLTGISSLAAYQFRLADHYASIRNYIGKVTFTTSPSRKYSFVY
FT                   IPYGQSASMVMLDYLLANRKSFAADLQDSLQDMIRNDTSMANPMELVVVSDRSPLKESL
FT                   LQDETLDADRTIKQPLQVIRRVHFSDRIKAAGMAKLNPAQMSVRVNKDELHIDLPPASA
FT                   SRSISSEAVVRKEQPGAIRTERFAGKKIDEWFTGERASTFNLFVNTERSLAERKFWASL
FT                   FVQMEGEYATRSITHHLSIENRLPLSNRNNRHTMFTDWSYSIGERHTSFQMTRHFVQAF
FT                   HRMKTKPTKVLRDMDWAYLKARQYDALLHFLQRASRIATQDLTIHWASTGFRTMLQDVS
FT                   LLQNRDWGYRDFTRLLSLDSFSPTAFRPYQNDLFINRSRLHATRPYQSSGTLITEYALG
FT                   NRDVVSELAIFLSQITGTRTIQTDASLMTYLEQSSRHNSHLLFVPNPINDSLREKTNPL
FT                   WIPQHFELGKKDLSRPTSIIKDDLRADRKLVHAAHLWEKERAIDLSGGKAPKPSFYQDE
FT                   DDIFANLENVRPSLLTEEMVFATILRLLPAHLLEDILGSKEFPSHLMDDMIFASRLTDG
FT                   QSILEALMEWALTNKTFDAYVDEEFLEGVRTRVQALIESEVIFSKALQDRAGILSFETW
FT                   ESTRQNEILSHLEEDGVVGKREVLLSSTVEGVEITSQMEAAPSSLTEALVGEDVFRPAE
FT                   LQIENPFGYMEPDPSFLFDEHTARKSAHASDLDELPVTALLRSRITELCSGYLFATSPH
FT                   ERASYLVDLYDVAEKGARDGELQDDEWRKYAKLALEQTVLHEQLIAYQPEAAAHLIESI
FT                   LSYKLPDQAVINADWVASNQERATSLLTQVMGKKELADAVILEYLAGQLDHRKGHIEKP
FT                   LLSVRDYKKAWADRIEEIGQGLVYDYSNDVLEAEHDPEHWSGGFSVPEAYDPHDPFNAY
FT                   YPWTTDMNALAMGQDNWTRFGSGTWEHNRDQGTFTHPKGSSGMSGFIRNDFTYTDYQFE
FT                   VDFKVDEPADGDSAGIVFKYHNDQNYWMFVVSDGSASGMPRPMQLFKVENGRSTMYSTP
FT                   MNPFAWEKEKWYTLRVWVTGNRIRVWVDHNLQYDFTD"
FT   CDS_pept        complement(670975..672063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41615"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z488"
FT                   /protein_id="BAH41615.1"
FT                   /translation="MANFKYIEKITTSKELLDTIKSEIEQLTNYTFNPAAGETQEKSTW
FT                   TVMTDLTKKDSASGKTSELVLKGISKINTETKEFYVKFVNPGFTNPKEHSSLTVQVLTD
FT                   YNATAKTFATEGHPVNFEWADEKFVVNGKPTDRTIDKPVYLYMNVMNNRLSLVAVGDPA
FT                   VHFEDYRKSFLYVGALKPFKYNMDDVVGNIMLTAGAVSTEPTAPIAPHDYGQYTSFGNN
FT                   TLQMLATKSGIRFQKHYPAFITQAPQPGKAYSDSKLGDTGLLLEPQGFNASAWTRRYHL
FT                   SPIYVVHGYDGYRGSLDACIAVSKNNILHLDELIIDVDPSDTTKKHKQEVYRYFDHNTE
FT                   QNFMNYSANVKMGVAFLKEVRY"
FT   CDS_pept        complement(672078..673886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41616"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z489"
FT                   /protein_id="BAH41616.1"
FT                   /translation="MPSKQVAWIEGEVTADLLINKLADEIVNAKIPDTKNRWEKVFEVN
FT                   EDKWVTFKKTIVADTQGTYKHTDGKTYPVYKLPDLRELRSSYNDIPLVDEDGYVYETLG
FT                   TSNTKSGKKIQVKEFVYKDTEGNDITLSVPGLPVVNIDDLDPSNTVGKKAYVLLQGKYE
FT                   LDGVTFTPGVEWNEYKIITQMPSDWNDLLSKAKWTTYYSGGYTTYVSAQLYKFGMVKYI
FT                   ANPVHHYDRTVVLKAVPDVPTGQTPNDYFVMLKHPIQQYNYLDVSYGKGFTGKNPVGNS
FT                   ADTYLLACDMSTVIPGKVPVVLDQKQAELQYNKWNNPDDTEKYTPPHEAWALDYDDKVE
FT                   IKSPSSHFFYGADSIVSWVPNKKRRPDYWVEYNLSVSNDRVAIVIEGDPSPDMDAYYSS
FT                   FAYIGKTIPFADYDHKGNFGITVGMGDLTKEKSSFLPADIKQDTNPNYSGWGRYTSNGM
FT                   YSFSMLQTRSSVYFQAYYPAFITQLPKYDGVGTLPPELSKMVLEANGFQSSKWTKKYHA
FT                   SPIYLVHQFEGYRGYLDSVVAIEDHNLINKDELVVDTEEPKDPKNPAAGTWTEVYKFFR
FT                   INTPVNFFKYSPNPTDCTIAILKEVY"
FT   CDS_pept        complement(673900..674319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41617"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z490"
FT                   /protein_id="BAH41617.1"
FT                   /translation="MGFSVVYSGGGVIDKVRELPYPHFSKFTEPFIRGRMIDVTASKQV
FT                   FSDTYALPYPTEFLSVAFATNNYCVGDYWELSLDGVKVCETIYTKELPESVSMGNSFGI
FT                   VYPLKPNAQIRFDFHNISGTEKKVWYNVKFLRKKL"
FT   CDS_pept        complement(674326..674745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41618"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z491"
FT                   /protein_id="BAH41618.1"
FT                   /translation="MAGIANDYLIYPILDLIRDEVHRTKTVTADPFVEEPSVRLIREHP
FT                   LDPEKVTGAKLFYESGYMLDISLTFGSADTTTFPLEVDQLHPDWEYYSLWRLTSVTAAG
FT                   YAPDGKTVGSYLIRLLYDTRGLLTGTDVLRIEKER"
FT   CDS_pept        complement(674745..677780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41619"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z492"
FT                   /protein_id="BAH41619.1"
FT                   /translation="MQTMSNELRRILSERLKLGELSKPACRVEIDRLIFVPGRTEELDF
FT                   IMSDRREEKTLTRTIIQDSSKEGGTALSKISFVFPVEGKSTRDITAYMGDNRNHKGIDI
FT                   ACPVGTPIKAAWAGKVKKVTVSEKYTSFGFRVEIQHADGIWTRYAHMSEIHVKTGDYVT
FT                   QGTIIGKSGNTGDVRSAGVTNMGTYDDPNSPRSKGRGAHLHFEVWNGQAVIDPFPYMNG
FT                   SKYLFAASSNNGAGVTTDVTFVGTPGATLFDERFTNNTWHTKSVYKVDELAKKLSMIER
FT                   SSTEHSNLTFTFDPKGYKTLFPSPTVTTGMNLKLTSAHPGIFSMGFSTNFGEGAGELRV
FT                   FFNGKMQIKVNKFSGTENVEIRDIPFPNGEMEIRIELFWNGKQVNRFSLQYIQIKELQG
FT                   RPDLYGNKDKVDPTIQQEFFEEREITSTFMPGQPRKVSLQVGKFVYMDTLTLDNINHIE
FT                   MDDQFEMDSREARITISNPGGYYSPDYNPFYFPETYKETPWSYFVNGFHVGVLSENTPV
FT                   RIYMGYGLNLMRVFTGLIDKLDLNGEESTMTIYCRDMYKKIMNKVITEDKQYPPDVGHS
FT                   AAHDTNVFSSMTRRDKIISMAKKQAKQQGPELDYKFLLAIAEHETKMGTLGKGLPPGDF
FT                   ILGYGCYTGEKCDPQYQGIERQLYRGAVRYREAMASKGWRFQSVDDVKYFWQGGDKGAY
FT                   QWASDTNWYNSVWQIYQKFRSSTEFDQIPEWEGTAPVPTEPTAKAAYLKSAIVQDLIAH
FT                   AGMYSWRSNPQDIYYPYAIVQETSYTHATQATGKVFKAVPDKEGEFVEVDAESILTPKG
FT                   WKNPFIEPPGRKFESYQYKVGEAIAEIMKDTEFRSYCDRYGTYRLEEIDMNRPIVATYT
FT                   EHDNLITIHKTIDFSRGRSHLVILDEENKAGHFVDTEILMELKGEVRTGVRHVPSAKTD
FT                   ELKRLAARRTFFDIKRLCRTLQISIPGNPALDVLDRIYIIDSNTTTREAYTIKGIRSMF
FT                   DAQNGYMQILDLFWSNNEGAIV"
FT   CDS_pept        complement(677792..679207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41620"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z493"
FT                   /protein_id="BAH41620.1"
FT                   /translation="MISWADVNEKDWFFNEVMEASNYLMADGEPFIQGIAYGSFESNAP
FT                   YLHEEYKGSTGQKVFTLAAKLTPGADNPLFVYIDGTQTLFKEIRPNQTDPNKTDVELYY
FT                   APSANSVVAFSSFGKPALDRFGKPIPPNSSSFAYPNKRLDNGGTYFYNPFSRQFNEYLY
FT                   AYGRSLKRMDVPEEEWKSTPAQELAKKYIGLKQDVYMVSPAPGATIYLPYNLNGVQVRF
FT                   IYNSYENGALFMRGGYFSVKSPGVWRNDRFFPNAYINRAEAFLLIDRLRRSFYQRFTDS
FT                   QPPTQRLDESHTAYEGQRVFRLNGTYPAGKKLLVVKVDGKVVNSSDYQEFDDHTVLFNM
FT                   PLEAGKNLHFLYVKETSTRFEDVGREKYMYNSNTGEKIALNGGMTGSKPSWWAPSVLSM
FT                   EDERFGNGDYLVEGIAINNFADGAAVVNHMYEVSSSNAEEKEKWFMPYSLLTRAQAVSF
FT                   LNRFRKWSLERFK"
FT   CDS_pept        complement(679256..679867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41621"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z494"
FT                   /protein_id="BAH41621.1"
FT                   /translation="MTQQYAFGTANQRYKKKLFLDTGFEFIEVNARLIEPYSPPSPQPS
FT                   LREIKIINAPSHIHHSGFSSYQCSLTLLFPDKESYNEYLSYAGWTHKFYDEKGSIFLGS
FT                   AESITPQVLEAGRRYSVNVDLILIKKDSIERESRFQFQDIEGHWAQKNIEEMADLGLIT
FT                   VITRDGKPIIYFRPNDFVTRAEFIAFLNRTRRLVERMIRE"
FT   CDS_pept        complement(679880..681289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41622"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z495"
FT                   /protein_id="BAH41622.1"
FT                   /translation="MLKGVALARVAMTAAEFLDGLNTDWVQPMFMSDTQRQSRVLENQK
FT                   GLVDKITSIDKMPPGLKHLFFVDTAITGIKDSLINLLGGTTPSFSDYYNAFEAASKYDD
FT                   KDLTNELDNTFQLDKKEAQLEFDKYKAANKKREEKDKNSLLIDIDDSGSKLDNTPITSW
FT                   EEVKTLDLGKEVVGHHLESLSLEEGKLRSELKRTQATLRNQGKSEDSPEILKAYDDYYS
FT                   GINTKQNEHLAFFEEVFAKIPKGSDASDVVDSVIADIKASIAQNNLDKNNHTSGTKIKS
FT                   AMSKVSSDLENKEHQYYIDRSEAVLAGHSSNSEFMKNLEEKYLRSTIDSLDAGNSDMDS
FT                   LLAEYQNNETLKKIIEDFKKGLEKAKYDNLVSLHMSKQPTKGTFNMPDGLQPLTYWGMQ
FT                   TANGTHSTYDFTYGGDSNVNITIANMSGTEADLQRLGSTVSEAVRNTQASLSTELSQQV
FT                   RSGIATSYTRL"
FT   CDS_pept        682253..682405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41623"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z496"
FT                   /protein_id="BAH41623.1"
FT                   /translation="MALTFPHALKQVQQKRGKATGLIFKNIECFKGGCLPDGLHPGLGS
FT                   KRVIW"
FT   CDS_pept        complement(683206..683436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41624"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z497"
FT                   /protein_id="BAH41624.1"
FT                   /translation="MKKWDIWEYTLPQVAELMKRVNKYIQFEVETRMGFPFMRRKGTNS
FT                   AASSPHASSSQDYQEISEDDIAVLGKVLGGL"
FT   CDS_pept        complement(683535..683939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41625"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z498"
FT                   /protein_id="BAH41625.1"
FT                   /translation="MLNHQEDLEKKHAEMMNQEAVERIKKQQEADLIEAIFFEDDSEIR
FT                   LRDGKTYRIPPVTLKDARILMKKLGTVHIDAIILNFLPYENKEEDLFDILLLGFRNYPT
FT                   VTREYLDEHCDLETAKKLINILIGLNGLKK"
FT   CDS_pept        complement(684109..684948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41626"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z499"
FT                   /protein_id="BAH41626.1"
FT                   /translation="MIIKGVGQFLAKRASKDGNGVEVITLGNMQDLKIDMNVEMEDIFG
FT                   GDGLFAIDTLVKSKSIEITATDAKFDLAALELMMGSKLQEQKSDYVYVLGEQKAVTTGS
FT                   LDRTGSTGGAGVCEVEFGDKLFNGGGFAVRLKNSNRLLKQVKLSTSAAPQADEFMVDTF
FT                   NDGSDTKTRLIFSPALLNEDVVFNYQRIETVDVVDILMDEVPFPVHVVHHGSFLQKDGT
FT                   YAGIETELFSCMAKGSFSIDAARSTASTSAISLSVIDPERADGKLGSVKRFVSNKKV"
FT   CDS_pept        complement(685065..685496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41627"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A0"
FT                   /protein_id="BAH41627.1"
FT                   /translation="MVVDLYHHLYELLSTDSQLLALLGIAPEDKDSLSKQIIKRRKLAP
FT                   LSDVAKPLLSFYATSGKRDTHNPLLLTSFFRLDVITPGNIELAHQIANHLFHLLDGKSL
FT                   SMNGIEGLDMYVVSQQESDTGHSSTYCFTLVTKFTLQVC"
FT   CDS_pept        685577..685885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41628"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A1"
FT                   /protein_id="BAH41628.1"
FT                   /translation="MSPLKYIIGSYRSQEVITLRSDQIQIIIKQTKEKVSAKALEDHEA
FT                   VVGIMAMAKNFMLNEESVRHIIHEVFDGDKERMAKALTVASHLIDESLIQKIIADVK"
FT   CDS_pept        685979..686239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41629"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A2"
FT                   /protein_id="BAH41629.1"
FT                   /translation="MRDSKKAVLYVVIVAALAEFLLGEDIDREGWEELSDALGMLGMDL
FT                   NEIFTENTSLLLGLQKVCQEFGKMNITEEMIEELYVEDQLE"
FT   CDS_pept        686330..686497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41630"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A3"
FT                   /protein_id="BAH41630.1"
FT                   /translation="MYYQISFSADGEQVQVMKYTSTQDTPIAVLEEFFREHVQVNPASL
FT                   KGIGIVRIGE"
FT   CDS_pept        686478..686747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41631"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A4"
FT                   /protein_id="BAH41631.1"
FT                   /translation="MSGSVSNMACQGCDYEKACQKKMTVNDILMSAKEQDVVPMTCRCV
FT                   VHDICRDCQWYFKRQCASWKILNGKVFTAGTLQTCPKKILKAGC"
FT   CDS_pept        686816..687370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41632"
FT                   /db_xref="GOA:C0Z4A5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A5"
FT                   /protein_id="BAH41632.1"
FT                   /translation="MTDQLHQMDELFFAGKVDDFLQKAKENCEAKLTGMTFAGMTHDDV
FT                   VQEVLLKVYRTMKDYDQEKARVTTFVDHVITNKIRDCLRKAGTQKNLTNSNAVLVSSGD
FT                   ENEEETMISRIAAPSEEFRYEEVEMMLDIMEYMKLSTRDKLILQMRSEGYYHEEIGQRF
FT                   NISKERVCQIIKAILKQYGEL"
FT   CDS_pept        687498..687827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41633"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A6"
FT                   /protein_id="BAH41633.1"
FT                   /translation="MHTTPTAEGGEEEVNIWFGGCVAGIEKAVIAFDYEKQEFREEPLT
FT                   YTNFLLTDGMGYTVNPLDSEIFEITKEEFEQMLADHLATQAAELEAEKKLREAAEEIST
FT                   NEETE"
FT   CDS_pept        687832..688407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A7"
FT                   /protein_id="BAH41634.1"
FT                   /translation="MRQPTIVAFEGIDANAKEAQAALLEENLRCLGYKVKRVSFPRLDT
FT                   PIGAVIGMWLRCEIELDEKAVGKLFEADFLDYQREMARLSKENVDFIIMDHYELSNYYY
FT                   FYIKDTPLSWYATMSDLTKRPDATFFLRTEVDANHAMLLKVQEAYLSLAHASRRSVHTL
FT                   DTAIGVERMQKNILQVVHQLHLKKRVTC"
FT   CDS_pept        688401..688982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41635"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A8"
FT                   /protein_id="BAH41635.1"
FT                   /translation="MLTKLIGIVAAVFIPANAVLPAVEKGLSEVHPVVKLAGDIDRQWH
FT                   RKKELSNVITQVAPRLDKATVELYTETIFRLSEQYEIDPLLIMAMIWQESRFQHDAISG
FT                   KGARGLLQIMPRTGSWLGVHPDDLFDPVINLQTGIKYVDLLQKKYGNLRLSIIAYNQGE
FT                   GNVGRNRYHDGYYTKVMAHYKKMSGLLRES"
FT   CDS_pept        689005..689811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06590"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41636"
FT                   /db_xref="GOA:C0Z4A9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4A9"
FT                   /protein_id="BAH41636.1"
FT                   /translation="MSEHAVFVNQRLGKKKEQYSLYNMENIRRCKEDSEYLGEVILANE
FT                   ELIWHSVHKYIGKPETLVKQYCLEKADILQLGRMGIIKAIKAFDIARGVKFSSFAVITI
FT                   VREINCFLRDSGNIVRPTRTATTILHHISKIEADLGYLPTIEELSLLLGENVEQIKKAL
FT                   DVGRPVKYLQEPFLKASASSHEAATAMDVLKDEGRDVEEYVLDKLYVTALLAQLQNQIS
FT                   LKEWQVLQLRMAGYNQTQTAEFLNVSQMCVSRTMKKIQNISKNTLS"
FT   CDS_pept        689887..690861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41637"
FT                   /db_xref="GOA:C0Z4B0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B0"
FT                   /protein_id="BAH41637.1"
FT                   /translation="MKYYRLGGSGLKVSALGLGTNSFGGRADEQTSVNIIHTAIENGMT
FT                   FIDTANIYTQTESERIIGLALEGKRHEVVLATKAGLVKGEGPNQRGSSRYHLMLELENS
FT                   LKRLRTDYVDLYQIHTFDPETPLEETLRALDDMVRSGKVRYIGASNYAAWELMKAIGIS
FT                   QREGLNRYISTQVSYSLADRTPERELVPLCLDQGVGIIPYFPLAGGILTGKYTSAEQAP
FT                   AGSRADKEPRFVRLLSEDKLEFGRKISRIAAELGVSSSVLSLAWLMHKPAVSSVIVGVT
FT                   SVGQLTDNLQSTALALDEATLAELDRLSDTYRNGEPFAVYRLP"
FT   CDS_pept        690987..692498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BBR47_06610"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41638"
FT                   /db_xref="GOA:C0Z4B1"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B1"
FT                   /protein_id="BAH41638.1"
FT                   /translation="MMDTKKQSAPFHCSLDENLEKVKKELGNSTDLVTRQVRLEAVDQI
FT                   VVGILYTEGLVDKNMISSLMESLMLHAKKAHIPAEAECEERSLILMKDFLLTIGGVEEV
FT                   YDFDHLYDALLTGDTVILVDGYSNGFIANTKQWEDRGVQETSVQTVVRGSREAFSENLR
FT                   TNTALVRRRINNRNLWLETVQIGDMTQTKVAMMYIKGVVQDSVVAEVKERLGKIEIDGI
FT                   LESGNIEEMIQDHTFTPFPTIYNTERPDSVAAGLLEGRVAILVDGTPIVLLVPAVFVQF
FT                   FQSPEDYYMRADFGILRILRFISFFIALLGPSIYVAITTFHQEMLQTNLLMSIAAQREG
FT                   VPFPAAVEALLMEFTFEMLREAGVRMPRAVGSAISIVGALVLGEAAVQAGLVSPATVIV
FT                   VSITAITSFVFPSFSMSIPIRLLRFGLIALAASFGFIGIFVGMIALCIHLCTLRSFGVP
FT                   YMAPLAPVNLADQKDTLLRIPIWMMHTRPHFLRQKNSVRERKSKI"
FT   CDS_pept        692551..693753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BBR47_06620"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41639"
FT                   /db_xref="GOA:C0Z4B2"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B2"
FT                   /protein_id="BAH41639.1"
FT                   /translation="MKRKGVFLLTLALLVLLTGCWNRRELNDLAIVMGTGIDKIDGEYV
FT                   ISTQIVNPGGVASKEGGGMNQSSVATYSMRASSIFEGIRKMTTVTPRRLYFSHIQVLVL
FT                   GEQIAKEGAKEVLDLLFRDHEVRPDFYVILAKDATALQILSMIDPLEKIPATKLYKSLE
FT                   TAESAWGSIVSIQLDEFIADLLRDGIEPVLVGVNSKGKVHMGTSGGNSQKESQSSLLRY
FT                   HEIGVFKGDKLRGWFNEEESIGFSYITDRVDSTVEEIPCDKNNKIVIEIIRSKTTVNGK
FT                   VEKGKPQVEVSIFAEGNVGEVACSNDLSDPKTIYKLEADVEKQIRGKIVSAIHKAQKQY
FT                   RSDVFGFGQSIYKNDPKGWEKVKEDWDSQFPNLKVKIKTDVKLRRTGKVGNSFIPFMKK
FT                   E"
FT   CDS_pept        693823..694056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41640"
FT                   /db_xref="GOA:C0Z4B3"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B3"
FT                   /protein_id="BAH41640.1"
FT                   /translation="MWTIILIFLISLLIALFEVPYLRRNAMKKEMLVFFILLVVGTGLG
FT                   IAESLKVNIPNPLDWITFVYKPFSDFILGTVE"
FT   CDS_pept        694094..695185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BBR47_06640"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41641"
FT                   /db_xref="GOA:C0Z4B4"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B4"
FT                   /protein_id="BAH41641.1"
FT                   /translation="MIDNGHISARQFMILVALFGIGDAILYVPSLTATAAKQDAWISAF
FT                   MGWGEGFLLTYLYVSLSMRYPNKSIFQFSEEILGKWMGKAVAVLFITYFFIDASLMLME
FT                   IGDFVTTQIMQETPIEIILVLFLVIIVMGVRSGPEAFSRVGELLFPYFLLLFFVLIAFI
FT                   SPQIKIENLKPVVAHGIAPVIGGNFRYVGYLLETVILIVMFPLVQRPARAAKAYIWGIL
FT                   FANFCLTMITSVAILVLGADITVLLAYPSYTLAQKISIGNFLERIEVLMAVIWFITLFV
FT                   KITICYYATSCGIAYTMGLRDYRQLTLPLGMIMIVVALATMPNRPYFDTFVSEIWMPYS
FT                   LTYGLFLPVLLLSVGALRKKPVC"
FT   CDS_pept        complement(695232..696731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06650"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41642"
FT                   /db_xref="GOA:C0Z4B5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B5"
FT                   /protein_id="BAH41642.1"
FT                   /translation="MAFYYTEPSRTFNEFLLLPNLTTKECTPNNVDLSTPITKYKKGEK
FT                   PAISLNIPFSSAVMQAVSDHHMAVALARCGGISFIFGSQSIESQATMVRKAKGYKAGFV
FT                   VSRSNLTPSHTLKDILELKEATGHSTVAITEDGTAKGKLLGIVTGRDYRISRDSQDKLV
FT                   SDIMTPFSKLIYGKSGITLSEANDLIWEHKLNCLPIVDENQNLDFLVFRKDYDSRKNNP
FT                   LSLLDANKSYIVGAGINTKDYKERVPALVEAGVDILVIDSSDGFSEWQRETVQFVKENF
FT                   NVPIGAGNVVDKEGFRYLVESGADFIKVGIGGGSICITREQKGIGRGQASSLIEVAAAR
FT                   DEYFKETGIYVPLCSDGGIVHDYHVTLALAMGADFVMLGRYFARFDESPTKKVKIGNNF
FT                   VKEYWGEGSNRARNWQRYDTGGKSSLVFEEGVDSYVPYAGSLRENIDRTLSKIKSTMCN
FT                   CGSLSISELQQKARITVISATSLVEGGAHDVILKESSMAAE"
FT   CDS_pept        complement(696959..698374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cssS"
FT                   /locus_tag="BBR47_06660"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41643"
FT                   /db_xref="GOA:C0Z4B6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B6"
FT                   /protein_id="BAH41643.1"
FT                   /translation="MSKFRLKNLPISRQILILFMILTSVLGVGLGIGYPLAVKQYLVSN
FT                   TYSLLEEEFYTLSQHISFNEHNELLPVPAAAPYFLQLLLQRYEYSFDMIVYAENGQELG
FT                   SRSNSNGRIPYEDSKELFLKAATYPSQKLQHGSLDRGDESYLFVSKKMDYHGFPYYMVL
FT                   FSKEQELNQINSILTRQFLLVFGLLLLVSWLLAVWFSGYLSRPLRTLEELCKKIARRQF
FT                   DIPLAMDRGDEIGQLARSFDMMKNQLKEYDESQQHFVQNISHELKTPIMAIQGYTQGLI
FT                   EGVFQGPQAEKGLSIIMEESKRLEKVVGQLLYITKIESVSQMMQVDRVDLSEMMHLLKQ
FT                   RLSVLNPQIEWELNLADDLIVEGDGEQLSTAFVNIMENQLRYANSRLTISGRQAGKSVV
FT                   VTISNDGPPIEEALLPHLFQRFRKGKSGKHGLGLAIARAVLEAHKGTIDARNDADGPCF
FT                   TMIVPIEFKGRLS"
FT   CDS_pept        complement(698371..699072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cssR"
FT                   /locus_tag="BBR47_06670"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41644"
FT                   /db_xref="GOA:C0Z4B7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B7"
FT                   /protein_id="BAH41644.1"
FT                   /translation="MNTPYLVYLVDDETNLLDLLQSYLQNAGLQVKAFSSGKDVLPLLD
FT                   EETQPHLWILDIMMPDIDGYELLRLIREKSNVPIIFISARDQDVDKIIGLELGSDDYLA
FT                   KPFLPRELVIRAKKLLQRTYEKPGAAASSTQTFQDWVTIDPYIISEKGRQVKEGDELID
FT                   LTTKEFELIVYLLHNQGLALNREQILTSIWGEDYIGSDRAVDDLVKRIRKKMPKFPLET
FT                   VYGFGYRMTRI"
FT   CDS_pept        699253..700308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yerB"
FT                   /locus_tag="BBR47_06680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41645"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B8"
FT                   /protein_id="BAH41645.1"
FT                   /translation="MKRTVKSSLMVLAFMLLTTACGQKPVDTQPSPQVPDPLVQTPPET
FT                   NQPIEYAYKAPMTGIGSQENLGSKRPIMVMINNAPPARPQTGINKADMIYEVLSEGEMT
FT                   RFLAIFQSQKPEVIGPVRSIRPYFIQIGTGFDAVLVHAGGSPDALETLARKDLSHLDEI
FT                   PNGKYFWREKFRKMPHNLYTKPELLEKAMQDKGMRQTAEVPRFTFLPEDTEIKEGEPAT
FT                   QVDLTFHSLNKAAFTYDAEQKKYMRFTAGKPHLDLSDKKQLSTTNLLVISAKHRVLDKE
FT                   GRLSVDVIGPGDGYLFQQGKARKIKWKRSNGVIRAYEDAALTQEAPLLPGNTWISILPN
FT                   SPGLSKSLKFQ"
FT   CDS_pept        700427..700717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yecD"
FT                   /gene_synonym="yerC"
FT                   /locus_tag="BBR47_06690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41646"
FT                   /db_xref="GOA:C0Z4B9"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4B9"
FT                   /protein_id="BAH41646.1"
FT                   /translation="MQLEKLKGKGLEQLFEAVLSLETMEECYQFFDDLCTVNEMQSLAQ
FT                   RLEVARMLRKGFTYNQIEAETGASTATISRVKRCLNYGNDGYQMALERIGK"
FT   CDS_pept        700735..701430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrB"
FT                   /locus_tag="BBR47_06700"
FT                   /product="protein PcrB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41647"
FT                   /db_xref="GOA:C0Z4C0"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Z4C0"
FT                   /protein_id="BAH41647.1"
FT                   /translation="MIDYRGWRHTFKLDPDKTIDDEALEAICESGTDAIIVGGTYGVTY
FT                   DNTLELMSRLRRYAVPAVLEISSLDAVVPGFDSYLIPLVLNAGDPDWIFAPHVSGLQAF
FT                   GAYIHWDEIITEGYIIANPEAGVAQLTKARPIADATQAKAYAQVATNICRLPIVYMEYS
FT                   GTYGDPTIVKAAKTGAGEAHLFYGGGIRNPEQAAEMAAIADTVVVGNVIYDDLDAALAT
FT                   VKAVKGTQY"
FT   CDS_pept        complement(701494..703203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41648"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4C1"
FT                   /protein_id="BAH41648.1"
FT                   /translation="MKCLDKGQIALYLYDLLEPEEAEVIAAHLEECRHCQMKLKQELDE
FT                   LEDLEESLATDEPSDAVIHDIMANLPPYPIHVLKRSERQKIQKKIDWKKRSLDIVKKAT
FT                   IAVAGMAAVVYFGTLTSPSFATYVNNLYASTIKSDPQQTESSLFAAEAPEDALIQRGLE
FT                   RGYNKKLDLKAVDNGMTLEVKEVMADTRDVRIIFGFKDKNGKQLEKLFRNFPVGDEDKL
FT                   NETYEIKITDEDGNVLETIDKYHLKYNKKESIGEKEEYLMVSRPISRYFTDVSKIPDKL
FT                   NIELRIKKLDKVDGNWSVTIPVDISKAKKETRIVPINEHFTAPNGEVINLKQVMVTPGQ
FT                   TEFVIENTEGSGSSPSLTYEVVDDKGAVLAAWSTLDLVSEFGEDPNPFFKNVSREYFVR
FT                   ATDDKNIHFISFHSLPTDKNLTFRVGDNYDQVPSNFKQKLSIETLKTTPVTIKHEGSTL
FT                   TFSNFASEEITKTNPITSEKIKRLRNTLQLEATLAPGVIFLDSWQGADDKGKEYDFNFM
FT                   GSTTKDEKGNFIMKGTLVDEMDVIPKELTLTIEEQVNKAKDMDWSVALPLKN"
FT   CDS_pept        complement(703200..703757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06720"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41649"
FT                   /db_xref="GOA:C0Z4C2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4C2"
FT                   /protein_id="BAH41649.1"
FT                   /translation="MEEDRVIIGRVLQGNKDAYSEIIARYHGKVSSILRKMLGHTPDAQ
FT                   DIVQEIFIKTYYHLPEYKANYDFSAWLYRIAANHCLDELRKRKRKLTLSSNEEIEPVDS
FT                   HTPEVAFLNKEGQRLLRQRMMSVEEKYRIVLEMRYFESLSCEEISHRLSIPSSTVRTRL
FT                   SRGKDKLREAIGHAGQGGDFHL"
FT   CDS_pept        704067..704162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41650"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4C3"
FT                   /protein_id="BAH41650.1"
FT                   /translation="MSLSLNQREEELSMKIQAKKVESVRTTAVAA"
FT   CDS_pept        704258..705412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41651"
FT                   /db_xref="GOA:C0Z4C4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4C4"
FT                   /protein_id="BAH41651.1"
FT                   /translation="MERRPLFKPVHPVYEVTEQMLRLGEAPGYTFELEDENGSIRKMIK
FT                   LMDGTRTIGEIHTLLVVDYPEITYEEIVEAVESLSGLGFLMDQAKEEASVLTSEQKERY
FT                   KANIRYFSLFTDLNQSPSELQEQVSRKKVTILGMGAFGSTLLVNLVGAGIQHIKLVDFD
FT                   RVELSNLNRQMVFNEQDIGRLKVEAASDFIGRLHSEVLIETETMQIKSSEDVERVIAGS
FT                   DLVMLAADQPFFFLQRWVNHACTKLQIPFIAGGFNLIEGQFFMVEPGKTGCIDCMHLHR
FT                   SAQIEDYPQLIQRLLDTNFILPTATIAPNTMMITGMMASDAIRYLTGIAPVQSAGKFII
FT                   FDFNTLEKSVFFEWERNEAECPTCGRGSGTEPIFHIKRNEVLAK"
FT   CDS_pept        705479..706687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06750"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41652"
FT                   /db_xref="GOA:C0Z4C5"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4C5"
FT                   /protein_id="BAH41652.1"
FT                   /translation="MHPLARRAENEEEILIGRTDISNFIVLPAIGVEIIDMLDEGKSIH
FT                   EVATIMEERLGEPVDVLDFAQDLIASYQFVYMVDGEVVNEPVPVVDHFSWIKQGTGQFF
FT                   FNRVAFGLYGILFFTGLFICLFTGKYIPVYSDIFVSSSVTVSVVVSFVATWVFLFFHEM
FT                   AHLMAARSLGIGSRIGLGHRLVFAVAETNMSNIVLVEPQRRYRAFLAGMSWDAMFMGIG
FT                   VILLFANDQGWLTLLPFMEAFIRMLNVILLMALAFQFMVFMQTDLYYVLATKFQCSNLM
FT                   VNTRMFLKGKFRSLTQEEQEEWEYVADHEKRVIRWYSWVYLIGSVWGIWFFVQYQLRMA
FT                   VDFIWIIADDMKNAPLHSWEFWDGILLILLVLVPFLILGWSWMRAYRQRRSERERTKSL
FT                   QGT"
FT   CDS_pept        706767..707252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41653"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041656"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4C6"
FT                   /protein_id="BAH41653.1"
FT                   /translation="MNPMIQKIIHLRKEGHLDEAIQLALQLVSQSPTDPVAHYQCAWCH
FT                   DAAGLEREAVPFYEKAIELGLSVEDDLQGALLGLGSTYRTLGQYEQAAATLEMGMQQFP
FT                   SDRSFPIFLSMAYYNLGKHHEAMNLLLKNLAETSSDPTILAYRKAILFYADDLNKTW"
FT   CDS_pept        707323..708927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06770"
FT                   /product="probable two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41654"
FT                   /db_xref="GOA:C0Z4C7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4C7"
FT                   /protein_id="BAH41654.1"
FT                   /translation="MYKLILVDDEEDVREGVSQEIDWHSHGYEVVAKAENGREALELVE
FT                   RLRPDVVVTDIKMPFMNGLQLAESIGRDYPAIRIIILTGFDEFEYAQKAVKLQIDEYVL
FT                   KPFSASELMEALDKVKRRMDEEAAHRENVQLLRDSYRKSLPVLREVFLSSLLSRQLVQH
FT                   DVFSKACEYGIELRSPEYLVAVICVDQPKQEEQQLFLFAVKNIAEEQLNASKQAGIVFL
FT                   HEDQVVLLMRTKADDTQRIEVRAQHIAEEIRRTIEKYMSITVTIGIGNAVADIAALPYS
FT                   YEDAMQALDYKSILGCNRMIVINDVEKQASEQIRLDERREHELVRCIKMGTSTELRAVI
FT                   DELFDQVAGVPVSIEDYRIYLLEIMTTILKTAHRAEVDMDQLFGGQRYLLQVMTTFTGM
FT                   EDAREQITDICERLMASIASGRQTTYRRLITQALDYTHAHYHSPDISIHKVCEQLHISL
FT                   GYFSGIFKKETKTTFVSYLLSLRMEKAKELLRTTDLKSFEIAEKVGYTDPNYFSFSFRK
FT                   YTGMSAKEYRSQSEQEG"
FT   CDS_pept        708931..710694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06780"
FT                   /product="probable two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41655"
FT                   /db_xref="GOA:C0Z4C8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4C8"
FT                   /protein_id="BAH41655.1"
FT                   /translation="MKRLLTVIKVKGIQFIITTSFTLVTVLVMLFVGVMLYGKFAQTAE
FT                   QNAYLHTQQILEQVKYNLDSYLNGMTQIFELVDDKIRRSKGLTADKLSEQLETIVETRK
FT                   DIVSIAVFTREGTLLATTPSKVLRQNTRLTEQSWFQKAIEDPTNMNFSLPHIQNLFKGE
FT                   YTWVVSMSREILLHGPDGEIPTVLLVDVNFKEIDDLCQRVGLGKKGYVYIIDLVGNIVY
FT                   HPQQQLIYAGLKNENRSLPLKHSYGSYVEETEDEARLITIKTIDQLGWKIIGVSYMDEI
FT                   VTTKKEISRFIFWLLIFVIVIVLFVLHYLSAKISRPIKLLERSMEKVEQGDFSESEPIR
FT                   GSHEVEQLSLRFHLMVAKVRELMHQIIREQEAKRKSELEVLQAQINPHFLYNTLNSVVR
FT                   MVGNGKNEDVITTITSLSKLFRISLSRGKNIITVREELDHARHYLIIQKMRYKQKFEYE
FT                   IVVENEDEVLNCLTLKLLLQPIVENAIYHGIEHLADPGRIRIFAAIIDGKVLLQVSDNG
FT                   LGMSPDVLAQVKAGFYKSEEGSGVGIQNVQERIRLTFGEQYGLEIASEQEEGTVVRVWI
FT                   PRQVAEERDRL"
FT   CDS_pept        710691..711677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06790"
FT                   /product="putative ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41656"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4C9"
FT                   /protein_id="BAH41656.1"
FT                   /translation="MRTAAGKRFTVYGLVFLVAVTLFYSCSASLTDVVVDKKKTVALIV
FT                   RMKHGDYWRTVKLGAEMAAKEYERNLNFYAPDYEEDAQRQMELVQQAIADGSETIVVAP
FT                   SDERVLREAIKLTRERAIPILVLDTVGNDSAVKSYIGTDNYDMGRKAFEKMVYLIEKKG
FT                   QIVLLGTDRIKANAKRREQGVLDLLPREMQVELVANENAPSDKKQIGEWTRELIRKHPQ
FT                   LKGVIALDSSTAIGVAEELESSGLRDKVKIVAIDSPPEVLEYLQEGIISATIIQKPLSM
FT                   GYLGVKYAVEASNGEAVPSLVDTGTKVIDRENMFWSENQKLLFPFVK"
FT   CDS_pept        711803..712849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglB"
FT                   /locus_tag="BBR47_06800"
FT                   /product="D-galactose ABC transporter substrate binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41657"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4D0"
FT                   /protein_id="BAH41657.1"
FT                   /translation="MRKLIATTLVAAVTLSVVGCSQSGGSQPAASGGGSAPAGNPKIGV
FT                   AIYKFDDTFMTGVRNAISKAAEGKAEVDIVDSQNAQPTQNDKVDLFINKKVNALAINPV
FT                   DRTAAGVLIDKAKQANIPVVFFNREPMPEDMQKWDKVYYVGAKAEESGTISGQLIVDYW
FT                   KANPEADKNKDGVLQYVMLKGEPGHQDAELRTKFSVKAIEDAGIKVEKVAEDTAMWDRV
FT                   KGQEKMAAFLAASGDKIEAVLANNDDMALGAIEALKASGYFANGKYMPVVGVDATAPAL
FT                   KELEAGTLLGTVLNDANNQGKATLSIAASLAKGETPTKDSTGFDITDGKYVWVPYKKIT
FT                   KENMNDAK"
FT   CDS_pept        712932..714449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA"
FT                   /locus_tag="BBR47_06810"
FT                   /product="galactoside ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41658"
FT                   /db_xref="GOA:C0Z4D1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015862"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4D1"
FT                   /protein_id="BAH41658.1"
FT                   /translation="MAQQVFLLEMNHIHKEFPGVKALDDVTLKVRPGTVHALMGENGAG
FT                   KSTLMKCLFGIYRPDAGEIVLNNEQVTMSSSKDALAHGISMIHQELHPVPFRNVMENIW
FT                   LGRFPVKRIGPFSFVDEKKMLSDTEKLFADLGMDLNPHAVVRDLSVSKVQSLEIAKAVS
FT                   YRSKVIIMDEPTSSLTGNEVEQLFAIIRELKSRGVAIIYISHKMEEILRIADDVTIMRD
FT                   GKLIGTWRAAELTTDLIISKMVGRDLTQRFPSRSNTPGEPILKVEGLTSPFSQSFQHVS
FT                   FELRKGEILGVGGLVGAQRTELIEALFGLRAVSSGKVSINGQEVRIKSPKDAKRYKMAL
FT                   LTEERRVTGIIPVLSILENTVIANLASYQTPFLLLNERKRRADVSRSIEMLRVKTPSMK
FT                   AMIKNLSGGNQQKVLLARWLLTDPDILLLDEPTRGVDVGAKYEIYTIITELASQGKGII
FT                   MISSEMPELLGMSDRIMVMCEGKLSGFLSGTTATEEEIMRLATKHLA"
FT   CDS_pept        714468..715487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglC"
FT                   /locus_tag="BBR47_06820"
FT                   /product="galactoside ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41659"
FT                   /db_xref="GOA:C0Z4D2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR030158"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4D2"
FT                   /protein_id="BAH41659.1"
FT                   /translation="MSSLSAKQVQGFVTQNAIYIVLVLLIAGIAIYDPNFLSITTLRDI
FT                   LMQSSTRAIIALGAAFVLITGGTDLSAGRVVGLTAVISASMLQTQDYPRRFFPDLPDLP
FT                   LLIPILIAIAAGLLVGLINGIIVSRFSVPPFIATLGMMVIVYGFNSIYFDREPNQSQPI
FT                   AGLRSDFNQLGTGYIGPSGPYSIPYIVIIAIVVAFIVWVIFNKTRLGKNMYAIGGNMQA
FT                   ATVSGINVAFNLMMIYAIAGALYGLGGVLEAARTGGATNNYGNMYELDAIAACVVGGVS
FT                   TSGGIGTVPGVLAGVLIFGVINYGLTFIGVSPYWQLIIKGLIIVAAVAFDIRKYLAKK"
FT   CDS_pept        complement(715545..716594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06830"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41660"
FT                   /db_xref="GOA:C0Z4D3"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4D3"
FT                   /protein_id="BAH41660.1"
FT                   /translation="MGLKENAPTLNQRIDTLDTVRGFALMGILLVNIVALLYAQTPEIG
FT                   SVDHWLFQFFNFFVESRFFVIFSFLFGVGFYIFISRAKEKGANSTVLFIRRLIALLALG
FT                   FVHKMFHPGEALFIYAIFGFILLPFYRLKARTNLIIGLILSILVCSLGFKALLVLPLFI
FT                   LGLAVGQYGVFQDIPKFLPVIKKVQGVTFVLSLIGLFIQYRLTPADLAMSGANLVVDDT
FT                   VSEETLQQLMNYTIALTSTGLVMAAFYTTTLIRLLQNKTVQTILSPLTSYGRMALTNYV
FT                   GQTVLILVGGYVFDWFGNLGYLQTTLICLGIYVVQMVVSVLWLSVFRMGPLEWVWRLFT
FT                   YMKITPLRK"
FT   CDS_pept        716789..717589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41661"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4D4"
FT                   /protein_id="BAH41661.1"
FT                   /translation="MKPIARGKWRLAAGMAYFRWKRYVQWTFGRTRFAHEKRSEWLRYV
FT                   HYSHQTILLRPLQNVEMWMQHNKVINLRLAIARLDGLIIHPGETFSYWKQIGKPTRSKG
FT                   YVEGMLLSQGRVTAGVGGGLCQLSNLLYWMTLHTPLTVTERHRHSFDVFPDSHRTQPFG
FT                   SGATCFYNYLDLQIANQTQQPFQLHVYLTDTHLVGEWRSDMPPTRTYVIIEKEHEILPS
FT                   IWGGYERKNELYRDVYTLEGERVEQEWLTENRAYLMYEPLLPKG"
FT   CDS_pept        717691..720039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="BBR47_06850"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41662"
FT                   /db_xref="GOA:C0Z4D5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4D5"
FT                   /protein_id="BAH41662.1"
FT                   /translation="MSFADRITAGLNPEQREAVLTTEGPVLILAGAGSGKTKVLTQRIA
FT                   YLISAKQVAPWSILAITFTNKAAREMQNRVAAIIGGAAAQDAWLSTFHSLCVRILRRDI
FT                   DRLGINRSFSILDAGDQLSVVKQCLKELNIDPKQYEPRSILAAISGAKNELTDPETYTR
FT                   LAGDPFAQVAAKVYTAYQKKLRNNQSLDFDDLIMTTVRLFKEVPEVLEFYQKKFRYIHV
FT                   DEYQDTNRAQYLLISMLADKHRNVCCVGDADQSIYKWRGADISIILNFEKDYPEAKLIK
FT                   LEQNYRSTKTILQAANQVIANNKLRKEKKLWTENPGGDKIMCFQGDSEHDEAYFIVDTI
FT                   RKQMAQYKSYDKFAILYRTNAQSRVVEEVFIKSNMPYTIVGGTKFYDRKEIKDILAYLR
FT                   LISNPDDDISLQRIINVPKRNIGDTTVDKLQAYANANGQSLFQAIQETAYMGLPSRTTN
FT                   AILSFNDLISNLMQMTDYLSVTELVEEVLKRSGYRDSLKEEKTLEAQARLENIEEFLSV
FT                   TQEFERKNEDKSLLAFLTDLALVADIDSLGDDGAQEEVSAEGQVVLMTLHSAKGLEFPV
FT                   VFLVGCEEGVFPHSRSLFDDAEMEEERRLAYVGITRAEERLYMTCARMRTLFGRTNVNA
FT                   PSRFLQEIPAELLEGNPATADRGFSGGGRSSAFGQRDGSAFGRDTGARPFGAPSSQAGS
FT                   APKFGSAQRTPSSTPATFTRPAGEKLPGHGQGAGVDWKVGDRVAHGKWGNGTVVKVKGT
FT                   GDDMELDIAFPSPTGIKKLLAKFAPIQKG"
FT   CDS_pept        720094..722109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BBR47_06860"
FT                   /product="NAD-dependent DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41663"
FT                   /db_xref="GOA:C0Z4D6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Z4D6"
FT                   /protein_id="BAH41663.1"
FT                   /translation="MDRLTAETKIKELAKRIERHNRLYHEEDRPEISDQEYDQLMRELR
FT                   ELETSFPDLQSPDSPSLRVGGEPLPFFEKVVHKTPMLSLGNAFNEEDIRDFDRRVRQAV
FT                   GSQAVRYVAELKIDGLAVSLHYENGLFVRGATRGDGTTGEDITQNLKTIRSIPLRLTKP
FT                   LTLEVRGEAYMSKGAFEKLNKEREERGEALFANPRNSAAGSLRQLDPKIAASRQLDTFI
FT                   YGIGDLQGETVESHSEGLDLLETLGFMVNQERRVFDDVDELLAFIAGWTEKRPHLPYEI
FT                   DGMVIKVDSYAQQEELGFTAKSPRWAIAYKFPAEEAVTILEGIEVSVGRTGNVTPTALL
FT                   KPVSLAGTTVKRASLHNEDIIREKGLLIGDHVVVKKAGDIIPEIIAVLPERRTGNEVPF
FT                   AMPTHCPECGSELVRLEEEVALRCINPMCPALIREGMIHFVSRTAMNIDGLGEKVVAQL
FT                   YRDGIIHSVADLYYLHQQRDALLGLERMGEKSVDNLLAAIEASKENSLERVLFGLGIRL
FT                   VGAKAARVLAEHFGNIDTIMQASEEEITQIDEIGPKMAASLVNYFAQPQAQAVIERLRA
FT                   AGVNMEYKGIRIESGADLPFSGKTIVLTGTLTQMSRQEAEEAIARLGGKVTGSVSKKTD
FT                   LVIAGEKAGSKLEKAEKLGVAVMDEAGFLQVLESNA"
FT   CDS_pept        722157..723056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41664"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4D7"
FT                   /protein_id="BAH41664.1"
FT                   /translation="MNSFLKWGIGVVAMLQLVGCGNNSSTGSKEINANPPTVTAAALQG
FT                   NLTYQDVLELGATIHNLMMTDDARQVWVGTNAGLYSSAGGGTWGSLSTDLEQYAIEGWF
FT                   VDPDDPKRIFVGGIDGVLHSTDGGKKWTSVNKGLPEPANITSFVGNRRGDEVRLFAFVS
FT                   GEGIYQSMDGAQSWSLWQPMDQEVFAMDFDPEQDRLYVAAQFSLLYNEEGQWKTEEIPG
FT                   AQQIYSLAINRRTGTLAVATEKGIYEKIKGEWRLLDARSPEKLIVIASGGEDTKWVGIG
FT                   ESALIYKLEDNRWVKWNE"
FT   CDS_pept        723098..724165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yerH"
FT                   /locus_tag="BBR47_06880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41665"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4D8"
FT                   /protein_id="BAH41665.1"
FT                   /translation="MKVKFLAGCRFLTAVLLVMALTGCSLIPGGKDKAPEPTTPSLSEV
FT                   VEVSEDYYGSITPYKQNQTRGMLADTKYRVDFSHLELGLMEFARETYPTSDYYFQEGQV
FT                   IKKEQVTQWIAQEKTAGANGKKKNGILVHVLEHDYLSKKDKSLAGMVLGLSLSPNYQDA
FT                   TGQDKVYTAQELQAKGQQVAARIVQSVRATNPEVPILILMYQVPEVNSTLVPGHFIMSG
FT                   TVGANEATISKWLPIEEEYFLFPSSEVEQKYPEQSLQYDKLMRQSKGYFPEYIGMTGLG
FT                   RFMDGKLTEITITATAEYDSRTEALQFTQFAAGSINQLFDKSVHVNLYVQSMNKPLSIY
FT                   IRPTSGEPYMHIYRQ"
FT   CDS_pept        724441..725988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocA"
FT                   /locus_tag="BBR47_06890"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41666"
FT                   /db_xref="GOA:C0Z4D9"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4D9"
FT                   /protein_id="BAH41666.1"
FT                   /translation="MQVEFKNEAFTNFSLPENKKAFEEALAKVESELGLEYPLIIGGER
FT                   ITTEKKSNSFNPSNKEQVVGVVSQADQALAEKAIQTAASTFETWKKVPAQARSRYLYKA
FT                   AAIMRRRKHEFSAWLVKEAGKSWAEADADTAEAIDFMEYYGRQMDKLSQRHDLPRIPDE
FT                   DNELYYVPLGVGIVIPPWNFPLAIMVGMTTAALVAGNTVVLKPASTTPVIAAKFMEILE
FT                   DAGVPAGVVNFVPGSGSQIGDYLVEHNLTRFISFTGSRDVGLRINELAAKHRPGQKWMK
FT                   RLVAEMGGKDSIVVDNDCDIELAAQSIVASAFGFSGQKCSACSRAIVHQDVYDQVLGRV
FT                   VELTKQLTVGDIRTNDFYTGPVVDEKAYNKILEYIEIGKTEGKLVAGGEKGPESGYFIM
FT                   PTVFADVDPQARIMQEEIFGPVVAFCKANDFDHAMEIANNTEYGLTGAVISRNRENLER
FT                   AREEFHVGNLYFNRKCTGALVGVHPFGGFNMSGTDSKAGGPDYLLLFTQAKMVSEKL"
FT   CDS_pept        726246..727049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06900"
FT                   /product="putative undecaprenyl-phosphate
FT                   N-acetylglucosaminyl 1-phosphate transferase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41667"
FT                   /db_xref="GOA:C0Z4E0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4E0"
FT                   /protein_id="BAH41667.1"
FT                   /translation="MFVGLLLVSTFFAGAQKTVAVLAVGGAVLVAIGWIDDTYKSQKKE
FT                   FPALPKLMVQLLVAMMTFLMDIRFRGINLMWLGGEEGTYISFPILVSLLMTVLWIVGLI
FT                   NMVNFLDGVDGLAAGATAISAVTLFFLSMLKGQELTALLAVALAGAALAFLRFNFYPAK
FT                   IFMGDAGSMFLGFALGVISLEGTMKGATIISLVVTVLAVGLPVVDTVQVIISRLLAGSP
FT                   MYQADRRHVHHRLMSRGLSTKQTVIILYMVSLLFSVLAVFLFYSQ"
FT   CDS_pept        complement(727050..727970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41668"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4E1"
FT                   /protein_id="BAH41668.1"
FT                   /translation="MVKKFDITTLISQHGDILTSLFDHMSDMFFLMAVEQDADGEYLFR
FT                   YVLMNPSAMHVALLSEEAYGKTFDDVYPHEKASLLQHMYTQAVKSGSPIHFTANGDIIG
FT                   ESILSPVYDSNGVCTHVFSITRDVTERTNLESQLAYMAYHDVLTGLPNRRLLSEKLQQA
FT                   LRAAQSKEEMVAALYLDCDRFKEINDTWGHDTGDLFLQMLATRLKSSVRDGDIVARLGG
FT                   DEFVIVLTGIHSERQVEKIANRILLATQEPWMIEDRTIPFSTSIGIALYPASASEAEQL
FT                   LSNADKALYQAKKTGRNRFFFFDPI"
FT   CDS_pept        728130..728972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BBR47_06920"
FT                   /product="phosphatidylserine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41669"
FT                   /db_xref="GOA:C0Z4E2"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Z4E2"
FT                   /protein_id="BAH41669.1"
FT                   /translation="MGKKLLPGLIHRLPQNAMSRTMGKITATPFSRLAIQRYIKHYQID
FT                   TSIIEKPASEYRTLKEFFSRRLKPAARPIAPGPDTIVSPVDGTVSQLGDICEGTLIQAK
FT                   GKDFSVSELLGGSEEEAKRYYGGKFITIYLSPRDYHRIHMPVTGDLSSYCYLPGRLYPV
FT                   NKLGIENVDRLFARNERLVTHIKTDSLGDMALVKVGALFVGSVKVCYNTATTNIKHGRQ
FT                   THEKIAGTPRYEKGSELGWFEFGSTVILLLESNELEWATGVEKGKSLLMGQALATKKA"
FT   CDS_pept        730733..731023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BBR47_06930"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41670"
FT                   /db_xref="GOA:C0Z4E3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4E3"
FT                   /protein_id="BAH41670.1"
FT                   /translation="MSAITRKEVEHVANLARLQLTEEEAERYTKDLNAILDFAAKLNEL
FT                   DTSNIEPTSHATDVKNVMREDVNRPSLPREDVLKNAPDHEDGQFKVPAVFE"
FT   CDS_pept        731056..732528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BBR47_06940"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41671"
FT                   /db_xref="GOA:C0Z4E4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Z4E4"
FT                   /protein_id="BAH41671.1"
FT                   /translation="MSLFDKRLSEIHSALRAKEISVTDLVQASIASIKEHDGEIKSVLH
FT                   VDEEGALAHARQLDERLVKGNEELGLLYGLPAGLKDNLVTKDIRTTCASKFLANYDPVH
FT                   DGTVSKKVKDADSVIVAKLNMDEFAMGGSNENSGFFPAKNPWNTDYVPGGSSGGSAAAM
FT                   AARHFYYTLGSDTGGSIRQPAAFCGVVGLKPTYGRVSRFGLVAFASSLDQIGPVTKNVE
FT                   DSAYVLQAIAGHDEYDSTSANVDVPNYLSALTGDVKGLRIGVPKELIGEGIDPEVRDAV
FT                   LAALKQLESMGATWSEVSMPHTEYAVPAYYLLSSSEASSNLARFDGVRYGVRADNAANL
FT                   IELYKESRSQGFGQEVKRRIMLGTYALSSGYYDAYYKKAQQVRTLIIQDFNSIFADYDV
FT                   ILHPTTPSTAFKVGENVDDPVKMYLEDICTVPVNLAGLPAISVPCGFSKNGLPIGLQIV
FT                   GRAFDESTVLRVAHAYEQTAGFYGRKPEWVRG"
FT   CDS_pept        732533..733969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BBR47_06950"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41672"
FT                   /db_xref="GOA:C0Z4E5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0Z4E5"
FT                   /protein_id="BAH41672.1"
FT                   /translation="MSKYETVIGLEVHAELSTNSKIFCGCPTEFGAPPNTHTCPICLGH
FT                   PGVLPVTNKQAVEFAMKAALALNCEISRETKFDRKNYFYPDSPKAYQISQFDQPIGYNG
FT                   WIDIEVNGETKRIGITRLHLEEDAGKLTHSDFGGESLVDFNRVGVPLVEIVSEPDIRTP
FT                   EEARAYLEKLKAIIQYTEVSDVRMEQGSLRCDANVSIRPYGQEEFGTKAELKNMNSFRN
FT                   VQMGLEYEVLRQTEVVSSGGKVVQETRRWDEANKKTLTMRSKEEAHDYRYFPDPDLVRM
FT                   QISEEWIEAVRATIPELPDARQARYVNEFGLSKDDAGVITISKETADFFDETVKTGAEP
FT                   KSVANWLMVDLLAHLNANNLVFADVKMTPKGLGEMIKLIEDGTISSKIAKTVFKEMVET
FT                   GKEPKQIVEEKGLVQISDEGALRQVVVDAVNSNPQAVADFKSGNEKAAAFFVGQVMKQT
FT                   KGKANPGMVNKLIQEVLNSL"
FT   CDS_pept        734103..735674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41673"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4E6"
FT                   /protein_id="BAH41673.1"
FT                   /translation="MTQKWKSATAAFAVTTMLLGTGAQAFAASPEMILKNAENPSKEQV
FT                   KLPARAVEIVAALEKLEPALKALTLREVVISDYDENQVDLYISHPADTEMSAYLLFDRQ
FT                   SGELLGYEASPFIWEENEKVTDEAIVQKAEKAVQELFGEKKRKMTDAPQLSKTVYDEEE
FT                   LFIYPNVYFPILLNGLEIDEARYGIEVEMDSGGHLLGLSFQPLDLTGIQVADPKKAVTK
FT                   EEIRKQIFTPERLRYGYVWEGTDGKPGIEYTMRTAPVFDALTGKEIEMEWGADEGDGKL
FT                   HTSDIKDISLKPQGKPFIAKDATDQQILENLFEVDAKKLYTTYRKDEQQGEITYDWSNP
FT                   IDFNRASIMVNKVTGDIGGYVNLAHIENLSVPLTKEQSLQKAITFLEPHAKKAEWQVEM
FT                   YEEIKKEDKKSVEQYGFLFFEKQNGIPLMEYSYGVAIDPNKGKVVEFVASVPAEDRKYP
FT                   VLKPSVTAQQAADSVSKQVPVKLTYIWPRSGEKNAPILVYKLDTSKGWPTVDAVNGSFK
FT                   WGEYED"
FT   CDS_pept        735694..737352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41674"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4E7"
FT                   /protein_id="BAH41674.1"
FT                   /translation="MKRNGKRTAIALTIAMMLPGTSGTALAASPEIHPSHIASATKSEE
FT                   KLPERATQIVAALEKLEPALKTLTKRTIVKSEMDEKLLNLYLESPESNDMGATVVFDSK
FT                   TGELFTYNASLYIWKQGEIATDEVILQRAEKAVLELLGADKRKQAGSPQLSKAVEEVDP
FT                   EELTDPLAIYRTIYYPVVLNGLEILGNRTGIYVTTDYAGHILGVSTELLDLKETKVPDP
FT                   KTALTPEAVKKQFFTPDRLELGYVLEGKDAKPGMQYLWMNNAYIDAVTGKQIDFTHGTE
FT                   LAGNGKRNPDNLKNITLSPKGEPLIVKSRADGEKVVAGLFDVDTKVMFPEYYTGEVDGE
FT                   IIHSWSDEFGYEDVSISVDASTGAVTSADIFMETKSLPVPLSKEEALKKAISFIEPYAA
FT                   KSSTEWQVEIFDPYKQPKLADWMIELNEGEGEEEEDTGTGTYTFIFYELHDGLPVFDRY
FT                   YWMKVDIESGQVFTFIVNMPEKEGTLPILKPSVTEQQAAEIVAKNLPVKLSYFWPTYKG
FT                   KQAPFLTLVYTVDKSKSWPYVDAVKGTLEWGEYEE"
FT   CDS_pept        complement(737406..739166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41675"
FT                   /db_xref="GOA:C0Z4E8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4E8"
FT                   /protein_id="BAH41675.1"
FT                   /translation="MDHLIIKPKTHEEHTQIEDEALVEQAKAGDQEAFSELVRRHRSKV
FT                   YGYARSYTQEAFLAEDIVQDALIRAFLHLGTLVDSRRFLPWLHRIVRNQAYTRLSKGPQ
FT                   KRETVFSSMGKQTHEQEPADWEDLDSILHRLGRSWSHSAQNTNPEEVMVRRELFETIRS
FT                   LLYCLNPRERRIVESHFFDHLAPHEIAHMFQMSQANVYQVLSRSRKKLIQEKTRVVVDQ
FT                   YMKTRKVAGSMKQAVLNKPEAFTMPTWVTCAAALYGMVESTERKMSLPMILGLSGHAFR
FT                   LTIVPGNIHIAGPTMFHFQRVLQQGLKNMGFESRAVTSYHLSCEPSMNANQVAPSLLSP
FT                   EAREKRQLSVLLPEALELVHRSIDKGHPVLAWDLFMPEFGLIYGYDDEKRVFYAGDNCR
FT                   NDSTIPYENLGRGIVEELFVLAIDRAFPIDQRTMLANALQSALVHYRGEEPQDQSCVNG
FT                   LATYAAWQEAYEKGTVEPNGNAYTTVVNGDARRYASLFWSEIVDTWTDSVFDEVRPLMK
FT                   EAAGLYGAIADGFDTLSKLFPFPAGGEPNDAEKGKQAIALLQAIERNERAAVSVLEQIQ
FT                   AGLTANQAST"
FT   CDS_pept        739448..740002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_06990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_06990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41676"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4E9"
FT                   /protein_id="BAH41676.1"
FT                   /translation="MNKFIGVVVFSLLTVIISGCNGTQSVNTPIEVTQESQKAPSQIWI
FT                   QAYLNGSNKPQPELIESSEDKRQVEQIYKWINEGEKDQKITVSNIDRVYLLRFEFMRDG
FT                   KIAESQNYLYVITTDSKLYAKHVEVNEKYNFDKYDSSKLSNLINEAGIEGWQELKSGVI
FT                   NNEVLPGSQISRSFISLASSG"
FT   CDS_pept        complement(740174..741076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_07000"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_07000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41677"
FT                   /db_xref="GOA:C0Z4F0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4F0"
FT                   /protein_id="BAH41677.1"
FT                   /translation="MKSKVLSALFCLAALWGASFLFIRIASPVLGPFLTIQGRVTIAAI
FT                   ALLIYTACIGRSADFQSRWKQYLILGALNAAIPFMLIATAAIHLNASMSAILNSLTPVF
FT                   SALVAWGWIKETLTLGKWVGIIVGIIGVAILVGWSSIPLTFEVIVAVGLSILSTVSYGF
FT                   GGVYAKKALAGVPPLSVAVGQQIGASILLIPFTLFNLPTSMDSLTPAAIFSVVGVAIFC
FT                   TAIAYPLFFYLISNAGPTKTQSVTLLIPLFGMIWGVVFLDETITAGMITGLIVILGSIF
FT                   LIYDIRPQPAKNKPSQKAG"
FT   CDS_pept        741202..742638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_07010"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_07010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41678"
FT                   /db_xref="GOA:C0Z4F1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4F1"
FT                   /protein_id="BAH41678.1"
FT                   /translation="MSFHKFLQEYRFTYLALYHAIKEAIATGALHHGMKLPSSRELAGL
FT                   HQISRGSVNQVYDMLVADGYVVSEVGRGTFVTFQVNHELPLEKAETPLQLSNWGERICR
FT                   MPLRKQIEEGSPIKVDFRIGRTDYHQFPFQEWNRFMYAEVRNFLAKQHEEANVAQGHLP
FT                   LREAIAVHLRRTRGIPAKADRIVVCNGSMQVITLLAQLLVNPGDPVIVEEPSFTGIKKA
FT                   IASTGGVPSPVQVDKFGIQVHDWKSRLLFVTPSRHFPTGSILSQDRRRQLLDWASRQGS
FT                   IIVEDDYDSEFRWGGRPVEPLKALDQEDRVAYVGTFTKTTLPDLRIGYAVLPKCLVEPM
FT                   IRAKQLFEPHPSNMMEQRALAAFMKSGHYERHIRRMNRVYGKKYALYHQMLQENMGSLF
FT                   TFLQSDAGLHIYSVWKRTEDEYIRLRTACRQKGVIWEDATTYFMRPPASAACFGFSHLN
FT                   EEEMKEGIRLVLEAWESIST"
FT   CDS_pept        742934..743272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_07020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41679"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4F2"
FT                   /protein_id="BAH41679.1"
FT                   /translation="MKLISVAGESVAPGKGGSPSDTFDRSIATWQENGQEKTITVTYVR
FT                   YFGKVLAERGIYDQEAEGVPVSHLVATLFLEKHPEAKETRHYINDTAAFVALFEGFSLT
FT                   KWKERYPL"
FT   CDS_pept        743384..743854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_07030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_07030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41680"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4F3"
FT                   /protein_id="BAH41680.1"
FT                   /translation="MFSIWLPLVMTSSALVFGAIPSHVPATMISSAAWMVAVQEFDAFL
FT                   QDWKKGQTLENLRHPLFDLTGVSAVSGMMEIIRFSGEAHGQKGEITLSFYTLEGDKVFS
FT                   PPGSVSVARVDEKRREFQVTGAIPRVLRGRTGVVQVTFMGEKRASYLLKVRF"
FT   CDS_pept        743883..744611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natA"
FT                   /locus_tag="BBR47_07040"
FT                   /product="Na(+) extrusion ABC transporter ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_07040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41681"
FT                   /db_xref="GOA:C0Z4F4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4F4"
FT                   /protein_id="BAH41681.1"
FT                   /translation="MIEVKDVSKRFKEIAAVQHVSFRVEAGEVYGLLGENGAGKTTTMR
FT                   MMATVLSPTEGDIEISGFSVRQQPLEVRRRIGILFGGDVGLYSRLTARENIAYFGRLYG
FT                   LEQARLEERTRSLSRMLEMDAFLDRRVGAFSRGMKQKVAIARTLVHDPDVILLDEPTTG
FT                   LDVTAATIFRRMVGKLQEEGKTILFSSHNMGEISKLCKRVALMHKGKLRFAGGLDALRE
FT                   EFGTEDLDDIFMAVVEGSEG"
FT   CDS_pept        744611..745792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natB"
FT                   /locus_tag="BBR47_07050"
FT                   /product="Na(+) extrusion ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41682"
FT                   /db_xref="GOA:C0Z4F5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4F5"
FT                   /protein_id="BAH41682.1"
FT                   /translation="MGLHVVWTVLKKELMDLFRDRKAWMGTLLVPLLVIPFVFFLLGTS
FT                   YSNVEKEAREYIPLAVQGSSSLIAVLQKNPAVQILEPSNPEQALQAGQLRAILTIPAGF
FT                   DEEIAAGKTAQLSVAYDSTNQKSVYARTLLEQTVEAYSKEVVAKRLNQAGLSEQTIQPI
FT                   VSTFQNAASEERKSGGMLAGIIPLMLVVSLASAGMAAANDLVAGEKERGTLESLLTAPI
FT                   AAQHILTAKLLAVMTMSTMGAVASLISVTLAMRLGPMATEGDHFTLAFFSPVTLLVLIV
FT                   TILLLAALFAGLELVLSTIAKSFKEGQTYMSAVLFLAMVPSYMLMPVSPVDIPAHYYVM
FT                   PVFNGVALSKEVFYGKVDPMHVLLGIGSLLVYVVFTIFLASRIFRREGAGLKH"
FT   CDS_pept        745860..746762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BBR47_07060"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BBR47_07060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH41683"
FT                   /db_xref="GOA:C0Z4F6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0Z4F6"
FT                   /protein_id="BAH41683