(data stored in ACNUC1104 zone)

EMBL: AP008957

ID   AP008957; SV 1; circular; genomic DNA; STD; PRO; 6516310 BP.
XX
AC   AP008957;
XX
PR   Project:PRJDA20395;
XX
DT   03-APR-2009 (Rel. 100, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 4)
XX
DE   Rhodococcus erythropolis PR4 DNA, complete genome.
XX
KW   .
XX
OS   Rhodococcus erythropolis PR4
OC   Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Rhodococcus.
XX
RN   [1]
RP   1-6516310
RA   Sekine M., Tanikawa S., Omata S., Saito M., Fujisawa T., Tsukatani N.,
RA   Tajima T., Sekigawa T., Kosugi H., Baba S., Takei Y., Terui Y., Matsuo Y.,
RA   Nishiko R., Ito M., Tago S., Fujita N., Harayama S.;
RT   ;
RL   Submitted (31-MAR-2005) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Genome Analysis Center (NGAC), Department
RL   of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066, Japan URL
RL     :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Takarada H., Sekine M., Hosoyama A., Yamada R., Fujisawa T., Omata S.,
RA   Shimizu A., Tsukatani N., Tanikawa S., Fujita N., Harayama S.;
RT   "Comparison of the complete genome sequences of Rhodococcus erythropolis
RT   PR4 and Rhodococcus opacus B4";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1111/j.1462-2920.2005.00899.x.
RX   PUBMED; 16423019.
RA   Sekine M., Tanikawa S., Omata S., Saito M., Fujisawa T., Tsukatani N.,
RA   Tajima T., Sekigawa T., Kosugi H., Matsuo Y., Nishiko R., Imamura K.,
RA   Ito M., Narita H., Tago S., Fujita N., Harayama S.;
RT   "Sequence analysis of three plasmids harboured in Rhodococcus erythropolis
RT   strain PR4";
RL   Environ. Microbiol. 8(2):334-346(2006).
XX
DR   MD5; 9a5285f20fd2556d90d86e7e85e6d906.
DR   BioSample; SAMD00060932.
DR   EnsemblGenomes-Gn; EBG00001204589.
DR   EnsemblGenomes-Gn; EBG00001204590.
DR   EnsemblGenomes-Gn; EBG00001204591.
DR   EnsemblGenomes-Gn; EBG00001204592.
DR   EnsemblGenomes-Gn; EBG00001204593.
DR   EnsemblGenomes-Gn; EBG00001204594.
DR   EnsemblGenomes-Gn; EBG00001204595.
DR   EnsemblGenomes-Gn; EBG00001204596.
DR   EnsemblGenomes-Gn; EBG00001204597.
DR   EnsemblGenomes-Gn; EBG00001204598.
DR   EnsemblGenomes-Gn; EBG00001204599.
DR   EnsemblGenomes-Gn; EBG00001204600.
DR   EnsemblGenomes-Gn; EBG00001204601.
DR   EnsemblGenomes-Gn; EBG00001204602.
DR   EnsemblGenomes-Gn; EBG00001204603.
DR   EnsemblGenomes-Gn; EBG00001204604.
DR   EnsemblGenomes-Gn; EBG00001204605.
DR   EnsemblGenomes-Gn; EBG00001204606.
DR   EnsemblGenomes-Gn; EBG00001204607.
DR   EnsemblGenomes-Gn; EBG00001204608.
DR   EnsemblGenomes-Gn; EBG00001204609.
DR   EnsemblGenomes-Gn; EBG00001204610.
DR   EnsemblGenomes-Gn; EBG00001204611.
DR   EnsemblGenomes-Gn; EBG00001204612.
DR   EnsemblGenomes-Gn; EBG00001204613.
DR   EnsemblGenomes-Gn; EBG00001204614.
DR   EnsemblGenomes-Gn; EBG00001204615.
DR   EnsemblGenomes-Gn; EBG00001204616.
DR   EnsemblGenomes-Gn; EBG00001204617.
DR   EnsemblGenomes-Gn; EBG00001204618.
DR   EnsemblGenomes-Gn; EBG00001204619.
DR   EnsemblGenomes-Gn; EBG00001204620.
DR   EnsemblGenomes-Gn; EBG00001204621.
DR   EnsemblGenomes-Gn; EBG00001204622.
DR   EnsemblGenomes-Gn; EBG00001204623.
DR   EnsemblGenomes-Gn; EBG00001204624.
DR   EnsemblGenomes-Gn; EBG00001204625.
DR   EnsemblGenomes-Gn; EBG00001204626.
DR   EnsemblGenomes-Gn; EBG00001204627.
DR   EnsemblGenomes-Gn; EBG00001204628.
DR   EnsemblGenomes-Gn; EBG00001204629.
DR   EnsemblGenomes-Gn; EBG00001204630.
DR   EnsemblGenomes-Gn; EBG00001204631.
DR   EnsemblGenomes-Gn; EBG00001204632.
DR   EnsemblGenomes-Gn; EBG00001204633.
DR   EnsemblGenomes-Gn; EBG00001204634.
DR   EnsemblGenomes-Gn; EBG00001204635.
DR   EnsemblGenomes-Gn; EBG00001204636.
DR   EnsemblGenomes-Gn; EBG00001204637.
DR   EnsemblGenomes-Gn; EBG00001204638.
DR   EnsemblGenomes-Gn; EBG00001204639.
DR   EnsemblGenomes-Gn; EBG00001204640.
DR   EnsemblGenomes-Gn; EBG00001204641.
DR   EnsemblGenomes-Gn; EBG00001204642.
DR   EnsemblGenomes-Gn; EBG00001204643.
DR   EnsemblGenomes-Gn; EBG00001204644.
DR   EnsemblGenomes-Gn; EBG00001204645.
DR   EnsemblGenomes-Gn; EBG00001204646.
DR   EnsemblGenomes-Gn; EBG00001204647.
DR   EnsemblGenomes-Gn; EBG00001204648.
DR   EnsemblGenomes-Gn; EBG00001204649.
DR   EnsemblGenomes-Gn; EBG00001204650.
DR   EnsemblGenomes-Gn; EBG00001204651.
DR   EnsemblGenomes-Gn; EBG00001204652.
DR   EnsemblGenomes-Gn; EBG00001204653.
DR   EnsemblGenomes-Gn; EBG00001204654.
DR   EnsemblGenomes-Gn; EBG00001204655.
DR   EnsemblGenomes-Gn; EBG00001204656.
DR   EnsemblGenomes-Gn; EBG00001204657.
DR   EnsemblGenomes-Gn; EBG00001204658.
DR   EnsemblGenomes-Gn; EBG00001204659.
DR   EnsemblGenomes-Gn; EBG00001204660.
DR   EnsemblGenomes-Gn; EBG00001204661.
DR   EnsemblGenomes-Gn; EBG00001204662.
DR   EnsemblGenomes-Gn; EBG00001204663.
DR   EnsemblGenomes-Gn; EBG00001204664.
DR   EnsemblGenomes-Gn; EBG00001204665.
DR   EnsemblGenomes-Gn; EBG00001204666.
DR   EnsemblGenomes-Gn; EBG00001204667.
DR   EnsemblGenomes-Gn; EBG00001204668.
DR   EnsemblGenomes-Gn; EBG00001204669.
DR   EnsemblGenomes-Gn; EBG00001204670.
DR   EnsemblGenomes-Gn; EBG00001204671.
DR   EnsemblGenomes-Gn; EBG00001204672.
DR   EnsemblGenomes-Gn; EBG00001204673.
DR   EnsemblGenomes-Gn; EBG00001204674.
DR   EnsemblGenomes-Gn; EBG00001204675.
DR   EnsemblGenomes-Gn; RER_r0010.
DR   EnsemblGenomes-Gn; RER_r0020.
DR   EnsemblGenomes-Gn; RER_r0030.
DR   EnsemblGenomes-Gn; RER_r0040.
DR   EnsemblGenomes-Gn; RER_r0050.
DR   EnsemblGenomes-Gn; RER_r0060.
DR   EnsemblGenomes-Gn; RER_r0070.
DR   EnsemblGenomes-Gn; RER_r0080.
DR   EnsemblGenomes-Gn; RER_r0090.
DR   EnsemblGenomes-Gn; RER_r0100.
DR   EnsemblGenomes-Gn; RER_r0110.
DR   EnsemblGenomes-Gn; RER_r0120.
DR   EnsemblGenomes-Gn; RER_r0130.
DR   EnsemblGenomes-Gn; RER_r0140.
DR   EnsemblGenomes-Gn; RER_r0150.
DR   EnsemblGenomes-Gn; RER_rnp0010.
DR   EnsemblGenomes-Gn; RER_srp0010.
DR   EnsemblGenomes-Gn; RER_t0010.
DR   EnsemblGenomes-Gn; RER_t0020.
DR   EnsemblGenomes-Gn; RER_t0030.
DR   EnsemblGenomes-Gn; RER_t0040.
DR   EnsemblGenomes-Gn; RER_t0050.
DR   EnsemblGenomes-Gn; RER_t0060.
DR   EnsemblGenomes-Gn; RER_t0070.
DR   EnsemblGenomes-Gn; RER_t0080.
DR   EnsemblGenomes-Gn; RER_t0090.
DR   EnsemblGenomes-Gn; RER_t0100.
DR   EnsemblGenomes-Gn; RER_t0110.
DR   EnsemblGenomes-Gn; RER_t0120.
DR   EnsemblGenomes-Gn; RER_t0130.
DR   EnsemblGenomes-Gn; RER_t0140.
DR   EnsemblGenomes-Gn; RER_t0150.
DR   EnsemblGenomes-Gn; RER_t0160.
DR   EnsemblGenomes-Gn; RER_t0170.
DR   EnsemblGenomes-Gn; RER_t0180.
DR   EnsemblGenomes-Gn; RER_t0190.
DR   EnsemblGenomes-Gn; RER_t0200.
DR   EnsemblGenomes-Gn; RER_t0210.
DR   EnsemblGenomes-Gn; RER_t0220.
DR   EnsemblGenomes-Gn; RER_t0230.
DR   EnsemblGenomes-Gn; RER_t0240.
DR   EnsemblGenomes-Gn; RER_t0250.
DR   EnsemblGenomes-Gn; RER_t0260.
DR   EnsemblGenomes-Gn; RER_t0270.
DR   EnsemblGenomes-Gn; RER_t0280.
DR   EnsemblGenomes-Gn; RER_t0290.
DR   EnsemblGenomes-Gn; RER_t0300.
DR   EnsemblGenomes-Gn; RER_t0310.
DR   EnsemblGenomes-Gn; RER_t0320.
DR   EnsemblGenomes-Gn; RER_t0330.
DR   EnsemblGenomes-Gn; RER_t0340.
DR   EnsemblGenomes-Gn; RER_t0350.
DR   EnsemblGenomes-Gn; RER_t0360.
DR   EnsemblGenomes-Gn; RER_t0370.
DR   EnsemblGenomes-Gn; RER_t0380.
DR   EnsemblGenomes-Gn; RER_t0390.
DR   EnsemblGenomes-Gn; RER_t0400.
DR   EnsemblGenomes-Gn; RER_t0410.
DR   EnsemblGenomes-Gn; RER_t0420.
DR   EnsemblGenomes-Gn; RER_t0430.
DR   EnsemblGenomes-Gn; RER_t0440.
DR   EnsemblGenomes-Gn; RER_t0450.
DR   EnsemblGenomes-Gn; RER_t0460.
DR   EnsemblGenomes-Gn; RER_t0470.
DR   EnsemblGenomes-Gn; RER_t0480.
DR   EnsemblGenomes-Gn; RER_t0490.
DR   EnsemblGenomes-Gn; RER_t0500.
DR   EnsemblGenomes-Gn; RER_t0510.
DR   EnsemblGenomes-Gn; RER_t0520.
DR   EnsemblGenomes-Gn; RER_t0530.
DR   EnsemblGenomes-Gn; RER_t0540.
DR   EnsemblGenomes-Gn; RER_tm0010.
DR   EnsemblGenomes-Tr; EBT00001575636.
DR   EnsemblGenomes-Tr; EBT00001575637.
DR   EnsemblGenomes-Tr; EBT00001575638.
DR   EnsemblGenomes-Tr; EBT00001575639.
DR   EnsemblGenomes-Tr; EBT00001575640.
DR   EnsemblGenomes-Tr; EBT00001575641.
DR   EnsemblGenomes-Tr; EBT00001575642.
DR   EnsemblGenomes-Tr; EBT00001575643.
DR   EnsemblGenomes-Tr; EBT00001575644.
DR   EnsemblGenomes-Tr; EBT00001575645.
DR   EnsemblGenomes-Tr; EBT00001575646.
DR   EnsemblGenomes-Tr; EBT00001575647.
DR   EnsemblGenomes-Tr; EBT00001575648.
DR   EnsemblGenomes-Tr; EBT00001575649.
DR   EnsemblGenomes-Tr; EBT00001575650.
DR   EnsemblGenomes-Tr; EBT00001575651.
DR   EnsemblGenomes-Tr; EBT00001575652.
DR   EnsemblGenomes-Tr; EBT00001575653.
DR   EnsemblGenomes-Tr; EBT00001575654.
DR   EnsemblGenomes-Tr; EBT00001575655.
DR   EnsemblGenomes-Tr; EBT00001575656.
DR   EnsemblGenomes-Tr; EBT00001575657.
DR   EnsemblGenomes-Tr; EBT00001575658.
DR   EnsemblGenomes-Tr; EBT00001575659.
DR   EnsemblGenomes-Tr; EBT00001575660.
DR   EnsemblGenomes-Tr; EBT00001575661.
DR   EnsemblGenomes-Tr; EBT00001575662.
DR   EnsemblGenomes-Tr; EBT00001575663.
DR   EnsemblGenomes-Tr; EBT00001575664.
DR   EnsemblGenomes-Tr; EBT00001575665.
DR   EnsemblGenomes-Tr; EBT00001575666.
DR   EnsemblGenomes-Tr; EBT00001575667.
DR   EnsemblGenomes-Tr; EBT00001575668.
DR   EnsemblGenomes-Tr; EBT00001575669.
DR   EnsemblGenomes-Tr; EBT00001575670.
DR   EnsemblGenomes-Tr; EBT00001575671.
DR   EnsemblGenomes-Tr; EBT00001575672.
DR   EnsemblGenomes-Tr; EBT00001575673.
DR   EnsemblGenomes-Tr; EBT00001575674.
DR   EnsemblGenomes-Tr; EBT00001575675.
DR   EnsemblGenomes-Tr; EBT00001575676.
DR   EnsemblGenomes-Tr; EBT00001575677.
DR   EnsemblGenomes-Tr; EBT00001575678.
DR   EnsemblGenomes-Tr; EBT00001575679.
DR   EnsemblGenomes-Tr; EBT00001575680.
DR   EnsemblGenomes-Tr; EBT00001575681.
DR   EnsemblGenomes-Tr; EBT00001575682.
DR   EnsemblGenomes-Tr; EBT00001575683.
DR   EnsemblGenomes-Tr; EBT00001575684.
DR   EnsemblGenomes-Tr; EBT00001575685.
DR   EnsemblGenomes-Tr; EBT00001575686.
DR   EnsemblGenomes-Tr; EBT00001575687.
DR   EnsemblGenomes-Tr; EBT00001575688.
DR   EnsemblGenomes-Tr; EBT00001575689.
DR   EnsemblGenomes-Tr; EBT00001575690.
DR   EnsemblGenomes-Tr; EBT00001575691.
DR   EnsemblGenomes-Tr; EBT00001575692.
DR   EnsemblGenomes-Tr; EBT00001575693.
DR   EnsemblGenomes-Tr; EBT00001575694.
DR   EnsemblGenomes-Tr; EBT00001575695.
DR   EnsemblGenomes-Tr; EBT00001575696.
DR   EnsemblGenomes-Tr; EBT00001575697.
DR   EnsemblGenomes-Tr; EBT00001575698.
DR   EnsemblGenomes-Tr; EBT00001575699.
DR   EnsemblGenomes-Tr; EBT00001575700.
DR   EnsemblGenomes-Tr; EBT00001575701.
DR   EnsemblGenomes-Tr; EBT00001575702.
DR   EnsemblGenomes-Tr; EBT00001575703.
DR   EnsemblGenomes-Tr; EBT00001575704.
DR   EnsemblGenomes-Tr; EBT00001575705.
DR   EnsemblGenomes-Tr; EBT00001575706.
DR   EnsemblGenomes-Tr; EBT00001575707.
DR   EnsemblGenomes-Tr; EBT00001575708.
DR   EnsemblGenomes-Tr; EBT00001575709.
DR   EnsemblGenomes-Tr; EBT00001575710.
DR   EnsemblGenomes-Tr; EBT00001575711.
DR   EnsemblGenomes-Tr; EBT00001575712.
DR   EnsemblGenomes-Tr; EBT00001575713.
DR   EnsemblGenomes-Tr; EBT00001575714.
DR   EnsemblGenomes-Tr; EBT00001575715.
DR   EnsemblGenomes-Tr; EBT00001575716.
DR   EnsemblGenomes-Tr; EBT00001575717.
DR   EnsemblGenomes-Tr; EBT00001575718.
DR   EnsemblGenomes-Tr; EBT00001575719.
DR   EnsemblGenomes-Tr; EBT00001575720.
DR   EnsemblGenomes-Tr; EBT00001575721.
DR   EnsemblGenomes-Tr; EBT00001575722.
DR   EnsemblGenomes-Tr; RER_r0010-1.
DR   EnsemblGenomes-Tr; RER_r0020-1.
DR   EnsemblGenomes-Tr; RER_r0030-1.
DR   EnsemblGenomes-Tr; RER_r0040-1.
DR   EnsemblGenomes-Tr; RER_r0050-1.
DR   EnsemblGenomes-Tr; RER_r0060-1.
DR   EnsemblGenomes-Tr; RER_r0070-1.
DR   EnsemblGenomes-Tr; RER_r0080-1.
DR   EnsemblGenomes-Tr; RER_r0090-1.
DR   EnsemblGenomes-Tr; RER_r0100-1.
DR   EnsemblGenomes-Tr; RER_r0110-1.
DR   EnsemblGenomes-Tr; RER_r0120-1.
DR   EnsemblGenomes-Tr; RER_r0130-1.
DR   EnsemblGenomes-Tr; RER_r0140-1.
DR   EnsemblGenomes-Tr; RER_r0150-1.
DR   EnsemblGenomes-Tr; RER_rnp0010-1.
DR   EnsemblGenomes-Tr; RER_srp0010-1.
DR   EnsemblGenomes-Tr; RER_t0010-1.
DR   EnsemblGenomes-Tr; RER_t0020-1.
DR   EnsemblGenomes-Tr; RER_t0030-1.
DR   EnsemblGenomes-Tr; RER_t0040-1.
DR   EnsemblGenomes-Tr; RER_t0050-1.
DR   EnsemblGenomes-Tr; RER_t0060-1.
DR   EnsemblGenomes-Tr; RER_t0070-1.
DR   EnsemblGenomes-Tr; RER_t0080-1.
DR   EnsemblGenomes-Tr; RER_t0090-1.
DR   EnsemblGenomes-Tr; RER_t0100-1.
DR   EnsemblGenomes-Tr; RER_t0110-1.
DR   EnsemblGenomes-Tr; RER_t0120-1.
DR   EnsemblGenomes-Tr; RER_t0130-1.
DR   EnsemblGenomes-Tr; RER_t0140-1.
DR   EnsemblGenomes-Tr; RER_t0150-1.
DR   EnsemblGenomes-Tr; RER_t0160-1.
DR   EnsemblGenomes-Tr; RER_t0170-1.
DR   EnsemblGenomes-Tr; RER_t0180-1.
DR   EnsemblGenomes-Tr; RER_t0190-1.
DR   EnsemblGenomes-Tr; RER_t0200-1.
DR   EnsemblGenomes-Tr; RER_t0210-1.
DR   EnsemblGenomes-Tr; RER_t0220-1.
DR   EnsemblGenomes-Tr; RER_t0230-1.
DR   EnsemblGenomes-Tr; RER_t0240-1.
DR   EnsemblGenomes-Tr; RER_t0250-1.
DR   EnsemblGenomes-Tr; RER_t0260-1.
DR   EnsemblGenomes-Tr; RER_t0270-1.
DR   EnsemblGenomes-Tr; RER_t0280-1.
DR   EnsemblGenomes-Tr; RER_t0290-1.
DR   EnsemblGenomes-Tr; RER_t0300-1.
DR   EnsemblGenomes-Tr; RER_t0310-1.
DR   EnsemblGenomes-Tr; RER_t0320-1.
DR   EnsemblGenomes-Tr; RER_t0330-1.
DR   EnsemblGenomes-Tr; RER_t0340-1.
DR   EnsemblGenomes-Tr; RER_t0350-1.
DR   EnsemblGenomes-Tr; RER_t0360-1.
DR   EnsemblGenomes-Tr; RER_t0370-1.
DR   EnsemblGenomes-Tr; RER_t0380-1.
DR   EnsemblGenomes-Tr; RER_t0390-1.
DR   EnsemblGenomes-Tr; RER_t0400-1.
DR   EnsemblGenomes-Tr; RER_t0410-1.
DR   EnsemblGenomes-Tr; RER_t0420-1.
DR   EnsemblGenomes-Tr; RER_t0430-1.
DR   EnsemblGenomes-Tr; RER_t0440-1.
DR   EnsemblGenomes-Tr; RER_t0450-1.
DR   EnsemblGenomes-Tr; RER_t0460-1.
DR   EnsemblGenomes-Tr; RER_t0470-1.
DR   EnsemblGenomes-Tr; RER_t0480-1.
DR   EnsemblGenomes-Tr; RER_t0490-1.
DR   EnsemblGenomes-Tr; RER_t0500-1.
DR   EnsemblGenomes-Tr; RER_t0510-1.
DR   EnsemblGenomes-Tr; RER_t0520-1.
DR   EnsemblGenomes-Tr; RER_t0530-1.
DR   EnsemblGenomes-Tr; RER_t0540-1.
DR   EnsemblGenomes-Tr; RER_tm0010-1.
DR   EuropePMC; PMC3784785; 24072865.
DR   EuropePMC; PMC5513430; 28715480.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP008957.
DR   SILVA-SSU; AP008957.
DR   StrainInfo; 718647; 0.
XX
CC   Rhodococcus erythropolis strain PR4 has been isolated from
CC   the Pacific Ocean. This strain was capable of degrading
CC   normal alkanes as well as branched alkanes as sources of
CC   carbon and energy (Komukai-Nakamura et al., 1996).
CC   This work was supported by NEDO.
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
CC   The microbial strain and microbial genomic DNA clones used for
CC   the sequencing project are available through the NBRC.
CC   URL:http://www.nbrc.nite.go.jp/e/index.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6516310
FT                   /organism="Rhodococcus erythropolis PR4"
FT                   /strain="PR4 (= NBRC 100887)"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="seawater"
FT                   /note="This strain is also named as MBIC01337, PR4."
FT                   /note="synonym: Rhodococcus erythropolis NBRC 100887"
FT                   /db_xref="taxon:234621"
FT   CDS_pept        768..2330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RER_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30709"
FT                   /db_xref="GOA:C0ZLE1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZLE1"
FT                   /protein_id="BAH30709.1"
FT                   /translation="MNDDPNALARVWVDVVAELTSDDPGSNLPALSSKQKAFVRLVRPL
FT                   TLAQGFALLSVPSPFAQETIERDLREPILQALGRHLGGQVEGLGVRIALEDDADAPAEP
FT                   VEERTGSRQFESVNSSGAYRRRRFTEGDGEPSDSETAETEEVDDDREALASVHESWPSY
FT                   FTKPPATPSASGSGANSLNAKYTFDTFVIGSSNRFAHAAAVAIAEAPARAYNPLFIWGA
FT                   SGLGKTHLLHAAGHYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRRYRETDVL
FT                   LVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVVSSDRPPKQLATLEERLRTRFEWGLI
FT                   TDVQPPELETRIAILSKKARMDRLEVPHDVLELIASRIERNIRELEGALIRVTAFASLN
FT                   RQPLDLTLAEVVLRDLMPDSSSLEINAATIMAVTAEYFNMSIDDLCGPGKARPLAQARQ
FT                   ISMYLCRELTDLSLPKIGQTFGRDHTTVMYADKKIRKEMTERRKVYDQVQELTARIKQR
FT                   SKR"
FT   CDS_pept        2916..4100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="RER_00020"
FT                   /product="DNA polymerase III beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30710"
FT                   /db_xref="GOA:C0ZLE2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE2"
FT                   /protein_id="BAH30710.1"
FT                   /translation="MELGSLKFRVSREEFADSVAWVARSLPSRPPVPVLGGVLLDATEA
FT                   GLTVSGFDYEVSAQVRVSADVTTAGQALVSGRLLADITKSLPNKPVDVTLEGTRVLISC
FT                   GSAKFSLPTMPVEDYPQLPTLPQQSGSIPVDLFSEAISQVAVAAGKDDTLPMLTGIRVE
FT                   IEQNSIVLAATDRFRLAVRELEWTPANPDVQAAVLIPAKTLSESAKTLAGNANSPVELA
FT                   LGSGTTIGNDGLLGIVNDGRRTTTRLLDAEFPKFRQLLPAQHTAMATVEVTPLIEAIKR
FT                   VALVAERGAQVRMQFSADGLLLSAGGDDAGRAEETLNASFQGEALTIAFNPGYLIDGLN
FT                   SLHSENVLFGFTTPSRPAVLRPAAEEEPTADESGNFAAPSSEYTYLLMPVRLPG"
FT   CDS_pept        4145..5053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00030"
FT                   /product="putative 6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30711"
FT                   /db_xref="GOA:C0ZLE3"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE3"
FT                   /protein_id="BAH30711.1"
FT                   /translation="MKIGLVGLGKMGFNMRERLRAHGLEVIGYDPRPEVTDVGSLAELA
FT                   ASLEGPRVVWVMVPAGEITQSTIAELADALEGGDLVIDGGNSRYTDDAVHAELLGARGI
FT                   GFLDCGVSGGIWGRENGYGLMVGGSEPDVAKAMPIFDALRPDGDAADGFVHAGPVGAGH
FT                   YAKMVHNGIEYGLMQAYAEGYELLEAESLIADVPGVLRAWSKGTVVRSWLLDLLVDALE
FT                   EDPELAQITGYTEDSGEGRWTVEEAIKHAVPAPVISAALFARFASRQDDSPAMKAVSAL
FT                   RNQFGGHAVKSASPKNSASGS"
FT   CDS_pept        5054..6283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RER_00040"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30712"
FT                   /db_xref="GOA:C0ZLE4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZLE4"
FT                   /protein_id="BAH30712.1"
FT                   /translation="MFVRRFSLRDFRSWDSLTLDLTPGTTVFLGSNGHGKTNVLESLGY
FT                   LSTLSSHRVSTDAPMIRSGSASAFAGATVVNNGRELTIDVELIEGKSNRARINQSPTRR
FT                   PREVLGILQSVMFAPEDLSLVRGDPGDRRRYLDELLTSRIPRMAAVRADYDKVLRQRSA
FT                   LLKTAGAALRRGSRGGESDNVLSTLEVWDGHLAAHGAQLLAGRLELVHDLAPHLAESYR
FT                   SIAPESRPASIRYKSSLGSSLDPEFTDPARISGIDDVAYLEERFHLELAQMRSKEIDRG
FT                   VCLVGPHRDDLELVLGDSPAKGFASHGESWSFALSLRLAGFALLRADGSDPVLMLDDVF
FT                   AELDRRRRRALATVAATAEQVLITAAVPEDVPDELEAAKFGVEASDTGDGRISRIVPVG
FT                   STDQEVEFDD"
FT   CDS_pept        6276..6821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30713"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE5"
FT                   /protein_id="BAH30713.1"
FT                   /translation="MTEDSSAAPEPELKGIDLARRALEEARATAKANGKAVGQGRSSPK
FT                   YGSGRPRRRSGWSGPGPDARDPQPFGALTSAISKSRGWSPKVSEGTVLGRWPQVVGEDI
FT                   SAHAEPISLKEGVLSISAESTAWATQLRMMQSQILAKIAAAVGDGVVKTLRITGPSAPS
FT                   WRKGERHVKGRGPRDTYG"
FT   CDS_pept        6946..7857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30714"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE6"
FT                   /protein_id="BAH30714.1"
FT                   /translation="MSQKISTPASSFAEPDHILLQARNVEFDWSDLPMHWIPGDPFSTH
FT                   VLNVLHLLLPAGEEWFVETFKEALPLIEDEKLREDVVGFIGQEAMHSNAHSGVLVHLKE
FT                   NGLDPTPYTQQMEWAFSKLLGPRPMTGLRAENHLVERLAIIAAIEHITAFLGDWVLNAK
FT                   GLDKAGMHPTMLDLLRWHGAEEVEHRAVAYDVMRYFDKRETRRIRTQILVTPAIVWLWI
FT                   RGTRFLMRNDPELAAQAPSRRRPHLSDFIAAGKRGTVPTSFELVKRMSTYFSKSYHPSN
FT                   EGSTAQAVQYLASSPAAQAAAR"
FT   CDS_pept        8055..8978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00070"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30715"
FT                   /db_xref="GOA:C0ZLE7"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE7"
FT                   /protein_id="BAH30715.1"
FT                   /translation="MNMVVSTREVVATDENVVRLRFESADGSPIPPWHPGSHLDFHLPS
FT                   GLRRQYSLCGDPADRTGYSVAVRRIPDGGGGSIEMHALQPGEHVTVRGPRNGFPFVGEG
FT                   SALFVAGGIGITPIIAMVRAARELGMDWYFVYSGRSRESMPFLDEIASWEPERVFVRPD
FT                   DEFGLPTTADLLGRAPVGGAVYCCGPTPMLDAVRRGFRDTPSTALHFERFGAPPVIDGK
FT                   EFEVQLVNSGQVLTVPADESALDVIKKTLPGVGYSCQQGFCGTCRVKVLAGKPDHRERR
FT                   LTDTEQETEMLICVSRSDGGRLVLDL"
FT   CDS_pept        9034..9930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00080"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30716"
FT                   /db_xref="GOA:C0ZLE8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE8"
FT                   /protein_id="BAH30716.1"
FT                   /translation="MTARRVTNGSVSLAVFEQGKADGETIVLVHGWPDTHELWNRIVPL
FT                   LADDFRVVSYDSRGAGESTIPSRVQDYQLSALAGDLFAVIDAVSPGKPVHVLAHDWGSV
FT                   ETWEAVCEPGAEEKIASFSSISGPNLDHLGKWIRASVSKRRFLGPAAQGIASAYTVLFQ
FT                   IPGLCTLPLRLWFSKHWPAFLGFFDGLDPRVVNTAPTIADDMVNGLKLYRANIRPSLGK
FT                   PRDRYTDVPVQLILNKYDKAVRPVGYEDTEKWVSDLQRREIAAGHWSPFSHPGEVAEHA
FT                   RAFIASLRERRSEKQSS"
FT   CDS_pept        10128..12164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="RER_00090"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30717"
FT                   /db_xref="GOA:C0ZLE9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE9"
FT                   /protein_id="BAH30717.1"
FT                   /translation="MAAQKSDTSTSSKDYNASSITVLEGLEAVRKRPGMYIGSTGERGL
FT                   HHLIWEVVDNSVDEAMAGHATKVEVTLLEDGGIRVIDDGRGIPVGMHASGVPTVEVVLT
FT                   QLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRLDVDIKVDGYRWQQTYTDSKPGELVQ
FT                   GDPTKETGTTVSFWADPEIFETTRYNFETVARRLQEMAFLNKGLTITLTDERAEVIDDE
FT                   AAEVAEAPKSAAEEAEEAAQAAPRKSKTRIYHYPGGLEDYVRHINKSKTPIHNSVVGFT
FT                   AKGTGHELEVAMQWNSGYSESVHTFANTINTHEGGTHEEGFRAALTATVNKYALEKKLL
FT                   KDKDPKLTGDDIREGLAAIISVKVGEPQFEGQTKTKLGNTEVKSFVQKACNEHLAHWFE
FT                   ANPADAKTIVNKAVSSAQARVAARKARELVRRKSATDLGGLPGKLADCRSNDPEKSEIY
FT                   IVEGDSAGGSAKSGRDSMYQAILPLRGKIINVEKARIDRVLKNTEVQSIITAFGTGIHD
FT                   EFDIAKLRYHKIVLMADADVDGQHIATLLLTLLFRFMRPLVEHGKVYLAQPPLYKLKWQ
FT                   KGAQPEFAYSDRERDAMVKAGLESGKKINKDDGIQRYKGLGEMNAKELWETTMDPTVRV
FT                   LRLVTLDDAAAADELFSVLMGEDVEARRSFITRNARDVRFLDV"
FT   CDS_pept        12251..14782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="RER_00100"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30718"
FT                   /db_xref="GOA:C0ZLF0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF0"
FT                   /protein_id="BAH30718.1"
FT                   /translation="MTDTTLPPDGPQHDRIEPVDIQQEMQNSYIDYAMSVIVGRALPDV
FT                   RDGLKPVHRRVLYAMYDNGYRPDRGYVKSARPVAETMGNYHPHGDSSIYDTLVRMAQPW
FT                   SLRYPLVDGQGNFGSRGNDGAAAMRYTECRLTPLAMEMLREIDHETVDFTPNYDGKTQE
FT                   PTVLPSRIPNLLINGSNGIAVGMATNIPPHNLREVAEAIYWALENFEADEEATLAAVME
FT                   RIKGPDFPTHGLIVGGQGIQDAYTTGRGSVRMRGVVEIEEDAKGRTTIVITELPYQVNP
FT                   DNLITSIAEQVRDAKIGGISDIHDESSDRVGMRIVVTVKRDAVAKVVLNNLYKHTQLQT
FT                   SFGCNMLSIVDGVPRTLRLDQMIRLYTTHQLEVIVRRTRYLLRKAQERAHILRGLVKAL
FT                   DALDEVIALIRASQTVDIARAGLMELLDVDEIQADAILGMQLRRLAALERQKIVDELAE
FT                   IELEIADLEDILARPERQRAIVRDELKEIVDKYGDDRRTRIIAADGDVNDEDLIAREDV
FT                   VVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVSHFFVTSTHDWLLFFTTKGR
FT                   VYRAKAYELPEASRTARGQHVANLLAFQPDERIQSVIQIKTYEDAPYLVLATRNGLVKK
FT                   SKLTDFDSNRSGGIVAINLRGEDELVGAVLCSADDDLLLVSAQGQSIRFSATDEALRPM
FT                   GRATSGVQGMRFNGDDELLSLNVVREGTFLLVATSGGYSKRTGMEDYPVQGRGGKGVLT
FT                   IQYDKKRGTLVGALIVDDDDELYAITSGGGVIRTAAKQVRKAGRQTKGVRLMNLGEGDT
FT                   LLAIARNADEPEELAAETTDNADNADGAKES"
FT   CDS_pept        15055..16188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30719"
FT                   /db_xref="GOA:C0ZLF1"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF1"
FT                   /protein_id="BAH30719.1"
FT                   /translation="MAPAAPVTPAKGDGQAPPQPVANQARGSQAPPWQRGPQPQGQPSQ
FT                   APKAPAQNPSAQNPAVQNPGKAPAPQNQVPQSQPQTNITRPAGAGAPAGRPAAPAGGKP
FT                   PAGPQRPAAAGPAQGGPVQGGPAKTPAQGGAPKGQPQAGRPAAGAQTGRPAGNPSARPV
FT                   VTGTAAAAATGGIAGAAAAKAVAPSGANPKAANATAANPTVANPKAKAAAIDGPTRHID
FT                   RKDLPKDMPDLSEAKHPLPAAVKGEKTHAVSASVVDGAPLRATVQIRRIDPWSTLKITS
FT                   VISVSLFFVWMVAVGLLYVVLDGMGVWDRLNNAFTDIVADGGSDGLVTAGQVFGYAALI
FT                   GIANMVLFTALVTIGSFIYNLCSDLVGGVEVTLADRD"
FT   tRNA            16264..16337
FT                   /locus_tag="RER_t0010"
FT                   /product="tRNA-Ile"
FT   tRNA            16514..16586
FT                   /locus_tag="RER_t0020"
FT                   /product="tRNA-Ala"
FT   CDS_pept        16859..17968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30720"
FT                   /db_xref="InterPro:IPR041638"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF2"
FT                   /protein_id="BAH30720.1"
FT                   /translation="MLHNDIPSHGEIAALAEVEGPTCITIVTPTEDAPQDHDKARIAFK
FT                   DQVRSALASVEDPAERKLFEAEYAELDDDDDFWRFQSRSLVTYATPERLVTFRLPNRLQ
FT                   ALETVSDRFHLKPLLRSVTFPQTAFVLALAEGSVRLIEIAADQPADEVRVQGMPKNAAD
FT                   HAGKSSINSRTEAGRLSGSDSRKLRVNQYARAVDHEVRGVLAGRDVPLILAAAEPIASV
FT                   YRSVNSYRHLVDKTVEGNPEALSTQEVADGSRPALDDFHAEQLAAVRDTFNVRTEQGRT
FT                   QTDVADVATAATYGQVDTVFIDIDSVVPGSLDPQTGALTTGESTNGSTYGVVDEIARRA
FT                   LLTGARVLAVRAEDIPGGGAVAAILRFAP"
FT   CDS_pept        18031..19695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00130"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30721"
FT                   /db_xref="GOA:C0ZLF3"
FT                   /db_xref="InterPro:IPR012037"
FT                   /db_xref="InterPro:IPR027787"
FT                   /db_xref="InterPro:IPR027788"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF3"
FT                   /protein_id="BAH30721.1"
FT                   /translation="MKRVWERLRLYCKTLHPVGLAFALVFFTWSMSPSLLPRAWYLQGV
FT                   ATGISLAMGYGVGVTVAWMIRKCGVEPQWSDRTKKIGWRVLLAAAVILVPTFLVLGSWW
FT                   QQIVRDLVEAPRTNQANYLLVLLIALGIWFILLEAGRGLRFTTNKLTAVALRFVPLEAA
FT                   KVGSLIVIFALGIFIVNGALYNGLIAFANWSFSGADHETPDGIEQPLIAERSGSPMSAE
FT                   AWDSLGQEGRTFMGSGPTAAEITALTGREAKQPIRVYAGRESSDSINGVAQRVVDELER
FT                   TGGFDRGTLAVVTTTGRGWVNEDVASAFEYVEGGDTAIASMQYSFLPSPLAFIADRETP
FT                   MIAGRALFNAVYAKWIDLPVETRPELVVFGESLGSYGGQAAFAGAQDMMTRVDGALWVG
FT                   TPNFTAQWQEITDSRDSGSPEILPVIDGGQAIRFAGDPEDLELKSDWDDDRIVYWQHAS
FT                   DPITWWSFDLLLNKPDWLKEPLGRDVDPGMTWVPLVTFWQVTLDMVFSADVPSGHGHNY
FT                   GEDAADMWAKILHPEAWTSADTDKLRSLLTSNLEPTK"
FT   CDS_pept        19822..20439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00140"
FT                   /product="putative hydrolase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30722"
FT                   /db_xref="GOA:C0ZLF4"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF4"
FT                   /protein_id="BAH30722.1"
FT                   /translation="MKSRAWWAAGVSVAALVMGAVTAPAAMAEPADFYTPPSELPAGAN
FT                   GDLIKSEPSPLLLSVPGSNGAWPATATKIMYRSEDAKGAPVAVTGTYLEPSNPWTGQGA
FT                   RPLVAAAVGTHGQGDQCAPSKLFNTGIEYQFPTDVMVGYESIWVNTLLLNGIAVVVTDY
FT                   EGLGTPGDHTYVNREAEAHAVLDSVRAAQQLPNTGIPADGPV"
FT   CDS_pept        20488..21099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00150"
FT                   /product="putative hydrolase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30723"
FT                   /db_xref="GOA:C0ZLF5"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF5"
FT                   /protein_id="BAH30723.1"
FT                   /translation="MKPSYAPELDLKGTYAGAPPADLAATLQQVDGTFLTGVIGYALNG
FT                   ILAQYPEVQPLLDAEINDRGRQMLAATKNQCVAESGLQFGFQQSSSFTNSGESLSAVLA
FT                   RLPMAQAILDEQKIGKLTPESPVLIQHGRSDDIVPFGQGQQLARDWCGKGATVQFSVNE
FT                   LPPIIPGMAINHATPYLVGTPESVGYMIDRFNNVPAPSNC"
FT   CDS_pept        complement(21157..21690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30724"
FT                   /db_xref="GOA:C0ZLF6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF6"
FT                   /protein_id="BAH30724.1"
FT                   /translation="MPLPTFSRMPPRKTLPVPASLLWHSEVMTRVTESLSTQLPDTFDH
FT                   ARARVEDTFDETAAYLEETAARIKESEAADNARRIAAVVATSVARGAGQVGLFLGRQGK
FT                   VLAKKGVERAKAIPTKSAERTEKPRGRKRVAVFVIAGVAVIGGAVFFKSRRREHPPVAS
FT                   APPRLEENSAEKTA"
FT   CDS_pept        21700..22227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00170"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30725"
FT                   /db_xref="GOA:C0ZLF7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF7"
FT                   /protein_id="BAH30725.1"
FT                   /translation="MTSTHQTATATLHTNRGDIKIALFGNHAPKTVENFVGLADGSKEY
FT                   TTANAAGTKTGPFYDGAIFHRVIDGFMIQGGDPTGTGTGGPGYKFGDEFHPELQFDRSY
FT                   LLAMANAGPGTNGSQFFITTGPTPHLNRRHTIFGEVLDDDSKKVVDAISSTAVDRGDRP
FT                   VEPVVINSITIS"
FT   CDS_pept        22389..23189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00180"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30726"
FT                   /db_xref="GOA:C0ZLF8"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF8"
FT                   /protein_id="BAH30726.1"
FT                   /translation="MGYQCVDCVAAGQRDVRPVRGVAGNTVSPTRAVPIVTYTLMGLNV
FT                   LAFLATFAQSRSIMNNQVGSSIFANWALNPGLVASGDWFRLIGSGFLHFGILHLAVNMY
FT                   ALYILGRDTEIVMGRSRYIGIYLVSLLGGSASVMAFQPVFSSLTALSWTAGASGAIFGI
FT                   MGAQAVLLLRLRRSPVPIISVIAINVIISISLPGISFWGHAGGLVAGAATAAAFLYAPQ
FT                   WLGAGENRVKAVRIGWIAFGAVTVVTLGVIVLRVVQLREQLGIS"
FT   CDS_pept        complement(23221..23724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30727"
FT                   /db_xref="GOA:C0ZLF9"
FT                   /db_xref="InterPro:IPR008691"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF9"
FT                   /protein_id="BAH30727.1"
FT                   /translation="MTRRSSTAVAATIAAVALFASACGSDSDKTDSDKSAAGASSATSS
FT                   ATVGGKTLDAKFETKCAKDGGTTVMTLLDAENATYGMLTVSAIIDESGTVQTAGIAGSE
FT                   GGSNGLPYTAGFAPGLPGGSASAKQDGNTFVVTGEGIGARDKGNPTATSSFEITFACES
FT                   IIGG"
FT   CDS_pept        24053..25396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00200"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30728"
FT                   /db_xref="GOA:C0ZLG0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG0"
FT                   /protein_id="BAH30728.1"
FT                   /translation="MTSTDSTTTDGGVAPSEIESRVVKKVARRLIPFLILLYFVNYLDR
FT                   TNIAFAKLTMSADLGMTETMFGLASGLFFVGYLLFEVPSNLALHRFGARLWIARIMLTW
FT                   GILAAALAFVPNVGSLYFLRILLGIAEAGFFPGVLLYLTFWFPKKYRVRLMGLFLLTLP
FT                   LSSALGAPLSAAIIQYGDGLFGLAGWRVMYLIEGLPAVILAFVVWFYLTDRPADAKWLT
FT                   LEERTWLMKSMADEEKELGDAGHQSAGKTLRDPRVIGFGLVYFGITYGLYALSFFLPSI
FT                   VAGFKQTFNTDFSLVETGLIVAVPYAIGAVAMVLWSRHSDKTGERMWHVAAPTLLGAVS
FT                   IPIALYLDSPFTVMIAVSLTAVGVLCALPVFWYLPTTFLTGASAAAGIAMINSIGNASG
FT                   FGAPYITGWLTDVTGNAKAGLWVVGAVMLCAAILVVALAKRSSKPAQI"
FT   CDS_pept        complement(25387..27252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00210"
FT                   /product="putative CdaR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30729"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG1"
FT                   /protein_id="BAH30729.1"
FT                   /translation="MHENWLQLLLAEASTEELIEHRDQLAAGSAPEAAAEIEREARSAL
FT                   QLRSLLAQRRQRATELGALNDIASLLTTMHDHHALLQEIVDQAKRLLGVDLSYLALIHD
FT                   DILIIEVTSGAYTSQLLGLTVPFREGLIGRVVENSSPAWSPDYRNDPSFAHIGPADDAA
FT                   RAENMRGLLAVPLTLNGKILGALCACKRQERRFGNEEVALLSALAAHASVAIENARSLE
FT                   RYRATVAEVNAANTELAERTALLEQTLTWDRSLTQVVLRGGGVRELVEETSASTGSPVF
FT                   FVTGTSEIPPGLQRVSESVNRVFDIFAADRREQEVTLIVGEQFLFATEVRSAGDQLGVL
FT                   FLLSRHEPTAAMRLALERSAPAIALALVGERAAREATRRARDAFLVDLITRPAPTPAEV
FT                   TGQFRLAGLNPDRSYTVVVARPADAVDRTRRSIEEIAFPSGTVVAEHGSRVIALIPGMS
FT                   PVEVAAAWVQPAENPTVGIADPAVGAEGLARAYVEAQHTVDVLETLGRASHVEPASSLG
FT                   IYRILLSRTGREELEALTLRSLGPLLEEEQRRGVPLLDTLASYLSHNCKHSATAAALAI
FT                   HANTLYQRLESIDRLIGTQWRQPDQALDLALLIRLRASAGKLGQI"
FT   CDS_pept        27343..28746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00220"
FT                   /product="putative FAD-linked oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30730"
FT                   /db_xref="GOA:C0ZLG2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG2"
FT                   /protein_id="BAH30730.1"
FT                   /translation="MGWCSRRHYRGGMTLLEALGSQIDADRLITDPDIMASYIHDDAEW
FT                   APYEMPVAVVRPRTAEQVQTVVQACIAHGAPVVTRGAGTGLSGGANAVAGGVVIAFDAM
FT                   NAIKEINTLERLAVVEPGVVNDHLRDACAEHGLWYPPDPASAPWSTIGGNVATNAGGLC
FT                   CVKYGVTKDYVLGMQVVTGTGELVRLGRRTAKGVAGFDLSALMVGSEGTLGVITEVTVK
FT                   LRPQRDPERTIVGYFDSIVAAGKAVEAVAADGLTPSALELIDRQCLLAVDAWKNMGLSA
FT                   DAEVVLLGRIDTPGEIGDAEAERMLACFNRSGATWSARSTDQEEADALFSARRLAYPAL
FT                   ERLGPVLTEDICVPKAAVPEMLARIEAISARHDTHIANIAHAGDGNLHPLLITPHDDEA
FT                   ARRRAQAAFSEIIDNALELGGTVTGEHGVGLLKMGGLAQELSPAVVAMHHAIKGALDPH
FT                   GIMNPGKVI"
FT   CDS_pept        28870..29718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30731"
FT                   /db_xref="GOA:C0ZLG3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG3"
FT                   /protein_id="BAH30731.1"
FT                   /translation="MFSSDLTLASVVPRRVDTVEAVRAAIALDGAAVFGGLHTEEDAIA
FT                   FASKLLGEKCIRVGRQFEASARSQDAEAAVVDTQPVDERGRKRSFGISGERMTAHNDGF
FT                   AFGDYAPDYLFLWCKRPAYPSGGDSFLIDAVKLTRLLAFDPATAELAEFCWSTDIDHSE
FT                   PNFPQSTFAPIARRVPSGRNQVRYHPYLAPIAGESEEAQWPLVKQWSEAVIHVRDSGPM
FT                   FRAEAGEMICIDNYRVLHGRDGYTDPGRELYSIWGWSSDAVAVPQQALDIVQPDLAALA
FT                   M"
FT   CDS_pept        complement(29726..30217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30732"
FT                   /db_xref="GOA:C0ZLG4"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG4"
FT                   /protein_id="BAH30732.1"
FT                   /translation="MLEDEFHPQPRDNATEVVSWATPMGVVYAMFGGGIALAIASIIAP
FT                   TEPAGRFLLALAVIGLFVMGGLALRQRPRLAVIDNAGTKSIAVQRLRARHTFTREQIDR
FT                   VRLVRYPRLGRRVPMLEIDIVDRPTDTEKLLIFGRWDLGTTPEDVLDVLTVHGLVPPEK
FT                   "
FT   CDS_pept        complement(30325..30588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30733"
FT                   /db_xref="GOA:C0ZLG5"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG5"
FT                   /protein_id="BAH30733.1"
FT                   /translation="MPKSKVRKKNDYTVNPANRTPVKVKMGPSSTLYVSVMLGFMLLGL
FT                   AWLIVYYLAADSITWMNDLGNYNFLVGFGFMVVGLVMTMRWR"
FT   CDS_pept        30691..31404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30734"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG6"
FT                   /protein_id="BAH30734.1"
FT                   /translation="MSSGESSRTVWHIGVLAVCLVAGLMVATAQRSAEENQLQVTESTR
FT                   LSDLVRSAQANAEKVSADRDELAAQLDSLQEDAARSDAGVAAALGDIKNISADAGLTEM
FT                   TGPGVVVTMTDAPRNAEGKYPVDATPDDLVVHQQDVQSVLNALWAGGAEAVGMQDQRII
FT                   STSAPRCIGNTLLLHGRTYSPPYVMSAIGDVARLEAALAAEPGIRIYKQYATRFGLGYT
FT                   QATPSQITVPAYTGG"
FT   CDS_pept        31427..32092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="RER_00270"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="protein synonym:glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30735"
FT                   /db_xref="GOA:C0ZLG7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG7"
FT                   /protein_id="BAH30735.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLGTEAVVWRNDDPQLTADLEGAV
FT                   AQFDGILLSPGPGTPQRAGATMDLVKVCADTKTPLLGVCLGHQAIGAAFGGTVDRAPEL
FT                   LHGKTSLVHHKDVGVLAGLPDPFTATRYHSLTVLEDTIPEELEVTAHTESGVVMAMRHR
FT                   ELPIHGVQFHPESVLTQGGHRMLANWLAVCGEAPPEGLVAALEAEVASALGGALPAIL"
FT   CDS_pept        complement(32151..34076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="RER_00280"
FT                   /product="probable serine/threonine protein kinase PknB"
FT                   /EC_number="2.7.11.1"
FT                   /note="protein synonym:protein kinase B"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30736"
FT                   /db_xref="GOA:C0ZLG8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG8"
FT                   /protein_id="BAH30736.1"
FT                   /translation="MTTPRNLSSRYELGEILGFGGMSEVHLARDLRLSRDVAIKVLRAD
FT                   LARDPTFYLRFRREAQNAAALNHPAIVAVYDTGEAETDAGPLPYIVMEYVDGDTLRDIV
FT                   RSTGPMTPRKAMEVIADVCAALDFSHRNGIVHRDVKPANIMINRAGAVKVMDFGIARAI
FT                   SDASSPMTQTAAVIGTAQYLSPEQARGEQVDARSDVYSLGCVLFEILTGEPPFKGDSPV
FT                   AVAYQHVREDPQTPSEINPDIPRELDSIILKAMSKNPANRYQSAGDMRSDLVRVLGGQR
FT                   PSAPMVMNDEDRTTILGAVGSDTGNYRTAPDPVEPVPARTTRAAEPPAKKKGGRYALMG
FT                   IAALLVIGLVTFFLIRVNSPKVEMVTVPGDLTNQPADVAEATLTNAGFQVERQQKTDKV
FT                   IAAGNVITTRPVAGVRIEKGSTVTIDVSTGPEQVAIPRLTGLSQDDAEKKLNSVGLRLD
FT                   PTIGKAASTIAEVDKIVNQDPAVGVSVVLDSAVSITVGTGPEQVRVPDVTGQREEVARP
FT                   NIEGAGFVVQITEIDSGLPKGQVVSTDPTGGTSATKGSTVTLRVSNGNQVAMPDLTNKT
FT                   VSEALTTLRAAGWAGTASQLVQNQSTTLTPEMVGKIVSQTQPPGSEISKDAVITVSVGA
FT                   LGIPGR"
FT   CDS_pept        complement(34073..35431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="RER_00290"
FT                   /product="probable serine/threonine protein kinase PknA"
FT                   /EC_number="2.7.11.1"
FT                   /note="protein synonym:protein kinase A"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30737"
FT                   /db_xref="GOA:C0ZLG9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG9"
FT                   /protein_id="BAH30737.1"
FT                   /translation="MALNNGALIADRYRLIRLIATGGMGQVWEATDSRLNRRVAVKVLK
FT                   SEFSSDPEFLERFRFEARTTAQLNHPGIAGIYDYGETRDSSGDSTAYLVMELVNGEPLN
FT                   AVLARVGRLAVPHALDMLEQTGRALQVAHDAGVVHRDVKPGNILITPTGQVKITDFGIA
FT                   KAVENSPVTRTGMVMGTAQYIAPEQALGQDATAASDVYSLGIVGYEALSGRRPFTGDGA
FT                   LTVAMKHVQETPAPMPADLPANIRELIDITLTKDPAGRYASGGEFADAVAAVRAGRRPP
FT                   PPGLLATGAASALPATGATQVMPPTYAGPVTGAAVADDAAAGGMTSGQKAVAWAGGGLI
FT                   LLALIIGGVWIATDGPSDPTPPVVTSTTLPTTTTTKPTTTTTRPTTTTTEPTTTTTRPT
FT                   TTTTEPTTTTTTPTTTTTTPTTTTTTTTTTTTTTTTEPLADPGDAEEPLGQDQ"
FT   CDS_pept        complement(35435..36901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="RER_00300"
FT                   /product="penicillin-binding protein PbpA"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30738"
FT                   /db_xref="GOA:C0ZLH0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH0"
FT                   /protein_id="BAH30738.1"
FT                   /translation="MNTPLRRVAMAVMVMVVALLANATYVQVIKADDLRADPRNSRVLL
FT                   DEYSRQRGQISASGQVLAASRATDDRYKYLREYPNPYPYAPVTGFYSMQYGSAGLERTE
FT                   DPILNGSDNRLFSQRFFDLVSGRDPRGGNVVTTLNPAMQQVAYDQLTSKGYTGSVVAIE
FT                   PSTGRILTMVSTPSYDPNLLASHDGAETTKAWDELNADPNDPLVNRAISQTYPPGSTFK
FT                   VLTTAAALGNGATPDDQLTAAPQITLPGTSTTLENYNGSTCGPNPTASLRDAFARSCNT
FT                   AFVELGIKDGADAIKDEASAFGIGPNTPAIPLPVADSTVGDISDDAALGQTSIGQRDVA
FT                   VTPLENAVIAATVANGGVRMQPNLISQLQAPDLTDLSTPSPVSMGQAISPAVAATLTDL
FT                   MIGSENFTGGDGKIPGVQIASKTGTAEHGVNPRETPPHAWYIAFAPAQNPTVAVAVIVE
FT                   NGGDRGLAATGGSVAAPIGRAVIAAGIQGG"
FT   CDS_pept        complement(36898..38349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="RER_00310"
FT                   /product="probable cell division protein RodA"
FT                   /note="protein synonym:rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30739"
FT                   /db_xref="GOA:C0ZLH1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH1"
FT                   /protein_id="BAH30739.1"
FT                   /translation="MSSNAAAGTAFPSPPGGFAPAPVQSTRRNMELLLLGFAVIITTVS
FT                   LLLVEASQEQKITLDLAKYALAYTGLFLIAHLAIRRYAPYADPLLLPIVALLNGLGLVL
FT                   IHRLDLADEQTALYNGVEAPSPDANQQVMWTALAITGFVLLLVFLKDYRLMARFSYTLG
FT                   LAGLVFLAIPAILPAKFSSVNGAKIWIRLPGFSIQPGEFAKILLIIFFASVLVAKRDLF
FT                   TSAGKHFLGMDFPRARDLGPILLAWIVSVGVLVFETDLGTSLLLFSTVLVMLYIATERV
FT                   GWLVIGGGLLAIGFFFAYKMFGHVRVRVDTWLDPLGDYANTGYQISQSLFGLATGGIAG
FT                   TGLGSGRPNQVPFAKTDFIIATIGEELGLIGLAAVLMLFLLLIVRGLRTALAVRDSFGK
FT                   LLAAGLSFTIAIQIFVVVGGVTKLIPLTGLTTPFMSYGGSSLLANYLLLAILVRISDAA
FT                   RAPVVTKKKGPPPIADANTEMMPRV"
FT   CDS_pept        complement(38349..39773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstP"
FT                   /gene_synonym="ppp"
FT                   /locus_tag="RER_00320"
FT                   /product="probable serine/threonine protein phosphatase
FT                   PstP"
FT                   /EC_number="3.1.3.16"
FT                   /note="protein synonym:phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30740"
FT                   /db_xref="GOA:C0ZLH2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH2"
FT                   /protein_id="BAH30740.1"
FT                   /translation="MTLVLRYAARSDRGLVRSNNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLMIAALAHLDDDEPGEDLLGKLEAATREGNDSIADHVEEEPELDGMGTTLTAILFS
FT                   GSKLGLVHIGDSRAYLLRDDHLTQITRDDTFVQSLVDEGRITAEQAHTHPQRSLIMRAL
FT                   TGNEIEPTLTVREARAGDRYLLCSDGLSDVVSDETIENTMREGSQEQCADRLIELALRS
FT                   GGPDNVTVVVADVIDLDYGQSHPIVAGAASTEEEEDSPPPNTAAGRAAAMRPPRATPKR
FT                   VVSQPEPEPKKKRNRLWWVVLAVVLIALVGVGAVIGRAVIRNNYYVGEDNGRVTVLRGI
FT                   PGSVLGYSLQDADLVGCVGDDDVLTLVSPDAIPSNCNILEVTDLQPSAQEQVRAGLPSG
FT                   KREDAQSQMIRLIGGDLLPRCEPVPTTTATPTPPPAPETTPPPAPPAEPATPTTAAPTT
FT                   TPTPTEVPGQTCRTVN"
FT   CDS_pept        complement(39770..40234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30741"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH3"
FT                   /protein_id="BAH30741.1"
FT                   /translation="MQGLILQLTRAGFLLLLWLFVWAVLRTLRSDIYAGSGVRVPPRYT
FT                   RAGKVLPSLGKAKVPRYLVVTQGALAGTRITLGSQPVMIGRADDSTLVLTDDYASTRHA
FT                   RLSQRGADWYVEDLGSTNGTYLDRAKVTTAVRVPLGTPVRVGKTVIELRP"
FT   CDS_pept        complement(40421..41839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30742"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH4"
FT                   /protein_id="BAH30742.1"
FT                   /translation="MGIVQRFERKLQGAVGDAFARVFGGGVVPQEVEAALQQEARDRVE
FT                   HLGGGILLAPNNYVITINNSDHEELAADRELTTKAFSRHLQDFIRDQGWQTYGDISVTF
FT                   EPSPTLHTGQFRTRGTVDPDGDAEQASPPSHVPQVSSRPPQRPPQRPAPIVPPVSNPVP
FT                   SQPGAGPMTQNSGYEPSREPAGRQPEPQQPARNGYSHDDGGYAAPQGQEAPYQNGYDRG
FT                   DGYRTGDDQQGYNQQQGGYDQQAYPNQQQPYEQAGYDQQGYDQQGGGYDQQGYQQQPYD
FT                   QQGYGQQAYQGGYDQQGYQQGGYDQQGYQQPYNGQSYDQPGYDQQSYQQGGYDQQAYTQ
FT                   QPYEQAGYEQGGNFEQTQAYPQQGYAQPQGGYAPTAQSLTATLQLEDGSGRHFQLRDGS
FT                   NVIGRGQEAQFRLPDTGVSRRHIDIRWDGRTAMLSDLGSTNGTTVNGAPVQDWQLADGD
FT                   IIRAGHSEILVRIL"
FT   tRNA            42094..42179
FT                   /locus_tag="RER_t0030"
FT                   /product="tRNA-Leu"
FT   CDS_pept        complement(42233..42643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30743"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH5"
FT                   /protein_id="BAH30743.1"
FT                   /translation="MVAISWLLGIPRTDAVTTKGSTSVNGLETPTRLSRTTAALGVGAL
FT                   AAAITFGSAVGTASADTPVADFGSLSFSVTNGPDNTIYDINAIINLPPGTLPPGMMNPQ
FT                   ITAPAAATQPVNDSFAGTALDFVLSFIQAAAR"
FT   CDS_pept        complement(42666..42971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30744"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH6"
FT                   /protein_id="BAH30744.1"
FT                   /translation="MSVSDFLPESGLRPTSGGRRPISAGSRVTMIPSSGSPPGDTKPQV
FT                   GVVVGDFTDAVIERSELGREGSGAAVGENPRKSSTDLRIDSDPLSKQPVPNHPAMG"
FT   CDS_pept        complement(43327..44199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30745"
FT                   /db_xref="GOA:C0ZLH7"
FT                   /db_xref="InterPro:IPR032290"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH7"
FT                   /protein_id="BAH30745.1"
FT                   /translation="MIIFRQHQPRWSGAIRSQPTVRLDSPPLGTGFPQHPYRRTGRDMT
FT                   GKETQYEVTEIKAIRGTEAKTITNKQQEGWELIAQQQGHLRTTITFRRPKPKIPWRLWA
FT                   ALGAAVVIVLAGIITIGALQEDDSDASTTEAVAASSTEQSSPQPAPEPAAEPANRETAE
FT                   ILTIDNNEDLSRILRDTDNCGQSVADFATQYAGRTIQFDGHIAAMNNFNNKTRYDILIG
FT                   ARDFDEGDAGGPAFQFRDVNIVSDLQLTGPENSDTLGVKDTLRVTAVVEEFEKKTCLLQ
FT                   LEPISTEIR"
FT   repeat_region   44364..44368
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(44369..46947)
FT                   /mobile_element_type="insertion sequence:IS1415"
FT   repeat_region   44369..44380
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(44482..45273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="istB"
FT                   /locus_tag="RER_00380"
FT                   /product="transposition helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30746"
FT                   /db_xref="GOA:Q3L9G1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L9G1"
FT                   /protein_id="BAH30746.1"
FT                   /translation="MSTPLRTVTSANGDPLAEAIDLTKRLKLPHIRRSLSDIIPTAKAQ
FT                   RWDPAEVVRVLLAEEAAGRDRANLHTRRKRAGFPTGKTFGDWDETKSSIPRATQDALRT
FT                   LEWVGRRECFCVCGPSGTGKSHFTEALGQAAVEAGLAVSWFTIEDLGALVRRHRADDSI
FT                   ARALTRIIRSDLIIVDDIGLLPVSEDAAEGLYRLVDAAYERRAIAVSSNLHPSGFDEIM
FT                   PKTLATATVDRLLHHAHVVVTDGDSFRLTEATTGKGVKPFS"
FT   CDS_pept        complement(45273..46814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="istA"
FT                   /locus_tag="RER_00390"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30747"
FT                   /db_xref="GOA:Q3L9G2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L9G2"
FT                   /protein_id="BAH30747.1"
FT                   /translation="MKSSREIMEILEAYDLTGSYRAAAELAGCDHHTVARYVQMRAAGQ
FT                   PPDRRRHRARAIDDFLPKIEELVVRSQGKVRADVIHERIVALGFTGGERTTRRTVAEAK
FT                   AQFRAGRRRVYRPWVTEPGLWLQYDFGDGPTISGRKTTLFCAWLAWSRFRVVIPIWDKT
FT                   LPTVAACLDATFRRLGGVPVYVLTDNEKTATIDHVAGIAVRNPEIVEVARHYGTTLRTC
FT                   LPADPESKGGSEATVRIAKADLLPKEVNLREQYHSFGELESACRQFCTDVNTRVHSSTR
FT                   RRPVERLAEELQRLHPLPKSPFTAVFGTTRRVNWESTISVEGVRYSVPHTLIDTRVWAR
FT                   FHGEELIVTAVDNDGGAVEVARHRRGQPGSPVLDNDHYPPRPDRDAADRVPKPRTAAEL
FT                   AFLQLGQGANSWLVEAAAAGARRIRAKMAEAVDLSKLHSPDAVDRALGTAAMTGRFADR
FT                   DLISILDYQVTHEHADPVRRSEDHTLQPGTAAWSTFGQTPAPASPATTDDESDDA"
FT   repeat_region   46936..46947
FT                   /rpt_type=INVERTED
FT   repeat_region   46948..46952
FT                   /rpt_type=FLANKING
FT   CDS_pept        47215..48456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30748"
FT                   /db_xref="GOA:C0ZLI0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI0"
FT                   /protein_id="BAH30748.1"
FT                   /translation="MRDTSEFWPWFVLSKPIPYPYGMKSVEDLRIQRLLAEYDSHEIDL
FT                   AYLALYQGAEERHCAFASIHQRLDVELQWMNTKARNGQSGHFNADNSRSLLNLIDEVAE
FT                   LTRVFAKSGVSVTISSEYDRVLTESKAWLVDSGGSPIPEGFTPIVVEKYEQIFSLDDVS
FT                   VKIKTEMNSELKLVGQGAFANVHSFVDPNYGIRVARKKLRKGADEREIQRFRQEFDLLK
FT                   ELSFPYILQAYKFSEDDNSYTMEFCDQTLGDYIGMNNNTIKFHARKRIALQFLYGLNYL
FT                   HSKGHVHRDLSYNNVLVRVYDAGAVIIKLSDFGLVKKHESEFTMTETQLKGTIRDPAVE
FT                   NFQEFGKVNDIYAVGYVLSFIFKGQKRVISEPRAIGEIVQKCAHSDPSHRYQDVLSIIQ
FT                   DIENIEFEPEGETA"
FT   CDS_pept        complement(48881..50047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30749"
FT                   /db_xref="GOA:C0ZLI1"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI1"
FT                   /protein_id="BAH30749.1"
FT                   /translation="MDEQQVKPSQPLNLKWRLIIALHMLHFFSILEHDALRAKLGKSKD
FT                   DSNQLSAFSNADFIKYFEDEFNFEGLFHRSSQLRAISASLERAGFLDRVPGGSPMFPAY
FT                   WETPHLTTAAQISGLLWLSPVLGSEFIIRSFGASTIAITGTNKSTGEMSTGTGILLDSQ
FT                   HVLTNKHVVEDMKLAVELMSSSIADPLCTSEIAEQRILRVVKQSAHEKIDVGIIEIEPV
FT                   EGEEPIDPVKGIAFRDPFWEDDTWTFGYPRVPLARDPAPLVVHKGAVVSPRVLDFFGNE
FT                   FFLFSSTSRPGNSGGPIVAEDGRVVGIVTRSLEVDDGPGSAAISDSNGTRVDETTKESA
FT                   STSWNGGISAAPFYAGIPTNSIEKALADMGYPNLLNVERWDLPTHNHD"
FT   CDS_pept        complement(50870..51946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30750"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI2"
FT                   /protein_id="BAH30750.1"
FT                   /translation="MEAGRRKISAVTNLPLRPIHSSAGHRPYKQAPSRNPFRAMKGTVV
FT                   KKLDYDLVGEQLFSNPKVRARIERHYRLPTDAATASQFLDYAVRHLDQEAMDNPLTQTY
FT                   SNQQVFKAAVNALGSNSRSWASFVKVRDQHLEGLLHGFDPEKTHTAILDGTVTLTDIRE
FT                   HLSGQSGIGDARAIVRWAALLTAQPNYYQQILVIARAFVDLAADADHPLDNEHLMMCLA
FT                   GYLIAPPRRWPGDKHIDTDILLMTPRERDLPGMGYPLASEFLRNLHWNGFKPDRHITRL
FT                   LRLWVPELRDTVDPDVDRLCRLIGSRNQSLRYFLKYSLIGVAITPDGNYSRADNLIWML
FT                   GAYLEKKNKESDVQYIHD"
FT   CDS_pept        complement(51973..52683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30751"
FT                   /db_xref="InterPro:IPR026954"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI3"
FT                   /protein_id="BAH30751.1"
FT                   /translation="MCRVWILSIPTGNPVRLGWDAQKSPIRTSPHWRVTPPNGVATPPS
FT                   AQNLLLSAAQLPGAGWTPQSDSDPEATELQETTQPECSNQSWILRSADMTDMAGASWTF
FT                   DAAAEVETISSQAFVYPDAAAAAAAMASYRDLVGRCTSWQSVLTAKGYTYAESQEMFDA
FT                   SVGEESVARQAGTTHVRLTDLPTFRMYWVTSRVGQTIVQVTYRPGSLLGTNQGRDQALE
FT                   LASTAVSTAENRTK"
FT   CDS_pept        complement(53810..54061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30752"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI4"
FT                   /protein_id="BAH30752.1"
FT                   /translation="MMYEDLGNLRMLARYLVGPAEISKLLGVEANTVNVWKVRHADFPK
FT                   PVRRLRSGDVWDVREIEAWAKSTGRQILAGHIPDVKSE"
FT   CDS_pept        54199..55074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00450"
FT                   /product="probable DNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30753"
FT                   /db_xref="GOA:C0ZLI5"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI5"
FT                   /protein_id="BAH30753.1"
FT                   /translation="MTTLSDDAESEPFAAGERPNGTKWQVLQGDCRVALQDLAPESVDC
FT                   VVTSPPYYWQRDYEVAGQFGLEPSIDGFVDNLREAFAALRPALKNTGTVFLNLGDTYYS
FT                   AKGRPHGTDAKHRSRRLPGLRAVDGPGLGLPRKSLIGIPWRVALALQEDGWTLRSTIIW
FT                   VRKSAIPEPTSKDRPWRKYEHIFLFSKSPKYYFDREGLNGEEDVWFIEPDRKSLARGTH
FT                   YAPYPRKLVERCINSGCPEGGVVLDPFLGGGTTMYVADAMGRSSIGVELNPEFCSLVAD
FT                   NMTAMEVEEA"
FT   CDS_pept        55371..56867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30754"
FT                   /db_xref="GOA:C0ZLI6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI6"
FT                   /protein_id="BAH30754.1"
FT                   /translation="MLQRLRGDWSGRGQVLLKTKSTQTGSRRDIWRLTPDAGSLLEEKK
FT                   KADDKGAVRIVDLALWFGRNLDIDSVTPNAVGGLDGSVHDIDRLIFWFKQKFGLPAGDL
FT                   VGTLYSDDVPAEYRETQFEAEPVGEDTLELLGSLPPAPTVGMNLGELVVLLEQSLEKGG
FT                   YQLPPGLVRRVLTAWLRGDIVILVGQPGTGKTLFATLLAGEMASLLQLDSPITVAVRAD
FT                   FDETEFIGYERLDGTPELRQFAQDVLMTENPLEAKIVVLEEFNLAAIETYLASVLVATQ
FT                   EQTRQIQLPGGTTGKLPVDTFVLATCNSFRDEPETRMRISSPTKRRSTIITMPNVLGDR
FT                   FDEDPGNAVLSLVSGLVGVESNRVAKRQADSRPSQFDSLRGAALTTVKTLDDLSDGVKK
FT                   HLVDVSGAILGTSTGRSWFTMGLLRDVVLAITHADRSESAELLALGEAVADKLIHQVRG
FT                   THSDIEELREVCANLPNAGEIATMIDRMMDGPSDELLPLL"
FT   CDS_pept        complement(56864..58381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30755"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI7"
FT                   /protein_id="BAH30755.1"
FT                   /translation="MTFECSAFGAPSFPKSGSQIPPNLVLGDADHMKKLNVRLISGVRE
FT                   WELGDLPRIVPAGQIVLAVRGNGSSTILLDGHRTRLTSGLVGIDLTRSTGYHRLDIEGR
FT                   TFWFGTQDAKLQLDGIEAMLNELGNQGTGWGGQVLFSDGAGLRNPHVVYGWLDEWAEST
FT                   LTAVESVLASPRPRTTRSEVLSRRGGSGVLRAPTLRLLRSAPKQYLSPDPNGALQMSDG
FT                   SRYTPLRVVVRKRSTSLDTIANRRAVALLTWLIRLNEEVLENKPSNTARVRCRLWLNRA
FT                   QTLARRPLAQALRSVGPGIEQSRQAEETTDAPYRMCYAATTDLRRLFAWSATSKPLGRY
FT                   SYVDRSDEIYQAYAASRLAKELGMQQTHPVLGSERLAFTGERFDMYYDTTSPPSVLRSW
FT                   RAQSLRPDDSRPDLLIHEKATGRVAVLDAKYRVARDGGASEDSRKEVTAYLGLYGISSI
FT                   SILFPGDGDAVTVSGHGRSIHEIPLRPGSDLSAAVPLILGSFSLPPF"
FT   CDS_pept        complement(58426..59433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30756"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI8"
FT                   /protein_id="BAH30756.1"
FT                   /translation="MKERLVTYWAVAQPGSVSGEVLVRDGYIVGDDAAIAQIAEAGVQL
FT                   VAAADGSRPMIWVSLGSANVRVPGFADQTLDRAGLEAEIRRRVTEEENAQRRSAVEAMS
FT                   EGSSHARSAMHSTPTSSVRDQWSRITEWLRVHFPATTITGADRRSVDAAMAKTGQSWPA
FT                   ELIELYTLVDRVSDERLLGLLHRFALLTLDDALWHWESSIQIWDESARLYGGGPVDVPA
FT                   EAGFQADTFIPAFVPFAGMDGNFLCIETRHGLMHGCVTEFDKSGADEPGPRWISISALL
FT                   SDLADSLTASHAFDDGWYCTTDNGALEWEPDRTWRLRQLHTCQLRASTENKIDR"
FT   CDS_pept        59746..60306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30757"
FT                   /db_xref="InterPro:IPR025447"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI9"
FT                   /protein_id="BAH30757.1"
FT                   /translation="MVPRNFFATRTLPPKFSRPRGGTPTPHADAIPLCQKAKKLAGHEA
FT                   RSLSQQGERHAEHPFEDRHRRLGRNPGIARIRPVNSVVMIALTGSPATLAFVARTDVVG
FT                   ADAAADYGTALEQAAATSVIWVVVGTGPVAAAELDQIEAAQRELDSMGIRSIRTLVAES
FT                   LEIGAEWFDTNGEVPDQQCMFCV"
FT   CDS_pept        complement(60440..61879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30758"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ0"
FT                   /protein_id="BAH30758.1"
FT                   /translation="MTTAVVVGSGPNGLAAAIELARAGIDVHVIEGADKIGGGTRSSEY
FT                   IVDGLVHDDCSAFHPTALASPYFKELDREFGLAEHGLTWRWPEIDLVHPLDDGTAGVLW
FT                   RDINRTAEGLGVDGKRWLDVFGYLAENFDELVQDVFQPIVHVPKHPLMLARFGTGALLP
FT                   ATGFARMFKTPQARALFGGVAAHMFGTLTLPLSSAVGSMLTAGAHAHGWPVAQGGSGSI
FT                   AAALASILRSLGGTIETGNWVTNYSQIADYDIVMLDIAPDAAGRLLDGRQPDRIARAYR
FT                   KFRYGTAAYKVDYAVRGDSDGSVVPWTNPHARKAGTLHLSGTISETAAVERQTVRGQMP
FT                   DKPFILLGQQFLADPSRSVGDIHPVWAYAHVPHGYPGDATDVVTRQIERFAPGFRERIV
FT                   GVHVRNVPQMQEYNPNYVGGDISAGANTARQIIARPRFGLDPYATGAPGVYLCSSATPP
FT                   GGGVHGMGGFNAARAALKARG"
FT   CDS_pept        62436..67034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="RER_00510"
FT                   /product="glutamate synthase large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30759"
FT                   /db_xref="GOA:C0ZLJ1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ1"
FT                   /protein_id="BAH30759.1"
FT                   /translation="MKQLPGPQGLYHPSNEHDSCGVAFVVDMHGRRSRDIVEKAITALV
FT                   NLEHRGAAGSEPNTGDGAGILLQVPDKFFRAVVDFALPAEGAYATGIAFLPQGDADAHE
FT                   AAAAVEKIVVEEGLKVLGWREVGTDDSSLGALARDAMPTFRQIFIGSEGDKYTGMDLER
FT                   RAYVVRKRTEHELGSEGAGKGGPGSETVYFPSLSGQTFVYKGMLTTPQLKGFYLDLQDD
FT                   RVESALGLVHSRFSTNTFPSWPLAHPFRRVAHNGEINTVTGNENWMRARESLIDSDVFG
FT                   GRENLDKIFPICTQGASDTARFDEVLEMLHLAGRSLPHAVLMMIPEAWEKHESMDPARR
FT                   AFYEYHSALMEPWDGPASVCFTDGTVIGAVLDRNGLRPSRLWITEDGLVVMASEVGVLP
FT                   IDPSTVVRKVRLQPGRMFLVDTAQGRVISDDELKSELAAEHPYQQWIDEGLIHMDDLPD
FT                   RPYTYMSHERVVLRQQLFGFTSEEVNLLVKPMALSGAEALGSMGTDTPIAVLSSRPRML
FT                   FDYFSQLFAQVTNPPLDAIREEVVTSLGATIGPEGDLLHPNADSCKQIALPQPILHNDD
FT                   LSKLVHVNDDGEFPGFRSVVIRGLYPVKEGGDGIRRALEGIKYQVSQAIEGGARIVVLS
FT                   DRESTEDYAPIPSLLLTSAVHHHLVREKSRTKVGLIVEAGDAREVHHMALLIGFGAAAV
FT                   NPYMAFETIDEFLQNKELEGLTLEKGIANYIKAAGKGVLKVMSKMGISTLASYTGAQLF
FT                   QVIGLSQELTDEYFTGLQSQLGGIGLDQIAADVEARHRIAYLDRPEERAHRELEVGGEY
FT                   QWRREGEYHLFNPDTVFKLQHATRTGQYEVFKEYTTMVNDQSERLAALRGLFDFNIGKR
FT                   PSISIDEVEPASEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGARSNSGEGGEHPSRF
FT                   TPDENGDLRRSAIKQVASGRFGVTSHYLSNCTDIQIKMAQGAKPGEGGQLPAHKVYPWV
FT                   AEVRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPQARIHVKLVSEVGVGTVAAG
FT                   VSKAHADVVLISGHDGGTGATPLTSVKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDG
FT                   QLKTGRDVVVAALLGGEEFGFATAPLVVSGCIMMRVCHLDTCPVGVATQNPLLRQRFSG
FT                   KPEFVENFFMFIAEEVRELLAELGFRTLLEAVGQVDMLDTTRALDHWKGSKAGNLDLSP
FT                   ILTQVESAFMDQDLHCTGTQDHGLDKALDQQLIVSARNALDKGEAVSFESAITNVNRTV
FT                   GTMLGHEVTKAFGGEGLPEGTIDITFTGSAGNSFGAFVPSGMTLRLHGDANDFVGKGLS
FT                   GGRIVVRPPLDAAEGFVAEDNIIGGNVILFGATSGEALLRGVVGERFAVRNSGATAVVE
FT                   GVGDHGCEYMTGGKVVILGATGRNFGAGMSGGVAYIYNPDKAFEKNLNTELVDLEDLSG
FT                   DDFTWLKSVIERHRDETGSEVATRILGDWSQQVGHFAKVMPRDYKKVLLAIAAAEKDGK
FT                   NVDEAVMEAARG"
FT   CDS_pept        67027..68478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="RER_00520"
FT                   /product="glutamate synthase small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30760"
FT                   /db_xref="GOA:C0ZLJ2"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ2"
FT                   /protein_id="BAH30760.1"
FT                   /translation="MGDPSGFLKHTSRELPVRRPVPLRLLDWKEVYEEFPNETLKTQAS
FT                   RCMDCGIPFCHNGCPLGNLIPEWNDLVFKDHWHDAIERLHATNNFPEFTGRLCPAPCEA
FT                   SCVLGINQDPVTIKQVEVEIIDKAFDEGWVKPVRAAHATNKRVAVVGSGPAGLAAAQQL
FT                   TRAGHAVTVFERADRIGGLLRYGIPEFKMEKRHIDRRLEQMEAEGTVFKTNVNVGVDIT
FT                   ADELREQFDAVVLAGGATAARDLPIPGRELDGIHQAMEFLPIANRVQLGDLDAPTITAE
FT                   GKKVVIIGGGDTGADCLGTSHRQGAASVHQFEIMPRPPETRAEQTPWPTYPLMFRVASA
FT                   HEEGGERLFSVNTENFVGENGKVTGLKAHEVEMKSGRFEKVEGSDFELEADLVLLAMGF
FT                   VGPEKPGLLTDLGVDLNERGNVARTSKWNTNVDGVFVAGDMGRGQSLIVWAIAEGRSAA
FT                   AAVDTYLEGVTALPSPIHPTAAPQR"
FT   CDS_pept        68663..69559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30761"
FT                   /db_xref="GOA:C0ZLJ3"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ3"
FT                   /protein_id="BAH30761.1"
FT                   /translation="MRARRLVAVLSALAAAVVVPVVSSPVASADPCPGLYVVAIPGTWE
FT                   PSGTSPGAGMLAPVTNGLPGSVRTDYVTYSATAFPWESNVYAKSKQQAVDNARGMIAAM
FT                   AASCGDTRFAIVGYSQGADAAGDLAAEIGTGIGVVPPTRVEGVGLLSDPRRSESDVLIG
FT                   PAVGGNGASGARIGGFGWLSGKTVTLCAVGDLYCSTPKDDFVMRLAGFMAQVSDPTPAN
FT                   ALSLRDEAAVIVNDLVTAGGLPALMAQLDPGANSRRVDQLVAFYGSQVHTDYTRYVVDG
FT                   AGNSATSWLHNWLAGKA"
FT   CDS_pept        complement(69560..69742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30762"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ4"
FT                   /protein_id="BAH30762.1"
FT                   /translation="MDSAEILYADGTCKALADGMPRSEVLAEFNSVGEVYSQITPMSSQ
FT                   RIAEIYVDTAEQTYC"
FT   CDS_pept        69780..70166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30763"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ5"
FT                   /protein_id="BAH30763.1"
FT                   /translation="MYRCPFSPAFATISSGERASIGAFAGGATCGATGSVTGGGVDSTT
FT                   LGAASGVAAGGLVASADSDSGAAELDVAAIDVLVAADVDSAALLSDWLLQPLRSRPAAA
FT                   TQRTSLFVFITRECYTPYRLVCPF"
FT   CDS_pept        70333..71205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30764"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ6"
FT                   /protein_id="BAH30764.1"
FT                   /translation="MQKSHKNGNRRLGTRVAVIAGTAGAVLAFAAPMASAQDPVDNSVP
FT                   GAAVCPATAESCVSVVVQSGTFDNNGFNLPIGKGDMIIAAEAGSGEGESTVLLPRDDGH
FT                   NGVYSKPLTVPGGVLGIDLPFGNLFGLAAVTAEVEATAAPTLNGIITDMDLSIPVRMKI
FT                   NNAFLGDNCYLGSEAAPVNLRLAPDPSVVPTYTVLPSTALKVSPVGNEATGFALPAASG
FT                   CGPFGVLNPIVNWRAKVPATSGTSLSTISDAYLYPGGLTGSDPLDDLGGGTGSSGSSGS
FT                   SGSSGSSGS"
FT   CDS_pept        71230..72081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30765"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ7"
FT                   /protein_id="BAH30765.1"
FT                   /translation="MVTECHHRCGVRPVITCASGWAKAALHQEDLRGHEITGESSNMFR
FT                   DSVLAGPVLRRGVTALAVAAAATMFVGTAATAEPAAVVGEVSADSIAAARAQAIGTTVT
FT                   VVGTATTPSGVFESSFYDKGFGLQSGNSGIYISDPNNSGIALGDQVQVTGVLADQEGLL
FT                   VVRPTAVEVIGTTTQISPARLPLNAIGEGSEGRLVTVSGIVSGPVVDDLPYGHKILVSG
FT                   VDGNTVIFVNTQTGIDVDAIAVGRPITVTGFSGQYASTYEVLPRSEADVQQGFTGSLSF
FT                   GS"
FT   CDS_pept        complement(72083..72985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00580"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30766"
FT                   /db_xref="GOA:C0ZLJ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ8"
FT                   /protein_id="BAH30766.1"
FT                   /translation="MGLLKDVTGWRRGTKLQRRLRDLTGTLVVVTGAGSGIGRETALAF
FT                   AAQGAIVVVSDINLESAQDTAALINTPTQASGAEAVFGGGSHAYQVDVSDEQAVIRFAE
FT                   TVAAHHGVPDIVVNNAGIGFSGTFADTEQRQFERVMDINFWGVVYGCRAFTPMMIDRGT
FT                   GGHVVNLSSAAAYTPQKALTAYSTSKAAVFMLSDCLRAELLPHGIGVSTICPGLVHTNI
FT                   LKTTEFAGTTAEEQLENQTKADNFYRKRNFTPDRVASAIVKAVRTNKAVVPVTVEAKLG
FT                   RTISRLSPGSMRVGARFEI"
FT   CDS_pept        73347..74966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00590"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30767"
FT                   /db_xref="GOA:C0ZLJ9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ9"
FT                   /protein_id="BAH30767.1"
FT                   /translation="MSRSSRRGHRKVAAVALAVSAGLFVSSCADSGNGGGSGDAPDSGS
FT                   GLSIGPVNEQSGEGDAVKGGTLTFSGYSAVTNLDPAKTQIAGSVAGSELGAIYDTLLRY
FT                   DPASKEFVPKLAESMEPSSDFKTWTLELRDGVKFSDGTPVDSAAVSASLNRYVTNKGPQ
FT                   SSLYASKVASVDTPDASTVVFNLVDPWTGIESLLSTGPGMIVAPSAQQGDQFTPIGAGA
FT                   FTLEKFAPNEELILDAREDYFDGAPNVDKLRLISIVGSQSTTESLKSGGTDVAYMRSLP
FT                   NVLDLIDSGYPGFVDIPSLSYLSLVNTAPGRPGADVRVRQALALATDPVALDNRLNEGK
FT                   GLPGQVIFQDTSRWHNDVAPIGVDTAKAKQLLDEAKADGFDGKITYLTLQENSAQAMAL
FT                   ALQSMANAVGFDFQIEYVNSVADVVKRLYADRDFDMATGSANLAEADPFERLYSNLKTG
FT                   GRNNAASFSDPEMDTLLDQLGVATSNDAKIEVLAKIQERANEVVPWQVYGNTPWLGVWG
FT                   QNVHGIQQSLDGIMFFDKAWKN"
FT   CDS_pept        complement(75050..77530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00600"
FT                   /product="putative pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30768"
FT                   /db_xref="GOA:C0ZLK0"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK0"
FT                   /protein_id="BAH30768.1"
FT                   /translation="MTQNLHNRSTGAAGLCRAERFGLRKSCQTSQPHRRPHDLGYRRCG
FT                   DRCQLSKAGPAVNSPSINQNAPEPLAEIEKRVLWLSTAMIHHANRVRPNPSGLKVGGHQ
FT                   ASCASMVSIMTSLWFGQLRSGDRVSVKPHAAPVLHGINYLLGELDESYLTTLREFGGLQ
FT                   SYPSRSKDPDPVDYSTGSVGIGATAPIWGAIARRYVDASLSGAGTGRQYSLVGDAELDE
FT                   GAVWEAVLDHSVAELGEIVWIVDLNRQSLDRVVPNIAATRLERMFSGAGWQVITVKFGA
FT                   LLESLFTRPGGTALRERILDMPNPEYQRLLRCTADEVRLRLPGDAADADAITSLINDLD
FT                   DATVLEAIRNLGGHDLDALREAYAQIDDTRPTVIIAYTIKGRGLPTQGHPQNHSSLLTT
FT                   EQYEILAAELGMDPSKPWERFEADGPSGRICAETAERLARPKVEHLMPPAVPKDIGRTP
FT                   SGTSTTQAALGRVLLDLSREAPDAAKRVVTLSPDVSSTTNLAGWLNKVGVWSPNERHNW
FT                   FADDAETIMHWREKPTGQHMELGIAETNLVGLMGELGATWSRWGQPLFPIGVMYDPFIE
FT                   RALEPWSYGIYAGGQSIMVGTPSGVTLAAEGGAHQSIKTPSIGLEQPGCVSFEPAFAVD
FT                   VEWTLLDSIGRLGRPDGSSSYLRLSTRPVDQALAAVPADPAARERRRRQVVAGAYTLRH
FT                   NPDPAITLVGMGATVTETLVAAERLGEQGISADVVCVTSPGLLFEALQARRGLADGPSW
FT                   ILDQVFPSSRSAPMVTVLDGHPHTLAFLTGINNVPGAALGVSRFGQVGSLEDVYRYHGL
FT                   DSDSIVRAALDLTS"
FT   CDS_pept        complement(77655..77975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30769"
FT                   /db_xref="GOA:C0ZLK1"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK1"
FT                   /protein_id="BAH30769.1"
FT                   /translation="MKKILKRAAARTQQPAPAPTGCEELTNAPETDPAALTPGVCQECA
FT                   ELGEDNWSHLRMCLSCGHVGCCDSSPHQHATNHYRDTAHPVMRSHEPGESWRWCYVHDL
FT                   MD"
FT   CDS_pept        78002..79597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00620"
FT                   /product="putative CPA1 family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30770"
FT                   /db_xref="GOA:C0ZLK2"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK2"
FT                   /protein_id="BAH30770.1"
FT                   /translation="MNGILLGVVVAALLVAAVARRFGLSSPLILVLVGLIACQIPGVPE
FT                   LELDPDLVLFVVLPPLLYSAALDSSYLALRSNLRPIGFLAVGLPLATTAAVGFVAYLIV
FT                   PEFSIAAALVLGAIVAPPDAVSASAIGRKLGLPRRIMTLLGGESLLNDATALTAYKVAL
FT                   AAAVGTGATLIGGFETFLVAAVGGTVIGLAVGFVISKVRGKLQDPVMESGIGLVVPFFT
FT                   YLAAEEVHASGVIAVVVAGLFLGQRSTRASYATRLQDTAVWKAVDLILESFVFLLIGLQ
FT                   LPSVVNGLQGYSTSIVVWASIAVLVTVVVVRIAWVFPFTYVPRWLSPRIRAREPEISAR
FT                   AVFVVSWAGMRGVVSLAAAFAIPLTVNSGEDFPGRSLILFLTFVVVVGTLLLHGLTLPW
FT                   VIRVLGVQGDEEQSDARAEAAAQDKAARAAAARLDELVGADADDVPQVRNRAADILRSW
FT                   NTHRANSAWERLGRSDEDLGESPSNAFRSLRLEMIDAERGVFIAERDAGRIDDEVLRKV
FT                   LRELDLEEATLDRD"
FT   CDS_pept        79780..81399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00630"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30771"
FT                   /db_xref="GOA:C0ZLK3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK3"
FT                   /protein_id="BAH30771.1"
FT                   /translation="MSRSSRRGSRRLAAAALAITASMFLASCADNGSSNGGGESADSGS
FT                   SLKIGMVNEQADPGTPTKGGTLTFSGYSAVTTLDPAKAQVAGATGGSELSAIYDVLMRY
FT                   DPIGQKFEPKLAQSLEASSDSKTWTLKLRDGVKFSDGTAFDSKAVADSINRYVTNKGPQ
FT                   SSLWASKVASIDTPDATTVVFNLVDPWTGIQSMLATGPGMIVAPSAQQGDQFTPIGAGA
FT                   FTLEKFAPNEELLLAARPDYYDGAPNIDKLKLISIVGAQPTAEALKTGGIDAAYMRTLT
FT                   PILDLIESGYPGFVDIPSLGYIANVNMAPGRPGSDVRVRQAMALAVDPETLNTRVNNGK
FT                   GLPGQEIFQDTSRWHNDVATIGVDPAKAKELLDQAKADGYDGKITFLSIQEPSAQATAL
FT                   AIQAMLNAVGFDAQIEYVTGAGDLVKRMYADHDYDMSTAALSLAEADPYERLYTGIKSG
FT                   GRNNATGYSDAEMDALLDKLGVATTDDDKKAVLAQIQERANETVPWQVWGNVAALDVWN
FT                   QNVHGLEQSLDGIVLFDGAWKS"
FT   CDS_pept        81492..82448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00640"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30772"
FT                   /db_xref="GOA:C0ZL82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL82"
FT                   /protein_id="BAH30772.1"
FT                   /translation="MNIGAIGKKLGQLVIVILIVSFGTFVLASLIPGDPAVSVLGEGRT
FT                   PAEYEEVRQQLGLNDPLLVRYWDWLTSALQGDLGNSLVPPQQDVLTAIGSALPVSVQLA
FT                   VMGLVIALVVAVPLALWSAHHEGGVIDRVISAATFGVLSVPSFLAGLLLIMVTVNWLGW
FT                   FPRSQWVRIGDSLSGNLSHAILPAITISLLEMAMFTRVLRSDLVTTLREDYILASKAKG
FT                   MPTLRVLFSDALRPSSFSLITMMGLALGGMIGSTVIVETLFSLPGMGTLIVRAAQQGDS
FT                   PMLLGAVVVIAVIYVLVNSAIDVLYTYLDPRSRRVHV"
FT   CDS_pept        82450..83535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00650"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30773"
FT                   /db_xref="GOA:C0ZL83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL83"
FT                   /protein_id="BAH30773.1"
FT                   /translation="MTPDGAAPSPAPSEVMTYRQQTVLLAPGPVETLEQPKNLVLIGSI
FT                   LTVIGVALLGTALFGSAIMMTVRIVLALVALVFLFKGLGKLGTSKWGSQFDLSYWLACI
FT                   WLAALILAAIFAPLLPLGEYKDTVKTLAEPGFASPSLLSDHPLGTNNFGLDLLARALFG
FT                   ARASLTVAICAVLIGMIIGGTIGVMAGYFRGKVDAVVGILTNSLLAIPSLVLLIALAAV
FT                   LTSNLRNITLALSILCIPSMVRIARANTIVVAQREFVLAARAMGATKWRVIWRELVPNV
FT                   LVPVAALGLVAVSGLIVAEASLSFLGLGIAQPDPTWGNMIAEGQGGIVEKHPFIVLVPG
FT                   VFLFLTVFSFNLIGEKYRSKL"
FT   CDS_pept        83532..84629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00660"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30774"
FT                   /db_xref="GOA:C0ZL84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL84"
FT                   /protein_id="BAH30774.1"
FT                   /translation="MTTSVQNGVPLLQADNIRTVFATPRGQLRAVDGVSIHVSAGETLG
FT                   IVGESGSGKSVLGRTIMGLLQKGPALDISGTVTFAGRDMSTMKKSEMKHFWGPEIAMVF
FT                   QDPMTSLNPFKRIGTHITESLKFHLGLKKDAARDRAAELLSMVGIPEPKRRLDQYPHEL
FT                   SGGMRQRVVIAMALACEPKLLIADEPTTALDVTVQKQILDLLASLNDKLNMAVILISHD
FT                   LGVVSGRSDRVAVMYAGSVVETSATEELFTRPRHPYTEALMAAIPRLESPTHTVLQTIP
FT                   GGLPDMTKPITGCRFAARCRYAQDDCLTGEPALAPGGLGDNTTESHTFACHYPVDTPEG
FT                   TTALVANEKAGTTAAGLSLAVKEMV"
FT   CDS_pept        84629..85618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00670"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30775"
FT                   /db_xref="GOA:C0ZL85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL85"
FT                   /protein_id="BAH30775.1"
FT                   /translation="MTAATDTRKPETVDAALTVEDLVVEFNVGKGQTVHAVSGISFTVA
FT                   PGETLGVVGESGCGKSTAGRAIMQLPSPTSGSIRLGETEMTALGAEELRRSRTQLQMIF
FT                   QDPISSLNPRRKVKALITEGPSIWGGKDKAAIEARAREVLAEVGLDPDMVWDRTPRELS
FT                   GGQCQRVCIARALMLDPKVLICDEPVSSLDVSVQAQILNLLEDAKKRHGLSLLFIAHNM
FT                   AVVKNISDRVMIMYLGRVCEIVPAEDMQNRALHPYTQLLLSSIPDPDATVTAAQNVEQK
FT                   VIELPSPLNPPSGCRFRTRCPLATDLCAEEVPELRLVQGGHQVACHNV"
FT   CDS_pept        complement(85619..86227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30776"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL86"
FT                   /protein_id="BAH30776.1"
FT                   /translation="MTWVQLLLIRHALPELAEVTEGFADPSLTDAGRVQALRLPAALAP
FT                   YRITGLFSSPQKRALETADPVAQALDLPVTELEGLAEYDYEQPHYIPMHEVLERAPETY
FT                   ARIKAGWLPESVDGDTFRARVLGAIDDVVAATDNNATVAIFCHGGVINIVLQELLGLER
FT                   PLTFPIEYVSVTRILVSRDGSRRVGSINETGHVRNMLRV"
FT   CDS_pept        complement(86224..87633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00690"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30777"
FT                   /db_xref="GOA:C0ZL87"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL87"
FT                   /protein_id="BAH30777.1"
FT                   /translation="MDRSTTRVRSSLIFVAILVVALAGIAARPPGFLSTFWPANAILLG
FT                   ILLRNPRSFAPIGLAVGGAALLTADLATGSPVQRAFELNAINLVGVTTGLIAANLLGCF
FT                   PRRISETKYTTRIFVVSVLASFTAGSASALRTQLHEGSGAGTELVGWFFADLCTYLIVL
FT                   PILLSAPPFDHVRRTFGPSVRQNLRLRRVAQILLPLAALLACLPLALEVQGALALLLPM
FT                   PALLWCAMRVSLFSTSLLAAGWSAWALIMAGQGRLALADPVHLLSEGVTTRISVILMAL
FT                   SPIAVAVATGAQRRAERELQRIAECDALTGTLSRHAFWTQSQELLDTQHTARKSIAVMM
FT                   LDLDHFKSINDNLGHLTGDSVLEQFGNTLLATTEGLGLSGRLGGEEFAVAAADCTFEEA
FT                   IALAERIRQRQEAHSRSIRGFAGTVSIGVAWVDQAMAEMDALLDIADTAMYQAKREGRN
FT                   LVVAVDLYMAR"
FT   CDS_pept        complement(87712..88602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00700"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30778"
FT                   /db_xref="GOA:C0ZL88"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL88"
FT                   /protein_id="BAH30778.1"
FT                   /translation="MPELFHVKPPGEILQVGESRLHVLAEGDGPVVVLCGGLAGNWFDW
FT                   DDCARHLQSDHTVVRFDRPGFGLSEPSSEVPTVRGEAQRIRDVLDTLGLTGPAVVVGHS
FT                   IAGFYAEGFARLFPDRAAGMLLLDSSAEKEPKRLFPRDLLLIASRAAAASFSTTGLQRL
FT                   LGTTTRKILNQSVPPSGSSEATLEWVRKIYREPHYLEAAMIEYVAYTDMALELTALRRS
FT                   SKHPLPDIDLSVVAAHTGHTTPWSIAWMAKQQKLATYLGGSFHVLRPAHHHAMIDQPEE
FT                   LANLIRRLTQPNPRE"
FT   CDS_pept        complement(88616..91930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00710"
FT                   /product="probable lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="protein synonym:LysRS"
FT                   /note="protein synonym:lysine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30779"
FT                   /db_xref="GOA:C0ZL89"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="InterPro:IPR031553"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZL89"
FT                   /protein_id="BAH30779.1"
FT                   /translation="MESPPENPRQARRFRKGRFSQVPHISGLILGVFSVLVFLWSISPV
FT                   LRHILRVPREYIDSYYFDAPDTSLSWALVVALLAAALASRKRIAWWLLTIYLALITLTN
FT                   IASTIVDKNPNNAVAAVVLLVVIGILIAARPEFYTRVRRGAGWKALGVLIGGMAVATVI
FT                   GWGLVELFPGDLPQNQRFLWALNRVTAAASVDNEVFDGHPRVFVNTVLGLLGAIALLAA
FT                   VMTLFRAQRSNNALTGNDESAIRGLIQNFGADDSLAYFATRRDKAVIFAPSGKAAITYR
FT                   VEIGVCLASGDPIGDPEAWPHAIEAWQDLASQYGWATAVMGASETGATAYKKAGLSVLQ
FT                   LGDEAILRTREFNLNGRDMRPVRQAVTRVRRHGVTVRMRRHRDIPPEDMAAVIIRADDW
FT                   RDTDTERGFSMALGRLGDHLDGDCLLVEAVMGEGTEDESVVGMLSLVPWGPNGVSLDLM
FT                   RRKPTAPNGVVELMVSELATRSDEIGVVRVSLNFAVFRSVFEEGSRIGAGPILRIWRSV
FT                   LVFFSRWWQLEALYRSNVKYQPDWEPRFLCFEDNRELPRVGFASAIAEGFVVLPSFGRK
FT                   SSQVVKHTGTHAAVPAALVTSEGLHADGSPPDSAPSFTTNGPRRPEQVRVRMNKLAQLA
FT                   DEGIAAYPVAYPPTHTIAAAAKSPEGTRVRIAGRLLRVRDYGGVVFTDVRDWSGDIQVL
FT                   VDQDNVGREKLAEFAAEFDLGDLIEVSGTIGRSRKGELSLIAVEWRMNGKCLHPLPDKW
FT                   KGLSDPETRVRQRYLDIALNPKARELLEARSAVVKSLRDSLGGRGYLEVETPILQQVHG
FT                   GANAAPFLTHINAYNLDLYLRIAPELYLKRLCVAGMEKVFEIGRVFRNEGVDFKHNPEF
FT                   TILEAYEAHSDYEGMMRMCRELIQAAAVAAFGREIIMRPGPDGELVEVDISGEWPVKTM
FT                   HGAVAEKLGVDVSPETSLEDLQKLCDANEIPYQSSWDTGAIAQEMYEHLVEDYTEFPTF
FT                   YTNFPTSMSPLTRPHRSIPGVAEKWDLVAWGVELGTAYSELTDPVDQRNRLTEQSMLAA
FT                   GGDPEAMELDEDFLQALEHAMPPTGGLGMGVDRIVMLITGGSIRETLAFPLAKPRQ"
FT   CDS_pept        91941..92288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30780"
FT                   /db_xref="GOA:C0ZL90"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL90"
FT                   /protein_id="BAH30780.1"
FT                   /translation="MVSDTSVNGAIELPLLPVDQILTLSVVCRVQFCGRRKMIDMTDNI
FT                   PAVPIRDEMIRLGQFLKLANLIESGAEAKEVIADGMVSVNGEVEDRRGRQLRDGDVVEI
FT                   GGMAAKVEAPA"
FT   CDS_pept        complement(92304..92780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rraA"
FT                   /locus_tag="RER_00730"
FT                   /product="putative ribonuclease regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30781"
FT                   /db_xref="GOA:C0ZL91"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL91"
FT                   /protein_id="BAH30781.1"
FT                   /translation="MTEPVATADLADEIGPDIRSCDTQFTQFGGREVFAGPITTIKCFQ
FT                   DNLLVKQTLSEPGNGGVLVVDGDASIHTALVGDIIAGRGVDNGWAGVIVNGAVRDSAIL
FT                   RTLDIGVKALGTNPRKSTQTGSGEKNVPIEIGGVTFNPGEIVYSDQDGVVVRES"
FT   CDS_pept        92853..93839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30782"
FT                   /db_xref="InterPro:IPR011200"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL92"
FT                   /protein_id="BAH30782.1"
FT                   /translation="MDTSRWYRSFAEVEARGNSEVYEEWGNGVSEDPAVLALIDRLPEP
FT                   RRQPNLIFGASRHLGAPVAPYASFRRWLRENWSAVEQLARIRTTQTNEAGRAAVLLPVL
FT                   GLLKGPLSLIEVGASAGLCLYPDRYSFLYDGTKYLHPVDGPSTVLLECATTGSPPIPER
FT                   VPDVVYRAGIDLNPLDVGDTDDMRWLESLVWPEQDHRRQRLRDAAALARVDPPHLVRGD
FT                   LTAAVADLVRRAPQNTTVVVYHSAVLNYLTLTAREEFAETVRALPCHWIANEGLGVLPE
FT                   VDAKLTASPEARRGKFVVSLDGTPRGLAGGHGQSLDWLDQTRTAPAG"
FT   CDS_pept        complement(93836..94507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00750"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30783"
FT                   /db_xref="GOA:C0ZL93"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL93"
FT                   /protein_id="BAH30783.1"
FT                   /translation="MTECNGHHSDTARDLPKMSKDSETQHRLGPQRNPAIDDAVLDATR
FT                   QLLEEKGYAGTSIDAIATRAGVGRPAIYRRWPSKAHIVNDAIYPVLDVEQGADIDTELG
FT                   AEGTIADQIRALVQGAVALFAAPATRAAAPGLMSEVRTNAELRDVLVVRQLAGVRVELN
FT                   RRLEAARERGDIRSGVDADALLDIMAGAAIFALSVRDVSDPGPFADSLADIVLNGILPS
FT                   T"
FT   CDS_pept        94581..95804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30784"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL94"
FT                   /protein_id="BAH30784.1"
FT                   /translation="MNLRTETETSGGDPDYAEFARPGESRNDPAEMRRSLEGWLTTVLW
FT                   RGSKPSVTSVEVPAANGMSNETVLFDATWIEDGIRAEHRLVARIAPRDSAVPIFPSYNL
FT                   DQQFRVMSAVAAHTSVPIPRVYWSESNPDALGGEFFVMERREGEIPPDVMPYTFGSWLS
FT                   EASADDCSRLQQSSVRVLTELHTMADPHLALPELCRDGTEPTGAEALRAHLEDQRRYYE
FT                   WATADGPGSPLIERGFDWIEANFPVDAGSAVLCWGDSRIGNVIYRDFEPAAVLDWEMAT
FT                   LGPRELDLGWMIFQHRFFEDLAAMAGLPGMPDFLRREDVAEAYRSLSGHEVADLDFYIV
FT                   YAALRHAVIMFRVQSRAVAFGQAELPDNPDEMILHHKTLEAMLDGTYWESLATATLTTA
FT                   SVATGDAR"
FT   CDS_pept        95801..96964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30785"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL95"
FT                   /protein_id="BAH30785.1"
FT                   /translation="MTLSPLDDYPVHQIAETIRHVGTSDRNFYDRYYFNCHAGVDGGTE
FT                   PLFLIIGLGQYPNLGVCDGFAVLRRGDDHIVFRASRALGDDRMDLSVGPLRIEIIEGLH
FT                   RLRVVLDPSPEAPDLSFDLTFESDGPANLEARHFHRQLERVTFDTQRFVQTGTWSGSLT
FT                   VDGDVIPVTPETWRGNRDRSWGVRPVGEAEPPGRKADPSIAGSQNFFWIYSIMQFGDFT
FT                   VVTVVQEDQQGRRILEDATRVWADRSREPEWLGRPDHQLTFISGTREVKSGTLYFRRPG
FT                   APGESDHILEITCEPILPNYIGVGTGYGLEQDWRHGMWQGELVVQGLREKVSDIEPWKK
FT                   MLCPVDNLARFTLVGDGVTRTGTGLFEVAVIGPHQRYGFTGIGDVAP"
FT   CDS_pept        97016..97951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00780"
FT                   /product="putative protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="protein synonym:phosphotyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30786"
FT                   /db_xref="GOA:C0ZL96"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL96"
FT                   /protein_id="BAH30786.1"
FT                   /translation="MSTRSRILFARTAKAAALVVTGGLLFAAPATAIPLDLGSLNTGSV
FT                   DLGSLDPVLAPTPNLASVANFRDIAGNDGRGYATVDGSHLKRGVIYRSNALTATSDADK
FT                   ATLTGLGLADAYDLRGSTEISNPFIGGADKLPDGVTYTNIPIEFKDLTQLATTIKSPEE
FT                   AKQFLVDTNRSFVTDPVRRAGFKQVLSDIAAGDGVQLFHCTSGKDRTGWTAMLLQTIAG
FT                   VPAQTIMDDYLLSNTYLQATNEKILAQISQALSPQVATNLEPALGVDASYLEAGLAQIA
FT                   SDYGTVDGYLTEGLGLTADTIALLKAKLVD"
FT   CDS_pept        complement(97962..98537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00790"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30787"
FT                   /db_xref="GOA:C0ZL97"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL97"
FT                   /protein_id="BAH30787.1"
FT                   /translation="MTDDDPTTERGGPASWWKVTAIVAAVLVALTCGVIVWSFMPPVVY
FT                   FPFFALAASVLLGLGGVWLILSLIGWMKYKTLRLSTIAPVIVLVTGALVTLSVPSRVAF
FT                   ALSKDSLEAVAADCQKSLDNQTIGVYRVLQVWPVGNGCRFHIEGGLIDSIGLAYLPDGA
FT                   PYLGKPRRDGEIGYQEFDGDWYSFVQAF"
FT   CDS_pept        98688..99152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30788"
FT                   /db_xref="GOA:C0ZL98"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL98"
FT                   /protein_id="BAH30788.1"
FT                   /translation="MNQDLIIRRYRPSDEDVVVDLWSRAAREAHPFLTGEGTGEREQKM
FT                   REVYLIQADNWVAEHNSEVVGLLGMIGSEIGGLFVAPASQGLGVGRALVEHATTMHGEV
FT                   TLEVYTLNDRARRFYALMDFEEEGRRHDAETNHELITLRRTGRDSSLIQA"
FT   CDS_pept        complement(99335..100309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30789"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL99"
FT                   /protein_id="BAH30789.1"
FT                   /translation="MLSELQSVVQLTPTSAARRPVPGSVQMKRYDLRSRTDRLDPETDY
FT                   EEMSRILAAQEFPWDINQALSFALFRTYAVPSIGKLLFSTGEFTDKVQKRYDDTSLILD
FT                   AILEHGLSSTEGRKSVRRMNQMHGSYDISNEDMLYVLATFVVTPVRWLDEYGWRKMTDN
FT                   EIVGSTNYYRHLGRYMNIKDTPDTYEGFVKLLDDYEREHFSFDSGARAVADSTLDLMCT
FT                   FSPNNLAPKALVKGFAFALMDDHLLDAFHYKHPSTAMRVVSRGALKVRARLLRFFPVRT
FT                   KRKFARELPNIRSYPNGYKVEDLGTFPTGCPVKHLQADQQAQA"
FT   CDS_pept        100402..100860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30790"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA0"
FT                   /protein_id="BAH30790.1"
FT                   /translation="MSVTRTAGVFAAIGLPIAASVMFAGVASADPPHPFGGAAVTIGCP
FT                   NQGSLASLTGLTGQSGPESNPPIAKGDIRFDSFPAAAPIPAAGQVTVAWVNTDTGKSGI
FT                   VDLVGAYPYLSATVNTGVGNVVATAFGSINWGSSPICQSNPTIGRFIA"
FT   CDS_pept        100979..101398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00830"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30791"
FT                   /db_xref="GOA:C0ZLA1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA1"
FT                   /protein_id="BAH30791.1"
FT                   /translation="MKAYFRDGKGGDVNGSSARQLMSQMLVEKRNSLAPEMVGMRCEGA
FT                   RRMHGLSRRDVAQIADISFNHYQRLEQGTSVGVSAPVIVRICDALLMEDDEKARMLALH
FT                   QAWARPRRPLAGSRVAGPQAAGEISGRQRASSSGV"
FT   CDS_pept        complement(101344..102771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30792"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA2"
FT                   /protein_id="BAH30792.1"
FT                   /translation="MLAAAGAVGLVLVTSSVQSIATASPFGSLDAGSSSGSTEIPTVSN
FT                   GGFTSKTPYTPGQRIADYQAPPTGYIPVYTESVARHGSRALSSLKYDDLSLQLWEIAEA
FT                   ENALTPVGKEFGPALRDLMAANKKLGYGNLSGLGVTEHRQLGARVTERLPQLFDAIAAQ
FT                   QGTITLTSSGVDRAVDSAENFAQGLTGAFPAVAGDVAPVTTDADLLYFHDSDANADYKD
FT                   YEESDPRLKAVDDQIADLPRTREVSRHMMLRLYSEDFVNRLSAGEFSLVDRGKGSSTID
FT                   NEVDAAYMLYNTYIITPGMAEEGKWNFERFIDSDDAQWLAYTNDAEDFYAKGPGFTGED
FT                   VTYRMATVLRDEFLRGLQEHTGDAAVPGADFRFAHAETIIPFAALLKLPGSTVSQAEGD
FT                   LYTYANNPWRGANVSPMAANVQWDVYAGPDGERLVRMLYNERETAFAAPCAPVSAGSFF
FT                   YTPDELARCLPEISPAA"
FT   CDS_pept        complement(103171..104820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="RER_00850"
FT                   /product="fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30793"
FT                   /db_xref="GOA:C0ZLA3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA3"
FT                   /protein_id="BAH30793.1"
FT                   /translation="MTYEDRPWLALYRNDVPPDIDVEQPTMLEMLAATVRSDPDATAVM
FT                   YFDGQLSFAELDQQSDALARALRAGGLAKGDRVALFLQNVPQFVLALAGIWKAGGVAVS
FT                   INPMSRERELGYQLEDSGAAVLIALEGLYESVGRNVVSDSPVRRVITTSELEYQSRNDP
FT                   RVFDGIVKKDLGTDDLATLIDQHRLGDPITTDAAPEDIAVLTYTSGTTGPPKGAMTSHA
FT                   NMTFNAQVYRDWLGLTPKDTVLGVAPLFHITGLIGHIAVSVLARMPLVLAYRFQPEVML
FT                   DAIREHRPTFTVGAITAFTALLNTPGCAPEDFTSMRLLYSGGAPISPTAAEAVRAMTGA
FT                   ALHNIYGLTETTSPTHAVPVGADTPVDPTSGALSVGVPVPNTVVRIEDEGGAVLPIGEI
FT                   GELVVRGPQVVRGYWNKPEESASAIRDGWFHTGDVGFMDEAGWFYVVDRKKDMIIASGY
FT                   KVWPREVEDVLAEHPAVREAAVVGIADEYRGETVKAFVSLVAGASVTPEDLIDHCKQRM
FT                   AAYKYPRSVVLVEELPKTVTGKILRRELRTTS"
FT   CDS_pept        complement(104817..105770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30794"
FT                   /db_xref="GOA:C0ZLA4"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA4"
FT                   /protein_id="BAH30794.1"
FT                   /translation="MTEAPYLGELLRDAPSNWGKWGESDEVGSLNYLDAGQVLRGVGTI
FT                   KQGSVFTLQRLIGDPKGDPVWPGRSPAERTQIFDESSWDGDDAPNFPGGLHYADDKIDA
FT                   FLQGSTQYDALGHVWYDGALWNGYSADTTVGGLEKASVEPIADRGVVGRAVLLDMAKFR
FT                   GKENLDKAETFTHHDLLACAEAQGVTIEKRDILVIRTNFLKLFFDQGEAFYEGFCEPGL
FT                   IYSPELVQWFQDMEIPNLVTDTIANEVTTDPENGVALVLHNALMRNLGVVFTEICDLEK
FT                   LAADCASDGQYTFLYVAAPLKVAKASGSPVNPVAIK"
FT   CDS_pept        105886..106812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00870"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30795"
FT                   /db_xref="GOA:C0ZLA5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA5"
FT                   /protein_id="BAH30795.1"
FT                   /translation="MVIALLEIPCSAILNTVTEFENAVLIGASIRQARRHSGLSLRELA
FT                   RRLDVSPATLSAVETGKTRVSVDRLAAIGGILGVRFDALLPAAIVRPPEQPRWGGDDAD
FT                   PDAHFRPNEWRRFGPSSFDPVLAAALAEMVKTGYHGAAMREIAKRAQMSVPGLYHHYSS
FT                   KQQMLAEILDLTMAELNTRSLAAIEEGESPDERLAFLVECVTLFHIYRRDQGFLGASEM
FT                   RSLTAENRLRITESRNYQQWLMTKQVDDGIAAGVFETDRPRQAARAIVVMCVSVAQWYR
FT                   PSGPQTPEEIARDYVRFALDLVRLQRP"
FT   CDS_pept        106859..108586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30796"
FT                   /db_xref="GOA:C0ZLA6"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA6"
FT                   /protein_id="BAH30796.1"
FT                   /translation="MLGRYPYRDSSKERNPMSSNLSHKAYMIGAGIGNLSAAVYLIRDG
FT                   EWNGEDITIMGLDMHGANDGESAATFQHQYGHRELGNDAGFINRGGRMLNEETYENLWD
FT                   ILSAVPSLDNPGKSVTDDILDFDHAHPTHDVARLIDRDGIRNKGENDYKHMQFDNKDRY
FT                   LLTKLMTMPESDEAKLDDISIEQWFEDTPHFFTTNFWYMWETTFAFKRVSSAMELRRYM
FT                   NRMILEFSRIQTLAGVTRSPYNQYESIILPMRTFLEGKGVKFVNELKITEFVFKDTPLR
FT                   DEIIVTGLDYENVRTGEKGRIDVAEGDFVFDTNGSITDSSSIGDLDTPIVEDMRYAPSA
FT                   LLWKQATEHFYDLGNPDKFFGDRAQSEWTSFTVTTSSHELINEISRITKQLPGNALNTF
FT                   VDSNVLLSIVVHHQPHYHAQKENEGVFWGYCLFPRKDGDYVKKPFIEMTGREMLEETLG
FT                   HLEALDESGALAARRQEIMDSVVNSIPSHMPYASALFNRRAVGDRPLVVPKHSKNLAFI
FT                   SQFAELPFDMVFTEQYSVRCAQVAVYKFLGIPEDKLTKMHHYEKDPKVLAKAAVTMFR"
FT   CDS_pept        complement(108594..108971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30797"
FT                   /db_xref="GOA:C0ZLA7"
FT                   /db_xref="InterPro:IPR035197"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA7"
FT                   /protein_id="BAH30797.1"
FT                   /translation="MAEQTRPNFPQYCGYLLGKTLPDRYQDWVRNDLVGPGAQARYIIR
FT                   FTVPATLILLLFLLIPGPIWIPLAMMALLLIPLAYFVVALGTIYRRHRLLSHGLDPELL
FT                   DEKAQRRADRTREDYEKRHGR"
FT   CDS_pept        complement(109002..109973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00900"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30798"
FT                   /db_xref="GOA:C0ZLA8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA8"
FT                   /protein_id="BAH30798.1"
FT                   /translation="MSGPHRVVVLALNGVIPFELGIPARIFGRALDVEDRPLYEILTCT
FT                   IDGNPVRTDADFSISVDHGSELLATADTVVIPASYELGPAFDEGYLSPELAAAFEHIRP
FT                   GTRLVSICTGSYILAAAGLLDGLRATTHWRNTDHFQRVYPKVNVDPDVLFVDEGHILTS
FT                   AGVASGVDLCLHIVRRDHGMEVANTVARRCVVPPWRDGGQAQYIRRPLADKPSESTADA
FT                   RHWALEHLGDPITLADLATRANMSVRTFSRRFRDEVGTTPNRWLTSRRVDRARELLEES
FT                   DLSIDAIAARTGFGTATSMRQHMNEALGVSPSAYRRTFKAPA"
FT   CDS_pept        110045..111361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00910"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30799"
FT                   /db_xref="GOA:C0ZLA9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA9"
FT                   /protein_id="BAH30799.1"
FT                   /translation="MTSETALPESGPQQVSPPRFHRAWSVAIVAFLALVGAASFRAAPS
FT                   VLIDPLHEDFGWSRASISAAVSVNLILYGLTSPFAAALMERFGIRAVVTSALALISLGS
FT                   GLTIFMNSSWQLILLWGVFVGLGTGSMALAFVATVVDRWFVEKRGLVTGILTAGGAAGQ
FT                   LVFLPVLAKLAETYDWKSVAFTVSFAALAVVPFVLLFLRNYPSDVGTTPYGAPADYAPP
FT                   AKPVYQRGGAGGRAISVLVMASKTKVFWLLAGTFAICGASTNGLIGTHFVPASHDHGMP
FT                   ITTAASLLALIGILDMVGTIASGWFTDRMDSRKLLGIYYLFRGISLLFLPLLLANTVNP
FT                   PMIAFVIFYGLDWVATVPPTVALCRQHFGADAPIVFGWVLASHQIGAGLVAFLAGLVRD
FT                   QIGSYDAAFLVAGALCAIAAVMSLLIAKRPKEAVLVDSV"
FT   CDS_pept        111440..112993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00920"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30800"
FT                   /db_xref="GOA:C0ZLB0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB0"
FT                   /protein_id="BAH30800.1"
FT                   /translation="MPAPSAATFSRLADLIAIDNVADRPTKSITEVFTGKELATIPVGT
FT                   ADDALAAIARARVAQKEWAKRSVLDRAAVFHRYRDLILENRDALMDMAQAETGKSRTAA
FT                   QEEVLDISMTSRHYARVAPKLLRPRRVSGMLPGLTKTVVRYQPKGVVGVISPWNYPMTL
FT                   AVSDAIAALLAGNAVVLKPDSQTPYCALACVELLYKAGLPRDLFAVVPGPGSVVGTALV
FT                   ENTDYLMFTGSTATGQLLAEQAGRRLIGFSAELGGKNPMIVAAGADLREVTDAAVRACF
FT                   SNSGQLCISIERIYVEESIAPEFIRMFGDRVKKMNLAAGYEFGIEMGSLVSEAQVKAIS
FT                   AHVDDAVVKGATVIAGGKARPDIGPLFYEPTLLTGVPEDAECYRDETFGPLVSIYPVKD
FT                   VEEAIAAANDTEYGLNASVWAGSKAAGEAIAARIHAGTVNVDEGYAPTWGSTAAPMGGM
FT                   GVSGVGRRHGAEGLIKYTEPQTVATTRVMNLGGPRGLPAKVWAKLMPHAIKIMSWVPGR
FT                   "
FT   CDS_pept        112997..113440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30801"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB1"
FT                   /protein_id="BAH30801.1"
FT                   /translation="METASAYIEATPVSVWKVVSDIEGMGRFSPENTGGTWTSGTPGTV
FT                   GAKFKGTNKHGLIRWSTHCTVVDVVDCRKFSFESDEPKARWTYVLEPSGTGTVLTETRE
FT                   IYAKPALYVRMMSGSGLLGRGRDQLMQTGMETTLARIKAFLES"
FT   CDS_pept        complement(113501..114457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00940"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30802"
FT                   /db_xref="GOA:C0ZLB2"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB2"
FT                   /protein_id="BAH30802.1"
FT                   /translation="MNTDLQAQAADVLRRLALDESLKERTMADAATAALARKVAARYIG
FT                   GETIDDAFDRLPSIFARGHKASIEYTGESVRDPELANAETDVFVELAERIGTSGVESTV
FT                   SFDLSHIGLVIDPEQCFRNVVRLAETTERAGAELIISAEASDRTDLVLDMHARLAERFT
FT                   HVGITVQARLHRTAKDLAALLDRPGRIRLVKGAFLEAESVGYPRGSAELRSAYLDYAAR
FT                   IVESGHQVSIATHDRDILEALRAEHDSKLRADHVEFEMLLGLGTEQLDALRAAGFTTRE
FT                   YVIFGTQWWLYVLNRIAEEPERVYTALVDAALVTTAN"
FT   CDS_pept        114481..114855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30803"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB3"
FT                   /protein_id="BAH30803.1"
FT                   /translation="MRELFSGPLRSIYCRYIVDTSKKHRQSRRTTCTPHTTTQKCKNVA
FT                   SMAAEARIVDTVSVEDSMESAPRVASKTEQKDALKADAVAKVSADLVDPTSVDTAVLTS
FT                   VKPAQRSVLRWVYSEVPLSR"
FT   CDS_pept        complement(115011..115826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30804"
FT                   /db_xref="GOA:C0ZLB4"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB4"
FT                   /protein_id="BAH30804.1"
FT                   /translation="MSFCEPARVVTVTSLTPHMRRISIEAEGDWHWPTGGQGDERIDIA
FT                   FPKPGETEADYDYFNNPDYGKADLGTEPPWRHYTVRKVHDGGRRLDIDFVVHPGGIAAD
FT                   WALRAEPGHLLGVFWSDSSRSHYQAPAGPRWQLLVADATGLPGLGRIVEELREGDVAQA
FT                   IIEVETEEDRQEFVTRGDVTYTWLVGSGLGKAPSALFEAVERVEFPESESADVYAWVAC
FT                   ESATSRRIRKHLREVRGIARDKHNVVGYWREGADGHVSGMNSEEVTVGA"
FT   CDS_pept        complement(115971..117209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30805"
FT                   /db_xref="GOA:C0ZLB5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB5"
FT                   /protein_id="BAH30805.1"
FT                   /translation="MDSREAWQLDGEDLKSEVLDLVRARHELQSRMVLLIVEMFSREVL
FT                   GGKGFRAIAQWLHGSTNLEIGECSLLVGLARLLMLEPVVADAFHRGDVDALKARQVASF
FT                   CQHPPKNMTLADVDKARGILLGLASKNIADCDAVRAAIRRIEKQYGKREDGVPVGEDSE
FT                   RNEFYASKGLYGRVTVKGDLDAVNGARLITLLSRLSAPTPEKDGVKDTRTPALRRADGF
FT                   CELLRRYERAGLGPIEGGVKPHITVTASAKDMTDLQALKDLLPSTEELGFAWTDWVGPI
FT                   SIDTARMLACDCTVTRILLDENGVPLECGKEARTATVPQRRALAVRDGGCAFPGCGTPS
FT                   GWCDAHHIVHWNDGGPTDLDNLILLCGHHHRTLHHTEWRVEIGPDRKTVFYPPMSIDPY
FT                   QQPIGGNSPPTAA"
FT   CDS_pept        complement(117302..117919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00980"
FT                   /product="probable NarL family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30806"
FT                   /db_xref="GOA:C0ZLB6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB6"
FT                   /protein_id="BAH30806.1"
FT                   /translation="MIRLLLADDHAIVRAGLRALLESESDIEVVGEAGTAEEAIAFCAT
FT                   TPVDLVLMDLRFGPGKTGVDATRAVCALPNPPHVLVVTNYDTDADILSAVEAGASGYLL
FT                   KDTPPVELLSAVRAAASGDSVLSPAIASKLMTRVRKPETSLSPREIEVLKLVAAGRSNR
FT                   EIGKELFLSETTVKSHLVHIFGKLGVKSRTSAVARARELGSI"
FT   CDS_pept        complement(117916..119118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00990"
FT                   /product="probable two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30807"
FT                   /db_xref="GOA:C0ZLB7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB7"
FT                   /protein_id="BAH30807.1"
FT                   /translation="MDEPGPNLAKLGEMHRSPLTPVFAGLQLGLHVLVMALAGVVFLRA
FT                   LIDESDLTATIIALAVIFVAVYLFGVAKRLRGNAARWWLAVLTLVWIATMAVSADAAYL
FT                   AFGLFFLYLHILRRPWSLLAVTAATAVAVIGTGLHRGWTVAGAVGPIIGAAVAVAIGLG
FT                   YQALYREAAERGRLIDELMNTREELASTSRDAGKFAERERLAAEIHDTVAQGLSSIQML
FT                   LHAAERADPESPAIRQISLARETAADSLAETRQLIAELTPAALDGQSLADALRRICERA
FT                   SSPELEARSVVEGEALRLPMPLEATLVRIAQGAVSNVLRHADATRMAVTLTYSDNTVSL
FT                   DVVDNGRGFDVAVLERGPAESFGLNAIRRRVELQGGTFSIESEPGHTAVAVTFPLDVGE
FT                   Q"
FT   CDS_pept        119233..120279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01000"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30808"
FT                   /db_xref="GOA:C0ZLB8"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB8"
FT                   /protein_id="BAH30808.1"
FT                   /translation="MFVAMRDLRAARGRFALISVVVLLVALLVSFLSGLTAGLRHQNVS
FT                   AIEAMNADTVVFADTGAGASFDESALTQDQVNAWAGAAKDVDPIGIGRGKAGLADGNQK
FT                   SVALFGADGGFGDVTPSASGTVVLSEGAARDLGAGAGDQVSVGTQQFTVSDVRGDDWYS
FT                   HSPVVWMTLGDWQAANPRGGVATVLAVTGASDASATDKSAVTTSTTVSGSLDAIGSYKS
FT                   ENGSLTLMTLMLFAISALVIGAFFTVWTIQRTPDIATLKALGATTGSLVRDALGQALIV
FT                   LIAGVTAGIGLTAVAGSLIGDAMPFVLDASTTVVPAVALIGLGLLGAAFALRFLSTTDP
FT                   LTALGSAR"
FT   CDS_pept        120276..121016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01010"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30809"
FT                   /db_xref="GOA:C0ZLB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB9"
FT                   /protein_id="BAH30809.1"
FT                   /translation="MTVTTGTTVLDIQNVDLTFPDGQSRVTALDDVSLRLHRGEIAAIT
FT                   GPSGSGKSSLLAVASTLIRPDSGHVYLRTPEGSTDIAALSRRAASELRRSSIGIVFQQS
FT                   NLVSSLTALEQLEVMAHLGQSVFTSRTRRKAVKSKAMDLLDAVGLADQSGKRPSQLSGG
FT                   QRQRVNLARALMNDPQLLVVDEPTSALDQERGAAVMDLIIGVVREHEAATLLVTHDRSH
FT                   LSRMDTVYRVVDGSLAEDQEALAA"
FT   CDS_pept        121221..121568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30810"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC0"
FT                   /protein_id="BAH30810.1"
FT                   /translation="MPVMAVHRDGSIVFANPSFADMLGYPKKAVSALRLQDILYDKDAD
FT                   DVSAEQAHRELSSEPGSVKEFVHSDSTLVRATVSQSLLRRDDDTITLAVLHDLTERLWN
FT                   NPRHIDDKPTK"
FT   CDS_pept        complement(121575..122201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01030"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30811"
FT                   /db_xref="GOA:C0ZLC1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC1"
FT                   /protein_id="BAH30811.1"
FT                   /translation="MTEVLREDTSARRKIIEAAREVFVDPGYAAATIKQLAAAAGVSVQ
FT                   SVYFVFGNKPSVLSALLDVAVAGDEEKTATLDRPWVAAALGAPHPLGQLRIQVHHGRLI
FT                   LERTADILLALRAAASADEDAARLWQINRTQRRTVQEHLMVGIVEKAPTVDLETAVNVA
FT                   LTLLSPETYTDLVVGAGWTGQKYEEWVVNTLAATLGLDRTVKSRK"
FT   CDS_pept        122253..123224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30812"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC2"
FT                   /protein_id="BAH30812.1"
FT                   /translation="MTKVLVLGGYGAVGIPLMKQLAKVPEISAYSAGRDRARADVVVDL
FT                   KEPGAYSAAVRDFDVVVNASGFEDVRLAEEAVRGGAAFVDITATSNYCEELEAVDGPVL
FT                   MGVGLAPGLTSVLAAEAHRLGDGPVDIVIGLGGGELHGPAATAWTYGMLGTRFPDPDGR
FT                   SIRNYTGMKTFRMPADATGYRSGPAVRADFSDQHALTRDLGVPVRTYLRLDTSTATLGL
FT                   AAMTWAPALQKVVPKKLWGSDRWVAMARTDTGPALWVSGRSQSAATATIAARAVQVIRD
FT                   SAISKPTWFHAVETAESLQLAVPELSVRQWDGTRRTSGKAVD"
FT   CDS_pept        complement(123171..124463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30813"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC3"
FT                   /protein_id="BAH30813.1"
FT                   /translation="MRSLLVDRRTGIIRELVDAFVPQHFPPEFKLIHSYASDSARFSPW
FT                   SSDSAGAGYCFDLGDRARPTAAAIGEAVERYCGNIVAKPIVRGSADALIGASIDLSQLA
FT                   RFDAAQYAQPQFPFVEPTDDLELDWTRGVDLITGADTWVPAELVWGSYPHFVARTGPAI
FT                   SPVAQAGLAAGPTTEFAIRNALREIVERDAMTLSWTGRRGVRIVTGIPEVLRRLGNHGS
FT                   LSTRWLSFDSDFGIPVLGALVHDRLTGYSTMGTACHEEARTAAFKSLGEALQLQLLSAD
FT                   YDNPESGIGRAAASPTSPLAPWRADRSYAGAYRSDFADVMDYGCHLQLHLDPEIQARFE
FT                   SELAGAVVGEVDLDSLTSPIDTESALTGSGFRPAWVDLTTTDVLSAGLRVVRVVVPGCL
FT                   TNAAAGLPFLGSPRLVDGLAGRPPRTIPLPH"
FT   CDS_pept        complement(124460..125800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30814"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC4"
FT                   /protein_id="BAH30814.1"
FT                   /translation="MDELLVDARSGVLTSLEPHIRSDMPTGWVGWSARVADTRNFGGSG
FT                   SLFRADPYGFGASIRDDAAARGAATGEAVERYCGNVVPEDLIRSSASALELAGSRVVDP
FT                   AKFALYSEDQYRLPGFPFVPFTSALEIRWALGHTMDEKVPTYVPAALTYLGYYTGTRRG
FT                   EPPIASLQYAGIAAGRSRDEAEMSALLELLERDATALWWCGDRSQPAIELADWERLPAH
FT                   RQLGDLESQTRSVRVLLLPSPFGIPVAAVWIRDDRRGLVALGTACRPTVEAAVSKALVE
FT                   AYAVLAITIDLADPDGPTWRSVADGTLPAHLYKPFRADRRYRDEFDAQWKDVVDLPTVA
FT                   QLYLDPVMAHLAEEHLFDYTETRSVSEVPDEDPVNLASLVALLTSRGYQPISVDLTTRD
FT                   ISIAGLHVVRVLSPGLYNNAPAAFPLLGGSRVTSASTTHLHLPVPLA"
FT   CDS_pept        complement(125793..127220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01070"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30815"
FT                   /db_xref="GOA:C0ZLC5"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC5"
FT                   /protein_id="BAH30815.1"
FT                   /translation="MISLGVKIPAADGSSLATDVLLPDSSPRGLIVIRTPYGRGWHLAE
FT                   GLEWRSRGIAFICQDVRGRHDSTGSWEPYVHERLDAAALAEWLQDQPWTPECVIASGAS
FT                   YAAGTAWAFAAETNNADRAFRARGIVSKVPTIGSDRVKRDPSGILLLAEHLAWWGEHGD
FT                   SSSSREGFIPALMRSDSSLLEHLPVQSMIEEVGLTSDSPGWLTPILRAREREPYGSDDL
FT                   VSADELSELDVAVLHIGGWDDAMIQETLRHFTSVGRGPQSLIVGPWAHDLRPGMVGETS
FT                   FGRLQVEWMESIFSARPVTINRVFDRGAGDWSSEPYVTGANRVRLEPDPRTAPFNFTHH
FT                   ADEGRNDCVVWTFDMEVECVLSGMPSVELTVHSPEGEADWIVELSVVDPAGVTRSIARG
FT                   AGVSLQPTMVTIDLDPVLHTVRAGDVLTLRIAGSDFPRLARNLGDGDRYRGTRSTALHQ
FT                   SFSGSLTLPMLGGTAGG"
FT   CDS_pept        complement(127217..128053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30816"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC6"
FT                   /protein_id="BAH30816.1"
FT                   /translation="MRAPTRRSVYALADGHHPYPTPDGVWHYLTPDENAVTIGAPAEDL
FT                   AELDNFLRRSGSVLGPGAIEIADALVSRGVLAVPGQVPEIPAPQRVLMDGVGPVADACI
FT                   ALLSKALPDLEVVSTTAPIEDDVASSDLVLSVADAPPHDAWSELDTWCRHSRTPWQRVH
FT                   KELGEICIGPFFDGIDSASYRDVCGRRLAASRVPDHLLALWNHLADSERRPLGLSPTAA
FT                   AMVSALACSDVVAGAHGAPQSHLHHQIRMNPRTLMMTRHPVLPLPGGVLEPSPTLR"
FT   CDS_pept        complement(128124..128447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30817"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC7"
FT                   /protein_id="BAH30817.1"
FT                   /translation="MVALRRIPSSRSRSCMHSLVPVALRGDLSYGGIVMEMVSITEGMT
FT                   MSNISFDSVSNSAPANALQGVGTNALVDNPFTFEPVAEATSAHALQGVGTNALVDNPFS
FT                   FQS"
FT   CDS_pept        128450..129664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01100"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30818"
FT                   /db_xref="GOA:C0ZLC8"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC8"
FT                   /protein_id="BAH30818.1"
FT                   /translation="MFRDRSFRLFFTARTIAVAGAAVTGVAMPILVFDISRSPFLTSLA
FT                   AAGTVLPYLVFGLFAGAVADRVNRRTVILCAQAVAALALASIPAAQALGVLTAWHAVGV
FT                   SMCIGTCFVWFDAAAFGALPALVGRQRIPAANSALWTSSTLVDVAFPAIAGVLVASIGP
FT                   AYALGADALAYVLAGLAMASIGASFSSTPAVPKKSEPGIARDIREGLSFLWQSPLLRAL
FT                   TGVGFVNSLTQGAVTALLVVYATEGLGISTSSPMIGAVWTAVSVGGVVGAVLLPRLPAQ
FT                   WPVGAITVGALTIAPVVLFVVATTSNTAAAITALTVYSGCATVTILNGIGARQRLTPDR
FT                   LQGRVNTTARMVAWGGSPVGALIAGAIAGRWDIGTAYLVACSFALVGALFAWVSALRTD
FT                   PCPHR"
FT   CDS_pept        129749..130816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01110"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30819"
FT                   /db_xref="GOA:C0ZLC9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC9"
FT                   /protein_id="BAH30819.1"
FT                   /translation="MTLTSEAVPDAPSRAHPVGDRGYVPFLLATAVVLATVSTVAVWSG
FT                   AASLSFADVFAVLYAHVGGPPVDPLLDRIVWGLRVPRILIAALAGAGLSLAGAVLQALV
FT                   RNPIADPYILGVGSGASFGAVLIMTTGIGTGLSIGVPVAAFLGAMVSLIAVLVLGRREG
FT                   MLVPLRMVLAGVAIGYLLSAATSFVQLRADPSQLSGVLFWLLGSVSGAGWSDLGVPAAV
FT                   ITVCAAVLLTQSRQLNALAMGDESAQSVGVDVRRTRLLLLVIASLLTAVVVSVAGGIGF
FT                   VGLLVPHAVRLLVGSDHRKLLPATALVGATFLVIVDLAARMLDAPNELPLGIITAGLGA
FT                   PFFLWLLRRDGGAQS"
FT   CDS_pept        130813..131607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01120"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30820"
FT                   /db_xref="GOA:C0ZLD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD0"
FT                   /protein_id="BAH30820.1"
FT                   /translation="MRLSASGIHVVRGGRLVVSGVNLEAPEGSVVGLVGPNGSGKSSLL
FT                   RALYRSMKPRSGIVKVDEVNVWDDLSPRSAARIIGVVGQEHSSDFSFSVREVVATGRTP
FT                   HHSAFSRLGEIDRDIVSAALARTGMHGFGSRLFAELSGGEKQRVMLARAIAQQPSVLVL
FT                   DEPTNHLDIRAQLELMELVAELGTTTIVAIHELALAAAYCDYVCLLSGGVVVATGPTAE
FT                   VLTEDLLSEVFGVQVHLGTHPLTGRPLLSFAPPLLHTKEAVS"
FT   CDS_pept        131604..132584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01130"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30821"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD1"
FT                   /protein_id="BAH30821.1"
FT                   /translation="MKSSIRTAALLCSAVTATAVLTACGNSTADSAASSSEKISVTNCD
FT                   REVTLPKTAERIVSLYPSMTELLIQLGAADRIVGQSNTDLSPPSPELADQFAEVPVLST
FT                   GVPAKEALLDARPDLIVSDGEYWFDGDRLQTMDELRDLGIPIFVNSGYCHKAVTEGRID
FT                   DVWSDLDGLGALTGTSDAAATLLADGKKSLAATEASVAGQEPVPAVMVQVSEGQSYALA
FT                   RGLYSSVLEAAGGSNLFENDLPDGKYFGQVATESVLAKSPKAVLVVYSTESARESTLDA
FT                   ARTAFAGTPAATSNAIFAVPEAWFAGELVSIDGAAEVSRLLHPGS"
FT   CDS_pept        132589..133275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30822"
FT                   /db_xref="GOA:C0ZLD2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD2"
FT                   /protein_id="BAH30822.1"
FT                   /translation="MTALERVEAVVSLHAALDRTVAPSELLFDEAALPPVTPEFVELPA
FT                   PTPLPARDFPDILQARRSHYNPAQVALGIGELSNVLHHSLVSSPTAGGMRELTLSFVVS
FT                   HPGHSLGAGVYRYIQEGRAEAVRPGDVQGNLRASLLQPEFVDVFPVLLFVVADVEAPLE
FT                   KYAMRHYRTMHVDAGVLVQNLYLVTEAMGLVGCAIAGFTDARVASLLNLATTQLPVMAF
FT                   ALGRPS"
FT   CDS_pept        complement(133277..133570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30823"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD3"
FT                   /protein_id="BAH30823.1"
FT                   /translation="MSFLRRAGRVAVASSIHGNVQRRQRTRWAAEDQARAAQVQPVPPI
FT                   PDLPPLPPQAAPAESEMSMDAKLEQLTKLGELKNAGVLTEAEFETQKARILG"
FT   CDS_pept        complement(133567..134019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30824"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD4"
FT                   /protein_id="BAH30824.1"
FT                   /translation="MSNQDQFGPIEYVAVEFPGSAPTSAGFEQLLALVDSGVIRILDLE
FT                   FVTKAADGSVSVVPASTFELVDFDLAQFDGAASGLLDVGDIAAVGEELAAGSVAAVLVY
FT                   EELAILPVIEAWTRSGAKVVTEGHLSLDELAAALDNTAPDTTEKDA"
FT   CDS_pept        complement(134023..135669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01170"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30825"
FT                   /db_xref="GOA:C0ZLD5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD5"
FT                   /protein_id="BAH30825.1"
FT                   /translation="MSVKPGAADTSAAVTTASWLPLIVVVLTQIQASFAVNALTVSMAG
FT                   ITTDLDTPATSVGTAITAGTFAMAAFILLGAKIGARYGTRLVFQIAVAIHGLAMAAVAL
FT                   SQSPAMLFVAQAASGAVIALIAPALTVFIATNFSGDQQAKAIGYLAAAIPAAGVLALLI
FT                   AGSFATTIGWRYSFALVVALAVVNLVLSFRVKPVPPQKDITIDWAGAAIAAVAVILLSF
FT                   GFSGLNSWGVILATDAAPFSVIGVSPAAILIVLGTICAQGFFQWTRSRKAQNKPQLFNL
FT                   DVLKTGAERATTICMATMMFVGTAANFLIPLYMQIIQGRSSLQTSFSIIPYTLSIFIAS
FT                   TVVARLYKTYSPRLIARAGFVVVAAGLILLAFTIRGDWHQIFVVIGLITLGLGQGAIVA
FT                   LVFNTLLTAAPKELAGDVGAWRGLVHNMSGSVGIAVASVFAVGILGTLVSSQLIDNPTI
FT                   PASLKVESGINLDQVNFVPNDQLVVTLENTSATQAQIDEAIRINTEARLRALRTSLLVL
FT                   AGLSLLAIIPAGRMPNEVPALEEPQPTKGKK"
FT   CDS_pept        complement(135738..136964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01180"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30826"
FT                   /db_xref="GOA:C0ZLD6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD6"
FT                   /protein_id="BAH30826.1"
FT                   /translation="MEDLTEVASRAVAAERDARSVRWHNPAAVRKAAASVRDSLDDERS
FT                   ALSRPSYSGLSPSPHMARQLELITTLQPPLPADAGISTAAQAEADAVAAVTTARIALRA
FT                   AHLAVLEARVAALDAGDTDTVAAAIRGYVPLNSGNPVVRHVQDLGSRIREEARHVVSGK
FT                   PRSIAFRLGLSLGMGLAYLAFIRLFQWDAKEDRLPYLALYALSGVVGSVVCTNALSFDA
FT                   GRVRAALSGGTRLWHVLVAKNAMMLLLVGSAGFLLSAILAWRSGSSADLVKACGQVLTM
FT                   ILLWLGVANVMSVALPLRAEPMTARRHDGTWKQFLLSFVISYGVGLIVNLMLYWRVWAK
FT                   TTLLEQMGGPWIPVLLLLASAAATWLLLTVLAVLLAEQPRFRRGLQREMVVYREKTNHP
FT                   QATIQHNSG"
FT   CDS_pept        137004..137591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30827"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD7"
FT                   /protein_id="BAH30827.1"
FT                   /translation="MTTNSEKEDLQRYLQAARDALVWKLDGLSEYDIRRPMTRTGTNLL
FT                   GLVKHMIGVELGYFGPTFGRRVPDLPAWLRSEELNVDMWARADESSADIVETYRRTWAF
FT                   ADATIEQHDLDAPGFVKHWPEDRRDVTLHRILVHVVTEIHRHAGHADIVRELIDGAAGM
FT                   KAGDNNLAPGDEAWWAEYNDRLETAAREAHHA"
FT   CDS_pept        complement(137593..139155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01200"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30828"
FT                   /db_xref="GOA:C0ZLD8"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD8"
FT                   /protein_id="BAH30828.1"
FT                   /translation="MSTETDTGSAPTPAKKKFEFPGAVTMLAIVTVLVWVAALFIPAGR
FT                   FGVDVDGSPVPGSFETVTSPLSFWERIQQLILSPVNGLYGVQDSITGFVDTDNIGRLFG
FT                   SVGVVLFIMALGAFISVSFATRSLETAVSQLATKLSDKGWLLITVIMVLFSLLGSTMGF
FT                   SVETFGFYALLIPLMTALGYDRMVAATMIILGALVGNMASTVNPFSIGVASGEAGVSIG
FT                   DGIVLRVILWIVLTAVAVVFVLRYAAKVKKDPSKSLVGFDIEDDEDEEPAEPVDIDGKL
FT                   TGTQKLVLLITGLTFGLMIFSVIPWSSIFGATTGPAEYDAYHVTATEPYWFELNWWFPQ
FT                   LAMLFILAAVLVGIVAKMGEKKIVSLITRGAGDMVGPAIVILLARGVSVIMTNTETLDT
FT                   ILNAMEQLVSGASAGVFAILVMLVNIPLAFLIPSSSGHATLAMPLLAPLGDFAGVSRAL
FT                   VITAFQMGHGLMLMVAPTNVVVVGGLAMAKVGYDKFLRFVWPLLLINFVIVVVVIGAAA
FT                   VFE"
FT   CDS_pept        complement(139152..140528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30829"
FT                   /db_xref="GOA:C0ZLD9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD9"
FT                   /protein_id="BAH30829.1"
FT                   /translation="MPEEFASPSYSTIKETVAGLMPALESELVELVRIPSIATEGFPSE
FT                   PLFEAHDLIVSLLEKAGVTKIEKLEITGKTAPVIIATVPGPEGAPTVLMYSHYDVVPAD
FT                   DVELWESPPFEPTKRDGAIYGRGTADSKANVIGMIGALRVFDGKPPVTVKLVIEGQEEF
FT                   GSPFDNYPPEAPELFAADAMVIADVGSVRPGSPTLTVALRGSAQVIVELTTLGADKHNG
FT                   LYGGAAPDARLALIRALASLHDDNGDVAVDGLLREPWTGSSYTEEEFRTLAEIRDGLPL
FT                   LGTGGIGERIWSGPAITVTGIDAPPVDGAVNAVASTARAVVNLRVHPRQPAADAQAALI
FT                   RHLEALRPFGLQLTVTAGETGDGFAAAEGGPAFDAALSALSQSWGEPAGLMAGGGSIPL
FT                   VMALDTAVPTAEKLLFGATDGYANIHGPNERVLLDELEKAVVAKALFFQEYAHTFEGKK
FT                   "
FT   CDS_pept        140678..141313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01220"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30830"
FT                   /db_xref="GOA:C0ZLE0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE0"
FT                   /protein_id="BAH30830.1"
FT                   /translation="MTVTTSETQERARTARKLGDGPRRAGLLDTAALCFGELGYDAVTV
FT                   ETITTRADVSRATFYAYFSSKDEVFRAVAEMMCRRFLDAQHMEGPAAEDLREVLRTTTS
FT                   AFITAVYTYGDLLAVIEHRARVDSEVERSWSAVREKLVSRYVRFVERIRQVHDVDPCVS
FT                   PPVLVQMISDAQMAGGARLSKASVEEQNQFIADMTTMSERLIGFEKSK"
FT   CDS_pept        141339..143036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01230"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30831"
FT                   /db_xref="GOA:C0ZLK4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK4"
FT                   /protein_id="BAH30831.1"
FT                   /translation="MAEQDVLEAALAEISALQQAHWPAGIPRAVEYPLEGGGLVDYLRH
FT                   WALERPDTPAIVFYGRVITYAEYDELSDRFAGWLLSLGVKRGDRVGVHLVNCPQFHIAM
FT                   LGILKVGAVHVPINPLFREHELIHELNDAGVTVLLTQNTFSKLVKKVRSQTPLEHVAKT
FT                   AVSDMLTAIPTVELPFEVDDPRLSDWQSIITSERATPVATELDSLAALNYTGGTTGMPK
FT                   GCEHTQRHMVYTAATATLAGGDQVGANPPVSLVFLPIFWIAGEDFGILVPLVNGGTVVL
FT                   LNRWDAETTLDAVETYGVTSLVGTVDNYVELMDTSGFSERNLSTLQNAMAVSFVLKLDP
FT                   ATRQRWREATGGVLREASYGMTETHTADTITLGFQDGDYDLKSEPVFCGIPVPGTDVLI
FT                   VDHDGRPVPVGEHGQIIVRSPSILSAYYRNEAATADAIRDGWLQTGDVGKFSERGGLHY
FT                   LARNKEMIKTNGMSVFPSEVEALLMLHPAIEKAAVVPKPDPDKGQVAFAFVQLVEGSDT
FT                   AADEIVSWAKENMATYKVPEVEVLEALPMTATGKVRKGDLFERTQGEK"
FT   CDS_pept        143033..146230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01240"
FT                   /product="putative acyl-CoA carboxylase"
FT                   /EC_number="6.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30832"
FT                   /db_xref="GOA:C0ZLK5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK5"
FT                   /protein_id="BAH30832.1"
FT                   /translation="MRLLIANRGEIALRIIRTARELGIETVSVYAEDDASSPHVAAATE
FT                   SVPLGASGASAYLDQSALLKIAAETGATHVHPGYGFLSENAEFAQACTEAGIVFVGPDA
FT                   QVLRTFGDKASARTAAVDSGVPVLPSTSANADLDEVREFFERNSRGIMIKALSGGGGRG
FT                   MRAVRDPKALDDAYRVCAAEAQSGFGSSALFAEVLSEHARHIEVQIVAGPGQGGTHALA
FT                   LGDRDCSVQRRHQKLIEVAPAQGLSGALRERLHAAAARLCAEVGYRGIATVEFLVEERG
FT                   FVFLEVNPRIQVEHTVTEEVTGIDLVAVQLAIADGVPFEDLDLPTGITAVEKVSETVGS
FT                   VANASGIAIQARVNMETMTPDGNALPSSGTLDNFTPPGGPGVRVDTFGTVGLSPSARYD
FT                   SLLAKVVTHTRRSDFPAAVRKSIAALSEFTIDGVATNLEFLQAILSDKDFRDGLVDVDW
FT                   LGSRLAELVPEADPQTPSASVDIAPDEDVVRAQMAGIVVELAAVGDGVHAGGQVAVLEA
FT                   MKMQHVLSAPGDLEVVRVLSSPGRSVSAGEPLLVVRSASAGSKLAEVDEVDLDDVRPDL
FT                   AEIIARHEVTLDAARPAAVAKRHKLGRRTARENVYDLVDDDSLVEYGALALAAQRSRRS
FT                   EEDLIANTPADGLIGGVATISGGESVVISYDYSVLAGTQGMRNHAKTDRLLEIADRKRV
FT                   PVVLFAEGGGGRPGDTDAGAGAGLELGTFRAMAALSGRVPMVAVVSGRCFAGNAALAGA
FT                   CDVLIATPDANIGMGGPAMVEGGGLGNFRPEDIGPIDVQRRNGVVHLVADDDAHAVALA
FT                   KQYLGYFQGASGEWTAPDPRLSRHVVPENRLRSYDVRGAIEAIADVDSVLELRRDYGRG
FT                   VVTALVRVEGVPYGVLANSSEHLGGAIDAEASDKASDFLELLEAHRIPLVTLCDTPGFM
FT                   VGPDSEEEATVRRFGRFFVAGARLTVPFGTIILRKGYGLGAMAMAGGSFHAPEFTVAWP
FT                   TGEIGPMGLEGAVRLGFRKELESVEDPEARETLFGQFVELAYAQGKALMAATTFELDDV
FT                   IDPADTRAWIRQLGRNS"
FT   CDS_pept        146288..147658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01250"
FT                   /product="putative sulfatase"
FT                   /EC_number="3.1.6.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30833"
FT                   /db_xref="GOA:C0ZLK6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK6"
FT                   /protein_id="BAH30833.1"
FT                   /translation="MSAARDNVLIIHWHDLGRHLASYGVAGVNSPNLDRLAAEGIRFTD
FT                   AHATAPLCSPSRGSLFSGRYPHNNGLIGLAHHGWEYHAEVQTLPQILSDNGWYTSLFGM
FT                   QHETAYPKRLGYHEYDVTNSFCDYVVPRAQNWLRRFPPEPFLLTTGFFETHRPYPADRY
FT                   TPADTAALEVPGYLPDVPQVREDLAEFHGSVEVADAAVGDLLGTLEEEGLDENTWVFFL
FT                   TDHGAAFPRAKSTLYAPGTGIALIARPPARYRSGGKEYETLFSGVDLVPTILDLLGIDV
FT                   PTEVEGRSHADALVDRGTEPSEPVRTSLFTEKTFHDSFDPIRAVRTKDYSYIENYAVRP
FT                   ALDLPLDIEDSLSGKALGTEHLAVRAPRELYDLRADPDEKINLIDRPEVSAIQAELSSQ
FT                   LHTWRAETDDRLPDEALGSAMAVHRMAAYLEKIGVRPNVRSAYSADRGYLESDTENP"
FT   CDS_pept        complement(147655..149535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysNC"
FT                   /locus_tag="RER_01260"
FT                   /product="bifunctional protein CysNC"
FT                   /EC_number="2.7.1.25"
FT                   /EC_number="2.7.7.4"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30834"
FT                   /db_xref="GOA:C0ZLK7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK7"
FT                   /protein_id="BAH30834.1"
FT                   /translation="MTTTITRQLLRLATAGSVDDGKSTLIGRLLHDTDSLPTDHLDSVT
FT                   DEDGVADLAALSDGLRAEREQGITIDVAYRFFSTPTRSYVLADTPGHERYTRNMFTGAS
FT                   NAHVAVLLVDARTGVLRQTRRHARIAALLGVPNLVAVVNKIDLVGFDEARFAQVQEELR
FT                   VLARQLGRGDVLAIPVSAKAGDNVVTRSENTEWYNGPTLLEYLEGVELHAPATHIEELR
FT                   LPVQWVSRPDPQNRRRYTGRISAGTLSVGDEVVVLPSGSKSTVISLDTLDDNRSTAVAP
FT                   LSVSVELADDIDVGRGDVLVSGGAQAHLPVLARELEATICWLSNTPLRAGDRIALKHTS
FT                   RTVRATVQELHTRLDPETLDEQDSPVELGLNDIGTVTLRTSSVVVADTYDHNRDSGAFI
FT                   LIDEQSNDTVGAGTILEPRVVVPGEQTRNDIKWHPSSLERQRRWASTTQKGATIWLTGL
FT                   PASGKSTVAVAVERAMVDAGRTAYLLDGDNVRHGISDDLGFSPGDRAENIRRVGHLTRL
FT                   FADAGVVAIASMVSPLRSDRAIARALNEAAGLTFLEVAVTTPVEECERRDPKGLYARAR
FT                   AGELKGLTGIDAPYETPEDPDLAFDTTGADINELVGRVIALLEERETARP"
FT   CDS_pept        complement(149535..150449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="RER_01270"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="protein synonym:ATP sulfurylase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30835"
FT                   /db_xref="GOA:C0ZLK8"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK8"
FT                   /protein_id="BAH30835.1"
FT                   /translation="MSTVTDVVDELRVLESEAVHIIREVVAELERPVLLFSAGKDSIVL
FT                   LRLAEKAFRPSPLPFPVLHVDTGHNFEEVIEFRDRRIKEGGHTLLVASVQDSIDQGRVQ
FT                   ESTETSGSRNRLQTRTLLDALEGGRFDAAFGGARRDEERARAKERVLSFRDEFGQWDPR
FT                   AQRAEPWSLYNGRIRRGESVRVFPLSNWTELDIWRYIAQEELELPPIYFAHERRVFERD
FT                   GMLLAASEFSTDAENAAATTEWVRYRTVGDLTITGAVRSHATTIDDVVTEISAATVSER
FT                   GETRADDRTSVAAMEDRKREGYF"
FT   CDS_pept        complement(150446..151255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30836"
FT                   /db_xref="GOA:C0ZLK9"
FT                   /db_xref="InterPro:IPR015124"
FT                   /db_xref="InterPro:IPR024628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK9"
FT                   /protein_id="BAH30836.1"
FT                   /translation="MTEAQRSFLVCASQRSGSTLLVESLRATGVAGEPEEFFQYLPETS
FT                   RSPQPRQWFEDVTDESVLGLLAPFHPGTPDTRTSEQWRTQLLELGRTPNGVWGGKLMWN
FT                   QTPLLLDRAAGLPWRSGTDLRSALHDTLDHDLQFIHVYREDVVAQAVSMWRAVQTQVWR
FT                   DDATPPNLSDGAQYNALGIAHLVTILGEQERQWKRWFEEEDISPIEIGFRDLTEDPQSV
FT                   VAKTLISLGLDGQLAPPPPLRRQSDGRSREWVQRYRIDAEQNGYPVT"
FT   CDS_pept        complement(151378..152292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01290"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30837"
FT                   /db_xref="GOA:C0ZLL0"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL0"
FT                   /protein_id="BAH30837.1"
FT                   /translation="MLFAVPTALLGVLIAWGLASPSGPESSSTVRVLAIGCGSLTLGIA
FT                   TLAWMGRSERRPATTPAIMWTQLTAAAAVWLVAEITLLVLNAAAADGAPVTSLTIGHFG
FT                   AFVSEVNVGRVGVAIIACAFAVVCYGIYGFTNPETVPVAPALVVSALALAARPITGHMA
FT                   QQSFGSILDAVHVLAAALWFGVLAALALAVPSRGAWAIWLPRYSALAWRCVLALVVTGI
FT                   VNAVVRLDSLSAFYDTAYGRVILAKIVAIAMLVALGWWWRRTWVVASAAHRMSSDGSLR
FT                   RAIGEVVFMAIAFGLAAALATTA"
FT   CDS_pept        complement(152324..152842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01300"
FT                   /product="putative copper resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30838"
FT                   /db_xref="GOA:C0ZLL1"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL1"
FT                   /protein_id="BAH30838.1"
FT                   /translation="MSTRIKVIAVGMLAMLATMLGMGTASAHSAVVGSNPENGASIQVA
FT                   PDKVSVTFNEALQAQFAALTVTGPDGNLWTKSDPSVEGPTVSADLGDLGPTGVYTIAYR
FT                   VTSADGHPVNGTLTFTLTEAGSGTPGAAAASSTGESESGSMPVWIFIVAGVVVFGGALF
FT                   FVLRKPKSS"
FT   CDS_pept        complement(152842..153510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30839"
FT                   /db_xref="GOA:C0ZLL2"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL2"
FT                   /protein_id="BAH30839.1"
FT                   /translation="MKNTLISRAVVTTVATGSAVLLAAGIASAHVSVVAPGATQGGYSV
FT                   LTFRVPTESDTASTTKLTVALPDLKSARTEPMPGWTAVVEKDPTSLVAKSVTWTADPGV
FT                   GIAPGQFQQFVLSAGPLPEQEEVEFKAVQTYSDGNVVNWDQEELADGSEPDKPAPTLTL
FT                   AASTGDAHGAPAADNTAETSAASESSSSDNTARWLGGVGLVLGALGAALGLGALVRSKR
FT                   "
FT   CDS_pept        complement(153563..154078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01320"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30840"
FT                   /db_xref="GOA:C0ZLL3"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL3"
FT                   /protein_id="BAH30840.1"
FT                   /translation="MRAAEQTATLRGISVGSASAALAVAAHGIGGGELPQSSSLTLLLA
FT                   VCATVGAVTATLPALSRGPAALIVALGLGQLAAHTTMTLSEHAHSPAPGLVMLGAHAGA
FT                   TVACAVAVLAAERLYRVVTHALHVVLASLAPAAVTSRGHTVSTGIHHGPVDALLRASIS
FT                   RRGPPALV"
FT   CDS_pept        complement(154093..154821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30841"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL4"
FT                   /protein_id="BAH30841.1"
FT                   /translation="MCSPRLKPKRRYLATHKHLETGSFSMGLFKKRKSRATRKAEAKAL
FT                   KHKAEVEAKLNAKSQRKRDKVETKSLKKLEKAEIESQHKIEKAQIATLKAQEKAAANQG
FT                   LTVAKVRKYLGVARLLAPVLLPIAYRAATAVRAQLDTTRAQKMGIAVDQLGDYTGHGAK
FT                   LSARIAGAESSVTEILSRKPDDAETQRFAAAIRERLGDLSTAVRAAEQMPQARRKAAHQ
FT                   AISSELDGVEADLLARLGVR"
FT   CDS_pept        154835..156427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30842"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL5"
FT                   /protein_id="BAH30842.1"
FT                   /translation="MCSVNNPAPQLPIIDSGALTRCRHRVRLDGLFPGKSASEPVDTGV
FT                   KQRQDAAIAKRAEIAELVIGAAPERWVKINPDQSASAQARDTLAACEAGADRIWGAVLP
FT                   VERDTGRKGRCEMLVRDDEGGGYIPVIVVNHKVTDPGQGAITSGLLEWEPAVDPKRKVR
FT                   SQVRDQMRVAQVYRMLERRGLASPSLTAGAIGYNGDCVLVHDLSAILDDYDERFADRIA
FT                   VARGEVLTSPSQVSECKSCPWWTECKQELVRNRDVSLVAVGSRAELLRDVGCNTIDQLA
FT                   AWDGEPLEDWPHGNFDDAVVIAKAWLADAPLVRRFEKISVTRADIEIDVDMESYQEHGA
FT                   YLWGTLLNVGGFSMYRGFATWDPLPTRDEARSFAEFWGWLMAERAAAAASGKTFAAYCY
FT                   SRSAEDKWLLDSARRFAGEPGIPSKDEIREFIDSPQWVDIYQAVSDQFICPNGKGLKKI
FT                   APVAGFNWRDAEAGGEASMAWYREAVGYDGEPDETQRTRILQYNEDDVIATKVLREWMT
FT                   DRAEKEIPLASEL"
FT   CDS_pept        156503..158893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01350"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30843"
FT                   /db_xref="GOA:C0ZLL6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL6"
FT                   /protein_id="BAH30843.1"
FT                   /translation="MCPEPASALPSSGRLHDGGCCMLSRLTSSASDADLSDVERRDLFS
FT                   RQVRQVTTVAPLANVANFFSACALLAYVVPPAHEEFRLIWGAAALAVILNSVRVWLPRA
FT                   IQGERYSPKHTTRYDYWALMLEVVLLGVLYTILAAEMLPVIDGSRKLVLIATIAGVVGA
FT                   GAVALSTVRSLGLAWILVHGLGLLFVMLAGATAEYFVLSFQLVVYISILCVGVVYLWAS
FT                   FRSRCLAEFEAAAERQTVSLLLDDFEGGSRDWLWEADTTGTLSHTSARLSQISGVSVSD
FT                   LRTLSLRGLLDRLDVGSTKSGRAAVHVIGDHLDRLMPFREVVIPVRVGGVDRWWSLSGH
FT                   PRLSEAMEFVGWRGVGSDITEKYNYERRILWLAATDGLTGLPNRRTFGTELSDALGAVR
FT                   TGEQVLVGILDLDNFKSVNDTLGHPVGDKLLISVAARLNRVVDGAMCARIGGDEFGVVL
FT                   RGTGDGGEVFARYLGALREPFFVRGNRIEVRASIGYASSPADSEDADTLVMSADLALYA
FT                   AKSAGKNRVGKYSPALRARARERASALQELGLAIESRQFELYYQPQVRADTGRVEGFEA
FT                   LLRWNHPVRGVLAPRIFIDVAEETGLIVPLGLQVLHMACAEAMTWPDDTYVTVNVSPVQ
FT                   LMSSGFGSAVNDALEASGLSSKRLQLEITETGAVEELAVAELDRLRATGIAIALDDFGT
FT                   GYSSFESLKKLPLDILKIDRSFITELSEGDSAVVTSVVEVAKALGMQSLAEGVETADQL
FT                   RLLLTAGCELVQGYYISRPMPATEVAEYLSATAQSSGGYFHSF"
FT   CDS_pept        complement(158949..159716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01360"
FT                   /product="putative 3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30844"
FT                   /db_xref="GOA:C0ZLL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL7"
FT                   /protein_id="BAH30844.1"
FT                   /translation="MEIKGTAALVTGAASGLGAATAKRLADAGATVFGLDLPASIERAG
FT                   DNVPAGVTLIPTDVTSGEDVEAAINQIVESGSPLRIVVNCAGVGWAGRILSKKGPHDLE
FT                   LFRTVITVNLLGTFNVMRLAADAISKTEAVDESGQRGVVINTASVAAFEGQIGQIAYSA
FT                   SKGGVHGMTVPAARDLAQFGIRVNTIAPGIIDTPMLAGVTDEYRKGLEAGVPFPSRLGQ
FT                   PSEYAQLAQMIVEHDYLNGETIRMDGALRMAPR"
FT   CDS_pept        159875..160465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30845"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL8"
FT                   /protein_id="BAH30845.1"
FT                   /translation="MSKAPVRPAASVENFERLQRDPLFEDLAELIAEVLSYAFDAPAAV
FT                   EIEQWTISCLPSTNRSAERHRLFTLNIGPMEILSVECHLVGGKPIEHVMSVYVSSSALE
FT                   SRTGCSIEELDEKHDLVAIRRTELASADGDGTVIDCSLEDSDALEQFALLPVDVTTVRP
FT                   LAEHLVAKGKGPFRQYHNSGFAKYVLERSLDHG"
FT   CDS_pept        160458..161108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30846"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLL9"
FT                   /protein_id="BAH30846.1"
FT                   /translation="MVDQLPIRLPRVLRDGDDAGAVDVLQEYFTRPLRKTGYLRTGALW
FT                   DSWDPSGNRDRDANIFTAEDLVAVTLLSVQVPAQGAFFLLGENNAELNRLLADVGPDRD
FT                   LSNEPDPFTPESPVWRLETALREIHGVGRTMASKLIARKRPRLHPIYDDVIGRELGTKA
FT                   AHLEPVREALHDGELHVRLLDLRVRAGLDDAIPAIRVLDVLAWMQGKGYKPAL"
FT   CDS_pept        161120..162601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30847"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM0"
FT                   /protein_id="BAH30847.1"
FT                   /translation="MGRSSLECMFDNGSTGGVGAVVDDGRPVVDPLVLPDILFATAQSE
FT                   NMLAAQKVLGASMLSESRFNAELDVSGDVDKAWRIACNEIAVMLTCSRRTAEVHIEIGD
FT                   ALREFLPLTKAAFAAGELDYARVRKIVDGLTGAAPEAIAALERRVLASAHRLPPGQLER
FT                   DIERQLFAYDPDAAAERRRKMLEHRDVRTRADRHGLAQLQATLSANEAVEALGLINEAA
FT                   GSVCNHDPRNASTRRADALVALLHGENGLTCQCGSETCEAVSPASRSTAPSRRKPLLHI
FT                   VCDLATLLGLTSDPASIDGYGPIDPDFARELAADSTWQALFVDFRSQAAGNRPRRQHAP
FT                   TVLPLVTRRNHPSREPKGCGDRIRAMQRLVARAPDIVRRSDGHGAQPDPTPGALTYAPG
FT                   AALAALVRAVDGHCRFPGCSVPASRCQLDHITEFDPSDPRRGGWTIASNLQCLCRHHHQ
FT                   VKTYRLWTPVMLVDRAIHWTDKTSGLTTVTVPERR"
FT   CDS_pept        complement(162579..163130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30848"
FT                   /db_xref="GOA:C0ZLM1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM1"
FT                   /protein_id="BAH30848.1"
FT                   /translation="MTVTELPWALDGRGLQLIRAPSLALHALGEDNATLAMELEPNLLT
FT                   PYLLGEECQGLWRYRSTQITGNPLDSAWITRIAVDARTSKPLGLAGFHGRPDARGMVEI
FT                   GYRIDPAFRRHGYARTALEILLDVASRQSEVHIVRATISPDNIASRNLISQYGFSEVGE
FT                   QWDEEDGLETIFEVSASPEP"
FT   CDS_pept        complement(163127..163810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01410"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30849"
FT                   /db_xref="GOA:C0ZLM2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM2"
FT                   /protein_id="BAH30849.1"
FT                   /translation="MTKTAESAQPDGRSTRWNDHKEQRKARILDAALDAVNEGGADVGV
FT                   QQIAERADVPRSVVYRIFKDRADLDEQLRVRILEMMMTDLTPTLTPQGTVGEAISRAVE
FT                   TYLQWIVKYPRLHHFLGKGSPSTRATGSKVVTGTKTAIAVQLGNLLGAILASRGKSSKM
FT                   AEPLAFGVIGLVDVSVNRWLSQPGSDVTSAELAEFLGRSIWQVLDGNLRSIGVDITLST
FT                   PIADL"
FT   CDS_pept        163913..165103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01420"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="protein synonym:acyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30850"
FT                   /db_xref="GOA:C0ZLM3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM3"
FT                   /protein_id="BAH30850.1"
FT                   /translation="MSNRVFVVGVGMTKFEKPGAREWDYPDMARESGTKALEDAGIDYT
FT                   EVEQAYVGYVYGESTAGQRAVYELGLTGIPIVNVNNNCSTGSTALYLATQAVKSGQADC
FT                   ALALGFEKMQSGSLGSTYDDREQPLMRHLLALAELQEFAMPPAPYMFGAAGVEHMERFG
FT                   TTAEQFAKIAVKNHKHSLNNPYAQFQDEYTLEQILEARQIHGPLTKLQCSPTSDGSGAA
FT                   IIASEAFVEKHGLAAQAIEIVGQAMVTDMNSTFEDKSAISLVGADMTRKAAEKVYAQAG
FT                   ITADDVDVIELHDCFSTNELLTYEALGLCAEGDGGKLVDADDTTYGGRWVVNPSGGLIS
FT                   KGHPLGATGLAQCAELTWQLRGTADKRQVDGAKVALQHNIGLGGAVVVTAYKPYAR"
FT   CDS_pept        165146..165577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30851"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM4"
FT                   /protein_id="BAH30851.1"
FT                   /translation="MASVSVSAVLPASPEKTWDALSDLSRWEEWLTIHQGWKSELPTQV
FT                   ALGAKFTEVVSVMGMANKIEWTVEEVEVPKMVKIAGTGMAGVTVEFVLSVEADGAGSKA
FT                   TVDASFKGTMIVGPIGKAVAKNAKADLEASLAKFAELVG"
FT   CDS_pept        165585..166460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30852"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM5"
FT                   /protein_id="BAH30852.1"
FT                   /translation="MTTPKTNAVEFDTSGLDVWTDPEHFEVTAERIAEYAAATNDPIER
FT                   HLKGEIAPPVFAVVPVFMSMAPAALSVAPVELLMKLVHGEQDFLFHRPIYPGDHLVARA
FT                   KPIGFEGRDNGSTVVIYVETKTDKGELVNEQWMTAFFRKVDAGPGLGEKAPEHRFDDAL
FT                   RAGSPAAVVNQHIDEDQTFRYSPASGDPMPIHLDEEIARMSGLPGIINHGLCTMAFTSW
FT                   GALTELAGGETERLRRLAVRFAKPVLPTQDIETVFYKSGSADGATSYSYETSAVGDLVI
FT                   KDGLAVIADK"
FT   CDS_pept        166502..167368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01450"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30853"
FT                   /db_xref="GOA:C0ZLM6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM6"
FT                   /protein_id="BAH30853.1"
FT                   /translation="MGSLDGRVAIITGAGRGIGREHALLFAREGASVVVNDLGGANDGS
FT                   GADAGPAQQVVDEIVAAGGKAVANTDNIATWDGAEGLVKQAVSEFGRLDVLVNNAGILR
FT                   DAFIAGMDESQWDAVIAVHLKGHAATLHHAAAYWKDQSKAGETVNASVINTASASGTFM
FT                   PNAGQGNYGAAKAGIAALTLVAADELDRYGVRVNAIAPIARTRLTLATPGMGALFAAEV
FT                   PEGEFDAFAPSNISPLVAYLAAADCKLTGKVYAVQGGAITELAGWHGVNTIESEGPWTT
FT                   ADLAERL"
FT   CDS_pept        167373..169571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30854"
FT                   /db_xref="GOA:C0ZLM7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM7"
FT                   /protein_id="BAH30854.1"
FT                   /translation="MARNAYELGLGLSEEHTALADSVRSFAEHTITTEQVRAAVESRTE
FT                   DKFPEFWTALVGQDLLGLAVPEEQGGHGAGLLTLAVALEALGRTVSPGPFVPTVLASAV
FT                   LGGADSKAGPEFLPGLIDGSRTAAVALGAPLAAESSDGGYKITGALDGVLGGEHADVLL
FT                   VPIQLPEGVRYAVLESSAVAITVQDSIDVLRGSARIEADNVQISAERILDGLTEARVRS
FT                   IAAVVLGAEDVGVMSWCVSTASEYAKTRVQFGRPIGQFQGVKHKCAQMGIALEQARAVV
FT                   WDAASALDKGDDTADFAADIAAVIVPDAAVQVAQDCVQVHGGIGFTWEHDAHLYYRRAL
FT                   SIRGILGTREDRANRVAQQALDGVSRASVLELPPEAEEIRGDIAAELAKLVELDEDDQL
FT                   IALGDGGWVQPHLPKPYGRSAAPLEQIVISQEIKAAGISMPQLLMGTWAVQAVVAHGSD
FT                   KQKQELAIPTLQGELVWCQLFSEPGAGSDLASLSTKAEKVDGGWKITGQKIWTTVAQFS
FT                   DWAMLIARTDATKPKHQGITYFVLDMSTPGITVRPLREMTGSALFNEVFLDDVFIPDEN
FT                   VVGEVNDGWNVARTTLAGERVALSQKMEAYASDSDLLKFAKSADLSPIGRYRVGELVAE
FT                   SQAIDLIGSRVVLKQLSGIDVSTTSSVGKLLAMKISQSIAEFVVAELGAAGAVSIPGQP
FT                   SDKAMEQLISGRATTIYGGTTEVQLNVIGERMLGLPRD"
FT   CDS_pept        complement(169592..171004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01470"
FT                   /product="putative amidase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30855"
FT                   /db_xref="GOA:C0ZLM8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM8"
FT                   /protein_id="BAH30855.1"
FT                   /translation="MSPNTPVHAFTDDALGDLDATGVAARIESGEVTAREVMEASIARA
FT                   EAVQGQLNGLACTDFDRALARSNRPAAGIFAGVPTAIKDNTDSAGLPTQQGSTAFTAVP
FT                   AKADSDFAKQFLSTGAISIGKTRLPEFGFSASTEYMTEEPVHNPWNPAYSSGASSGGAA
FT                   ALVAAGVLPIAHANDGGGSIRIPAAACGLVGLKPTRGRTIADPADKSMPIRLISQGAVT
FT                   RTVRDTARWMSAAESYYRNPRLAPVRLIEGPSSTRLRVGVITDSVTVTKTDDETRKSVE
FT                   ATAELLASLGHHVEDAALPVGPEFIDDFSIYWGFLSFAISTGGKQMLGPDFDKSGTDNL
FT                   TKGLYTLYRKNLVKTPRVLYRLRRLQQQYSAMFLKYDVVLSPALGHTTPELGYLSPAQP
FT                   FEELFDKLIAYTSFTPLNNISGGPAISLPMHQTSNGLPLASHFSADLGDERTLLELAFE
FT                   LEEAQPWRRIQD"
FT   CDS_pept        complement(171095..171253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30856"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLM9"
FT                   /protein_id="BAH30856.1"
FT                   /translation="MFNDVFNNVIHPMVTNFQQLGPQQFIPQQFIPQGLFQQAPQAAEQ
FT                   AVTIFGS"
FT   CDS_pept        complement(171398..172048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01490"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30857"
FT                   /db_xref="GOA:C0ZLN0"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN0"
FT                   /protein_id="BAH30857.1"
FT                   /translation="MSKPLTLADAARTFRKSPTPWMIGTMLVVAAAARFTLGNWQITDA
FT                   LVPLVMLAAFPFVEWIIHVFVLHWKPRTIAGVTLDSRLARSHREHHFAPRTISLIFIPW
FT                   QTLLIVIPVLTAVALLAFPRVELGLTFLTCISVLGLGYEWTHFLIHSDYKPKTALYRSV
FT                   WRNHRNHHFKNEHYWFTVTTAGTADRVLGTCPDPKSVETSPTAKNLHGTASKL"
FT   CDS_pept        complement(172045..172767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01500"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30858"
FT                   /db_xref="GOA:C0ZLN1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN1"
FT                   /protein_id="BAH30858.1"
FT                   /translation="MFQPVARTSASGAVFDQISVKVLAGELAAGEALPSERKLAEAFGV
FT                   SRPAVREAIQKLAQAGLVEVRQGESTSVRDFRRQAGPELLPQLLVRDGVPDLTVVRSVL
FT                   ETRELMGPQIAVLAARRISAESARELDTAVDQLGATEDPVELQDRALAFWDVVVDSADS
FT                   IAFRLIFNSLRAAYEPAMTALASVMVAEVGQTDLYRKLASAITSHDESTAEASAAQLLH
FT                   TGTTAIGDALTFLEGLKP"
FT   CDS_pept        complement(172822..173793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01510"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30859"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN2"
FT                   /protein_id="BAH30859.1"
FT                   /translation="MHHRRRFARSIALAVGAILIGTLASCSSSDDQPSPSAETIDYSFA
FT                   GYSAQIPADPQRVVVIDSRTSLEFALLADYPIVALDYDESSHLASKVPADAGHLGGNLS
FT                   KEDVLSYNPDLILISVGWYESYKSQNLTFEDIAPVLVIQDGSSPDKETESLGGPLGFMG
FT                   EQLALLGKTDAASAAQARYEAALATARDDVGSVAQTKTIAFVSLIEDKFFVFNTPNNLT
FT                   VDVASSLGYTILSNDAITAAQSAAIGGYSAEFGWENADVLADADVVVAQNLDSWPGNPA
FT                   WDRVPAVAAGNVAPLDYDDKVGFALTYTDFLNKLADTTRNLQ"
FT   CDS_pept        complement(173847..174818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01520"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30860"
FT                   /db_xref="GOA:C0ZLN3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN3"
FT                   /protein_id="BAH30860.1"
FT                   /translation="MANHCFDRAIDTRTPSVDDRKPVRSWFVTPSRQDFPGIMLWGAPT
FT                   LEPSTWNEPVSTPNRIVAEPWSVSTIRFKSTATGVWDFHTHREHELLWSAGGTVTLEAS
FT                   EHLWMVPPMLGIWIPAGTAHRVRSDDGAVIFATYLTPDRIDTDWDSIVGIPMTGALREV
FT                   LLHNENNAMPDLKRLRLQQVAIDLIHPVQAASLDIPLPRTPDLLSIAQQIIADPADDRT
FT                   TSDWARTIGVSGRTLMRRFQADTGTTLTQWRILVRVRVALIEIAAGKPVVAVARGLGYA
FT                   NPGTFIDLFRQVIGHTPAAYFRSFSPVMKPHQNGTKPARVTR"
FT   CDS_pept        174836..175903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01530"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30861"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN4"
FT                   /protein_id="BAH30861.1"
FT                   /translation="MQVRVILGSPNSDTVRKPMTSLLLPTADTDAEFARITAALTRRGF
FT                   LGAGALAGIGLLTACGTSSSESAEGSMRTINTALGQVEVPANPQRVVSADYYTGPAMFD
FT                   AGFTPVGLPVDYENADGVPEPYASALRSLPKVGRWYEPNAEAIAALSPDLIVMTNLLSE
FT                   NNPDLYEQIRSIAPTAVFAEDGQYAWKERALGVADALNQSAKVQELADRYEARIAKFRS
FT                   DNADVLSKVKVVYTTYFEESGFSLYSPTKYQTTVISEAGFQFNDRSLAIPAGSNEWFPK
FT                   EQLELLDEADVIITNSGKGPINEKLANDTIFQRLRAVKNDQVYSFDYEGVASFGWALTF
FT                   LEQFQPIAEEIRAKL"
FT   CDS_pept        complement(175916..177367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01540"
FT                   /product="putative amidase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30862"
FT                   /db_xref="GOA:C0ZLN5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN5"
FT                   /protein_id="BAH30862.1"
FT                   /translation="MSDDLHYLSATEAIAHFRTRELSPVELLQAVVDRTQKFEPHINAF
FT                   TEEMFEEALIGAREAESRYLGHGPDPRPLEGIPVAAKEKHAIAGKSLTEGSLAARGNIA
FT                   RENAPVIDRVLAAGGLIHARTTTPEFCVAAFTHSPLWGVTRNPWNLDYSPGGSSGGAGA
FT                   ALAAGTTTLATASDIGGSTRGPAGFTGTVGLKASYGRIPGVAPLSMDSYRGDGPMARTV
FT                   DDAILLANVLIGPDPRDHSSLRPAITLPHEYPTVEGMRIALCLRLGDFPIEPDIEANTR
FT                   ALAQSLVDAGAIVEEIELPWTRDSMAAAVKVHFGTIMGASVAEVARVHGDLLADYTLDN
FT                   VAITSKGAAEMSFLDGLRKETQMQRELAEAMAPFDALICPTSGTIAFPAGESLLDGLTV
FT                   AGQHVNTTAEALLTLPFNVANRCPVLAVPSGHAHNGVPTGVQIVGHTYDEPTVFRIGKA
FT                   LEKIRPWAYTDQHQPRLDVVAPASS"
FT   CDS_pept        complement(177401..178663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01550"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30863"
FT                   /db_xref="GOA:C0ZLN6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN6"
FT                   /protein_id="BAH30863.1"
FT                   /translation="MNQLLSNLEFGDPSRLRTVEPHWFDLYRDLHAHPELSGNETRTAA
FT                   LVAEELRRIGGWDVTIGVGGTGVVGVLQGSSGPVILLRADMDALPVAEDTGLSYASKTD
FT                   GVMHACGHDVHVTALLATCAALSADPTSITGTVVAVFQPAEETGSGARAMVDDGIFDRF
FT                   PRPDLCLGQHVGPTPAGMLVSKPDILMAASDTIRVVFHGRGGHASSPYACIDPLLMAAS
FT                   FALRIQSLVAHEAATPTAPVLTVGALHAGTAANIIADDAELLLSLRTFSASSREHMLES
FT                   VGRIARAEADGAGAAEAPDVHAYNGFPATVNTPDATSTVMTDLRRAGLGMHTLPQPLSG
FT                   SEDFGVFGTAAQCPSVFWHFGGTALRSFDERALAALAEGRIPPGTPSNHSPRFAPDPAA
FT                   ALPEGVTAMTAAALGALARSA"
FT   CDS_pept        complement(178691..179899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01560"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30864"
FT                   /db_xref="GOA:C0ZLN7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN7"
FT                   /protein_id="BAH30864.1"
FT                   /translation="MLRSTKVTVALLFVAYAIDYIDRLAINLALPLLGEEFDLDYSQRG
FT                   LIISTFFIAYTLAQLPGGLLADRYGAVRMALIGLVAWSVFTGLTALAWSFGTLLVVRFL
FT                   FGLAQGVFPAAAVKLVAERSIPEQRATATGWMNSSNAVGTLLAIVVAAALLPLIGWRGM
FT                   FLAVAALGVLSLVSIKLWLPPALPAEIDHGPDSSWDNMRTVLRSRAMWLFALMFFGYDF
FT                   VIWGMSSWVPSYLHDERGIALSSASLLLIPATVVAAVTTVVGGRISDRLAGNSRIVVVP
FT                   SMLACIVMLVSVPFASNTALFVVLVTLGSAAASFAFMPCFALPLRSLPSSVVGAASSMI
FT                   IFGGMVAGIVAPLVFGFIVDHLSWSAAFVSLALGPVVAIIAVMAAPQTREKMLNLVQLK
FT                   TAN"
FT   CDS_pept        179999..181018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01570"
FT                   /product="putative AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30865"
FT                   /db_xref="GOA:C0ZLN8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN8"
FT                   /protein_id="BAH30865.1"
FT                   /translation="MKPESDAYVIAESDLEIINALQLNPRASWTQLSSVLDMDSTTIAR
FT                   RWRRLVSNGHSWVNAVAIGRTHIFGYLLIRTTQDAVADVGERLSELACAYLLARTEGEY
FT                   EYFVGVVAADQKSLDALVCEHLAADPGILSIRSRVGVKVYRDGFSWEPGALGQAGRAQL
FT                   ATAAAPADPTVFRESDGALLEALGRDGRASYARLAAICGTNETAIRRRLAQLTASRQLI
FT                   FRCDVSQQAVGSPFEVIFDVAVDGSTDELGNLVSSWPEIRLLVATTGTANMLISVWLSS
FT                   LAQSLVVEDRLRRIGSVRILDRRVSLYPMKRFGQLLGPSGVAEGHVPVAIWGAGDVIR"
FT   CDS_pept        complement(181022..181735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01580"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30866"
FT                   /db_xref="GOA:C0ZLN9"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLN9"
FT                   /protein_id="BAH30866.1"
FT                   /translation="MLAAILLSFGVIFVAELGDKSQLMAMTFALRYRWWVVLGGITVAT
FT                   TLVHLVSVAVGHYLGVALPTAAISIVGGIAFLIFGLWTLRGDDLTDDEQNKAGRVTRSA
FT                   FIAVASAFFLAELGDKTMLATITLATDNDWIGVWIGSTVGMVAADALAIIVGSVLGKHL
FT                   PDGFIKIGAAVLFFVFGVWLLLEGIFPDSSAGIIGGGVVLAVSVLGALARMIWKRSRAT
FT                   DSDTHLVDDNRTPID"
FT   CDS_pept        complement(182028..182555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30867"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP0"
FT                   /protein_id="BAH30867.1"
FT                   /translation="MNRNEAIGISPFQAAGSLQGFVISGRWPDTTQEWAQLLALAVRVA
FT                   SMPGLLPTTTVFGVREDVPEDPQPGTVGLVVAEGPVLGDFALTPGRFSDHQPPALIMLH
FT                   PPSETTPSLPECEGSASGCVLLPGLPYLGLEHRAAWVEAEPDGTVVSMISRVGIDLISD
FT                   PDTAVLAMLLAS"
FT   CDS_pept        182601..184085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30868"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP1"
FT                   /protein_id="BAH30868.1"
FT                   /translation="MRRSGTPRWVIEICTYSVLAHKTGRVPARFALVRAVVCAGMTLSK
FT                   NRSRLEDLATQAWIFGYPLLIAAVSRDVMTATPTPVAMKAPLNQFAYARTTPDASFTDV
FT                   VSPNADTLYSSGWLDVSTEPQVLSLPDFGTRYWLVPILDAWSDVFTVPGSRTVGRTGGP
FT                   YLVAGPNWKGNVPKGLTLLRSPTAMNWIVARYATSGGTDLAEVHSLQDRTRLTPLSEWT
FT                   GDPKAYTPGEVPVNSAVDTRTPPVDQVAAMDGEAFFTTLDALLDDNPPRPEDTEMMKQL
FT                   SDIGIGSSLPWKSRPQEVRDALDRAARTGMDVLSEIAKEAEGNPKNGWTMHRGLGHYGT
FT                   HYAQRALIVWLGFGANLDADAVYPHATTDVDGKPLTGEKKYVLHFEKDELPPVEGFWSL
FT                   TMMNERQYFVDNPIDRYAIGDRSDLVFADDGSLDIYLQHESPGGEKERNWLPAPSGDFN
FT                   VFLRLYWPKAAVLSGSWTAPGIREASIREASIREAG"
FT   CDS_pept        184242..184814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01610"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30869"
FT                   /db_xref="GOA:C0ZLP2"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP2"
FT                   /protein_id="BAH30869.1"
FT                   /translation="MVTQNPFVQYGKEIWWMILIRGIFGVIFGIIALVWPGITVVALVF
FT                   LFGIYSIVDGLITLVRAIRDREHLSSWGWWVFTGVVSVGAGIVALVWPGITALVLLYII
FT                   AFYAIMFGIFGIVGAFKMKALPGSSWGWLLAASVLAVIFGIILLIAPGEGIISLIWLLG
FT                   WYAILFGLFMTVGAFQIRSRAKEAGVL"
FT   CDS_pept        184804..185952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01620"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30870"
FT                   /db_xref="GOA:C0ZLP3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP3"
FT                   /protein_id="BAH30870.1"
FT                   /translation="MFSKKGKPAAAAPAPIPTLSGSANWSIPRGLIVLLGLAATVVAVG
FT                   GMKVFGGILGPVFLALVLTIAVQPIQDWSQRRGWPKWVGMLGSLVTVYLILLGLAASLI
FT                   VSTAQLATILPQYSEEMTNLLNEGRDKLADFGVSTEQIQSTLSSIDLTKVVGVLESGLE
FT                   GLLGILSDLVFILALLLFMAFDGMSIRSRLNVLSEQRPEISYALSTFAAGTRKYLVVST
FT                   VFGLIVAVLDGGALWLMGIQLPVLWALLSFITNYIPNIGFVIGVIPPALLGLLQGGPWL
FT                   MLWVIVVYSVINFVIQSIIQPKFVGDAVGLSVTMTFLSLVFWAWVLGALGALLAIPLSL
FT                   LVKAVLLDIDPATRWADILISGPRTEPDEDPKEEAKPTPAPT"
FT   CDS_pept        185997..187343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30871"
FT                   /db_xref="GOA:C0ZLP4"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP4"
FT                   /protein_id="BAH30871.1"
FT                   /translation="MSAENTTENSHRQPSRLGRRLAVGGVAAIVAAAVAGIGFVIFAGG
FT                   ADSSNTVAIVNADAGTTLDGKELRAGDTLVDTLGKNEDFDFQVVDNPGGNYFATLTVPE
FT                   DFSETVASMFGTDPRQASVELAVNGSDSEKSAELTRAVSAQVGADGIKGLLAQTSAARR
FT                   SIDQNLTTAQILVAGTNEAGKSIDQVKAGAGTLLPYLETARSGALELMSVADQVSGVVD
FT                   QASGSAEELATRADSLGLTLGEASSSSAELKTRIDTLQTALNGLPIPPDVTAQLAGVSS
FT                   DLGALNAQLGTVPALLGGSVGPDTELGDLVRTAVGQLQGASDQLSSAAGQLNDGLIPIA
FT                   DQAPQMLGDVTDQITQGFTTLQGIAKSLVTGLDGAKSGIPAMTTPQQVQLTSVLSDPVA
FT                   VNQTSANSGDSGTRTLALVFGATTVLLGGALLTRTAAPLVRRRRSQEEL"
FT   CDS_pept        complement(187344..187967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="RER_01640"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="protein synonym:Fe/Mn-SOD"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30872"
FT                   /db_xref="GOA:C0ZLP5"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP5"
FT                   /protein_id="BAH30872.1"
FT                   /translation="MSVYTLPELPYDYAALEPHISGKIMELHHDKHHAAYVAGANAALE
FT                   KLAEARENDTIAAQANLLEKNLAFHLGGHTNHTVFWNNLSADGGDKPEGELAAAIDDNF
FT                   GSFDLFRAHFSANANAIQGSGWSILAWDSIGQRLIIVQLYDQQGNISIGLTPLLLLDMW
FT                   EHAFYLDYQNVKGDYVKAFWNIVNWNDVSARFDRARTQTAGLIV"
FT   CDS_pept        188228..189406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01650"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30873"
FT                   /db_xref="GOA:C0ZLP6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP6"
FT                   /protein_id="BAH30873.1"
FT                   /translation="MPAPVFLPESPEAAAPRVNLPGADLLRALAVAAVIYSHISFYVID
FT                   DLGSGWWVIDVVYGVLIEPAELNQHLSFVGVAVFMMLTGALVTRSAIRDGPGKFLTNRF
FT                   SRLLPAFWVATAIAILLVRLGINGMFSGQEGISDTEALMSFFLGGFFLKPEVAVLGVTW
FT                   TLTVQFLFYLACVAARPILRLRPIVMPLAGGALCSLVLLYNVYAPLPYTVPMLSKIAAT
FT                   LPAVFLGQIMYLAWAKLAPGRWLIVAVLVQMHVIIVATQFRVYWAGEHYLWTISVVAAA
FT                   VVLIGRYDGVPTRWSVVKWLSTRSYIIYLVHTLILYRVVENTVLYVGPTLAFALFLLTT
FT                   AAVAEIGYRWVELPGARAVTAWRNSRSRVASKHELVRRHSGTSVRKIHADRA"
FT   CDS_pept        189345..190058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="RER_01660"
FT                   /product="peptide methionine sulfoxide reductase MsrA"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30874"
FT                   /db_xref="GOA:C0ZLP7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP7"
FT                   /protein_id="BAH30874.1"
FT                   /translation="MSWYDDILGRASAKSTLIAPEDALPGREQKMPVPTAHYVNGHPLT
FT                   PPFPAELQTVVVGMGCFWGAEKEFWQLPGVYTTAAGYAGGFTPNPTYEETCSGRTGHTE
FT                   VVLVVFDPAVISYEQILAHFWENHDPTQGMRQGNDQGSQYRSAIFTTSAEQEEIAHASA
FT                   VAFGERLAEAGYGAITTEIGPLRDFFYAEDYHQQYLAKNPGGYCPVHATGVSCPVGLLR
FT                   QDQVPAQTDILPPSE"
FT   CDS_pept        190170..190766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30875"
FT                   /db_xref="GOA:C0ZLP8"
FT                   /db_xref="InterPro:IPR039708"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP8"
FT                   /protein_id="BAH30875.1"
FT                   /translation="MSGSTRGTASLLRRTIHVGHDPMVRRSDRIEGFMSFGLIIFAILL
FT                   LPLAVWAGAATASSQNALIAKQSAELHSISATTTADSTQTTASTADYIAPTTEMASAQW
FT                   NWNGEVHTGDVTVDSATPVGTEVPIYVNDHGDKTVAPITQSAADVAAVVTGVFTWFSVM
FT                   SLLVIAFMLVRVFLDRSRSAQWDRDLRAFLDANAL"
FT   CDS_pept        complement(190782..191711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01680"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30876"
FT                   /db_xref="GOA:C0ZLP9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLP9"
FT                   /protein_id="BAH30876.1"
FT                   /translation="MELRIFTEPQQGATYEQLLTVAQTAEKLGYGAFFRSDHYLAMNSD
FT                   GLPGPTDAWITLAGIARETSTIRLGTLVTSATFRHAGPLAISVAQVDQMSGGRVDLGIG
FT                   AGWYEEEHQAYGIPFPALKDRFELLEETLDVVTGLWRTPVGDTFDYDGKHVQIKNSPAL
FT                   PKPHQVDGPPILIGGTGKKKTPALAARFANEFNIPFKSLAETKDIFARVRQACIDIERD
FT                   PNELVYSNALVLCCGRDEAEIKKRAEAIGRDVDELRENGLAGTPSELVDKIGTFAEAGS
FT                   QRVYLQTLDLADLDHLELVASEVMPQLQ"
FT   CDS_pept        complement(191728..193509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01690"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30877"
FT                   /db_xref="GOA:C0ZLQ0"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ0"
FT                   /protein_id="BAH30877.1"
FT                   /translation="MTSPQPEPTLTFTPKRVAQLAFVLIGCQLVIRAWVAASNYFYWDD
FT                   LILMGRGGRFPLFSSELLLYDHDGHFMPAAFFFTGLITRIAPYNWALSATLLVIGQAAA
FT                   SLALLRTLRLVLGWRPALLIPLILYLFVPLTLPSFSWWAAALNALPLQIALAWACGDAI
FT                   KLYRTGHVRYVFSGTAVFVVSLLFFEKAVLVPFVALAFLVLYLRTQGEGTPIRSAVTKC
FT                   RRLWTACAAVLAIWIPVYLTTVESPITGNGRSMSTELLHHGTSLGMLPTLLGGPWRWER
FT                   WIPSPAWADPPTVLVAAAWAALLTTVVMTVRARRGAAWIWAAAALYFLASVVAMTATRS
FT                   DADTTYELAQTLRYFTDSATVFALAAALILAAPRRRPARIPVAVAAGLSALFVVSSLVS
FT                   TVTFVDIWRENPTRDYLANARMSLSQNQDAPLLEQPVAIEVLLPVAFPNNLASNVLAPL
FT                   PDRPEFSSSTPILRTIDDSGRIVDAEVTWTRRIPEGAAPNCGTRAEGPTEFPLDGPLAG
FT                   WEWTVQLNYLASTDGTIDVALESGDAVSVPVTQGLHSAFVRLVGHGNSVKITPTTPGLT
FT                   LCFGAGQVGAVVPTSAK"
FT   CDS_pept        193925..194884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01700"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30878"
FT                   /db_xref="GOA:C0ZLQ1"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ1"
FT                   /protein_id="BAH30878.1"
FT                   /translation="MSVVQVCARCAARWPVVGGPTQWCPRCSGVLLIPTRTEIYQPPNR
FT                   RGFRWIARSPSDPRGVGDAPVRRSLTTPRYDAVPQWGLQDIVDTSPVPPSRADRMADRV
FT                   GPLLTLATILYGLAVFAELGRYAILVRNRTTLIPQWLLTVSDAAVYFTQLGGLLISVFA
FT                   AVAGVCWLLRRRHEHFAGAGESDPRTASEVVVGCAVPILNLVMPAVYLFELVRRDPRGT
FT                   LLVKIWWGFWGFSALLLVVNAYWRSRPGIQAMADGVLLNAFIALVAAVTAALTLVVIRR
FT                   IERKSWRGEPESETRWVPVPRSVLEEKTVLDEKETAAL"
FT   CDS_pept        194881..195645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="RER_01710"
FT                   /product="putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30879"
FT                   /db_xref="GOA:C0ZLQ2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ2"
FT                   /protein_id="BAH30879.1"
FT                   /translation="MSPDRRGPLVVAHRGASAARPEHTLAAYELALEEGADGLECDVRL
FT                   TRDGHLVCVHDRKVDRTSSGTGIVSEMTLDSLNALDYGSTSEPAELLTLSDLITLALDF
FT                   ARPVKLFIETKHPVRFGGLVEAKLLAELHRFGIASPPSADHSRAVVMSFSATAVWRVRR
FT                   SAPLLPTVLLGDASRYLGGGASTAVGATAIGPSIKALREHPDLVDRAAAAGRATYCWTV
FT                   DDKADVDLCRELGVSWVATNHPGRTKQWLGSV"
FT   CDS_pept        195627..196571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30880"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ3"
FT                   /protein_id="BAH30880.1"
FT                   /translation="MAGQRVDFALVAKKSKRNSGPKQGSARAEKLAARQAEREAAAGAV
FT                   NRPFEGLAAECDLVALREFVPSATAPLPVIGSDRPVTLATVLPGAVAALVRDEGETATG
FT                   FVGVQVQAHSADLGADLAASVNWIKDAAPGDALSAANPDSETPAVTEVVDPSALLDITV
FT                   HQNFNWWIPEGVETDPEVAATVQHANSAIMPSARLEGDGLVAAWWVDAGEKAHLRWVRP
FT                   ESEDDLMLALARVHATGGLHLGEGSRYAGSFRTHGLLVPVFDLDREKHANEWVAATVEL
FT                   GERLAEALAVDAPLNSAELRSRDGLRGRQVTLR"
FT   CDS_pept        196625..197443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01730"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30881"
FT                   /db_xref="GOA:C0ZLQ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ4"
FT                   /protein_id="BAH30881.1"
FT                   /translation="MTLSHDISGSGPTLVLVHGIVHRRQAWDSLLDQLTPYRRVVTVDL
FT                   PGHGESVLPELGPDVMGQLIDDVSEFVKEVTPAGERAHVAGNSLGGWIALSLAARGDVA
FT                   SATALSPAGFFVNHLDQVRAINTFRALRGTAKLMGDGLPRALRYKLIRYPALAAFFAHP
FT                   SHVGYAAALADCRSLVSNELVDLGLEMDFVLPPIVDPTVPVTVAWGRRDLILPVYQAQR
FT                   VKKPFPQAKLMVLPGLGHVPMTDAPELISSILLAGSEPFGSRAKSVSAAG"
FT   CDS_pept        complement(197440..198021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftn"
FT                   /locus_tag="RER_01740"
FT                   /product="putative ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30882"
FT                   /db_xref="GOA:C0ZLQ5"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ5"
FT                   /protein_id="BAH30882.1"
FT                   /translation="MTGPLTCTILEFMTSGETHMTKFHALLRDQIRNEFNASHQYIATA
FT                   VYFDNADLPQLAKHFYKQAVEERNHAMMIVQYFLDRDINVELTGVDAAKADFKDAREPI
FT                   ALALTQEKTVTEQIVQLASTAREEGDYLGEQFMQWFLKEQVEEVASMTTLLTIADRAGA
FT                   NLFDLEDFVSREMSTVGDTTGAPNAAGGTI"
FT   CDS_pept        complement(198140..199066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01750"
FT                   /product="probable cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30883"
FT                   /db_xref="GOA:C0ZLQ6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ6"
FT                   /protein_id="BAH30883.1"
FT                   /translation="MSHGHGHGISPAEAATSNSGKHVNKLWIAAGLGLVTFVLQVTVGF
FT                   FTSSLALLSDSAHVFTDIFGIFMALAAILVAQRAARRPDRTFGMYRTEVFAALANAILL
FT                   FAVAGWVLYEAASRFSDPPEVPGLPVAIVAVVGLAMNVIAFLMLRSGAKESINIRGAYL
FT                   EVMADMIGSIGVLVSGLVTLAFGWRYADPVIGVAIGLFVLPRAFNLGRHAVRILLQQAP
FT                   DRIDVTSILEKINTLPGVVDAHDLHVWTLTSGMEVASVHVTAASDADPTTVLAATQTLL
FT                   AEVFELEHATVQVELQGSDGKCTELAW"
FT   CDS_pept        199201..199875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30884"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ7"
FT                   /protein_id="BAH30884.1"
FT                   /translation="MGRHRKSEPTRPGGRMAAVSVATGAILASGTSIGHASPLPVATEG
FT                   PALVSVPEILDLVRTTDLAGIAEQLGKTRQLEAERAALAYEVEKPRVMAPVSGTMTSNF
FT                   GPRWGTTHYGLDIANSIGTPIVSATDGVVIESGPAAGFGLWVRIQQDDGTVGVYGHINE
FT                   ALVVAGQKVRAGELIATVGNRGQSTGPHLHYEVWQSDGQKTDPLAYLNSRGVSFGEKAA
FT                   SG"
FT   CDS_pept        199904..200263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01770"
FT                   /product="putative BlaI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30885"
FT                   /db_xref="GOA:C0ZLQ8"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ8"
FT                   /protein_id="BAH30885.1"
FT                   /translation="MQGLGGLEAEVMDVLWQSDDALSVKDLVEILGERRQLAYTTILTV
FT                   VTHLYDKGWVSREKKSRAYFYRPSRSREEATSRALRELLDSSSDSAAVLLHFAKTMTDA
FT                   ENEALRRGLSGEGAQ"
FT   CDS_pept        200260..201207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01780"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30886"
FT                   /db_xref="GOA:C0ZLQ9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLQ9"
FT                   /protein_id="BAH30886.1"
FT                   /translation="MTLALPMLLGAVFVGFLVPRALRAVSSTLSPTVLLAAWLGSMASA
FT                   LYLALSAVLVLVWPSHAPVEGLVDGIARCFSAFAHGTSSWVGELITGTAVGVVGLIAVR
FT                   IVLAGRKQAREHARVREFHRDVLSIVARRDNSESDVLWLDHPLPMAYSVAGKPGFVVAT
FT                   QGLSSALTGGERDAVLAHERAHLSGGHHRIVGACEVLAAVLPGVPLFAAAPAAVGAIVE
FT                   LSADRHAARVTSPAAVRSALAVVSKSPLPQPDWSLGDRGGATAVRLRSLVDGDVASPRR
FT                   LTCAVAACVPAAITTAVAAAVTVAVSAGICAVLT"
FT   CDS_pept        complement(201208..201864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01790"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30887"
FT                   /db_xref="GOA:C0ZLR0"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR0"
FT                   /protein_id="BAH30887.1"
FT                   /translation="MSRSMKISAALIALFAVALITFITVDPIRADNESTDRAAQSTAVL
FT                   TDDAYRLTSAADDKVNLVEFLDFECEACLALYPTMERIRAEYEDRITFGIRYFPIPSHT
FT                   NSTLAAQVVESASRQGKFVEMYQRMYETQSQWGESAESQEALFRSYAQDLGLDMTRFES
FT                   DLSSRGVRERVERDFNEGKRLGVQGTPTLFLNDVKLAQMPSYEDLKAQIDSALEQ"
FT   CDS_pept        201979..202920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01800"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30888"
FT                   /db_xref="GOA:C0ZLR1"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR1"
FT                   /protein_id="BAH30888.1"
FT                   /translation="MNGLAPPSIGQMLTWDSSSLSPLVLLGAVLALWYWWSMHRVRARG
FT                   RLWPWYRTACFLAGCLLLIAVTGSKVESYGNELFSVWMFQHLTLSMAIPPLWVLGSPGL
FT                   LLLRSTSHRGPGRNVLALALSALRSRPARWMLHPGFTIPVFLFSYYGIYLSPIFDAVSG
FT                   LPAGHVFLEIFFLASGLLFIMPVLATGPLPVRQSYLGRCFDLFVEMPLHVFIGVVLMMA
FT                   TKPLLTTFVNPPPEWGVDVMQDQQLAGALAWSYGEPVALVVVVIFAMRWNRDDKRMNAA
FT                   QDRRAEIDGDSDLEAYNNFLRSLSAAERPETR"
FT   CDS_pept        complement(202932..203477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftn"
FT                   /locus_tag="RER_01810"
FT                   /product="putative ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30889"
FT                   /db_xref="GOA:C0ZLR2"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR2"
FT                   /protein_id="BAH30889.1"
FT                   /translation="MTQAKNSSEFTTLLRQQIRNEFTASQQYIAVAVYFDAHDLPQMAA
FT                   RFYSQATEERGHAMMMIQYLLDNDLDVDVPGVDDVVTKFDSVRAPVELALEQEKTVTEQ
FT                   ITQLARTARDTGDYLGEQFMQWFLKEQVEEVASMTTLLTIVDRAGDNLFHLETFVAREM
FT                   NTPAAADAMAPTPAGGGV"
FT   CDS_pept        complement(203515..203985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR3"
FT                   /protein_id="BAH30890.1"
FT                   /translation="MNTAHRRFRTAAVIAASAGAALLATSCSGTFDKFDESKAYKKTET
FT                   FSFAQASNGIDTLPSWVPAGATGIDEVIRTTGNERILRMTANITEIDHNSCIARPTVET
FT                   RPASLSAQWWPTGVEKGSSFQCGDWYVGEKDSFVYGYRPETLDFIIDQLDNK"
FT   CDS_pept        complement(204085..204996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01830"
FT                   /product="putative LytR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30891"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR4"
FT                   /protein_id="BAH30891.1"
FT                   /translation="MLVLLLALAGAVYYVDSSLNRIDALPDYAGRVADTPGTNWLIVGS
FT                   DSREGLTPEQEQALATGGDTGPKRTDTVILVHVPKSGKTTMVSIPRDSYVPIPGYGSDK
FT                   INAAFAFGGAPLLVQTVEEATGLRIDHYAEIGFSGFAGIVDAVGGVNVCLTQAIDDPLA
FT                   GINLPAGCQDLKGSDALGFVRTRATALADLDRMNNQRQFMSALLSKATSPSTFLNPFRL
FT                   WPLVSDTAKSLQVDEGDHIWNLASLAWALRGGMTTTTVPVAGFEDVDGSGNVLLWDKAR
FT                   ASQFFDALANDQQIPQDLITTG"
FT   CDS_pept        complement(205469..206290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01840"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30892"
FT                   /db_xref="GOA:C0ZLR5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR5"
FT                   /protein_id="BAH30892.1"
FT                   /translation="MNARETVRTWLRPPSPVRTDPELDPAARRGIRIEITIVLLVTFGL
FT                   SGLSGILSLAESLATPVALSDQTVALNPSRAAIDWIDLARQLLGVAKLLAWAALGLYLL
FT                   WRSGIGPRAAGLTPKPRFGRDIAPGFGLAAVIGLPGLLFYLVAQALSINLTVQASALDD
FT                   HWWRVPILVLSAIANSGAEEVLVVAYLITRLRTLGWSENKSLLASSLLRGSYHLYQGFG
FT                   GGVGNVIMGLVFGRYWQRTGKLWPLIIAHALIDMVAFIGYALLRDHVSWLP"
FT   CDS_pept        complement(206301..207080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30893"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR6"
FT                   /protein_id="BAH30893.1"
FT                   /translation="MATKTSTGPSTAERVRSACVRAQDAVLAIEGSDPTVTSVHHLRSN
FT                   GDVVVAVPHASAAAALAWNSGGGGLPAVLEITDHAPLRLREPVRSLVWLRGSLHAVPDY
FT                   EARVLADDVASEHPHPGLLDIGHTSVLLRLSLASAVVADSTGAEPVAVDELLNASPDPF
FT                   WEMETAWLQHLDEDHRDLVDLLVRKLPPYMRTGRVRPLGIDRYGLRLRVEDHTGDRDVW
FT                   MPFANPVDDAPALSRAIRMLVGCPFLNGLRSGGAANG"
FT   CDS_pept        207220..207858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30894"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR7"
FT                   /protein_id="BAH30894.1"
FT                   /translation="MAIPLSLGLPAPRNSRGLLEALFLPVVPASALIGGEAAGRVVVRL
FT                   DIDPEELRADTEASYEAVRFDVDVTTDQIDDAIALRLPAPLAVYVDGGEEDLTPAEAAL
FT                   RLCEGGRIPGLAAGRTPTEVADFLAVLAHESVGFVARAADGDEVIALLCGTAAALRGDD
FT                   VRAAIVDPKPEKLAALIPEAASAMREVLLTIEVADLPAVETALRAAGLQ"
FT   CDS_pept        207872..208804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="RER_01870"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30895"
FT                   /db_xref="GOA:C0ZLR8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR8"
FT                   /protein_id="BAH30895.1"
FT                   /translation="MRNLLGVPRIAYFGPSGTFTEIALAQLEAEGAFGETVERVPAGSP
FT                   PATLDMVRDGSVDGAVVPFENSVEGGVAPTLDSLALGSPLQIVAETDLDVSFSILVRAG
FT                   TTADQVRTIGAYPHAGAQVRGWIAENLPQAEVVLASSNAGAALDVQAGTVDAGVSTALA
FT                   GQMLGLDSLADNVADVGGARTRFVLVTKPAPVPERTGADRTALVLHLDNAPGSLVRALS
FT                   EFAARGIDLTRIESRPMRTELGTYRFFVDCVGHVEDSLVAEAMRALHRKSGVRFLGSWA
FT                   TANSTGPQPPSDEEAIRWIDELKHGGGER"
FT   CDS_pept        208801..209469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01880"
FT                   /product="putative phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="protein synonym:phosphoglycerate phosphomutase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30896"
FT                   /db_xref="GOA:C0ZLR9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLR9"
FT                   /protein_id="BAH30896.1"
FT                   /translation="MTGRLILVRHGQTEANVAKRLDTALPGAKLTPEGLAQAETLGIGL
FT                   ASAPPLALVSSLALRARQTAGFVEQAAGVSLDVRDGLHEVQAGDLEDRTDEAAHRLFME
FT                   TFHHWHTGNLGARIPGGETGYDVLERYVPVVNALREEFLEGSRDGGDIVVVSHGAAIRL
FT                   VAAQLAGVPGLFAANNHLANTETVELLPSADGGWECLRWGAVNPPFEHRLIPGADDVMG
FT                   "
FT   CDS_pept        complement(209479..211581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01890"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30897"
FT                   /db_xref="GOA:C0ZLS0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS0"
FT                   /protein_id="BAH30897.1"
FT                   /translation="MQFSRQPSSPGEQGSVATIDRPNEERATTPHRQDLNGLRGLAIGL
FT                   VVVFHVWFGQVSGGVDVFLVLSGYFFVGSLVRRAEAGGSLNPVPALRRVFLRLFPLIAV
FT                   VSILTALGTALLLPRTRWADLGDQLIAVLGFFQNWQLASTASDYLAADGSVTPLQHLWS
FT                   MAVQGQFYLLAIALVSVIAYVASRVNPNYFRPSLAVTLLVLTAGSFLYALAKSSRHQAW
FT                   AYYDSGARLWELALGGLLAVLMTSTRSRQIASLPFSVRATIGWAGLSSILLCGIVLDGA
FT                   QQFPGPWALVPVLATLALILSGVGDDTPWTSKTLAHPALTWLGSFAFALYLIHWPILVF
FT                   ALVITGRPEAGLLGGALIIALSVAGALALRRLVEVPVERGGRSRRYTVLACVVTAAAVL
FT                   AASVAWQSYASSQTTGQRAVDTLDLPTHPGALALTDGAEVPKASMVPSIFDAPLDLPAS
FT                   TLDGCIADFLERDVVHCTYGDADADRTIALAGGSHSEHWLTALDELGKSHGFRVDTYLK
FT                   MGCPLTVDSMQTLSDNDYPDCVDWSRGVLTELADASPDFVFTTATRPSSDGPGDVTPES
FT                   YVHVWQELERDGIDVLAIRDTPWLHHDGVAYRAIDCLATTTSPDHCAMPRSEMLSDVNP
FT                   APSAIADLTNVRLLDLSDGVCGPELCRVVEGNVLVYHDSHHLTASYVSTLSAELGRQLS
FT                   VQTGWW"
FT   CDS_pept        complement(211622..212440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30898"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS1"
FT                   /protein_id="BAH30898.1"
FT                   /translation="MVDLGTSPDGWNLPVVALSQDEIDYVRERLGLDALPVVLGGATVH
FT                   ASASAHHTAMQSAADSLSERDLLPGGEIHHELSARLRVLTHPKWELALRRHVGGRISRL
FT                   CVAQGEFLCVEATSTDSSFALCSVTAEPAAPVVTALGSAEAMPIAVINAPTEMLSLAFG
FT                   AGPDADSVTSALINAGIPEDDARQLGSAIVTCTAFAELVGIPHSLGATTLMTGAVTVYD
FT                   TLAGRLVGSTTRAADGTEWTSISSGTLHRLRQAVNALVTELEESTPETSG"
FT   CDS_pept        complement(212440..213708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30899"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS2"
FT                   /protein_id="BAH30899.1"
FT                   /translation="MVGITGIIWYPRGAAPNSAALVAGAGPVPLGVAAGAWSTVSSGLT
FT                   DTAASISRVMADLRTGWSGEAADAASSKFAPFQEWAAAAALLAGETAGKAQVQSGSYTV
FT                   ATLAMPSLAEIAAVQAAKVAAYSIGGALVGGAAAAEAAEEALKIRAAVTMETYDAATTH
FT                   LAVQQNFDSPPSIAEPTAGASASAESPGSAARQSVVQAASTLADVIADPVRAATAAVAS
FT                   VVSNPVFAAAASQAGAISGGASAAVSAATTAVTGATTAASTLATAGAGLTGLGGAGLGG
FT                   AGLGGARLGASTPSLFGTPSASRATAQVSAASATTRAGAFAGSSSSSSTGRHALPDPST
FT                   GQSAARQNPVTSPVQGTVDTVKVDPARTAGGSAPIAGGRHAAQSEDETEHDTPDYLKHF
FT                   EHFADGRTVIPSVIGGALETAER"
FT   CDS_pept        complement(213761..214060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30900"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS3"
FT                   /protein_id="BAH30900.1"
FT                   /translation="MHVDPQALVAAAMELESAATRLRGIVSTAQPTLRVLPAGSEEVSG
FT                   SAANYFNTISGSLASSTDRAIEELTAAAAALRKNAAAYELEDQLTKSSLAAAPI"
FT   CDS_pept        complement(214194..214544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30901"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS4"
FT                   /protein_id="BAH30901.1"
FT                   /translation="MTVTMTPDRFEELVGEALDLIPPELAKAIDNVVVLVEARDEEEPG
FT                   LLGLYQGVALTERDSHYGGYLPDTVTIFRDSILDICASEDEVVHEVAVTVIHEIAHYFG
FT                   IEEDRLHELGWG"
FT   CDS_pept        complement(214548..215642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30902"
FT                   /db_xref="GOA:C0ZLS5"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS5"
FT                   /protein_id="BAH30902.1"
FT                   /translation="MSEDKIEKSPDPVDPQGTPAKKTVSASRTRRVLAAVAVGAVVAAI
FT                   ATIAISGGLNKDDSSSVSVSGGGPAATGSTRDDAFTAAAAGDCLNWTPATESGGDRTDM
FT                   SKVQCGTEHRFEVAGPLDLSVFPGAEFGPGSRYPGALRFAELRDEHCTPIVMSYLDSKF
FT                   DPKGKFSVGLMFPSESGWASGERALRCGLQFSTTTGELQPFVGRVADQDQSNVWDVGTC
FT                   IGINQNLPTDPVDCAKPHAYEVISVIDLGTQFPGAMPSVEDQDRYLEGVCTQASNEYLG
FT                   SADALRDKTLTLFWDNISLESWLAGSRRVNCSIGKEVETGGFAAITGSAKGEILINGAA
FT                   PVPPPAAPEGRSLPTPLPGAAPPS"
FT   CDS_pept        215653..216120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30903"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS6"
FT                   /protein_id="BAH30903.1"
FT                   /translation="MPVAEAISNLHYKTHKRVCEYFVVMSENTPLDPEAVELAGRLFDM
FT                   ARTGDAAGLASYVDAGVPVNLTNESGDTLVMLAAYHGHADAVVALIERGADVNRPNDKN
FT                   QTPLAGAVFKGEDAVVKALVSGGADPKGGHPTAVDAARMFGREDYLSLLES"
FT   CDS_pept        216186..217439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="RER_01960"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="protein synonym:SerRS"
FT                   /note="protein synonym:serine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30904"
FT                   /db_xref="GOA:C0ZLS7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS7"
FT                   /protein_id="BAH30904.1"
FT                   /translation="MIDLKFLRENPEIVRESQRTRGEDPGLVDALLEADASRRAAVLTG
FT                   DNLRAEQKAFGKKVGQASPEERPALLEGSKELAAKVKEAEAAQHEAQAALDAAHRAISN
FT                   VVQEGAPAGGEDDYIVLEHVGEIPKFDFEPKDHLELGESLGLIDMERGAKVSGSRFYFM
FT                   TGYGAMLQLGLLQLAAQKAIANGFTMMIPPVLVRPEIMAGTGFLGAHSDEIYHLQDDDL
FT                   YLVGTSEVPMAGYHSGEILELNEGPKRYAGWSSCFRREAGSYGKDTRGIIRVHQFDKVE
FT                   MFTYCRPEDADAEHQRLLGWERDMLAAIDVPYRVIDVAGGDLGSSAARKFDCEAWVPTQ
FT                   GTYRELTSTSNCTTFQARRLGVRYRDENGKPQTAATLNGTLATTRWIVSILENHQQADG
FT                   SVRVPEALVPFVGTDVLR"
FT   CDS_pept        217681..221019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30905"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS8"
FT                   /protein_id="BAH30905.1"
FT                   /translation="MNWTSVLPKVVRVLVFSLCCDGAHMFCPNPLLMFALPKEVPMPQI
FT                   SQLRRFAVPITGTAMVAGMLLIGTPASAAISTTGFKTACVAGSIIGDVHKVTDNLITVD
FT                   APASVQPGETFTYRIQPSGTSYPDKDSGATTTNLSRLKVDYAIPANATFVSAAVVAGTS
FT                   VGLDSVAPNVLRVNDSGNVDGSGGILRLSGNNQVIGNSPTTSTNSEGGIRVPKSKKNLD
FT                   GSTNGNGDTWFRLPAVDVTMVAGATGVIQPKVRTAGTAGNLGASENFSTQLAKASFLGT
FT                   QWAPTRCSPRENKDTTPLNAGAGPLATISIASAPVDVETTTSLSVPATAITGTAVDLTA
FT                   TVAPNNAVGSVQFKSNGTAIGSPVAVSAGVATLSHSFDAAGAQSVTADFTAGAGFVSSS
FT                   ASAQTVTVSDPAPVDVETTTSLSVPATAITGSAVDLTATVAPNNAVGTVQFKSNGAAIG
FT                   SPVTVSNGTATLSHAFDAAGAQSITADFTAGAGFVSSSASAQTVTVSDPAPVDVETTTS
FT                   LSVPATAITGTAVDLTATVAPNNAVGTVQFKSNGAAIGTPVTVTSGVATLSHSFDAAGA
FT                   QSVTADFTAGAGFVSSSASAQTVTVSDPAPVDVETTTSLSVPATAITGTAVDLTATVAP
FT                   NNAVGTVQFKSNGAAIGTPVTVTSGVATLSHSFDAAGAQSVTADFTAGAGFVSSSASAQ
FT                   TVTVSDPAPVDVETTTSLSVPATAITGTAVDLTATVAPNNAVGTVQFKSNGTAIGTPVT
FT                   VTSGVATLSHSFDAAGAQSVTADFTAGAGFVSSSASAQTVTVSDPAPVDVETTTSLSVP
FT                   ATAITGTAVDLTATVAPNNAVGTVQFKSNGTAIGSPVTVSAGVATLSHSFDTAGAQSVT
FT                   ADFTAGAGFVSSSASAQTVTVSDPAPVDKATKTVLSVQGEAKVGLPVDLFATVSEDPSD
FT                   ALVPSGGTVQFKIGGVDQGAPVAVVDGVAKLPHVFGAEGTFVVSAVFSGSGVFTSSTAE
FT                   SVDVNVTVPTPSDVESSTSLTAPSSAKVGTSVQLKAVVSSSGATSGTVQFFDGTTPIGT
FT                   AVDVVGGQAVLSHTFTTTGNHSITAVYSGAQGVTGSTSTTSVVNVGNGGGDFGSLGSLS
FT                   LPFGS"
FT   CDS_pept        221265..224744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30906"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS9"
FT                   /protein_id="BAH30906.1"
FT                   /translation="MLVRRSSAVVVAALVGGVLVAGGVASAAPTSSPAVENTIGFKLGC
FT                   DGYEHLAVDIADVFHSTGATVSAPEKVVAGSTFTYRVQPNVMSVPTGGHAGRSVGKWTR
FT                   LKYDFDIPAGVSLVDAQVVAGTSSNLSGVTPSVIRINDGGSPDGAGTHLRISGNNQTAD
FT                   SNNKGGNGPSASKNSDGGIEVGAGKTFRLPAIDVTVVAGAAGSTVQPKLRATDGDSGAF
FT                   NSPKNAFTFLQYETLWPGYWERYNCSPRDSSGGGLNAGGQALATVNVVSQAATTTAVTS
FT                   GASATIGQSTDLVAQVSPVPTGGTVQFKDGGTDIGAPVAVANGVATLPHTFTAAGDHSI
FT                   TAVYDGVLEFLTSTSPARTVSVAAADVQTTTALTVPSSAVEQTSVALTANISPAADGGT
FT                   VQFKDGGTDIGGPIAVTAGAATLDHTFTTTGSHSITAVYSGTAGFGGSTAQAQTIEISS
FT                   SALSTTTTLQVPAAAITGSAVDLTATVAPNNAVGSVQFKSNGTAIGSPVTVSGGTATLS
FT                   HSFDAAGAQSVTADFTAGAGFVSSSASAQTVTVSDPAPVDVETTTSLSVPATAITGAAV
FT                   DLTATVAPNNAVGSVQFKSNGTAIGSPVTVSGGTATLSHIFDAAGAQSITADFTAGAGF
FT                   VSSSASAQTVTVSDPAPVDVETTTSLSVPATAITGAAVDLTATVAPNNAVGTVQFKSNG
FT                   TAIGTPVAVSAGVATLSHSFDAAGAQSITADFTAGAGFVSSSASAQTVTVSDPAPIDVE
FT                   TTTSLSVPATAITGAAVDLTATVAPNNAVGTVQFKSNGTAIGSPVTVSGGTATLSHSFD
FT                   VAGAQSVTADFTAGAGFVSSSASAQTVTVSDPAPVDVETTTSLSVPATATTGAAVDLTA
FT                   TVAPNNAVGTVQFKSNGTAIGSPVTVSGGTATLSHIFDAAGAQSITADFTAGSGFKNSV
FT                   ASAKSVQVSVADQESVVELNIPTDAKTGVATDLWATVRTSSDDAVGVGTVQFYDGGVAI
FT                   GGPEAVTAGAAGLSHTFTSAGAHSITAVYSGGAGVVGSSAQARTVNVTDPAPSDVTTET
FT                   VVTVPADGVVNKSVTLSATVSSVQNGGTVQFMDGDTPIGDAVPVVNGIAALNHTFTTTG
FT                   AHSISAIYSGAAGFTGSTSAAHAIQIKAATGGGTGSLGSGSAGSSDFLPFGS"
FT   CDS_pept        complement(224755..225390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30907"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT0"
FT                   /protein_id="BAH30907.1"
FT                   /translation="MPGNPAAAPALAAWATDLVSLDVDALTNACWTMPPTTIADRYSDV
FT                   PAILTAIAAPGVDGQYAVTWSGGGLSVAAKRSEIASGYACPFVFPAGQSNFYTAADASH
FT                   AVVRFLSRATGRPVNTRDVETFYPLICPGNSPWDPDGTGATGQPPLKLDPNQLAGIKSF
FT                   DADAATVTPVRGDYVRVTLPVSDGTGNSRPMQFTLSIGPEGYCLGAAT"
FT   CDS_pept        225419..225625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30908"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT1"
FT                   /protein_id="BAH30908.1"
FT                   /translation="MAGAVVVVGARGVVVVVSVVGGDGSSVRIPVRPSSSHAVIANVMA
FT                   SATAPTAARPADFIRSYAPFATF"
FT   CDS_pept        225688..226443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02010"
FT                   /product="putative acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30909"
FT                   /db_xref="GOA:C0ZLT2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT2"
FT                   /protein_id="BAH30909.1"
FT                   /translation="MDPVYRTVIGIARTVFAFEGLKFSVKGEQNIPASGGAVIAINHTG
FT                   YMDFTYAGLPARTPKRYIRFMAKKEVFDNKISGPIMRALKHIPVDRGAGADSYKAAVDF
FT                   LKRGELVGVYPEATISRSFEIKEFKSGAARMAIEAGVPIVPVVIWGAQRVWTKGYPKRL
FT                   GRTNTPISIAVGEPIAPFEPASELTAKLRSTMQELLLDLQKDYDHPAGEYWVPARLGGS
FT                   APTLEQADKMDADEAEAKAKAREARKSEG"
FT   CDS_pept        226447..227181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02020"
FT                   /product="putative acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30910"
FT                   /db_xref="GOA:C0ZLT3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT3"
FT                   /protein_id="BAH30910.1"
FT                   /translation="MSFEPVYTAVEVVARGLSGFQGVKVTRTGTEHVPVSGGAVIAINH
FT                   TSYLDFIPAALAVGTAKRKLRVMAKAELADNKVLGFLMRGCGVIEVDRSAGAQAYRAGV
FT                   DALKRGELVGVYPEATISRSFEIKEMKSGAARMAIDAGVPIIPLIVWGAQRIVTKGGPK
FT                   NLGRNHFPISVEVGAPIDPVEPAEALSEILRIEMDAILRHVQDGFVHEPGAYWVPRRLG
FT                   GGAPTPAEAAAMDAQERAKRAR"
FT   CDS_pept        227217..228056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30911"
FT                   /db_xref="GOA:C0ZLT4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT4"
FT                   /protein_id="BAH30911.1"
FT                   /translation="MSPDRRISPDRPTLVATDVDGTLIDHDELVSARTRAAVHAVVESG
FT                   TPFLLATGRPPRWISPVVEGLGYAPLAVCANGAVVYDSYADRVLSAATLSVDALTELSE
FT                   LALVALPGSGLAAERVGESAHDAATPQFVSSPDYEHAWLNPDNTEMSEDEVLAAPAVKL
FT                   LIRRPGMTSTAMYDTLAPHVGALADMTYSTENGLIELSAPGITKASGLVAAAERFGFDL
FT                   SGLVAFGDMPNDIPMLGMARLGVAMGNAHPEAKAAADEVTDTNSAHGVAKVLERWWS"
FT   CDS_pept        complement(228094..230091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30912"
FT                   /db_xref="GOA:C0ZLT5"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT5"
FT                   /protein_id="BAH30912.1"
FT                   /translation="MPHRRPKPSLVLGAVAAVAVASPFAVYGFTSTTSDVRSANETTSV
FT                   AVPTQIAEVLLASVPDIIIPVKELTGLDLPDINLGDLRNLKLPTEIPLPPGITLPTELF
FT                   PAPAAPGAPTETAPVPSEEEPGAVVKEVTRDTPFSMVALTSDTLASAQSKVRALAEDGT
FT                   WGPWFTPDAIDSASSDQATNAGTATEPVFVGATKSIQILTPQGVAAPAVEAVPAPEAAP
FT                   APVEAPAEAPVPAEAPVPAEAPAATGELGYTPASVSKPLRQATTAADAVTAVLIDPGTS
FT                   DADSNLQAVAAPLGGSGPSVITRAQWGADESLRCDSPTYDDFTGGATVHHTAGSNNYTK
FT                   EESAGIVRSIYAYHARTLGWCDVGYNVLVDKYGQTFEGRAGGLDKAVQGAHAGGFNENT
FT                   TGIAMMGDYSTVEPSQATLNAVGKFLGWKLGLAGLDPKGRTTMYSEGTEFTPYPQGAAV
FT                   DLPIIFAHRDVGNTACPGDAAYAHMNDIRNIAAANIGGSLNPSNPSNPSTPAPKPTTPV
FT                   DTVTGGTGSSIPDLVTQILKITDNSPLAQKWIAEGGDLGRLGQALSGILQAKLGNQGAL
FT                   FQNGAVYTSPNGGVFTVLGEIFKSWQSFGSDAGELGLPISDEYSIPDGLRSDFENGSLI
FT                   FNQIAGMVTKVLKTYNETFAQEMANSAPVG"
FT   CDS_pept        230522..231985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30913"
FT                   /db_xref="GOA:C0ZLT6"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT6"
FT                   /protein_id="BAH30913.1"
FT                   /translation="MRVSILGLVPALALGVAIGGFTQIRADEPSILHAVAADTQFTLSG
FT                   HGNGHGRGMGQWGAYGYAKNDGWSGERILSHYYGGTVLDSLPPAQMSVRLTAQDNSTLD
FT                   VYSDAGLVVNGQRTAPGEAAHLTALPGGGAQVVVTSGCGGGVVWEAVTEHPWVDPVDLG
FT                   PDRPADQFLKLCNNDAPYRGALGVVLDNGSARTVNLLDMEDYLLGVVPVEAKAEWADSG
FT                   GAEALRAQAVAARSYAATEHRSSYADTCDTQDCQVYGGAGKEDPRTTEAVRSTAGAVLS
FT                   RDGKIVATEFSSSTGGYSSGGEFPAVEDLGDALSPNHDWTVNLTAGEIADAFDVGELQS
FT                   LKILSRNGFGTDGGRVTAVEVVGTDATVGATGMQFRQKLGLKSDWFTVGDGAGVVVAPD
FT                   SESTVPESNSPSDDPSGTVTETQIEKKYRELGGESGSLGAPAGPEMQLPSEAGTFRVYE
FT                   NGTIIWTKVLGAQVVDANVLREWIPTGGS"
FT   CDS_pept        complement(232088..233611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02060"
FT                   /product="putative CdaR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30914"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT7"
FT                   /protein_id="BAH30914.1"
FT                   /translation="MASRRCQTGPMPITLRQLCATEQFGLRVLAGHDQLDRTLTWAHVS
FT                   ELPDPTPFLDGGELLLITGVSLPTTAAETTRFVRTLVAAGIAGIGFGTGLGYEQAPQTL
FT                   VDAATRFSVPLLDVPLRTPFIALTKAVSKAQSDDDMKALRSNYQSLRRLLQAAVTVNGT
FT                   RAVVRRVAELIGGWAALLDSAGHTVEISHTAAAAGIERTAPERDARPMEVSFLTSENED
FT                   VISHPLMTSRGKLMGYLVAGCPGAVGSLNQGIVIAAASLLTLMTARTRDAQLTMNHLRT
FT                   VAMHQLFEGQNALARNISGELWGGFPVEPFQVFHVAGPSGLLESVSVSLLDGLSRDLAF
FT                   GITDGALIAVVSATDSGRILARVNEIDVTVGVSDMLWWDDLSRARRQAAQAAAEAGARN
FT                   LPSMRFAELSESGLSAFLDQDRSTAFAAAHLRPLLEAKGGSDLYRTLAMWLAHNGVGDA
FT                   AATALNIHRHTLRSRLARIESLLQLDLGSPTERAELWLEYRLLGDAPTI"
FT   CDS_pept        233753..235174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="RER_02070"
FT                   /product="gamma-aminobutyrate permease"
FT                   /note="protein synonym:GABA permease"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30915"
FT                   /db_xref="GOA:C0ZLT8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT8"
FT                   /protein_id="BAH30915.1"
FT                   /translation="MSSTDQPALQHTLKKRHLSMIAIAGVIGAGLFVGSGVAIQETGPG
FT                   VLVSYALAGVVVILVMRMLGEMSAASPETGSFSSYADKAIGRWAGFSIGWLYAWFWIIV
FT                   LGIEATAGALIMNRWVPGVPQWTWALILMIVLTLTNIISVKSFGEFEFWFASIKVVAII
FT                   AFLGMGIVAICGWMPGVEAPGMTNLTGHGGFLPNGTGAMLAAVLVVVFSFFGAEIATIA
FT                   AGESANPLEAVRAAVKSVVWRILIFYIGSIAVVVTLLPWDSASVALSPYVAVMDSYGIP
FT                   AAGNIMDVVVLTSVLSCLNSGLYTASRMIFSLAGRGDAPKSLSRIEKTGVPMRAVLVST
FT                   IVGFLTVGMNYLSPDKVFLFLVNSSGAIALFVWLVISVSQLRTRRKLEASGQELELKMW
FT                   FFPYLTYATIAAIIALCIGMLTLDSTRSQMIVSLGLAAILVGIGLYRYRNHKETEDAER
FT                   ADAEVVPVSESAPTP"
FT   CDS_pept        235253..236446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02080"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="protein synonym:acyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30916"
FT                   /db_xref="GOA:C0ZLT9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLT9"
FT                   /protein_id="BAH30916.1"
FT                   /translation="MGTIMTTPEPIVIVDGARTPVGSFGGVFKDVPAHELGAAAAKAAL
FT                   SRAGVAPEDIDEVVMGCIGQVGPDAYNARRVGIAAGLPENVPAYTVNRLCGSGLQAVWS
FT                   AAMQMRWGAAAITLAGGDESMSRMPFYDFAARSGYKLGDRSLVDGTVAMLTDPFSKAHM
FT                   GRTAEAVARKYGVSREQQDEFAVESQRRAATDAAKAAFAEEITPVETGGRRSVTVTEDE
FT                   HPKPGTTVETLAKLRPAFEEGGSVTAGNASGINDGAGALVLATGTEAAKRGLTGLVTLE
FT                   TVTTAAMEPGLMGYAPVLALEKLFAQTGLKPSDIGTAEVNEAFASQAIAVIRDSGLDPE
FT                   KTNPYGGAIALGHPVGATGAILTLRAARDMVRRDLEFGIVTMCIGGGQALAALLKRV"
FT   CDS_pept        236449..237600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="RER_02090"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30917"
FT                   /db_xref="GOA:C0ZLU0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU0"
FT                   /protein_id="BAH30917.1"
FT                   /translation="MVTKRKPSWHDDEITAVAELARGFFDRELIAKREQWDAQHRVDRS
FT                   VWLEAGKLGLLCCSIPEEYGGGGGTFAHDLAVFEAQGYCGDYALGNSVHSGIVAHYVLE
FT                   YGSEEQKKAWLPGMATGEILGAIGMTEPGTGSDLKAITTSATRDGDHYVVNGSKTFITN
FT                   GGSADMIALAVKTDPKAGAKGVSLLIVDLRDCEGFAVGRVLDKVGQHGADTSELSFTDV
FT                   RVPVSNLLGESEGLGFGQLMAQLVQERLIIGAQAIGTIERAVEETVAYTKARQAFGHNL
FT                   FEFQNTAFELAECQTIARTCRVFLDNCIEDHLNGELDGADAAMVKYWLTEQQCAVVDRC
FT                   VQLYGGYGYMREYPIARMYEDSRVQKIYAGANEVMKGIIAKSL"
FT   CDS_pept        237711..238634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30918"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU1"
FT                   /protein_id="BAH30918.1"
FT                   /translation="MSFTIDVGSARVTQLTELAHWPFPPRELFPHAGDAEIEDASARLT
FT                   PEFFDAGSGDLVLAIHTYLVEIGGKAIVVDTGNGNSKHRPNLLPHHMFGTDYLSRFADT
FT                   GVDVGDVDLVVSTHLHPDHCGWNTNLEAETWRPTFPRATYIFDRTELAALEQLAADGPH
FT                   EGVVSDLAQTFEDSVRPVLDGAKWEAVDDGHVLAESEGTRVVVRSAPGHTPGHVVIEIR
FT                   TADGGAVIAGDVIHHPIQFLYPDLSQGGDADPEIARVTRRELLERCASEGLLLLPAHFP
FT                   VDEPITIEFDSSGAPSASGLIGLATS"
FT   CDS_pept        238704..239918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="RER_02110"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30919"
FT                   /db_xref="GOA:C0ZLU2"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU2"
FT                   /protein_id="BAH30919.1"
FT                   /translation="MTAANSETARAQYDLIVVGSGFFGLTIAERAATQLGKRVLVLDRR
FT                   HHLGGNAYSEAEPETGIEVHKYGAHLFHTSNKKVWDYVTQFTEFTNYQHRVFALHKGQA
FT                   YQFPLGLGLVSQFFGRYFTPEEARALIAEQSSEIDSKDASNLEEKAISLIGRPLYEAFV
FT                   RDYTAKQWQTDPTELPAANIARLPVRYNFDNRYFNDTYEGLPVDGYTAWLENMAKDPKI
FT                   EVRLDTDYFDVRDELRTASPEAPVIYTGPLDRYFDYSEGSLGWRTLDFETEVLPTGDFQ
FT                   GTPVMNYNDADVPFTRIHEFRHFHPEREYPTDKTVIMREFSRAAEAKDEPYYPINTPED
FT                   REKLSAYRSRAKKETAENKVLFGGRLGTYQYLDMHMAIASALTMFENTLRPHLETGAEL
FT                   AGESE"
FT   CDS_pept        239966..241828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glfT"
FT                   /gene_synonym="glfT2"
FT                   /locus_tag="RER_02120"
FT                   /product="galactofuranosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30920"
FT                   /db_xref="GOA:C0ZLU3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU3"
FT                   /protein_id="BAH30920.1"
FT                   /translation="MTYLGKSLLQRIILPRAGEPLDVRTLYLEESWSNSRRAHSTSRTS
FT                   VALGAETEVSFATYFNAFPASYWRRWSILKSVVLRLELSGHGRVDVYRSKADSSRIHVE
FT                   GKEFADGDAAVEFEVELAPFEDGGWIWFDITTDTAVVVESGGWYAPVEAPGEATVAVGI
FT                   PTFNRPTDAVKALAALSSDPLVSDVIKAVIMPDQGTRKVRDEPGFAEAAAALGDRLAIH
FT                   DQGNLGGSGGYSRIMYEALKTTQCQHILFMDDDIEIEPDSILRALAFSRFAKSPMLVGG
FT                   QMLNLQERSHLHVMGEVVNRGIFMWSAAPNVEYDHDFSKNSLRDSKLLHRRIDVDFNGW
FT                   WMCMIPRQVAEELKQPLPLFIKWDDCEYGLRAKEAGYPTVTLPGAAIWHMAWSDKDDAI
FT                   DWQAYFHLRNRLVVAALHMPGNGRGLVVNTVKATLKHLLCLEYSTVAIQNKAIADFLAG
FT                   PEHVANMLPTALGEVHAQRKEYPDAVVVPSATALPLPSGAEVGDVSAPTNPVAKIVRVG
FT                   KAVVHNLKPAHPEHHERPQLNVPTIDARWYLLSQVDGVTVTTADGRGVVYRKRNPKQAL
FT                   ELLKEAMRLRRELAARFPELKKQYQDAVPSLTSTERWERVFGIS"
FT   CDS_pept        241899..242342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30921"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU4"
FT                   /protein_id="BAH30921.1"
FT                   /translation="MSHFGEHALGWIAIAAVGAAVDKPRRREWAGAAVGAFGAHAASVV
FT                   IKRVVRRKRPSDPSVQVNVSTPSKLSFPSSHATSTTAAAVLIGRLTGLPLPALLVPPMM
FT                   LSRLVLGVHYPTDVLAGAALGAASAAVVRRVEEARAEQKCGDK"
FT   CDS_pept        242339..243244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02140"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30922"
FT                   /db_xref="GOA:C0ZLU5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU5"
FT                   /protein_id="BAH30922.1"
FT                   /translation="MSEEPATVSGPPKSLPAGIVKALRPRQWVKNVLVLAAPIAAGTAT
FT                   EADVLLPVALAFVVFCMAASGIYLVNDAMDVEADRAHPTKRFRPIAAGVLPVNIAYGMA
FT                   VVLLAGAIGLSFLANWQLAVVMGVYIVIQLAYCFGLKHQAVIDICIVSSGFLLRAIAGG
FT                   VAAEIDLSQWFLLMMAFGSLFMAAGKRYAELQLAEKTGAKIRKSLESYTMTYLRFVWTM
FT                   AATTLVLCYGLWAFQQDAIKGTNWYAISMVPFTIAVLRYAVDVDGGEAGEPEEIALGDR
FT                   VLQLLAIAWIGVVGVAVYLV"
FT   CDS_pept        243324..245141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aftB"
FT                   /locus_tag="RER_02150"
FT                   /product="arabinosyltransferase AftB"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30923"
FT                   /db_xref="GOA:C0ZLU6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU6"
FT                   /protein_id="BAH30923.1"
FT                   /translation="MVLAAALMFWGAWERRWIADDGLIVLRTVRNLLAGNGPVFNAGER
FT                   VEANTSTAWTYIVYAFSWLTQIRLEYVVLTIALVLSTAAVVLAMLGTGRLYRGVRQSAG
FT                   GTILLVPAGVLVYIAVPPARDFATSGLETCLVIFWIALLWLLLVRWAQASTPSTASILT
FT                   LSFVAGLGPLVRPEMAIPGAAALMMIVLSAGLTWKIRALIVVVAGLVPVGYQIWRMGYY
FT                   ALPYPNTAVSKDAGGAKWAQGFAYLWNLVGPYLLWLPLLFLLIGALLLVWRSRADAPAT
FT                   ATDQPARSLWQRFQQFLRTPRAVVTFILGSGLILGIYSLRVGGDFMHGRVLLPVLFCLL
FT                   IPVAVIPLRVPARAAFGSNRDTAIFGVSAVLWIGTIIWAFFAANTTGMPEGSVVGRSGI
FT                   VDERAFYALNTGHKHPILAEDYLDYPRMRAMVETIARTPEGGLLLPSASYDSWFVVPPP
FT                   GPLEEPAEHVVFFLNLGMTSMNVGLDVRVLDQMGLAYPLAAHTERLEDGRIGHDKNLYP
FT                   DWVVADTGMIDVRPWLPFFLDEDWVADAKLAITCPETQELLTSYRSELTWARFKQNFQQ
FT                   AFDFAKYRFDRVPAYELERCGLVPPEPPK"
FT   CDS_pept        245473..246483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02160"
FT                   /product="mycolyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30924"
FT                   /db_xref="GOA:C0ZLU7"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU7"
FT                   /protein_id="BAH30924.1"
FT                   /translation="MRFARKRLTQRLKHRALAIGAAALVLPLAAGVAGSAVASAAPAHT
FT                   APSHTAPSGGYDELWVPSSMGNIKVQVQWAARGGNAALYLLDGLRARNDANAWSFETNA
FT                   MDQYRNDNITLVMPVGGESSFYSDWYAPSNFNGQQITYKWETFLTQELPNFLANYGVSP
FT                   NNNAVLGLSMGGSAALTLAAYHRDQFKFAGSLSGYLNISAPGMREAIRVAMLDAGRFNV
FT                   DSMWGPPWSPSWLRNDPFVFAPRLQGLSMYISSASGLPGEYDHPRAPIDYYNTANGMGL
FT                   EALALVNTRAFQIRMNSLGIPATYSFPSNGTHSWPYWSAELWKARGQILDTMNAW"
FT   CDS_pept        246737..248620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csp1"
FT                   /locus_tag="RER_02170"
FT                   /product="mycolyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30925"
FT                   /db_xref="GOA:C0ZLU8"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU8"
FT                   /protein_id="BAH30925.1"
FT                   /translation="MRVGLATEDRRRSRATFRTKVVGALAAMLVLPIAAGLTTAGTAAA
FT                   APAPAQAAPAVTQNPTGAAVTKVDWLSERRVALWVNSPAMGTPIQVQILLARDWNVNPS
FT                   ASFPSVWMLDGLRATDNENAWTYETDAESFYADKNVNVILPVGGQSSFYSDWLEPDNGK
FT                   NYQWETFLTKELPPILEKDWRTTQTRGVVGLSMGGTSAMFLTARNPGFFKFAASLSGIL
FT                   TTTSLGMPQAIQFAMTDAGGYNSAAMWGPPSNAQWAAHDPYALAEKLKGVSLYVSSGSG
FT                   TTGPYDQPSGIPGVSTNYAGMGLEILARLTSQTFATKLNQLGIPAQVNYRPSGTHSWPY
FT                   WQFELHQLWPQLANAIGVEVEKPACGTSGEIGATAAANGWIGDCITPEYSVAGGLAQDF
FT                   RNGRIYFTSGTGAQPVAGRIAGAYMNTGAAAGPLGFPRTPELGTPDGRGRFNHFQNGSI
FT                   YWTPQTGAHPVSGDILAEWSAQGWEGGPLGYPTADEIATPGKPGKVQGFEIGAMYSSAN
FT                   GTHAVLGMIMGKYGELGWENGWLGFPKSNEVPIKDNGRFTEFEGGNIYWSPGTGAWSVE
FT                   NGPLFDGWKSVGYEGGRLGFPISDKFDIPGGVQQNFQFGYITVIGDKTEVH"
FT   CDS_pept        249288..250241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30926"
FT                   /db_xref="GOA:C0ZLU9"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLU9"
FT                   /protein_id="BAH30926.1"
FT                   /translation="MARSGKRRGCLIPLLIILVVAAVVIGGWYILAGRVPSPTPIPPSP
FT                   EPPVSQPASCPDVQVVAIPGTWESSATDDPYNPTANPASLMLNVTRPLQEKFDSSRADV
FT                   YTVPYVAQFSNPVAIPPDGQQSYNNSRAAGTAATNDFLMKRHAECPLTSYVLTGFSQGA
FT                   VIAGDVAASIGDGTGAVPADLVLGVGLIADGRRDPAFGNTVGPSVAGVGAELSLNGLKL
FT                   PGLTMTGPRPGGFGDLNDRTYQICAPSDGICDAPAAALNPTNWLSSAPRLLEYYNNPVH
FT                   AMYNSFQVDPNGTTATQWMAQWAAEKIDAAPTPPHS"
FT   CDS_pept        250448..251443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02190"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30927"
FT                   /db_xref="GOA:C0ZLV0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV0"
FT                   /protein_id="BAH30927.1"
FT                   /translation="MSSTHGSDALRKFRFAAGGEGNAEEGGARRFVKLAQKAEELGYDS
FT                   FMIPDHLGNQVGPIAALGALAVATDKIRLGTAVLANGFRHPAVLAKDAATIDVLSGGRL
FT                   ELGIGAGWMKEEFDKGGIAYESPGVRIEKLEESLQILDTLLRGQECTFEGKHYQVRGLK
FT                   GSPRPRQGPRPPIIVGGGGPKMLALAAKYADIISVATPTNRDGRLLLSGITMEKTIERV
FT                   ERIREAAGERFDEIELNWTITMIMITDDREQAAEMAIAALDQGFPPNIEVDRKLSVEEL
FT                   LNSPYLAVGTFEEIADQIRLVREKTSMSYVGVFPTQMEAFAPIIPLLAGE"
FT   CDS_pept        251626..253515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD32"
FT                   /locus_tag="RER_02200"
FT                   /product="probable long-chain fatty acyl-AMP ligase FadD32"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30928"
FT                   /db_xref="GOA:C0ZLV1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV1"
FT                   /protein_id="BAH30928.1"
FT                   /translation="MNALFDGFLDEKGQIRLQPGFTLVDYVEQHSRVNADELAYRYIDY
FT                   SRERDGEALELTWEQFGVRLRAVAARLQQVTKRGDRVAILAPQGLDYVISFFAAIQAGS
FT                   IAVPLFDPDEPGHTDRLHAVLGDCKPTAILTAASSAAGVRQLFRSLPAAERPRIIAVDA
FT                   IPDTVGETWVRPDIELDDIAYLQYTSGSTRVPAGVEITHRAVGTNALQMVDSIELNEDS
FT                   RGVTWLPLFHDMGLLTVILPALGGKYITIMSPRAFVQRPYRWIKELAAVSDGAGTFAAA
FT                   PNFAFEHAAARGLPKDGETLDLSNVIGLINGSEPVTTSSMRKFNDAFAQYGLPKTAIKP
FT                   SYGMAEATLFVSSTKHSDEAKVIYVDRTELNKGRMVIVDQYSENAIAQVSCGYVSRSQW
FT                   AAIVDPETLTEVPDNHVGEIWLHGENIGIGYWGRPDETAETFHNKLDNRLSEDSHTEGT
FT                   PADANWMRTGDFGVYVDGELYITGRVKDLVIVDGRNHYPQDLEASAQEASPALRPGFIA
FT                   AFAVPANQLPSVVFSNTHSGLKFDDDDSSEQLVIVAERAPGAGKADPQPIADTVRAAIS
FT                   SRHGVTARDILLVPAGSIPRTSSGKIARRACKASYIEGTLRGGYQQTAFPDSV"
FT   CDS_pept        253553..258496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pks13"
FT                   /locus_tag="RER_02210"
FT                   /product="probable polyketide synthase Pks13"
FT                   /note="protein synonym:type I polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30929"
FT                   /db_xref="GOA:C0ZLV2"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV2"
FT                   /protein_id="BAH30929.1"
FT                   /translation="MVEQDGVQSKDVVSEMSVAQLREWLRNWIADATGQPVSTIVDDRP
FT                   LDEFGLASRDAVALSGDIEDLLGVTLTATIVYQHPTIASLATRIIEGEPEAPEETVDAS
FT                   YYVSGATTDAHDIAIVGLSTRFPGAGHTPSDMWEMLAAGRDGISDLPEDRWAEFMSDPA
FT                   IKAAVENANTKGGYLDDVKGFDAEFFAMSPLEVVNVDPQQRLALELAWEALEHARIPAS
FT                   GLKGKQVGVFIGSSANDYQLLAVSDPTTAHPYALTGTSTAIVANRVSYFFDFRGPSIAL
FT                   DTACSSSLVAVHEAVRSLRSGDSNIALAGGVNMLLAPPGTLGFDQTGMLAPDGKLRAFS
FT                   AHAQGIVRSEGGGLVVLKRLEDAERDGDSILAVIAGSAVNQDGRSNGLLAPNPDAQADV
FT                   LRFAYRDAGIVPTTVDYIEAHGTGTDLGDPIEADALSRVVGRGRDDDKPALLGSAKTNF
FT                   GHLEAAAGAAGLIKVVLAMQENKIPATINYLGPNPHIDFEKAHLQVTPEATDWPRYTGK
FT                   AVAGVSGFGFGGTNAHVVVKEYVPADVAVDEPVVDAPVADEPAAEDESTVVLAVSGALP
FT                   SRRRRAAADLADWLETEEGSKTPLADVARTLARRNHGRSRAAVLAKTRSEAISSLRAVA
FT                   AGKPAQGVFSADSPSPKGAVWVFSGFGSQHRKMAKQLYTENAAFKAAVDEVDALIQDEA
FT                   GYSMVEMFLDDAIEYNVETAQVGIFTIQVGLAALLRHHGAEAEAVVPHSMGEAAAAYVS
FT                   GGLNLEDAVRVICSRSRLMGEAEGALVGDDIRLMALLEYSASEIEALLPTYPKLEVCVY
FT                   AAPTHTVIGGPQPDIEAIVAAAEADGKMARVLQTKGASHTSQVDPLLGELAAELAGIEP
FT                   TTLKLGVYSSVDKDTFYRPGHEPIHQEAYWVKGLRHSVYFTNAVRGAVAHGHTTFVELA
FT                   PNPVTLMSVAATAFDSGLHDMELIQTLKRKEDESAGVLAALAQLYVHGHAVNLESLLPA
FT                   GDFASVPRTAFLRKPYWLDIRVSAGGSARVPGSHVALPDGRHVWEVDASAVTDLAVLVS
FT                   AAAGQVLSDVALTAAVPHGELAGAATLTTTLNPHPGGASVQVHAREGSTFRLLFDAVVT
FT                   SGEPLPELVISAPVKTSAPMETLAEVVEDAGDKWDPNGSQSLDDRLKIVVAESMGYSPE
FT                   DLPAEVPLIELGLDSLMAMRIKNRVEYEFDIPQLQLQAVKDASLNEVNKYLRYAIDNRE
FT                   EVQAMADKQAAEKLAADAADEDAAPAEESVELPATAPVAAAPSDPSRAGTADDAGSDVP
FT                   PRDAAERLTFATWAVVTGKSAKGIFNDLPIVGDEVAEKLAARLSERAGGEITLDDVLDS
FT                   TTIEELADVVRQYLEDDGKIDGLVRTLRARPEGSTAVPVFVFHAAGGSTVTYEPLLKRL
FT                   PAGTPMYGFERVEGSIETRAAAYVPLLREIQGDGPYVLCGWSFGGVMSYAVAKLLREQG
FT                   ADVRVVGLLDTVMAGEVVPDTEAERRKRWERYGKFAKRTYNLDVPLPLDVLASTEADED
FT                   QIQILMDMIKMSGAKIPGGIIEHQRTSWLDNRAIQTAEFSSYDGDVVLYMADKYHDELM
FT                   TLEPAFKTRKADGGWGDYVKNLEVVYIGGDHLQIVDEPYIAKVAADLTTKLAQIETAQT
FT                   KAAETGVQK"
FT   CDS_pept        258493..260034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /gene_synonym="accD4"
FT                   /locus_tag="RER_02220"
FT                   /product="probable acyl-CoA carboxylase beta chain"
FT                   /EC_number="6.4.1.-"
FT                   /note="protein synonym:carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30930"
FT                   /db_xref="GOA:C0ZLV3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV3"
FT                   /protein_id="BAH30930.1"
FT                   /translation="MTTTTAEKLAELREKLEKAKEPGSARAIAKRDAAGHSTPRQRIDM
FT                   LLDPGSFVEVGALVKMAGEDNPYSDGVMTGHGTVDGRPVAVFAHDQTVFGGAAGEMFGR
FT                   KVAAVNDFALKVGCPVVGINDSGGARIQDAVSSLAWYANMGSRQEPLSGVCPQISVILG
FT                   KCAGGAVYAPINTDVVVATEESYMFVTGPDVIKSVTGEEVSLEDLGGARKQAEYGNIHH
FT                   VAPDEKAAFDWVREYLSFMPSSCTEKAPLINPGLEPEITESDLELNAFMPDADNAGYDM
FT                   HDIILRIFDDGTFHEIGAQVAHNVITGFSRVDGLPVGVVANQPTYLSGALDADSSDKAA
FT                   HFVRLCDAFSIPLVFVVDTPGFLPGVDQEKVGVIKRGGRFLFAYIEATVPKVTVVVRKA
FT                   YGGGYAVMGCKQLGADINLAWPTARIAVMGAEGAVNIMGRRQLAEAGENAPAVRAQLIN
FT                   FYNEFVATPYIAAERGYIDAVIEPSQTRLEIRKALKLLKDKTIFKNPRKHNLMPL"
FT   CDS_pept        complement(260031..260942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02230"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30931"
FT                   /db_xref="GOA:C0ZLV4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV4"
FT                   /protein_id="BAH30931.1"
FT                   /translation="MLNLERLRALHAVAENGSVAAAARTLHVTPSGISQQLNKLEREVG
FT                   VPLLEPQGRGVRLTEAGRILARRTAEVLSTLAQAEAEIASLQSEVTGRVRIGALVSPSR
FT                   TVLPRAIAEIRHAHPQLEITFNEGESEELLPALIRRDLDVVVVDSWSTLPVELPDGVSF
FT                   TPVYDDVALLALPASHPLAENKVVALSELSEHAWATWTRGTDFHTFTVRTLRAQGFDPR
FT                   IEYEVAEFPTQVEFVAQGLAVALIPRLARVVPPEGVRMLDTLPPLGRDIYLAWRTDSER
FT                   PAVLAAIEALRRQFDSLGDKKN"
FT   CDS_pept        261034..261966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02240"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30932"
FT                   /db_xref="GOA:C0ZLV5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV5"
FT                   /protein_id="BAH30932.1"
FT                   /translation="MTAQTPTPTRTPRGRIDPRLLVVGGAAAISISSLLIKLADVGPST
FT                   AVFFRCFLALPPLLWLAWREFRRVGKPSRRAVVLQVLGGLLLGLDFALWSQSILMIGAG
FT                   MASVVVNVQVIVVPALSWLVFGNRVPMRFVFALPFMFTGIALAGGVFGGGGTGDELLWG
FT                   TALSLVSGIAYGGYIFVVGRTGEADRAASQVLISTTSAGIAGSVIGSLWGRIDFVPGWE
FT                   AFGWLAALALVGQVFGWMLMGHSLPRLPAEVGATLLLMQPVLAVLLAVVLLGERPGVGQ
FT                   LLGCVVVVGAVSAVSIRRTRAVTRVGSAG"
FT   CDS_pept        complement(261963..265253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02250"
FT                   /product="arabinosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30933"
FT                   /db_xref="GOA:C0ZLV6"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV6"
FT                   /protein_id="BAH30933.1"
FT                   /translation="MTASPQTSSSPPPAGQDARERFHRTRWVAIIAGLLGFVLALATPL
FT                   LPVVQTTATVNWPQNGVIGDVEAPLMAQVPIDVNASIPCTAVSSLPEGGGILMSTAPAQ
FT                   GDGAALSSMFVRVSATSVDVLDRNVVVASAAREDVESSRCGAIAFSSDVNRTSAEFVGL
FT                   TYPDGNPIRGQLDGDFRPQVVGVFSDLPDGAAPEGLGFSMTIDSRFSSSPSVLKLVAMI
FT                   VAVLSTIVALVALARLDGTDGRKHRRFLPERWWKFSGIDGVVVGTLVVWHFIGANTADD
FT                   GYLLTMARVSPDAGYMANYFRWFGVPEAPFGWYYEVLAVMAKISTASPFMRLPALLAGI
FT                   LCWMVISREVVPRLGRAVRRSNVALWTGGLVFLSFWLAYNNGLRPEPIVALGALLTWCS
FT                   IERAIATGRLLPAATAILIGAFTLAAAPTGLMCIAALLAGVRPLVRIVVKRHRLVGTLP
FT                   LLAPIAAAGTIVLVVIFADQTFAGVMEATRVRTIIGPNLEWYQDFLRYYYLFVQTVDGS
FT                   VARRFAFLTMILCLFTTLFVLLRRGRVPGAATGPSWRLVGVVFGTMFLMMFNPTKWTHH
FT                   FGAYAGIAGSLAALTAVAVSASALRSRRNRSVFVAGLLLMLALTFAGINGYWYVSSYGV
FT                   PWFDKTISYDGRESNTLFLALFALALAFAAWQYLREGFAAPPEKPNTAKGRRIRKFAAA
FT                   PLTVIAGLMVLFEVLSLLKGAVSQYPAYSLGRSNIEALAGKTCGMAEDVLVETDVNSGN
FT                   LRPLPAPGFNAEDLLSGVDSKGFSPNGVPSDLTADYIEVKQGMGNTDSQSVGPTFATGS
FT                   GAGTSGGTGNLGVNGSTAKLPFGLDPSKTPVMGSYQPGVQEPASLISSWYGLPTRSEES
FT                   PLVVMSVAGRVWSVDNTGAITYGQSLLVEYGKTQPDGTVQVQGSYMPRDIGPAPSWRNV
FT                   RIPIDELAPDADAVRVVAFDPNLTGDQWMAFTPPRVPKLESLDSYIGSEQPVLLDWAVG
FT                   LQFPCQRPFTHQNGVAEMPNFRILPDRPLAVSSTDTWQSADNGGPLGFTEVLAGATTVP
FT                   TYLKDDWARDWGSLERYDRYFPNAVPAEVETGTATRSGMWMPGEMRVH"
FT   CDS_pept        complement(265339..268629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02260"
FT                   /product="arabinosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30934"
FT                   /db_xref="GOA:C0ZLV7"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV7"
FT                   /protein_id="BAH30934.1"
FT                   /translation="MPSEVVVPPKPVPTGPEAPRESDSQRVRTARLIAIVTGLLGLLLA
FT                   LATPFLPVKQEAASIDWPQGGTVNSVSSPLISYSPTSLDISIPCSTLGQLGGSGGTLLS
FT                   TMPNGAPDRNARGLTVRTTADRLEALTRDSVLISAPLDQLSGCTAITITTNSEQTVAAV
FT                   TGIDGVGTTLTGDYRPQVVGIFTDLQGAAPAGLSAHMDVDSRFSSSPTLLKLFAMIVAA
FT                   LSTIVSLYALHRIDGVDGRRARRFLPARWWKFTGIDALVIGTLALWHVFGANTSDDGYL
FT                   LGMARVSEHSGYMANYFRWFGVPEAPFGWYYDVLALFAKVSTASMWMRLPALIAGILCW
FT                   MVISREVIPRLGVAVRRNKVAIWTGGLVFLAFWLPYNNGLRPEPIIALGALLTWCSIER
FT                   AIATGRLLPAAMAVLIAAFSLAAGPSGLIAIGALIAGARPILQILIARGKRVGFLSQVL
FT                   PILAAGTVVLVAVFADQTLATVLESTRVRTAVGPNVPWFEERLRWDALMTISPDGSLAR
FT                   RFGMFVMIVGLVFCVMMILRKGRIPGTAIGPSRRILGIVFASLLLMQFTPTKWTHHFGV
FT                   YAGLAATVAVLAAVGVSASSMRSKRNRALFAAGILFILAVAFTSSNGWWYVSSYGVPWW
FT                   DKPPSIAGKGFSTGFLGLTILALLLAAWYHVMEPRERNGTEDSVKKTRRLRLLAPSPLT
FT                   IAAGAVVLFEVLSLLKGAVAQYPAYSIGKSNIESVFGGSCGLAGEVLVESDPNTGVLQL
FT                   VDRPTDLAGAGAFGASESTGFSPDGVAGDLTADAEDSTAGSANSLDTTTSQSGTTSTPG
FT                   TGSGTAGGSQSTSGVNGSNVALPFGLDPAKTPVLGSYGAPQNASLTTGWYSLPERNDAA
FT                   PLLTVAAAGRIRYVNSDGIVTPGAVLQVEYGKKQADGSVDALGRVDPIDIGPSPSWRNL
FT                   RVPMDQLPADADTVRLVASDTDISADQWLAVTPPRVPTMRTLQDVVGSTDPVLMDWAVG
FT                   LAFPCQRPVDHLYGVAEIPEWRILPDRIGAESTNAWQDHYGGGPLGWTSELLSARALPT
FT                   YLDNDWDRDWGSLEQYTPLDPDAVPAQMNVTTETRSGTWTPGPIRYQS"
FT   CDS_pept        complement(268679..268948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02270"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30935"
FT                   /db_xref="GOA:C0ZLV8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV8"
FT                   /protein_id="BAH30935.1"
FT                   /translation="MVRVPLTAEELERGLRLGELLRSARGDRSMVQVALDAGISVETLR
FT                   KIETGRIATPAFFTISAVAEVLGISLDTIARTLETPQSEQEVAS"
FT   CDS_pept        268998..269762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="RER_02280"
FT                   /product="probable methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30936"
FT                   /db_xref="GOA:C0ZLV9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV9"
FT                   /protein_id="BAH30936.1"
FT                   /translation="MVEIKTAGEIDAMAAAGRITAQALAAAREAASVGVTLLELDAVAA
FT                   EVISAAGASALFLNYRPATAPIPFPGVACISVNDAVVHGIPNGYRLRDGDLVSIDCGAR
FT                   LDGWCGDSAISFTVGQGSSEDQALIDATDEALARGIAAAQPGNRLGDIGAAIGQYARGL
FT                   GYGMLADHGGHGIGREMHEGPDVPNEGRAGKGFRLRPGLVIAIEPMLIADGTDDYRHDA
FT                   DGWTLRTVSGARAAHSEHTVAITEDGPVIMTR"
FT   CDS_pept        complement(269772..271604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02290"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30937"
FT                   /db_xref="GOA:C0ZLW0"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW0"
FT                   /protein_id="BAH30937.1"
FT                   /translation="MTETLPDVQLLEEARPGRVRSAVRRSVVQRGRLVDLAIMATFTVA
FT                   AIYVMSNLWSDLQSGYLFNAGRDQAMWEWFFADTAHALAQFRSPLFSDLQNYPLGVNLM
FT                   ANTAMFGISIPLAPITLIFGPTATYAIGLTAGLGGTAIAWYWAFSRHVLTGVSVRSKIA
FT                   AAVGAGFCGFAPAMISHANGHPNFVAFFVLPFIFLQVVRISNGKRPVRDGIVLGLLVAW
FT                   QIFLGEEPLLIFTMSAMVFGAAYALPGLAKSRQAIKRAMPGLVIGGAVTLLITAVPLWS
FT                   QFFGPASYDGVSHGQAGNDTAALTTFPTESVAGDPEGAEFRMNPTEENAYFGWPLVLLL
FT                   LGATVWLWRIRLTRAAAAVIVVMGVLSLGSELTIDGDKTGITLPWKLLADLPLFESVLE
FT                   SRFAMGAIPAIGLLLTLGTYRAFVELRGPRRTAAGVWLVALAVAMIPLIPTPIDADQRS
FT                   ATPEFITSGSWENYVSDGTLVTVPVASAEDARALSWQVDADFGFPIAGGYFVGPDSKTR
FT                   AGIYGAESRPTSTLLVNAKQTGKVPLIDVGTRANALTDLRYWHADVLVLPRFSGDDALR
FT                   HTVDELVGFDAKRVDDVWVWDVRDLVSGKTSNQS"
FT   CDS_pept        271922..272611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mspA"
FT                   /locus_tag="RER_02300"
FT                   /product="probable porin MspA"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30938"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW1"
FT                   /protein_id="BAH30938.1"
FT                   /translation="MGWCLCMSKTAVRSSAVGAVALLAVVLGGGTASAGVDNTSSITDV
FT                   KGNRIEVYQADTAIHVFPPLDSSPLSVEFFHDGVAGVKIDGPDAASFTGTKLTIGYQIG
FT                   YPIALTGATVVLNSPGLDWAVESGTNLGIGLVPDFELGLDISNGFAIGGDIIPSQELDV
FT                   DLAPGGITDVALLEDQEFDGPEAAVRLSGVHGYVQGAIGPVTIRPYAKAVTSNGDTVVT
FT                   YGVPQRL"
FT   CDS_pept        complement(272634..273260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30939"
FT                   /db_xref="GOA:C0ZLW2"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW2"
FT                   /protein_id="BAH30939.1"
FT                   /translation="MSELVTQSRELVPHRAVLDSAEHVLVIARGKPFGREQAFHEVLSV
FT                   AIRNRIEVLTLARALIDVSESRDYRAIPTDTAHTVAVLEWGELLEIPTEHHEKSRAESA
FT                   GDADETNDFDDPIEPEYLVETDVGGRVVFVALAFTIGGIVGFFAHDWALLLLITAVYLV
FT                   WIAARLVAKLVSVSRSAHWADAEPIRGTDSTTHNAERSHHHAVAA"
FT   CDS_pept        complement(273366..273974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02320"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30940"
FT                   /db_xref="GOA:C0ZLW3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW3"
FT                   /protein_id="BAH30940.1"
FT                   /translation="MTRTDARAAMIDAAERLVAERGLAALTLRDVQTEAGQANKSAAQY
FT                   HFGSREGLLAAVVESRMRPAGERRRELLDTIDLDPNPPTMRALVEALVLPLAEQTIYRE
FT                   GTLYARFLVQSIFDPAMSSTIRDHMQAESFREVQRRIVAASSLPAEIAELRAATLTVLA
FT                   VVTFATWEGRVDSRERAHVIVADLIESCLGALSAPAAQI"
FT   CDS_pept        complement(274048..275982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aftA"
FT                   /locus_tag="RER_02330"
FT                   /product="arabinosyltransferase AftA"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30941"
FT                   /db_xref="GOA:C0ZLW4"
FT                   /db_xref="InterPro:IPR020959"
FT                   /db_xref="InterPro:IPR020963"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW4"
FT                   /protein_id="BAH30941.1"
FT                   /translation="MPETTTAPSTELSTPSPWRNAAATVVEMALGALVAAVVAAVGLFA
FT                   FDRVQWPAFTSSNVTQAVTTVLQVLCIAVVGVAVLMFRARKAERVAKLLSWAGLSGFVT
FT                   TTLGLPLAATSLYLHGVSVDQQFRTEYLTRLTDSAALQDMTYVDLPPFYPAGWFWIGGR
FT                   VANLLGMDGWEAFKPYAIGSLAVVAVVALVLWTKLIRRDWAVVAALAVTAVVLAYNSPE
FT                   AYGAVINLLIPPVLILAWGALDRPGASRFAGAGAILGTGLFLGFAATVYTLYLGFAAFA
FT                   VTLMAVVAAVLAARAQNTWKAALGPLVRLAAIAVISGLVALTVWAPYLLKALSGATAES
FT                   GTAMHYLPDSGAVLPFPMLSFTLVGGLCLLGTVWLISRFLFSRRARALGIGVIAVYLWA
FT                   LLSMTFTVAGSTLLGFRLEPVLIGLFAAAGVFGFFEFAGWIVLATSENPRVKAVLVALG
FT                   VIGAIAFAQNIPQVLAPDIAVAYSDTDGNGERGDKRPPGAEANYADIDRIIREQLGREP
FT                   HDTVVLTADIGFLSFYPYFGFQGLTSHYANPLADFRARAALIEQWSELKTPDELIAALD
FT                   ASPWRSPDAFVFRQGADGYTLRLAEDVYPNDPNVRRYTVTFPKELFDDPRFTVTEQGPF
FT                   VVVTRSDAI"
FT   CDS_pept        complement(275992..276753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02340"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30942"
FT                   /db_xref="GOA:C0ZLW5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW5"
FT                   /protein_id="BAH30942.1"
FT                   /translation="MINAVGNPQTVLLLGGTSEIGLAICEEYLKKAPLRVILAALPGDP
FT                   GREAAVKQLEAKGATSVELIDFDAVDFESHPKVIDQAFSNGDVDVAIVAFALDGDSEEL
FT                   WQNQRKAVLVANVNYTASVSVGVLLGEKMKAQGFGKIIAMSSVAGERVKRANFVYGSTK
FT                   AGLDGFYLGLGEALAEFGPQVTVVRPGMVRTQFSAHVKEAPLTVNKDIVAKLAVAASDK
FT                   GKEIVWTPGPWRFVMMGLRHVPRPIFRKLPV"
FT   CDS_pept        complement(276750..278183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02350"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30943"
FT                   /db_xref="GOA:C0ZLW6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW6"
FT                   /protein_id="BAH30943.1"
FT                   /translation="MSTTAEETPQPALHTQARTLTGWGRTAATTAQVLSTPDVEVIANA
FT                   VAQVAEQNDSKPSHLRRGVIARGLGRSYGDPAQNAGGLVIDMNALSRIHRIDRDTALVD
FT                   VDAGVNLDQLMKAALPFGLWVPVLPGTRQVTIGGAIGSDIHGKNHHSAGSFGNHVVSLD
FT                   LLTADGKVRTLTPRGGRNDPKAALFWATIGGMGLTGIILRATIKMTPTETAYFIADGDV
FT                   TNSLDETIALHSDGSEANYEYSSAWFDAISAPPKLGRAAVSRGSLAKLDQLPAKLQKNP
FT                   LAFDAPQLLTFPDVFPNGLANKFNFTAIGEVWFRKSGKYRGKVQNLTQFYHPLDMFGEW
FT                   NRAYGSNGFLQYQFVVPPEAVDEFKKIIVDIQRSGHYSFLNVFKLFGEGNQAPLSFPIP
FT                   GWNICVDFRIKPGLNEFVTELDKRVLEFGGRLYTAKDSRTSAETFHAMYPRIDEWIATR
FT                   RKYDPTGVFASDMSRRLEL"
FT   CDS_pept        278337..278720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30944"
FT                   /db_xref="GOA:C0ZLW7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW7"
FT                   /protein_id="BAH30944.1"
FT                   /translation="MDLKTQIVRFVATGGLSAVVDYGLYVLLLALGLPRVAAKSLSFVA
FT                   GTTTAYLINRRWTFKAEPSRARFIAVVALYAVTFAVQVGLNELMVHVFDEHWWRTPLAF
FT                   VIAQGTATVINFIVQRAVIFKIK"
FT   CDS_pept        278775..279701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30945"
FT                   /db_xref="InterPro:IPR032557"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW8"
FT                   /protein_id="BAH30945.1"
FT                   /translation="MIIVLDSSALTRGARFDAAIADARALGHRVVVPRLVVLEVASRYR
FT                   EESAEMIAALSVQARMYDRLGLRRDLTRFVDAAHDKADGYVDDVIEDLVAIGVEVVDPV
FT                   DVSHLEVAERAISLRRPYTDKKKRDGYPATLNWLTVLDLADRNPEVDVIWVSTDARAYG
FT                   DGEDGVWHADLARELASRGLEYRVRWASDIPVIDGPVQVEQVSEVAEVVPEAPVAQGFV
FT                   EPEAVVPTEIPEPEVPAAPVVPEAPASAPAPKPVQRAARTRVAPQRIEPAPKAQSGGLR
FT                   GLGKVIGGRKRKVTIVDDLDEVDLFGA"
FT   CDS_pept        279859..280719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02380"
FT                   /product="putative carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30946"
FT                   /db_xref="GOA:C0ZLW9"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLW9"
FT                   /protein_id="BAH30946.1"
FT                   /translation="MRRAAVLDSAAGVRIPSGIDREAIRFPGFDGELVRTAGSTADLRE
FT                   GVVLYLHGGGFMCCGLNTHRPVVASIAKRTGLPVLHIAYRQLPSTSISGSVDDCLDAYR
FT                   WLLDQGALPEKVVFVGDSAGGFLVFVTALAAVSAGLEVPAGLVGLSPLLDLDCTTKSVH
FT                   ANARRDVIAPVSALMAIGKLGGQTNSPVDGDLAALPPSLLIAAESEVLRVDSEVMAQRL
FT                   AAAGVPCSLQIWNGQVHAFPAVWPGLPESRAALRDVARYTRQARCGPAPGRGRKLFGKL
FT                   NFRSG"
FT   CDS_pept        complement(280716..281324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02390"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30947"
FT                   /db_xref="GOA:C0ZLX0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX0"
FT                   /protein_id="BAH30947.1"
FT                   /translation="MASTRKQEISEETRRRLVKAAAELAAEGGSTAMSVQAVAERSGIS
FT                   RGSVAWHFGSKDGLLRAVVEDAFRWGMEKLRAELASSSATGIEALIEANFVLMSYPEAR
FT                   IFSTILIEAVIPGSTIRETYAEQYVAMRTLYADYLRSIDTPVANPELVAVTLLAGTLGI
FT                   NLQHRLDPDNVDRRSAVTELESIYARAMAPTATSGHENP"
FT   CDS_pept        281534..282325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02400"
FT                   /product="putative polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30948"
FT                   /db_xref="GOA:C0ZLX1"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX1"
FT                   /protein_id="BAH30948.1"
FT                   /translation="MELIDLTRTLDPADRELLPECLKALASVVAPSVTYSHPAGAGRDE
FT                   FAAALQCGVHDLPDGEGWGSEMLSEFNSHLGTHVDAPLHYGSTSEGKPSRTITDIALDE
FT                   LFCETVVLDLRGRCEANQPISVDALKAALAENGASVPQDGAVLLRTGQESFTLADPGFF
FT                   QYPGMSREGTLFLAEQGAKVLGTDAAGWDLSFAVMAQKFRDTGDNSVLWDGHRAGRERE
FT                   VFIVQQLANLAALPPSGFHVAFFPIKLARASAAPARVVAFV"
FT   CDS_pept        282379..283311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30949"
FT                   /db_xref="GOA:C0ZLX2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX2"
FT                   /protein_id="BAH30949.1"
FT                   /translation="MKLATVEYEKTQQTALVTGSGEQLLLLERAHHDVTGKPAPELETM
FT                   QTIIEGGPAAREILDRLADEQPASAIVDAGDVRWMSPLPQPVQIRDFGCFMDHFRNARA
FT                   RIQGVALEDVELPKIQLERPLYYIANRLAVTGHESEVVWPEYSSLRDYELEFACVLGRG
FT                   GSDISRADAPAHIFGYTIFNDFSARDTQLEEISTGLGLSKSKDFSNANVLGPWIVTADE
FT                   VGDPYQLEMTARINGDEVSRGTSADMDHRFEDVISFASTSTRLYPGEVFCSGTVPSGCG
FT                   LEHGRFLEPGDVVELEVAGLGVLRNRVVA"
FT   CDS_pept        283308..284546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02420"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="protein synonym:acyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30950"
FT                   /db_xref="GOA:C0ZLX3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX3"
FT                   /protein_id="BAH30950.1"
FT                   /translation="MSGEVMVLGVGATPFGRHADTSASELAGRAAIDAVEDAGLTRGDV
FT                   GAVFYATVSQKAIDRQHMIPGQIALRPYGFGGVPVVNVENACAGGATALWLAIAHVRAG
FT                   LSEVALAVGVDKLVCSDPARSLEVFDGALDVAHRDETLAGLASLSAPVPGELGSQGERS
FT                   VFMEIYASLARAHMERFGTTEFELASVAAKNHAHSVHNPWSHFRKPFTVDEVLAARRVA
FT                   WPLTVPMCSPVSDGAAAIVVTTADFARRHDSSRRAARVLGCSLVSGTDRAADDVESHIG
FT                   RRAAMSAYEEAGVGPGDVDVAEVHDATAFGEVQQVENLGFCPIGEGGAWSASGASSLGG
FT                   VRPVNPSGGLESRGHPVSATGLAQVFELVTQLRGQAARRQVPGARIAVAENGGGLYGIE
FT                   EAVAAVTILGGPR"
FT   CDS_pept        284543..286090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02430"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30951"
FT                   /db_xref="GOA:C0ZLX4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX4"
FT                   /protein_id="BAH30951.1"
FT                   /translation="MNADMMNDEPMAPGLHEQAGYADLILSALRRRPDHIAFRFTDRNG
FT                   DRAELTYRQTAEQIERIAGVLSSLALPDGGGVALLAGPCPEAFTVMAAACLAGVRYTAL
FT                   HPLATEENDRMVLKDSGTDLLLVADGQFQTRAEAAQTRVMSLSALESACELATAGTGSD
FT                   FGGQGRALYLFYTGGTTGEPKGVMLRDRSLVANAWACTTWEWPADTTMLLTTPMSHAAG
FT                   LLVAPGLQRGASFELHRSFDPDRVVDAIENDGVTATFVVPTMLYALLDHPRLSDANLSG
FT                   LNWMLYGAAPIDPTRLAQAGAVFGPILSQHYGQAEAPNALTVLDTREHTDDPAVLGSCG
FT                   RAMPGVEVVLFDEQGNETATGVPGELCVRGPLVMDGYWNKPEQTAAALANGWLHTGDVA
FT                   RIDETGLISIVDRIKDTIISGGFNVYPREVEDSLGHHPAVAACAVFGVPDPQWGEAVTA
FT                   AVVLKTGWSVTPEQLVAHVRSHKGPIWAPKEISILEALPLTALGKVDKKALRGASQT"
FT   CDS_pept        complement(286079..286939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30952"
FT                   /db_xref="GOA:C0ZLX5"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX5"
FT                   /protein_id="BAH30952.1"
FT                   /translation="MTTVLLLTCDGAAREADVESKLVMEALTSYGIASTMAPWSSRSLL
FT                   DIDADLVLIRSTWDYTQRLDEFLAVLDQLTAPIANPLPIVEWNAHKGYLTELAAAGVPI
FT                   VPTAVIAAGKSETLTLPSFEGADVIVKPAVSAGAVGVGKFAAGSEQAHAHLSSILERGN
FT                   DALVQPFISDVVDGERSIIHLGGRYSHAVRKIPATNDFRVQEFHGGTNFLHEPSAAELA
FT                   VADAALAATPCGPGELLYARVDVVGPVDQPLLMEVELIEPELFLPFAPGSADSLARAVV
FT                   ASLGL"
FT   CDS_pept        complement(286974..288068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02450"
FT                   /product="putative S1 family peptidase"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30953"
FT                   /db_xref="GOA:C0ZLX6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX6"
FT                   /protein_id="BAH30953.1"
FT                   /translation="MTKRAGRRGLWTAAVLAAGLGALALVAPPLTPGTIKSAPVTVITT
FT                   TTPPAPVVPLTPEELSAQVVPTIVTITAPAGFTTTAGTGIVLSPDGVVLTNHHVISGAS
FT                   DVTAVSMSNGLIYDAEILGYDSVSDLAVLRLAGATDLPVAVVGKSAEATRGDAVTAIGN
FT                   AEGGGVPVPAPGVITNLGVTVNTRNVSDGSRNQLKGLIEVDADIRPGDSGGPLVNAVGE
FT                   LIGVSSAGNAVTDRTETSPAPQSYAIPIDTALPIVEQVLGGRSSETVRVGPTPVLGVAV
FT                   KDHAEMPAGAEVVAVSFDSPAERVGLTKGAVITEFGGSRIASSADLNAAMSSRRPGDTV
FT                   AVTWVDATGQPGTGSLVLDEGPPR"
FT   CDS_pept        complement(288138..288968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02460"
FT                   /product="putative glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30954"
FT                   /db_xref="GOA:C0ZLX7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX7"
FT                   /protein_id="BAH30954.1"
FT                   /translation="MTPRVSVVVPAYNNADYIAETIDSILNQTYQDFELIISDHSSTDD
FT                   TVKVLARYADDPRIEILSTEAGGGAKRNWDRVSEAANGELLKLVCGDDTIYPECLAEQV
FT                   AAFDEHPSVVLVASQRKLVDANGKTILSARGLAGLKGRVTGRDAARKTVTAGANIFGEP
FT                   GCVLMKRSALKAIGWWDDTNPYVIDEATYTAVALQGDVYAIAKPLASFRVNAGQWSVRL
FT                   AKDQARQAAAFHKDLRESDPTLVSAMDVRIGDARALATSFMRRGVYMLLRHRMS"
FT   CDS_pept        complement(288965..289435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02470"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30955"
FT                   /db_xref="GOA:C0ZLX8"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX8"
FT                   /protein_id="BAH30955.1"
FT                   /translation="MASPDSTATPPAGMTGRPGPLMRVVKNQALAFLLVGGVNTALGTA
FT                   WFIAWQIALGDQFGYHFAIVAGYVCNLLCAFAMYRYLVFEVRGHFLRDFWRFVVVNFGA
FT                   FVINLALMTVAVSVLHFPPIPSQLVITAVTATASFFGYRDFSFSRNKRTGNS"
FT   CDS_pept        complement(289435..290028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlC"
FT                   /locus_tag="RER_02480"
FT                   /product="dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="protein synonym:dTDP-4-keto-6-deoxyglucose
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30956"
FT                   /db_xref="GOA:C0ZLX9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX9"
FT                   /protein_id="BAH30956.1"
FT                   /translation="MSQYRELKVPGAWEFTPKQFGDDRGVFLEWFREPGFSEITGRTLD
FT                   LQQANCSVSAAGVLRGIHFADVPPGQAKYVTCVKGAILDIAVDLRVGSPTFGQWDSVLL
FT                   DDVDRRAIFLSEGLGHAFLSLEDNSTVVYLCSTGYAPEREHEVHPLDPDIAIDWPTVGR
FT                   SGEPLNITLSAKDTAAPSLQDAVSAGLLPTFGEG"
FT   CDS_pept        complement(290048..290923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="RER_02490"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="protein synonym:dTDP-glucose pyrophosphorylase"
FT                   /note="protein synonym:dTDP-glucose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30957"
FT                   /db_xref="GOA:C0ZLY0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY0"
FT                   /protein_id="BAH30957.1"
FT                   /translation="MRGIILAGGTGSRLHPITLGVSKQLVPVYDKPMIYYPLSTLMLAG
FT                   IRDIMIITTEDDAPQFQRLLGDGSQFGVDLTYQIQHEPNGLAQAFVLGAGHIGSESAAL
FT                   VLGDNIFYGPGLGSKLTRFENIDGGAVFAYWVSDPTAYGVIEFDREGKAVSLEEKPANP
FT                   RSNYSVPGLYFYDNDVVAIAKDLEPSARGEYEITDVNRAYLEAGRLQVEVLPRGTAWLD
FT                   TGTFDSLLDASNYVRTIEERQGLKIGAPEEVAWRHGFITDDELRIRAEKLLKSGYGKYL
FT                   LELLDRGKDW"
FT   CDS_pept        291031..292038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlB"
FT                   /locus_tag="RER_02500"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30958"
FT                   /db_xref="GOA:C0ZLY1"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY1"
FT                   /protein_id="BAH30958.1"
FT                   /translation="MRVLVTGGAGFIGANFVHQTVAERPDAEVTVLDALTYAGNKSSLD
FT                   SIADRITFVHGDITDAVLVDELVGAADVVVHFAAESHNDNSLADPWPFVQTNIVGTFTL
FT                   LQAVRKHDVRYHHISTDEVYGDLELGDPDRFTESTAYNPSSPYSSTKASSDMLVRAWTR
FT                   SFGVRATLSNCSNNYGPYQHVEKFIPRQITNVLAGLRPKLYGDGLNVRDWIHVDDHNSA
FT                   VWAIIDGGRIGQTYLIGADGEVNNRTVMESILQILGRGADEFDFVTDRPGHDVRYAIDS
FT                   SLLRKELGWSPRYEDFRSGLEATIDWYRDNEQWWRPQKDATEQAYVAAGEKKTS"
FT   CDS_pept        complement(292035..292961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02510"
FT                   /product="putative NAD-dependent epimerase/dehydratase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30959"
FT                   /db_xref="GOA:C0ZLY2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY2"
FT                   /protein_id="BAH30959.1"
FT                   /translation="MNVPTWVVGSGGLLGSSVARELERRGADIRTSRVPWGEPALAREI
FT                   LFADARKLVTDAAGGPWRMAWCAGAGVNGTSSDEFARENQLMKDVLDELGTADAGVGTV
FT                   FHASSAGGVYAGAPGAPHTETSATNPLADYGRAKLDAESIVREFGSRSGTRTVIGRFAN
FT                   LYGPGQNLAKPQGLISHLCRGYLLSMPISIYVPMDTLRDYVYVSDAAEMVVDSFTRAEA
FT                   SQEPTVTKIYASGRSVTIGAILGACHTVFRKRPNVVLASSPLASAQARDLRLRSIVWTD
FT                   LDQRTHRPLPAGIASTLDSIRRNLAAR"
FT   CDS_pept        complement(292964..293965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02520"
FT                   /product="putative glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30960"
FT                   /db_xref="GOA:C0ZLY3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY3"
FT                   /protein_id="BAH30960.1"
FT                   /translation="MQPHRISVVVPVYQGEHTLNALIDEILPLTKTQTTPGGRPLVVEE
FT                   VLLVFDHGPDGSAAVIRELARQHDFIRPIWLSRNFGQHPATLAGMASSGGEWVVTMDED
FT                   GQHDPADIGGLLDTALDQQATLVYAQPVNAAPHGALRNAASKSSKWLTTKILSSENSVK
FT                   YQSFRLVLGEVGRSVAAYAGSEAYLDVALGWIAGEVTTSPVQLREERGRASGYHLRSLL
FT                   SHFWRMVLSSGTKGLRMVSLIGFLFAVGGLVIVLYVLASYVFFDAGVEVRGWASTMIVM
FT                   LFGFGAVLFSLGVIAEYIGVAVKTAMGKPPYLIVSDPASGPLGRRNATEPPA"
FT   CDS_pept        294101..294781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30961"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY4"
FT                   /protein_id="BAH30961.1"
FT                   /translation="MAEFEDHTNDRRENNRENTGLPGRADTGSGDTTDTECTARLRELQ
FT                   GAKWKRVLNVQAPYQWNIRRFLGGRKVLDVGCGIGRNLRNLPPGSVGVDHNEHSVEFCR
FT                   SLGFEAYSSAEFHSESDQRTFDGMLMAHLLEHLPAGEASGIVAEYLPFLEPGATVMLIC
FT                   PQERGFASDPTHTVFLDGVDLEKICADNGLVVRRSLSFPFPRWMGKPFIYNESVVIAEV
FT                   PSRL"
FT   CDS_pept        complement(294736..296901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02540"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30962"
FT                   /db_xref="GOA:C0ZLY5"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY5"
FT                   /protein_id="BAH30962.1"
FT                   /translation="MIPAVVCLAFFAIVTVDPRYFYVDDTESGAVGNWVQLGHLMREGQ
FT                   FPSLVLDQWMAGNYPVEGQGGLWNPVQIFINYIAPSVDNLALLATLVKLAFAIILGWGV
FT                   YRVCLEYGARPYWAAVAGSAVPFAGFTLYFEYPSWVTSVIGMAWVVQAWASGIRYARGR
FT                   SGPIPVFVFLYLAISVGYVHAALMAGVTVGALMVGEYVRSPQWRTTVKLGLVGVSAAAC
FT                   GAITFLPGLLSSAVTWRTGEEGTFNDNFLTAPWSETLTASIPSSVSSIESWTGETTYAP
FT                   ITYIAWFAIPALAFIGWRKAQGSLRELVTPLLLLAFILLFTAGPSDIGQIRWPARLLPF
FT                   VAVFSLVLLGVLLSRFGTLDKLRSRVIAASLIVFVLMIRASSSGPQYFIRHLTWAVVII
FT                   AVGALAIYLGRRYGAPAIAGLLILTIAPVTLYQVIAYPQALNKWYLPTSQSEAKANFPD
FT                   FPGTTLQLGNRALIRIDAETTELPWTSQVYGNYAKVLDLDYVNAYTPVGHADFASLLCM
FT                   GFDGSTCDDAYRNVFRPDEYTGRTSADLMLLDRVVLQRKQYPGADNEPAPPGWHWAEVP
FT                   EVAQDQIYILERDAGPISGQPGRVSATVNADAQSEYMSVKNERVRVSSPGGGSVVFARL
FT                   AWPGYTATLDGEPIPTKGLGGTYLYVDLPPGTDNAELVINFRSPGQRIGYVGMGFGLVI
FT                   LAGLSVIYYRDRRQSRDGTSAITTDSL"
FT   CDS_pept        297115..298944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02550"
FT                   /product="glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30963"
FT                   /db_xref="GOA:C0ZLY6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY6"
FT                   /protein_id="BAH30963.1"
FT                   /translation="MPENGQVMARRLVVQRGVFVGMSPIVNDDLYVEFRKGSGERTRHR
FT                   VALDKGARISTNTYFGRFAASYWQRWTTVTEVEASLRIESEGRFRVRMVASDIAGHRRI
FT                   LETRDGSGSSEVTLTTSLDKFVDGGALWLEVDSVDAPMTIDHLEWTVAAPETVRPVSVA
FT                   ICTFNRADDCAETVAALASDATVRDLVSSVYVVDQGNDLVKDRARFVEAADKLGEKLKY
FT                   LQQPNLGGAGGFSRGLFEATSEGTDLADVILMDDDILCEPETVLRLNAFANMTVEPTLV
FT                   GAQMMYLLNPDFLNVGAEDVDLKTLHHGQRVPKALINTSMLKKRQERRVDAGYNAWWTC
FT                   LIPAEVVEAIGLPVPIFFQWDDVEYGIRARKAGFVTVTLPNAAVWHADFYWKDFDDWAR
FT                   YFSTRNSLVVGSLHSDLDTKGLSRQFFRQISEFLVGMQYGLAFTTLKGIEDYLDGPEAL
FT                   RDGGIEAMASIRAGRAQYAETIKHDAATAPIASNELHTERAGGEPSLMRVILAKRGLNQ
FT                   WLGRTRGGLVNIPREDAHWWHISQFDHVVVTDASQSGVRIRQRDKATARALLIRTVKLL
FT                   RRFQKEAPAVSAKYRAAMPELTSRENWARLYEK"
FT   CDS_pept        complement(298948..299775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30964"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY7"
FT                   /protein_id="BAH30964.1"
FT                   /translation="MFERFRSSARTKLQRAVSEVVETADRRNADRTQQILDALALSRDE
FT                   LAEARVDIAGLRSRIDELEFRQRRDLAYAVDLEATASTAEFILEHLRVTDTFGHPHDTL
FT                   RHALGLIEIPGMALEFGVASGTTLRIVAEAFTEREGTVAGFDVFSGLPETWRTGFPVGE
FT                   FAQESIPEVPGAQLVPGLFEDTLPSFLNDESGPVAFLHLDADLYSSTKTVLDLLGDRLV
FT                   PGSIVVFDEFFNYPGWQQHEYRAWTEFVTRTGISFEYLGYTVDNEQVIVEITS"
FT   CDS_pept        complement(299823..300908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /gene_synonym="engC"
FT                   /locus_tag="RER_02570"
FT                   /product="putative ribosome small subunit-dependent GTPase
FT                   A"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30965"
FT                   /db_xref="GOA:C0ZLY8"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY8"
FT                   /protein_id="BAH30965.1"
FT                   /translation="MPENSTPLTEYGWNATLSNTFTTLAPPDSAPGRVLRVDRGRCDVA
FT                   VAEGTVRALSGSDPRGASQLCTGDWVTVAEVLNSREPEMHTVTSILPRSSSIVRSSASG
FT                   KSEGQILAANVDTVVIATASDGDVDLGRIERLLALAWESGATPVVALTKSDAAQYISDT
FT                   LAEVSAIAPGATVLAVSAETNEGMDVLDAVLDGTVAILGPSGAGKSTLANALLADTTGA
FT                   DRLETGRVRTGDGKGRHTTVTRELIPFSGARTLIDTPGLRGVGMWNAAEGIDKTFPEIE
FT                   ELIAECRFSDCAHNSEPGCAVLTALGRGDLDERRLASYRKLQRENAWNAARSNARLQAE
FT                   RTREIKVISRHLKSHYRGRDR"
FT   CDS_pept        complement(301064..301960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glfT"
FT                   /gene_synonym="glfT1"
FT                   /locus_tag="RER_02580"
FT                   /product="galactofuranosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30966"
FT                   /db_xref="GOA:C0ZLY9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLY9"
FT                   /protein_id="BAH30966.1"
FT                   /translation="MSAPEKIIGVVVTHKRRELLAESLKVLSTQSRSLDHLVVVDNADE
FT                   ADVKDLVDNAPLPTSYIGSQHNLGGAGGFALGILYALSLGADRVWLADDDGRPEGPEVL
FT                   ETLLDCAIRNDLAEVSPVVCDIDNPDRLAFPLRRGTSWRRLRSELGDEDLLPGIASLFN
FT                   GALFTADAIDAVGVPDLRLFVRGDEVEVHRRLVRSGLKFGTCLQTAYVHPNGADEFKPI
FT                   LGGRMHTQYPDNDTKRYFTYRNRGYILAQPGMRKLLPQEWVRFGWYFLITRRDPAGLRE
FT                   WMRLRKLGREEKFERPS"
FT   CDS_pept        complement(301957..302763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02590"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30967"
FT                   /db_xref="GOA:C0ZLZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ0"
FT                   /protein_id="BAH30967.1"
FT                   /translation="MTEHVNISTHNACVDFPIFDAKSRSMKKAFLGKAGGAIGRNSSDV
FT                   VVVEALKDITMTLKEGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGSATIRGRVAPVFDL
FT                   GVGMDPEISGYENIIIRGLFLGQTRKQMLAKMDEIADFTELGDYLDMPLRTYSTGMRVR
FT                   IAMGVVTSIDPEILLLDEGIGAVDAEFMKKARVRLQKLVERSGILVFASHSNEFLAQLC
FT                   NSAMWIDHGQIRMQGDIEDVVRAYEGDDAAEHVRHVIKEMERENTL"
FT   CDS_pept        complement(302774..303646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02600"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30968"
FT                   /db_xref="GOA:C0ZLZ1"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ1"
FT                   /protein_id="BAH30968.1"
FT                   /translation="MSASAIESETPDAPAPVSDSQTFRRAFKDLRDGLNQRELWLSLGW
FT                   QDIKQRYRRSVIGPFWITIATGVQATAIGILYAALLDMPLQEFLPYVTVGLIVWNLINA
FT                   SIIEGSEVFVANEGLIKQLPSALSVHIYRLVWRQMLFFAHNLLIYVIMVIAFGVWRNLS
FT                   WASLAAIPALGLIVLNALWVSIVFGIFATRYRDIAPILSSLTLLLFVLTPIMWTTQSLE
FT                   AQGGAVRDRAKIAELNPLFHYLDIVRAPMIGQPQELYHWYIVITITVVGWAVALLALRK
FT                   YRARVPYWV"
FT   CDS_pept        complement(303711..304280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30969"
FT                   /db_xref="GOA:C0ZLZ2"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ2"
FT                   /protein_id="BAH30969.1"
FT                   /translation="MTNPDKEQVLVIGPDGRPVAMPAAEAEAATSGTTEAAETEAESVA
FT                   EMVEQPAKVMRIGTMIKQLLEEVRAAPLDDASRKRLKDIHTSSIRELEQGLAPELREEL
FT                   ERLSLPFTDDSIPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRQGAL
FT                   PPGMSIGAPHSPAHPDQQSPGTGQYL"
FT   CDS_pept        304413..305615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30970"
FT                   /db_xref="GOA:C0ZLZ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ3"
FT                   /protein_id="BAH30970.1"
FT                   /translation="MAYDVARVRGLIPSLGDGWIHLDPQAGMQIPDAVSRTVSTAFRAS
FT                   ASSSSGRHVSNRRSAAILESARTAVADLVGGDPAGVVLGSDRAVLLAWLAESLSSRLGL
FT                   GTGLVLSRLDEEANVAPWLRVASRYGAQVRWAEVEIETCELPSWQFNDLITSTTRLVAL
FT                   TAASPVVGSAPNVRAAADRLHEFGGLMVVDAVGAAPYAHVDMADLGADIVAVSAPSWGG
FT                   PQVGALVFRDPGLLDRIPAVSLNPYARGAERLEVGGHQFALLSGLTSSIDFLAGLDESA
FT                   TGTRRERLETSISSLQDYQDGLFDHLMRSLAALPNVMVIGGAPTRVPTLSFTLEGMAAD
FT                   KVAAHLADKRIATVSGTHGGSRLLDALGVNDEGGAVTVGLAPYTTRYEINQLVAELGAL
FT                   G"
FT   CDS_pept        complement(305631..306620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02630"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30971"
FT                   /db_xref="GOA:C0ZLZ4"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ4"
FT                   /protein_id="BAH30971.1"
FT                   /translation="MYAITIDQPGGPEVMKWAQQPDPELPRGHVLVEVAATAVNRADLL
FT                   QRQGFYPPPPGASDILGLECSGVIVELGEDVTGWSVGDEVCALLAGGGYAEKVAVPATQ
FT                   LLPVPAGVDLRVAASLPEVACTVWSNVVMRGGLRRGQVLLVHGGGGGIGTHAIQVGKAL
FT                   GARVAVTAGSEDKLNRCRELGADILINYRDSDFVASLAEATDNHGADVVLDNMGASYLG
FT                   RNVDALAMDGHVVIIGMQGGRKGEVDIAKLMGKRGNITSTGLRGRPLTGPGGKADIVAD
FT                   VRAKLWPLIADGSVQPIVSTELPITEAPLAHQLLDSPETVGKVILTVK"
FT   CDS_pept        306679..307857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02640"
FT                   /product="putative FMN-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30972"
FT                   /db_xref="GOA:C0ZLZ5"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037350"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ5"
FT                   /protein_id="BAH30972.1"
FT                   /translation="MTYFGNMQNEIYLTGLSGAKPALPMTAAGLEDAAREQLSPEAFGY
FT                   IAGSASTERTAVSNLRAFDKHAIVPRMLRGTAAPDARDLSVEVLGTRLAAPILTAPVGV
FT                   LGLVHDDAEVAVGSVTAELGIGSILSTAASSTIEDVAAASGDNWWYQLYWPADDELAES
FT                   FVRRAETAGAKAIVLTADTPGMGWRPRDLELGHLPFLQAKGIANYLSDPVFRAKLATPP
FT                   EESAEALQIAVLTWVSLFGNHAVRIADIAKLRQWTTLPIAVKGIVHPDDAREAVAAGAN
FT                   GIVVSNHGGRQVDGSISALDALGPVADAVGHEVDILMDSGIRCGADVIKALALGADAVL
FT                   YGRPWVYGLGLAGADGVRHALRSLLADLDLTMGLAGLASVAEIDRSILMSNS"
FT   CDS_pept        307911..308411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02650"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30973"
FT                   /db_xref="GOA:C0ZLZ6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ6"
FT                   /protein_id="BAH30973.1"
FT                   /translation="MTAEATTEETSQAAHGETPWLTPCEMRAWRGYMDGNQRLMEVLNR
FT                   ELQDSHDLSLADYRILVMLSESADGSLRMSDLADGVLSSRSRLTHQIRRMESQGIVVRD
FT                   TCVEDGRGVLARITEEGRRRLAEAAPTHVAGVRNNLVDLLTPQELDVLADVFEKVDKAI
FT                   GER"
FT   tRNA            308463..308552
FT                   /locus_tag="RER_t0040"
FT                   /product="tRNA-Ser"
FT   CDS_pept        309250..309933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02660"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30974"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ7"
FT                   /protein_id="BAH30974.1"
FT                   /translation="MATELKARTSRRRSRAAVGLAACAVAALSSGVVFAGSASATPTAL
FT                   SDKFASTVTDDGWSLDLAATKLSANPVPNLATTAFTREGFVSAKVTGTIGGAGDSAVKT
FT                   GYVEQGLQIGCQIDVSSGLGLGLGFSLGPSVGVSISGVPSANVGVNASVNPSIQSTIAP
FT                   GTITTIPLGKKDLESSKASITAENVHVKVDACMGPVTIRSYAQLSVSTATSDNTLFVYS
FT                   DPTWL"
FT   CDS_pept        310063..310458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30975"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ8"
FT                   /protein_id="BAH30975.1"
FT                   /translation="MKIRTLATAGVLTAGIAVIGVLGGGVASAATPIVQPDHGRIGLSL
FT                   SNAETAALAAGPIPDAIANIVLGSQRWVGRAPGSVITNVDGRASAPDRVVIAEAAAHPG
FT                   GYVNIYVSDPNNPVTGGYIVQTYQHWN"
FT   CDS_pept        310675..310884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30976"
FT                   /db_xref="GOA:C0ZLZ9"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLZ9"
FT                   /protein_id="BAH30976.1"
FT                   /translation="MIATVFGLALLIAAFAAIGRLGGWAADYGTILVYLAFFLWMSIAG
FT                   RVFWWGADKLIAEARKKSNTGDRR"
FT   CDS_pept        310881..313247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30977"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM00"
FT                   /protein_id="BAH30977.1"
FT                   /translation="MKSVLKLRRSIAGALAAGALLTGVAGVIGAGIALTAGPATAGPAE
FT                   DCAAVRARDHQIYLNLIASLPPGAPVPPEYINPCLSAPTTTPTAAPTTTVGLPGAQAPG
FT                   GGPNVGANAPTNFPAYNGTPIVPVPGAALPGQPNTPTPSGIENPAGVPVPTTTSGPAPT
FT                   TPQPAGSTAPTAVPDRGPGPVPSGTPNSAPGQSESNPTVTPSGLDKGDGRDRYLELVLV
FT                   GAAAFTAGGIGVRGRRSPFGPRIPLGGRTPESILSQTVGTLASPLMQYVKGGQSKITVT
FT                   EPGGGRRTFFLIHDATSSHEAEIPVDVPPGGHMSVNPDGSVTVFDADGNPISVVAAPWA
FT                   YDANGNPVPTDYEVRDGRLIQTVYADEATAYPILADPPEKKAKAPTSVASKQVQKNTNT
FT                   AAPKPNSMTSRTSPQKPQNSGNTNSSNTSGATNSGTTAGKCAGITTQGSAPVTKPASPN
FT                   QSPRTTTKPGPKPAPTSQEQATNQLAQAHGEVPPVAPSKPAQPNQSPRTTTSPGPKPTV
FT                   SPRQQAANQLAEAHGDVPAGFTGNVPIPPDPNAPDDRSFPQKVWDTAWGVGESAVDTTV
FT                   DSVGTLGDAWRNFLVVPVHDAAVDPFGFNRGQRAQPSPEHSPAEIAAAAANIVSLIPIV
FT                   GTGGRVGGAAVQEAVEAVLRRGGTAADAEAAGRRAAATAGEAGNRAPSDPTIPVGDRPA
FT                   STPVGGRGDREINVKPGTNRPGIVNGREYTGHAFDRMQERGILPSLVEQAIREGVATPS
FT                   RGNTTVIYDSINNLSVIINETGRVVTTSFGNLSGK"
FT   CDS_pept        complement(313662..313841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30978"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM01"
FT                   /protein_id="BAH30978.1"
FT                   /translation="MRNGVLSVHRTLLLDAAVQVVGFTWNHQDVVVFLWDAVGEVVVIG
FT                   DQGKWMATLEGEDV"
FT   CDS_pept        313856..314257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02710"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30979"
FT                   /db_xref="GOA:C0ZM02"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM02"
FT                   /protein_id="BAH30979.1"
FT                   /translation="MTTFYAICAITTGAVALIASTPYVMYRSHARTIYWSSSILTIVFG
FT                   WLTAPQRSILGPVLLCGFAAVFVAWWWTPFLTRRHPTGFNDVFGAWLTRALYREQKDAP
FT                   PVNRYDKLHYKDTDRQARDTDSDGNQVNT"
FT   CDS_pept        complement(315498..315923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30980"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM03"
FT                   /protein_id="BAH30980.1"
FT                   /translation="MEAPTRVGHRRGRSRMTHLRRMITAAALIPAGIAAIALSGAGAAS
FT                   AVTPIADNGRIGVQLNQGETALFGQLNAGAAIESITNSTQIGVRLAPGSRFESGPNVVW
FT                   GRLDQFANEAASRGGEISLGVLNPARGSQQFFFIQNW"
FT   CDS_pept        complement(316281..316775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30981"
FT                   /db_xref="InterPro:IPR015068"
FT                   /db_xref="InterPro:IPR035944"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM04"
FT                   /protein_id="BAH30981.1"
FT                   /translation="MELGVHFALSDSVAAELLDARGDDDKLGALVEDIEETGRSEFSCD
FT                   TDKAWDPILCALSSTGYERVSENWPAYGVILGDEDLNTDTDDQLVTYLAPDRVAEVSSY
FT                   LAEITESEFGVRYDAMPLDDRNPEYGSDERGYAWGWLQEVADFFQRAARERRHVVFTVR
FT                   F"
FT   CDS_pept        316906..317877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30982"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM05"
FT                   /protein_id="BAH30982.1"
FT                   /translation="MIPTKRTGLSVVSLVILVVAGLLVAAPASSAAPPPDWKYTMVAFS
FT                   NASDRDMDVYESVDGTGFQLVQQSAYRPPSGLVRDPSIFRNTDGLYYLTYTTGGGANIG
FT                   FARSSDRINWTPLGNYPVPFCCALMPGTGDGTGSASPPGFSGSAGFSDGPSLSPFVTKA
FT                   WAPEWFVDGDRVNVILSMSTGGGFVPYLMTALEPSLRLWSPPVPLAGIGADHIDTTVVK
FT                   VGSTYHAFTKNETKKVVEHAVAPSVTGPYSFVPPGNWGSLVEGPAVVQLPSGDWRIYLD
FT                   AYTEGKYLYSDSTDGLNTWSPVQEVPGVSGTARHLGIMREPA"
FT   CDS_pept        318468..319151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02750"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30983"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM06"
FT                   /protein_id="BAH30983.1"
FT                   /translation="MSIESQNGVSHRRSRAAVGLAACAVAALSSGVVFAGSASATPTAL
FT                   ADKFASTVTDDGWSLDLAATKLSSNPVPNLATTAFTREGFVSAKVTGTIGGQGDSAVKT
FT                   GYVEQGLQIGCQIDVSSGLGLGLGFSLGPSVGVSISGVPSANVGVNASVNPSIQSTIAP
FT                   GTITTIPLGKKDLESSKASITAENVHVKVDACMGPVTIRSYAQLSVSTATSDNTLFVYS
FT                   DPTWL"
FT   CDS_pept        319209..319640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30984"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM07"
FT                   /protein_id="BAH30984.1"
FT                   /translation="MVTHHAHKGEIMKIRTLATAGTLTAGIALFGVLGAGVASAATPIV
FT                   EPEQGRIGLSLSNAETAALAASPIPDAISDIVPGSQRWIELAPGSALTVGPDGKLSAPD
FT                   RVVIGEAAAHAGGYVDVYLADPNNPANAGYVTLTYQYWN"
FT   CDS_pept        319826..320041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30985"
FT                   /db_xref="GOA:C0ZM08"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM08"
FT                   /protein_id="BAH30985.1"
FT                   /translation="MIATAVGLGLLIAAFAVIGKLAGWANDYGTILVYLAFFLWMSISG
FT                   RLFWWGADKLIALLRTKKSDNRGAHR"
FT   CDS_pept        320038..323058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30986"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR028904"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM09"
FT                   /protein_id="BAH30986.1"
FT                   /translation="MKSGRRLRRTLAGVLAAGALLTGAAGVIGAGIALSAAPANATPEE
FT                   DCAAVRARDHQIYLNLIASLPPGAPIPPEIINPCLSAPSTTSTAAPTTTVGLPGVQAPG
FT                   GGPNVGANAPTNFPTYNGTPIVPVPTIEVPPITSESPASETGVGAFPNASASAVPSPTP
FT                   TPGEGTTTDRGPGPIPADSDSDSNIAPAQTVPDPAADVSTAGEDSGRDRYLELALIGAA
FT                   AFTAAGIGVRGRPGPFSPRTPESVLSQAVGTVVSPLTAYAPGGQSSLRVFDPITGGSRF
FT                   FFLIHDETSSHESVIPVTVPPGGHMSVSPDGTVTVFDADGNPVSTIDAPWAYDANGTPI
FT                   PTHYEIRDGQLVQVVDTAGIENLLYPILADPELTPEERAALEAQANFIGPMTPEGEQAR
FT                   RDAQNVLAANPPEPADSGLEQLMLGDPNSEVSEPPITETGTGNPVGDAILADQTQEPIT
FT                   SNIGGRDYTTEPADPADSDLGQLMSGDPNSEVSEPPITETGTGNPVGDAILADQTQEPI
FT                   TSNIGGQDYTTEPVVTDTSFTDENGTNWSGTPSKVPNVWSWTYTDAQGEEHDLQVTYDE
FT                   QGRPYQVFDHSNSELSLYDWSTGEPVRIGDAQHLDPGVAYDQPYTGEIMSFVLPPLRGG
FT                   RLIAGAVRAEDLIVSNRTAPTRPPVTSPAVPAQSVPRPGTVPPRGIPVIDGTVPPAEHD
FT                   QPTIPSVNEPARPDPTIPEPSQPTSPGDPDRGEWESPSPGEVADPGSNPEPKAPSPGHV
FT                   EEPSVPTLPDVGHVPVNPDAPGAPQQPGPPEFDPFATDPSTIEQPGVIPGPTDRPTVAT
FT                   PPLQPDSGEPGVSLPITNTQTDPGGIETGEPADVPAGRIPILGDPEGGHGIWDNAYPSE
FT                   IASMFDQNGNLTPNAAFQQFVTGVDPAFTYYLPAPFRPTGRISIDNWIQELNMLQEVKG
FT                   NYDMLFRPHVPDFMRDNIVDGMLEQAERQVRAIALAGSDAHLQWVFLQEQAAQIMEDAF
FT                   DEVIGLENINIIVFGGE"
FT   CDS_pept        323062..323835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30987"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM10"
FT                   /protein_id="BAH30987.1"
FT                   /translation="MPTSSLRRNPTAGLTVKVIPRKGAPESEAVTAALVARSLRLLRDI
FT                   DPVFDVDLYQTVGDALPDGAGVEQALASNIRQILVPPTEKSIEAALIERRRSPDATGGM
FT                   YPLSLGRHMTLYSPAGDVKVVVSFGGTSGSGAFACAFADESLISLASKLVQGLADIWDS
FT                   RVTVLYRRTESSPQRNVPGDAIVGSCTYFGPELPIKETQLPPSVEAFPYQDGTIVIQKN
FT                   LSTPLTVEDIRSIRAAAGLPTERPEIPLPKGFRRL"
FT   CDS_pept        324921..325538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30988"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM11"
FT                   /protein_id="BAH30988.1"
FT                   /translation="MHRRAKLASVLEGIDGLAMATPRKVRGSAWERVLKAAASNLGPEW
FT                   VVARSGTQGELIHLPVRWWFNSIGLDPKPNREELTFSHVPLMREFTPGTITFRQSSYQP
FT                   GPTDSGPPNMQMDIFDTRGAAEIVRWWALGPSTKFFAAPPLPDSVAAAEQAYADRKEEP
FT                   CRDWMISAGLRVIADTGSPIEVIDSVLWELARRDVGGHVQSF"
FT   CDS_pept        325804..326640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30989"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM12"
FT                   /protein_id="BAH30989.1"
FT                   /translation="MASMHMSDDKPKPPKSVTEVLESLGMDRDQLREMAKDAIADLTPK
FT                   KGRGAAWEKVLGAAVEKLGPNWTIIGSGLRAKLLHTPVRWFFDTVGIDPIPNREKLTIT
FT                   HLPLIEPLDPGTLTEWQDHYDSRHSGHDYHGRQIDIFDTVSAAELVIWWAEGPASDLFD
FT                   ARSVEALTPLREKQYLERSQSGPARWTILAGLRVITDTGSPLEVIDNAIEYFRGRVADP
FT                   KAPLVMFWTQFREVAAAGDRERTLWWLDEHRRATVREHYPLPDSVFADVLEDLGDG"
FT   CDS_pept        326701..327120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30990"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM13"
FT                   /protein_id="BAH30990.1"
FT                   /translation="MDHWVVVPEQPGFVGDRTVVDAATSPPTVERAHFVFTRQPTDGLI
FT                   GAGPLVLVDRETAEALEDNVFGEVSLHPADLDTDPASGLLRVPDFVWCQVHGQAGMLDI
FT                   GLTEDGRLVMSGQALLVFHSFGGGIDNATISEWLG"
FT   CDS_pept        327161..327340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30991"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM14"
FT                   /protein_id="BAH30991.1"
FT                   /translation="MMACLERSALPQVAVIEELPTDTLIRLGDKPMHVGAADIVAVRAV
FT                   SGYGDQVGLERTGR"
FT   CDS_pept        327337..328206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30992"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM15"
FT                   /protein_id="BAH30992.1"
FT                   /translation="MSFFGRRPTVAGYWGTRVQSSQEVAQTMRAFLDDLEAIDPELALS
FT                   LVSTAEFDKVPADLSVDGLVRIFEHSRSKEMGYSDTPGPGYDIDLSPEDGTARRVGAWV
FT                   GGLETSAPNSVLVSLPTETQLTDSTRRLLDPDIGDAIMRVIVKHWEPERARWSIGDYRH
FT                   LQNRSKGEVEVGWETYFHSGVTFDRSALPQSAVVEELPTGTLIRLGDKPMQVDAADIVA
FT                   VRAALGYPVQAPQWVRSSPLHQMSRNVLTGWPASPFDSIVRWHSEPTCSRGSSIRIQRF
FT                   GGRWSAIC"
FT   CDS_pept        328221..328760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30993"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM16"
FT                   /protein_id="BAH30993.1"
FT                   /translation="MWAATRASIATKGFGARLLSLQDRDGQWAGGAFFPAEFDFAGPEA
FT                   AEQGSQPWTATTWTLNSLREWGLDASVLRERRTAELLAENCRWEYEGRPYWDGEVDCCI
FT                   NAWTVANGVWLDMRVDELADWFVQHQLPDGGWNCEWIEGSTRSSFHSTLNSLKGLLAYE
FT                   IATGGNKGDVRGSTIR"
FT   CDS_pept        328768..329121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30994"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM17"
FT                   /protein_id="BAH30994.1"
FT                   /translation="MLQRGLFRRLSTGEPVGPWVGRFAYPFRWRYNVLNAADYFREASL
FT                   SYGNEPDPRMADAIEMIRVARASDGTWLQAGRQPGRVWFEVDTEAGEPSKWLTLSGIRV
FT                   LAWWDQSSPLGSA"
FT   CDS_pept        329692..331377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt"
FT                   /locus_tag="RER_02870"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30995"
FT                   /db_xref="GOA:C0ZM18"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM18"
FT                   /protein_id="BAH30995.1"
FT                   /translation="MSMEMVLAEAVIDSGDTAWVLISAGLVLFMVPGLAFFYAGLVRGS
FT                   SALVMLQQNLVPLGLVSITWVVFGYSFAFSGDWGSGFLGDLKLFGLQDIHTAAAPGFHL
FT                   IEGAVAVPTLAFVVYQMMFAIITPALITGATANRLKPLGWAVLLVLWSIIVYPPIAHWL
FT                   FNPEGWLALRGAQDWAGGIVVHASAGAAALAILLVVGKRPGWPNAEAVPHSVPLALIGA
FT                   GILWFGWFGFNAGDGLAADGVAAQALMNTHIAAAGGMVVWLVIERYTEGKATAIGGITG
FT                   AVAGLATVTPCAGFVSTFSALAIGALAGLVCHFALALKSIFKFDDALDVIAVHFIGGIL
FT                   GSLLLGLFGEKAINSIGRDGLFFGGGAGLLGEQALALIVVIAFSFVVTWLIATGIEKTI
FT                   GLKLAPKDQVDIDRRQQGMDAYRYNAAFVDAGGAPQTSGFDSGVLVEGTKLVPNLAAPK
FT                   HELITAVLQTIESEKLREALLAAGAESIVVSEAHVSASDSASLKFRGQRNDVVFTERLR
FT                   VEVLVASEHAQAVLDAINEYSGGRRSGFVQQAAEPLTEATEQGS"
FT   CDS_pept        331429..331731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /locus_tag="RER_02880"
FT                   /product="urease gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30996"
FT                   /db_xref="GOA:C0ZM19"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM19"
FT                   /protein_id="BAH30996.1"
FT                   /translation="MHLTPRELDKLTILMLADVALRRKAKGLRLNHPESVAVITAAALE
FT                   GAREGKTLEEVMADASHALTVDDVMEGVAEMIPRVQVEAVFLDGSRLVTVHSPIQ"
FT   CDS_pept        331761..332198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="RER_02890"
FT                   /product="urease beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30997"
FT                   /db_xref="GOA:C0ZM20"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM20"
FT                   /protein_id="BAH30997.1"
FT                   /translation="MASKSTKKDSGGEKKVPVGGYVLRDEPIELNEGRPRLKLRVRNTG
FT                   DRPIQVGSHYHFMEVNRALSFDREQSFGWRLDIPAGTAVRFEPGDEKEVTLVPFGGKQR
FT                   VQGFNGLVDGWAPTHAAYRPRLPGAVQRAEELGFLSEPQTD"
FT   CDS_pept        332234..333952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="RER_02900"
FT                   /product="urease alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30998"
FT                   /db_xref="GOA:C0ZM21"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM21"
FT                   /protein_id="BAH30998.1"
FT                   /translation="MTSISRQEYSGLFGVTTGDQIRLGNTDLYIEVEEDLRTIGDESIY
FT                   GGGKTLRDGMGQDPESCSIDGALDLVITNVVIVDATIGVVKADVGIKDGKIVGWGKAGN
FT                   SSTMEGVTPGLTTGPATDAISGEQMILTAAGIDPHVHLVSPQQAYHALSGGVTTLIGGG
FT                   IGPTDGTNGTTITSGIWNMEMMLKANEGLPVNVCMLGKGNSSGHQSLVEQIKAGAAGLK
FT                   VHEDWGATPATIRESLRVADEMDVQVAIHTDTLNEAGYVEDTIAAFEGRTIHTYHSEGA
FT                   GGGHAPDILRVTGEDNVLPASTNPTLPYGINTQAELFDMIMVCHNLNPKVPSDVSFAES
FT                   RVRAETIGAENVLQDMGVISMFSSDSQAMGRVGENWLRAIQTADCMKRSRGKLPEDSPT
FT                   HDNFRVLRYVAKVTINPALTFGLSHVVGSIGVGKMADLVLWEPAFFGAKPKTIIKNGLI
FT                   SWHAMGDPNASLPTPQPVIYRPMFGGFGKALPQSSVSFVSRAALDDGIKDRLGLERQVV
FT                   AVEGTRTVTKRDLVRNSATPEIKVDPETFAVTADGVHAYVEPAESIRLNQLYFFS"
FT   CDS_pept        334022..334609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureE"
FT                   /locus_tag="RER_02910"
FT                   /product="probable urease accessory protein UreE"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30999"
FT                   /db_xref="GOA:C0ZM22"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM22"
FT                   /protein_id="BAH30999.1"
FT                   /translation="MTAPSGKPTRVDALLGKETDEEWAGRLDNAVVDVLSLDQWEAQKS
FT                   RLRRTTIGGRELAVSLDRGIQLQDGDILLWDEQANTVVVARINLKDVLEIDLSALVEVT
FT                   PEKMIQTCLELGHAVGNQHWPAVVKGMKVYVPLTVDKAVMGSVMRTHAFEGIEYTFIPG
FT                   AEVIPYIAPHEARRLFGAAAREGEGHTHDPLV"
FT   CDS_pept        334638..335306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureF"
FT                   /locus_tag="RER_02920"
FT                   /product="urease accessory protein UreF"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31000"
FT                   /db_xref="GOA:C0ZM23"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM23"
FT                   /protein_id="BAH31000.1"
FT                   /translation="MRMMQFSDSMFPVGSFSFSNGLESAVAQGIVTGGPSLREFVLSAA
FT                   HQGATCDGIAVLAAHRGATAGDFSAILAADHAVIERKLNEEARTMSTRMGKKLAELGGR
FT                   LAGETLFNKWLAAIASGETPGTYPVGLGIAFAEMGSPEEDAFTVNQYGVAMTLLGAALR
FT                   IVRVDHLTTQEILFEVNQSAGREYAAVRDYGLDDMSNFAPMIDILAAVHVKAHVRMFMN
FT                   "
FT   CDS_pept        335317..335958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /locus_tag="RER_02930"
FT                   /product="urease accessory protein UreG"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31001"
FT                   /db_xref="GOA:C0ZM24"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM24"
FT                   /protein_id="BAH31001.1"
FT                   /translation="MKKTTRIGIGGPVGSGKTALIEAITPEFIKRGTSVLIITNDVVTT
FT                   EDAKHVRKALKGVLVEERIVGVETGACPHTAVREDPSMNLAAVEDMEKTFPDTDVVFIE
FT                   SGGDNLTLTFSPALVDFFIYVIDVAAGDKIPRKNGPGISQSDILVINKTDLAPYVNADL
FT                   GVMDRDSKGMRGDKPFVFTNCMTGEGIKEVVDLIVHGVLFDEEEVGASAP"
FT   CDS_pept        335955..336902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /locus_tag="RER_02940"
FT                   /product="urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31002"
FT                   /db_xref="GOA:C0ZM25"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM25"
FT                   /protein_id="BAH31002.1"
FT                   /translation="MSATSVPGASRSLPGPIPTIPELDQYQDQPKQAPAGKVGKTGVLE
FT                   MRFVDRGDKTILRDMYRKTPLLVQQALYWDEALPTMPCVYMISTSGSVLQGDRLFLTIE
FT                   MEPGSLAHVTTQSATKVHRMDANHASQLQKVVLAENSYLELMPGVTIPHRNARYYARTD
FT                   ITVDPTATLLFSEIVMSGRKYHDGGEMFVYDLYSTMIKAERPDGKNLFTEKLVIEPARF
FT                   PVRYGGIMGDHDVFGNVILLTPKEHADAILEEIVPGRDGKVVSGASRLPNDAGLIFKVL
FT                   GPESEPVKAKVRDFWSLVRKAVLDTTIPPVPLWG"
FT   CDS_pept        336937..337980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02950"
FT                   /product="urea transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31003"
FT                   /db_xref="GOA:C0ZM26"
FT                   /db_xref="InterPro:IPR004937"
FT                   /db_xref="InterPro:IPR017807"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM26"
FT                   /protein_id="BAH31003.1"
FT                   /translation="MTTITKPWDDVADKNVVLRFIDTNLKGSGQVMFQGNALTGLLFLV
FT                   GIFWGAIAADTITVAIGAVVGLVVSTVTGMMLHSDDDSMRIGLYGYNGILVGAAFPTFL
FT                   AGGVMLWIYLVVGAAASTIAFLAVANVFKTWGVPALTFPFNLVNWFFLLAAFQFLRIET
FT                   SDLSAGQFPQHIGDASVHADITFNFLWDTLFRNVSQIFLINNTVTGIIFVIALLVASRW
FT                   AALFALIGSAIAMGSVLALGANTVDIGNGLYGLSSVLTAIALGSVFYNPSWRVFVYTVF
FT                   GVLVTVVIHGTLVSAFAPISLPAGTGPFVFATWLFLLPKKKFVPIQHDTIEGGAAEGKD
FT                   SIAKANG"
FT   CDS_pept        338085..338606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="RER_02960"
FT                   /product="gluconokinase"
FT                   /EC_number="2.7.1.12"
FT                   /note="protein synonym:gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31004"
FT                   /db_xref="GOA:C0ZM27"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM27"
FT                   /protein_id="BAH31004.1"
FT                   /translation="MTVQVVVMGVAGAGKSTVAVGLATSLGADFVDGDDLHPESNVAKM
FT                   RSGTPLTDEDRVPWLDAIAAWLSGRADAGRTGVVACSALRKDYRDRLRPDGLDVQFVHL
FT                   DGEFETISARMRSRAGHFMPESLLISQFEALEPLTDDERGITLNVVSKPSTLVGEAVDY
FT                   IHTSQRSVTA"
FT   CDS_pept        338603..339385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gno"
FT                   /locus_tag="RER_02970"
FT                   /product="putative gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31005"
FT                   /db_xref="GOA:C0ZM28"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM28"
FT                   /protein_id="BAH31005.1"
FT                   /translation="MSSTASPGPFDISGKVALVTGSSRGIGSALATGLAEAGAVVVLNS
FT                   RNVDVLEAERRRIADATGATVHAFAFDVTDSAAVRDAATRIEAEVGPVEIVVNNTGVQH
FT                   RAPLLEFGDDDFRRVMDTNLTSAFYVGREFARAMVERGHGKIVNICSVQSELGRAGIAP
FT                   YAASKGGLKMLTRGMCADWAPFGLQINAIAPGYFDTELTSALVNDPEFTAWLAKRTPAG
FT                   RWGRTEELIGSLLFLASPASDFVNGQILYVDGGMTAVV"
FT   CDS_pept        339431..340357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02980"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31006"
FT                   /db_xref="GOA:C0ZM29"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM29"
FT                   /protein_id="BAH31006.1"
FT                   /translation="MTDASAPRIHLGPVEDPHVADGIRRAGGVLVPLAEAEGVVWVQGP
FT                   ETFPSALPDSVRWVQLPFAGIEPWFDAGVIDDKRVWTSAAGAYAGNVAEHTMMLLLAGV
FT                   RSLPEQLAAQSWRKEEFDPRVGTLQGSTVAIIGCGGIGRALIPYLVASKVKVIAITRSG
FT                   TPVEGASETLSADRTGEIWSKADHFVIAAPSTSATRHLVGKAELDQMSESSWIVNIARG
FT                   TLVDTDALVDALEAGSIGGAALDVTDPEPLPDGHRLWKLPNAIITPHVANPATTLTRVL
FT                   ADHVAANVARFAAGDDLTAVIDPSAGY"
FT   CDS_pept        complement(340351..341274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_02990"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31007"
FT                   /db_xref="GOA:C0ZM30"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM30"
FT                   /protein_id="BAH31007.1"
FT                   /translation="MDTRRLYSFVRIVDAGSITRAADILHIAQPALSQQMTSLETQFGQ
FT                   QLLIRSKQGVEPTDAGHALYRHAQVILRQVESAQAEVSVVGRALAGGVSVGLAPYSTAT
FT                   AIALPLLARVREQHPNILLHINENFGGVLSEAMMTGRMDLALLYDAGPIKGVTFERLLT
FT                   EELVVVAPFGTGLAGESGSDISLSEIAELPLLLPGRMHTIRKVVEQAFDRAEQQPNVVA
FT                   EVESVMTLSEAVRTGLGATVLPWSVARRVMDVEALELRRIDPGIEVHVSLGTPANQPLS
FT                   KPAEAVRDVLRTVVADYVKGTNASGQ"
FT   CDS_pept        341466..342269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31008"
FT                   /db_xref="GOA:C0ZM31"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM31"
FT                   /protein_id="BAH31008.1"
FT                   /translation="MATSIDLVADLGEGFGTWTMGADDALLDTLTSANIACGFHAGDPR
FT                   TMDATVRGCVSRGIGIGAHPSFPDLAGFGRRAMDLSENEVRTDVLFQLGALHAFAVANG
FT                   TSLSHIAPHGKLGNLVAVRQDYARAVVDAVTAFDPSLIVLAQDGALADEATARGLCVGI
FT                   VGIADRAYNSDGTLVARSEPGAVIHDVDVLVERTVRMVVEEVVEAVDGTLIPVVADTVL
FT                   VHGDNPGAVANAKAIRAALEAAGVTIAPLAQVVASRRARDVGCSA"
FT   CDS_pept        342257..342973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31009"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM32"
FT                   /protein_id="BAH31009.1"
FT                   /translation="MFRVKTYVADCGDAAVRVNVSGGTAEQNWNTVRSIAARFDLGADG
FT                   IVSVIPTYDALLVEFDNLLTDHDAVRGLVREATTIPRPLEGEPRTFEIPVVYGGEHGPD
FT                   LGETARFLGVTEAEVVRLHSAAPLVMRCYGSPGGAPMLDGPAFGLPIPRRSSPRPHVAA
FT                   GSVAVAGRQAVVSARPAPGGWAVIGRTPLILVDPASEQISAYRPGDLFVFRAIDADRWD
FT                   EFDGRSLLPVGGDPHG"
FT   CDS_pept        342966..344039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31010"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM33"
FT                   /protein_id="BAH31010.1"
FT                   /translation="MAETVTVQTPGISSVQDLGRGSASQFGQATGGAADQISAEIANAL
FT                   VGSRREAPLLELTALDFSASASTDLLIAVTGAPATVTVDGHRQPQWEPIVWRAGQRLAV
FT                   TGIHDGLRVYVAVHGELAADYLLGSCAPDQVLGFGRHLTAGETLVVDTDCPPIDHPVFR
FT                   LPLFRLLPDRPSFGNVWTLDVTDGPDIEDFGESGAALFGTEFVVGDQSNHIGLRLASTD
FT                   QQPLPQRTSTGEVLSRGVPIGAVEVPAGNELLVLHRGRGVTAGYPVLAVVTTVSLSQLG
FT                   QARPGHRVRFRNCSVATAVAEHREQQHRIALLRRRVQNVFTTLRIPLHTSEARVPSHVG
FT                   TTRPASAPRRASILETA"
FT   CDS_pept        344036..345370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03030"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31011"
FT                   /db_xref="GOA:C0ZM34"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM34"
FT                   /protein_id="BAH31011.1"
FT                   /translation="MTNTIEAVDGQVADPRKVRKVVAAGCVGIFVELYDNGVFAFMATA
FT                   LAIVFFDVSKSSDALMLVFAGYAVSFFVRPLGAVVCGILGDRIGRQKMLVFVIMLISVA
FT                   TAGIGLLPTYAAIGIAAPALLIFLRIVQGFSVGGEAAGAMTFLAEHAPEGKRGLITSYA
FT                   QIASFLALLTGTMIAFAMSPWLNAEAINGGGLASWAWRIPFLMAIPMGIIGWYIRRAIS
FT                   DTPNFERLKESGGLSRNPLKEAFSTPEHRRAMILALFIPLMNGSGYYVLFSYMPTFLKG
FT                   DQIGFSTGTALLVTASSLVAICFAIPFMGALSDRIGRKKVIAGAAAAMAIGAIPCYAMI
FT                   VTGNVGLAVLGACLMAVIFAGHTAVIHILIVELFPTRVRYSAYGLGYNISSALFGGTAP
FT                   LLMTWLIPEFGIYVPAFYAVITAIGTLIAVSTITDRAHVPLRDTL"
FT   CDS_pept        345467..346222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03040"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31012"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM35"
FT                   /protein_id="BAH31012.1"
FT                   /translation="MPFSDYRTALVTGANTGMGAAVTEMFTKRGLTVYGVARNADKLGE
FT                   VADRTGMIPLPVDITDTAALAEAVGGLEIDILVNNAGVSATGNILDAEEASVDAMVDVN
FT                   LRAVLHLCRILLPGMVQRDLGHVVNISSIAGLYNFYGHTAYHATKAAVHQISRQLRNDC
FT                   IGKRIRVTEVCPGRVETEIFGRNLGGTPEAMKEAWETFYEGYESITTKDIADTIEFAID
FT                   APGHVNLGLIEVLPTFQVPGGLDFIRRND"
FT   CDS_pept        346234..347277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03050"
FT                   /product="putative zinc-containing alcohol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31013"
FT                   /db_xref="GOA:C0ZM36"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM36"
FT                   /protein_id="BAH31013.1"
FT                   /translation="MSFVLPETTLGVMAHAAGDLRVEHVALTAPTAEQAVIEIAYGGVC
FT                   GSDLHYWTHGAAGESILKAPMLLGHEVVGTVVTAAADGTGPAVGTSVAIHPATPGGTAP
FT                   RFPSDRPNLSPCCTYLGSAAQYPHTEGAFVKYAVLPTRMLRELPEGLDLRTASVAEPAS
FT                   VAWHAVSRAGDVRGKKALVVGCGPIGALVVAVLKRAGAQSITAVDMHDVPLQIASTLGA
FT                   DRVLKATDAEAVAASDADVVIECTGNHRGLESAIRGATRGGRVVMLGLLPSGPQPVHIS
FT                   LAITRELELVGSFRFNDEIDEVLLALADGSLAVDAVLTHEYPVEEALEAFAVAKDASVS
FT                   GKVLLRF"
FT   CDS_pept        complement(347337..348005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03060"
FT                   /product="putative 4-carboxy-4-hydroxy-2-oxoadipate
FT                   aldolase"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31014"
FT                   /db_xref="GOA:C0ZM37"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM37"
FT                   /protein_id="BAH31014.1"
FT                   /translation="MIHVKTKIDRADKDLIAELGTFSAATIHEAQGRKGSLHPAIKPID
FT                   RDMKFCGSAFTVKCHPRDNLMLQVAISYAQPGDVLIVSSGDQAAGQFGDVLANACVARG
FT                   IAALVTDGGVRDTREIRELGFPVFSKHVYIEGTVKESLGPINHPLVFGEQVIYPGDVVK
FT                   GDCDGVVVIRREEVAEAIELSRARDEAEAGYIERYKRGETPLEVSNLTALLEAKGLVVE
FT                   "
FT   CDS_pept        complement(348031..349239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03070"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="protein synonym:transaminase A"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31015"
FT                   /db_xref="GOA:C0ZM38"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM38"
FT                   /protein_id="BAH31015.1"
FT                   /translation="MATFVPAARVDRIRESPSVAAAQRVRALKAQGREILDLTVGEPDF
FT                   DTPDNIKSAAITAINTGQTKYTAVNGIPALRDAITARAASRTGIQYADNQITVGGGAKQ
FT                   VIFLALMATVEAGVEVIVPAPYWVSYPDMVLAHDGTPVIVQCKESDNFLMTAEALAATI
FT                   TPNTKWVILNAPGNPTGSVYTREQLQAIAEVIEANPHVNVLVDEIYDEINFGDAPIESL
FT                   LQVAPHLRDQVLVTNGVSKSHAMTGWRLGYGLGNSGLIGAINKLQGQSSSCPSSISQAA
FT                   AVEALTGDQSFLTESVRSYRLRRDLSARLLGAVPGLEPIVPQGAFYLFVNCAGLIGKQT
FT                   PAGTVIESDQDLVLYLLDEASVATIQGSAYGASPYFRISFATSEAILEKAAAQIAAAVE
FT                   RLS"
FT   CDS_pept        complement(349400..349804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31016"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM39"
FT                   /protein_id="BAH31016.1"
FT                   /translation="MGAWGSGPFDNDGAGDLIASIGHGDFTFESVEWAFEDDYLEVDGG
FT                   QIAVALLELVLIVRADRKRDPAAQDLDLDSFTSALTSERLTWLIEMVERTISSTDSELF
FT                   ELWDEQGPEELASWRVPVVDGLEDLRVLSV"
FT   CDS_pept        complement(349830..350450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03090"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31017"
FT                   /db_xref="GOA:C0ZM40"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM40"
FT                   /protein_id="BAH31017.1"
FT                   /translation="MLTALLAATAVLALLTLVPGPDMAVVTQAALGAGRSAGFRVAAGI
FT                   VSGLLVWGLLTVLGLSAILAASAEAYTVVKLAGAAYLIYLGVRALWESRTSRMQHNADA
FT                   PRSQKAGTWKTGFTTNLLNPKIAVFYTGLLPQLVPAGWPTGPSLALLVLIHAAITIVWL
FT                   SGYVVLLSRARSTFEKPRVRQALERITGTVLLGFGAKIALEAR"
FT   CDS_pept        350850..351860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03100"
FT                   /product="putative mycolyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31018"
FT                   /db_xref="GOA:C0ZM41"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM41"
FT                   /protein_id="BAH31018.1"
FT                   /translation="MRRFGFVGIVLVVLALVVGGVAYAEPAPENPPGDLTGQTGAHINR
FT                   IEQLSPTRSAVFVDSPAMRREVQVQVLHPASSAGSRPSFYLLDGVSAGSESGYSESTWT
FT                   QKTDIEAFFADKNVNVVLPVGGTGSFYTNWKNDDPNLGVNKWESFLAEELPALIDSAFS
FT                   GNGTNVVGGVSMGALGAANLITHHPKLYTGLASYSGCLDNSESSSQDSVRLTVASKAGD
FT                   ATNMWGPSSDPDWQKHDPSTNAETLRGKTIYVSSGTGAPGEYDNIFTPGGLQTAIEGGP
FT                   LEALANTCTQLFEARLGELSIPAVFAYRNVGTHSWPYWQDALHDSWPTVKTALGM"
FT   CDS_pept        complement(351881..352750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31019"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM42"
FT                   /protein_id="BAH31019.1"
FT                   /translation="MIIATHNGKFHADDVFGVSLLKQLYPDATVVRSRDESVLDSADIV
FT                   LDVGGRYNPAEGRFDHHQRDAGERSNGILYSAFGLLWQEYGLQFCEGDASVFRRIDSRL
FT                   VEGIDAVDNGQEIYTLNDYGTKPFDLSSVLDLFNPISSTDEEFDTQFELAVVLATQVLI
FT                   RLRAKYAGDAAAEREFTETYEKATDPRFVVLERFVPHGRAASAQPELLFTIFPNTNGGW
FT                   SIQTVKPADSKFGSRKLLPEPWRGLNGSDLAAETGVDSSVFCHKAGFIAAAQTRDGALQ
FT                   LLELALAE"
FT   CDS_pept        complement(352788..354482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03120"
FT                   /product="putative nucleotidase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31020"
FT                   /db_xref="GOA:C0ZM43"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM43"
FT                   /protein_id="BAH31020.1"
FT                   /translation="MTRRMTRTCAVLATTLLATTATSLSGVANAESQDTVSVRLLAFND
FT                   LHGSLRPPEGVRSEIRQADGSLTPAGGAAYLAAYVTQLRSQATNSLLYSVGDNWGSSAL
FT                   ESAMFNDEPTVELLNRMKIDASAIGNHELDKGLAEFRRMQSGGCSAVDACTFSPSFGGA
FT                   NFPLMAANMTYTNGTPATLPFTVNMVDGIPLGVIAISPANTSQIVTPGGIADLQFGDEV
FT                   EAINRTADVLDFFGVKAITVLLHRGDEPAVEGGPNDCNVESGPARDIALRASPKVDVIF
FT                   TADSHQQYNCEFPDPAGNPRVVMQGASHGRIVSVADVTIDRNTREVVRDQTSAFNQIVT
FT                   HDISPDPDIQALADRAWSEASESAQRPVGTITADLTRDRVPSGESTLGNLVADAQLAAG
FT                   STRGAQLALTNPGGMREDLDFGTSGQVTYRQAYGVQPFGNSLEVLSVTGAVLKDALEQQ
FT                   FQIDLDGTATERILSPSAGFTYAMDRRAAPGSRISEMRLNGQDIAPDCVYSVVVNKFLA
FT                   EGGDGFTALKNSTQMTGAGNDLDALTALFAAGSPVSPPATDRIRTAG"
FT   CDS_pept        complement(354583..355659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroT"
FT                   /gene_synonym="pat"
FT                   /locus_tag="RER_03130"
FT                   /product="putative aromatic amino acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31021"
FT                   /db_xref="GOA:C0ZM44"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZM44"
FT                   /protein_id="BAH31021.1"
FT                   /translation="MTAHIRPDLASIPAYVPGRNFPGAIKLASNETTVGPLPGVRDAVA
FT                   DAVANANRYPDNAAVALIEALASFLKVEPANVAAGCGSVTLCQELVQITCDQGDEVIYA
FT                   WRSFEAYPVVTQVGHAVSVKVPLTEDFGHDLDAMLAAITDRTRLIFVCNPNNPTGNALS
FT                   KAELESFLDAVPAHVVVALDEAYFEYSRSDADGIELFRSRPNVVVLRTFSKAYGLAGIR
FT                   VGYAVADPEIIVALGKVHTPFTVSAVAQAAAIASLAAADELLARTEGVIAERTRVRTAL
FT                   IEAGYTVPESSANFVYLPLGELSPAFAEASTEAGILIRQYGVEGVRMTIGDPHENDAFL
FT                   AFADTDVAKQAAGIGVSA"
FT   CDS_pept        355721..356440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31022"
FT                   /db_xref="GOA:C0ZM45"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM45"
FT                   /protein_id="BAH31022.1"
FT                   /translation="MSEIFRATAYLRGAEGEVATAVPLTVVEPDGPTRGGIVVLHEARK
FT                   FSPALLNLMCALAGEGWVSVAPHLFHREPEHIQGEVFGDNLFADFDATLDWLVGREVLA
FT                   DTIGVLGFDDAGTAAMLVATSRPVGAAVSVAARGIVEALSVDAQALVDAATSLQAPWLA
FT                   LYGEDDPSTPREHVTLLREATAKADVATLVVSYAGLAHRADEPPQLSEDADLDDPDSAS
FT                   IIEAQTRIFDWFDSHLR"
FT   tRNA            356537..356628
FT                   /locus_tag="RER_t0050"
FT                   /product="tRNA-Ser"
FT   tRNA            356711..356786
FT                   /locus_tag="RER_t0060"
FT                   /product="tRNA-Arg"
FT   CDS_pept        356830..357747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03150"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31023"
FT                   /db_xref="GOA:C0ZM46"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM46"
FT                   /protein_id="BAH31023.1"
FT                   /translation="MVHTQFLNVCEVTSAISVGDPRDRGNRQPIPATYAFCGAATRTEE
FT                   NPLETVDSRTLPVYSAGAVEVPFVIAGMDELVSRETRWDAHSHPTHELLWNERGASSAT
FT                   VGSRTWTITPTVGLWMPAGVLHSAIAPAGTWYRAAQLDIASVPSLSDVPVAIEVTPLLR
FT                   NLLERLADDSLGTSSRSLTEQMVIDVLAPSPNELLVLVPDSPLLQPIVDAIGDDPSDMR
FT                   TLSDWARLLGVSPRTITRVFRSETGMSFGQWVSAVRAQRAVTLLAHGLDLQEVAERVGY
FT                   HSTSAFGAAFRRTTGATPGMFRAS"
FT   CDS_pept        357904..358938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03160"
FT                   /product="putative iron-siderophore ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31024"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM47"
FT                   /protein_id="BAH31024.1"
FT                   /translation="MRSKRFLAVAAAAVAVALGMTACSSDSSETADGGSAGSGSSSFPV
FT                   TIEHAFGTTTIDAKPERVATVAWANHEVPLALGVVPVGMAAATFGDDNGNGMLPWVEEK
FT                   LDELGAKPPVLFDETDGIDFEAVSDTNPDVILAAYSGLTQEDYDTLSEIAPVVAYPEGP
FT                   WATSWRDVIKFNSMGLGMESEGQELISTIEKEIADEVASHPQLAGKATMFLTHVDTADL
FT                   SQVSFYTANDTRAAFFEDLGLSTPKSVADASTGGEFSKKVSAERVDVFDDVELIVTYGD
FT                   QALVDALKADPLLSQMPAVANNSIVFLNGTGPMGTAANPTPLAISWVLGDYVDLLAGAA
FT                   GKSE"
FT   CDS_pept        358935..359978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03170"
FT                   /product="putative iron-siderophore ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31025"
FT                   /db_xref="GOA:C0ZM48"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM48"
FT                   /protein_id="BAH31025.1"
FT                   /translation="MTVTSQDSTSGASDTRRPTFGNSLWLIALLVVLAVLMCASIVIGS
FT                   REVDWSDIVAALGGSTDNIGQGAIAKRIPRTVLAIVVGAALGLAGAVMQGITRNPLADT
FT                   GILGVNMGASLAVVIGMAWFGLWTQTSMIWVAVLGAAGAALFVYVVGSLGRGGATPLKL
FT                   ALAGAATSAAFASFITAIMLPRNDIAGNIRSWQIGGVGGASFEVIRQGLPFLIVGFVIC
FT                   LLSARSLNSLALGDEVASGLGERVAVVRAVAALGAVLLCGAATAIAGPIGFVGLVVPHL
FT                   CRLLIGIDNRWLLPFSALTGAGLLVAADILGRIVARPSEIDVGIITALVGAPFFIYIVR
FT                   RQKIREL"
FT   CDS_pept        359975..361027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03180"
FT                   /product="putative iron-siderophore ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31026"
FT                   /db_xref="GOA:C0ZM49"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM49"
FT                   /protein_id="BAH31026.1"
FT                   /translation="MTTTFVTPEVEVDAVGASRIRRGRRRRIVIAVLTVLAVASFAVTL
FT                   MVGKTFYPPSDVLRVVLGENVPGASFTVGRLRLPRAVLAVVAGICFGLGGITFQTMLRN
FT                   PLASPDIIGISSGASAAAAFAIISLSLGGSQVSIFAIAVGLGVAVLIYVLSFRDGVAGT
FT                   RLILIGIGIAAMLDSVTAYLLSTAAAWDLQETMRWLTGSLNGANWGSTVPVVLALVVLG
FT                   PVLLSQSRNLSTIQLGDDAAQALGVRVERTRILSIIAAVGLIAFATAAAGPIAFVAFLS
FT                   GPIAARIVGPGTSLLIPSALVGALLVLVADFCGQYAFGTRYPVGVVTGALGAPYLVYLI
FT                   IRSNRTGGSL"
FT   CDS_pept        361024..361839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03190"
FT                   /product="putative iron-siderophore ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31027"
FT                   /db_xref="GOA:C0ZM50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM50"
FT                   /protein_id="BAH31027.1"
FT                   /translation="MTGSHTLTVENLELGYGGRTVVESLDLAVPPGKITTIVGANACGK
FT                   STLLRSMSRLLSPRSGHVLLDGKDVHRLPAKKLARTLGLLPQSPIAPEGIVVADLVGRG
FT                   RHPHQRVLSRWSREDDAAVAEALAATDTTELAERSVDELSGGQRQRVWIAMALAQQTDL
FT                   LLLDEPTTFLDVSHQVEVLDLLTDLNRTRGTTIVMVLHDLNLAARYADYLVAMADRRVY
FT                   AEGDPAEVLTSDNVRTVFGLESRIIPDPISGKPLVLPLGRHHVLDDVLT"
FT   CDS_pept        361836..362465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31028"
FT                   /db_xref="GOA:C0ZM51"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024029"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM51"
FT                   /protein_id="BAH31028.1"
FT                   /translation="MTASNAPGGRIESVEQLNAILGQPHPTIMEKQTAYTTPLIREFVE
FT                   QARFFVLATSDAAGNCDCSPRGDLVSQVLFPDEKTLVLPDRPGNRRADSYRNMIENPHV
FT                   GILFLAPGHDEIVRVNGTATLSTDPDLLDSMAMNGKPAQLAVIVKIDEAYLHCARAILR
FT                   AKLWDPSTWPASDDVPSLRDMMAEQHSLLVEDLEPARQEAYRKYLY"
FT   CDS_pept        362500..363678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03210"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31029"
FT                   /db_xref="GOA:C0ZM52"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM52"
FT                   /protein_id="BAH31029.1"
FT                   /translation="MPSIASSLFWIALIAAIAPIVAGLIPRRLVPEVVLLLVAGAVVGP
FT                   FALNIAADSEAIGILRELGLGMLFLLAGYEIDRQELSGRGGRRALYTWLFCLALAFTVV
FT                   ALLGMRNVISAEAAVAIAMTSTALGTLLPILKDNKLLDTRLGKTVLNHGAVGELGPVVA
FT                   MAVLLSARGAVLSLIVLAVFALIAIVVAVLPGKLIHEGSWTHRLVRAGADTTAQTTVRL
FT                   TVLLLVSLGVLSAVFSLDVILGAFAAGFILRRLMPEGDERLEIKLDGIAFGFLIPIFFI
FT                   TSGMAIDVSAVAASPGILIAFLILIVVVRGVPVFFVTKFEKVEPPFTTRESAQVALYGA
FT                   TGLPMIVAVTGAAVDAHQMSSDNASILVAAGAITVLLLPMLATLLTKKEKVS"
FT   CDS_pept        complement(363680..364924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31030"
FT                   /db_xref="GOA:C0ZM53"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM53"
FT                   /protein_id="BAH31030.1"
FT                   /translation="MPMSLASSFFAHPHQAFTAGFYRNESFDFELRVVLGQATYGAADT
FT                   GEVLSAIAHVGEKDLEGWYEAWFDLGTRVFGHADEAAEAGHSRSASNAYLRAASYFGVA
FT                   INAVDGLSDDSVLVPTFKRHRQAWDRFVDTTAQPVERVRIPYEDTYLPGYFFRPPGDVR
FT                   RPTLIMVNGSDGPISGLWGSGGAGALERGYNVLMFDGPGQQSMLFERNIPFRHDWESVI
FT                   TPVVDYLVDRPDVDASKLAIYGISQGGYWVPQSLAFEHRIAAAIADPGVVDVAASWLAH
FT                   IPKNMQKLLDEGKSEAFDRDMAMGMKFSKDTARIWRFRARPYLADGYYNTLAEVRKYHL
FT                   EHVAGSISTPLLITDPEGEQFWPGQSKRLAALSGGPTTVVPFTAAEGANFHCQPMARRL
FT                   TDQRMFDWLDEQLDL"
FT   CDS_pept        complement(364998..365687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03230"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31031"
FT                   /db_xref="GOA:C0ZM54"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM54"
FT                   /protein_id="BAH31031.1"
FT                   /translation="MKERNAARWGLVAALALGGIVYSSWILEFFLDTGLDPVTSFLSEL
FT                   DAENQKYRDVFGNADVLSAILMLISGALGLLITPRRRLYVTGWIALAVFGIATIADASF
FT                   PLECSGEGCPSSAPDGLLPQLHHVHALTSSVAVFAIFTAMIAFTVGAFRYREHRSLRTT
FT                   GLTILILTSLATVWMLTTNSIEVSGGGNLGLGIAQRAQVLGMSLWLCTLAFAMSRPPST
FT                   GLPASPR"
FT   CDS_pept        complement(365698..366102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vsr"
FT                   /locus_tag="RER_03240"
FT                   /product="putative DNA mismatch endonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="protein synonym:very short patch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31032"
FT                   /db_xref="GOA:C0ZM55"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM55"
FT                   /protein_id="BAH31032.1"
FT                   /translation="MPATDPATSARMSAQRRRDTKPEIALRRELHRRGLRYFVDRAPVK
FT                   GVRRRADLVFPRRKVAVFVDGCFWHSCPQHATFPKNNAQWWTDKLAANVVRDRDTDARL
FT                   TEQGWTVIRIWEHEDPLVAAERVQKALLGP"
FT   CDS_pept        complement(366113..366988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31033"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM56"
FT                   /protein_id="BAH31033.1"
FT                   /translation="MTESLFPEPETLFPEPLFSEPEHEPLWSALQLAGDKPPADADRGE
FT                   KKNYAQRLSNQLAQTVADALRPLYPNITPTASGEGQEATVDVAKGRKRLDVKALDPTLG
FT                   LILCVSIKTYNFQDYSPRSGKLGRWTKNIVRNDHELRGEAMVLHQRQPYSVLVAVMFEP
FT                   YATCDDGDPTKTSDTGKSSFAHHVTTLSKRSGRGKRAVVGVPGKAWVDLGAEDTRYDLF
FT                   EKVYIGLYEPDGAVRFFDVDEPPPRNGRPTEAQTLSFTDFVTVVHGEVERRNRFAPTWS
FT                   DPEDSDDSDG"
FT   CDS_pept        complement(366985..368163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03260"
FT                   /product="putative modification methylase"
FT                   /EC_number="2.1.1.37"
FT                   /note="protein synonym:cytosine-specific DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31034"
FT                   /db_xref="GOA:C0ZM57"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM57"
FT                   /protein_id="BAH31034.1"
FT                   /translation="MRKGAVTSSRSMVGLFAGIGGLELGLSEHGWNTELLCEIDPGAQA
FT                   VLRSRFADVPLHGDVTKLRALPSDIELVAAGFPCQDLSQAGKTAGITGARSGLVDEVFR
FT                   LVKRKKGPRWLLIENVPFMLQLGKGAAMRHITDALEDLGYTWAYRVVDARAFGLPQRRQ
FT                   RVIMLASRTDDPREILFGQDAGERLGGDPADYPCGFYWTEGTRGLGWAVNAVPTLKGGS
FT                   SVGIPSQPAVRLPSGEIVTPGLVDAERLQGFDPDWTLPSVEVPGLRHSHRWKLVGNAVS
FT                   VRMASWVGGRLNDPIAYDAAGETPLEPGDAWPSAAWGRNRQAFRVHTSTWPVQYDYEDL
FT                   SGFLEDTRLLSARATAGFLKRARMGNLRFIPGFIEDVESHLERMGGYPEAAA"
FT   CDS_pept        368369..368956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31035"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM58"
FT                   /protein_id="BAH31035.1"
FT                   /translation="MSIQPSGDASWPAVLTWQAHNAPRMESVRVQLNGNRIKASGRIIG
FT                   GACSEHPAFSASYDLVTDEAGITRRLSVRTALAAGERQMSISRDEEGTWMVENGASHQR
FT                   SAFDGALDVDVILSPFFNTLPIRRVGLQNDIEDAEVPVVYVNLLDLRVEGATITYSSGT
FT                   DGISVLSPVSSSTLAVDTEGFVLDYPGLATRI"
FT   CDS_pept        complement(368968..369942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="RER_03280"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31036"
FT                   /db_xref="GOA:C0ZM59"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM59"
FT                   /protein_id="BAH31036.1"
FT                   /translation="MCQPELVSAIDSAPPVCVLGLGLIGGSLLRAAVRSGRQAWGYNRS
FT                   SESADAARADGFDADTDLVSVLQRANESGAIIVIAVPMPAVDATLEAIAAHAPNNPITD
FT                   VVSVKGEVKAAVERAGLSAKFVGGHPMTGTSASGWAVGDADLFVDAVWVVATDEGVDAD
FT                   VWSQVADLALDCGSVVVPAESLEHDRAVARISHLPHLLAETLAITGAAGGELALGLAAG
FT                   SFRDGTRVAGSAPGLVRAMCEGNRDALLVALDEALDLLQGARTDLLDNGSTARLVDSGF
FT                   AARGAYESHERWDIEDVQVGEPDWIERMRDAGRRGGVIRRSET"
FT   CDS_pept        369991..370530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31037"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM60"
FT                   /protein_id="BAH31037.1"
FT                   /translation="MGAQRAGNKSASSNQSEELEGFGVAVVREEGRWTVKALTPDALTS
FT                   LSAAETQLRELRSSGAVFGLLDVDDEFFIVLRPAPSGTQLLISDATAAIDYDIAADVLD
FT                   ALHIEIPDIDPDDLDDVEPWEEGDLSVLADLGLPEPVLAVIAAETDLYPDEQLGMIAQR
FT                   LGFASEFGAALDKLPR"
FT   CDS_pept        370531..370992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="RER_03300"
FT                   /product="putative tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31038"
FT                   /db_xref="GOA:C0ZM61"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM61"
FT                   /protein_id="BAH31038.1"
FT                   /translation="MTLADDQRMIRAAIVAARSASDADVPVGAVVFDADGVEVARAANA
FT                   REAASDPTAHAEILALRAAAKIYGDGWRLEGATLAVTLEPCTMCAGALVLARVSRVVFG
FT                   AWEPKTGAVGSLWDVVRDKRLTYRPQVRGGVLEDECAGLLEDFFREQRA"
FT   CDS_pept        371132..371323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31039"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM62"
FT                   /protein_id="BAH31039.1"
FT                   /translation="MGIADKAQNKAEDLGGKAKEAAGSATGDRDLENEGKGDQVKSAVK
FT                   DAGEKVKDAASSIKDKLT"
FT   tRNA            371380..371470
FT                   /locus_tag="RER_t0070"
FT                   /product="tRNA-Ser"
FT   CDS_pept        complement(371697..372029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31040"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM63"
FT                   /protein_id="BAH31040.1"
FT                   /translation="MGTPTAISNHLVKWFLHSGPQPGVPGPCASNHASIPMRTVCPKHE
FT                   SHRSGELAMADLTLLTDDELRERRIALSRSLTTAADLIPTPPPSFFEKLKQDIDAAAAE
FT                   WIARRS"
FT   CDS_pept        372115..372798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31041"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM64"
FT                   /protein_id="BAH31041.1"
FT                   /translation="MKKIWWIGGAVVVVVLALLVGPWAYGKFIAEDDAPAAVVSTQGAE
FT                   AASGSIDGQWTVVAGQGDNQTAAGYTVHEILNGSSVTVVGTTGEVSGNAVVEGEKLTSG
FT                   EVTVQVASIKTDSDRRDGQFTGNVMDISTYPTATFTIDSPVDLAAVPTDGTTATVTVSG
FT                   TLTLKGQSKPVSVDMTVLHSGDSLIASGSIPVTWTDFGVEPPSLGFVTVDASGSVDFLV
FT                   SLAAG"
FT   CDS_pept        372919..373272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03340"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31042"
FT                   /db_xref="GOA:C0ZM65"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM65"
FT                   /protein_id="BAH31042.1"
FT                   /translation="MMPRWRPFRTGEDPDPRFTLANERTYLAWIRTATAFVASGVGLEA
FT                   FGGDILNPTVRAGLAALLLVGGALIAITSFVHWISAERALRAERSLPVPLMAPVVGIVL
FT                   VICATVLVVEVVN"
FT   CDS_pept        373321..373611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31043"
FT                   /db_xref="GOA:C0ZM66"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM66"
FT                   /protein_id="BAH31043.1"
FT                   /translation="MQSERTSLSFVRTSLSILGLSAACLRWLPPFGSVALIGPSLAAVL
FT                   VVAVTVYERRSRPRRLAQFSAEKATPALGMGAALAVALLLLSATGLWILLT"
FT   CDS_pept        complement(373577..374518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03360"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31044"
FT                   /db_xref="GOA:C0ZM67"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM67"
FT                   /protein_id="BAH31044.1"
FT                   /translation="MWETLLESWKSLLEPLHDPVTLAIPAFVIFLAIEWFAARALEDHP
FT                   DDADGRARPAEGGYRSVDARTSVLLGLVSIATSTFWKVLALIGYSAIWVYLAPWHLSPT
FT                   AWYTWVILLLGIDVLYYAYHRIAHRVRVIWATHQAHHSSEYFNFSTALRQKWNNSGEII
FT                   MWLPLPFLGIPPWMVFVGFSVSLVYQFFVHTERVGKLWRPIEFIFNTPSHHRVHHGSDA
FT                   EYLDRNYAGILIIWDRMFGTFAAETHRPTYGLTTPVGTYNIWKLQTREYAAIARDWKAS
FT                   KSWRQRAGYVFGPPGWAPKAEVTSAESTAPSH"
FT   CDS_pept        374647..375102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03370"
FT                   /product="putative Rrf2 family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31045"
FT                   /db_xref="GOA:C0ZM68"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM68"
FT                   /protein_id="BAH31045.1"
FT                   /translation="MHITAKVDYAVRTLVELAAVGPDPAKAEFLAKSQVIPHKFLEAVL
FT                   SDLRRGGLVNSRRGPDGGYWLARSADEITIADVIRAVEGPLASIRGQRPEDVDYGGPAT
FT                   PLKEVWIAVRVNLRAVLENVTLTDVAGGELPEFIHELTADPEAWNRR"
FT   CDS_pept        complement(375115..376224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03380"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31046"
FT                   /db_xref="GOA:C0ZM69"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM69"
FT                   /protein_id="BAH31046.1"
FT                   /translation="MDPLLHTWPVSSTVMLWGSKSGRGSVLRLVRLTIGFCSLNFSIVA
FT                   FLFLLSGEGPDGPFARSWLVGIATVNLIPTILWFVGRIRGSRMLKLYGLWADLGTASIL
FT                   ITFTSHNAALFGAALFVATGAYFTYFLDRRWLAFHLAFATTFVIALTVLGLTNGDYSAT
FT                   SVIARTDVVLCAVIFIPATIQFTWRQLLSRATGSKVDALTGLLNRRGLWDMSERIWSVA
FT                   SANRADIAVAVVDIDKFKAVNDTFGHEVGDAVIIRTGTRLQEHVNGFGYAARTGGEEFT
FT                   VVMIGTPYGLRKRIATLPKAVVNASDDPLATVSVGAATLPFIPHQEEFDYNEFSRAIVA
FT                   ADHLMYDAKSAGGNAANTAPMTVPRRRAP"
FT   CDS_pept        376475..377104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03390"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31047"
FT                   /db_xref="GOA:C0ZM70"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM70"
FT                   /protein_id="BAH31047.1"
FT                   /translation="MIIEQGLRDRKKAATRAALSGAAARLARALGIECVTADAIASEAG
FT                   VSTRTFHNYFSSKEEAVLASFEESVNLWIEALASRPADEPILDVLEELVVEIVNDSGPS
FT                   GSEKASIWLLSDSSPALYRDAADMHQRINRAVVQALAERTGTDAEKDLYPTLLLGAVGG
FT                   AAKSVIDVWTGGKSEASSPEELVHDAFRQIRAGLPAPPPAPEMSRP"
FT   CDS_pept        377176..379530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03400"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31048"
FT                   /db_xref="GOA:C0ZM71"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM71"
FT                   /protein_id="BAH31048.1"
FT                   /translation="MATYLYRIGKFAYRRKGAVLSVWLIILVLMGVGAATLSGPTKDSF
FT                   SIPGTPAQQAQDLMAERFPDAPNPMDSLSARYVVQAPAGTTLADPANVKAMDDMLASIR
FT                   GIDKVADSAKVDPATATPEQAAKALVNPVTGNDSMVAMFKEKAAAAGTSETRAVDDARA
FT                   LSPLSADGTVGYVEVPFSGDFADLDQALRDSINSAADVGRAEGLNVQVSGSAAQEAEMP
FT                   GGVTELIGIAVAAVVLAITFGSLVAAGLPLLTAIIGIAIGSLGITVATGFMDLSSMTPT
FT                   LAIMIGLAVAIDYSLFIMSRFRHELTLTDNRAEAAGRAVGTAGSAVVFAGLTVIIALVA
FT                   LRVVGIPFLSDMGAAAAFTVLIAVLIALTLLPAILGMFGRKAFAGKIPFLSKRAEESEN
FT                   DDSGKPKLALRFITAVVRRPLVPLIGGVVLLGALALPATGLSLALPSEATGDPATSARQ
FT                   AYDLIDEGFGDGRNGPLIAVVDAKDASVPAGEAFAEVVSTISSFGDVQNAQVVGVNEAG
FT                   NTAQVLITPKSGPTDPATMDLVGSLRGAEAGLNDSIGVSYGITGQTALEGDVSDTLKDA
FT                   LVPYLAVVVGLAFILLLLVFRSILVPLTATLGFLLSVLATFGATVAIFQHGWLGIISNP
FT                   QPLVSFMPIFLIGVVFGLAMDYQVFLVTRMREEYVHGASAKEAVTIGFNHGARVVSAAA
FT                   VIMISVFGAFIAEPNSFIKSIGFALAAAVFFDAFIVRMVIIPSVMALLGDKAWWLPKWL
FT                   DKILPNVDIEGEKLSKALRDEKEAELQSASA"
FT   CDS_pept        379646..381379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03410"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31049"
FT                   /db_xref="GOA:C0ZM72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM72"
FT                   /protein_id="BAH31049.1"
FT                   /translation="MLIRLLRTYLTPYRGELTGVVVLQFISTMAALYLPSLNADIIDNG
FT                   VTKGDTGYILSTGGMMLMVTLTQILCSVGAVFFGARVAMGVGRDLRASVLHQVGTFSAR
FT                   EVGHFGAPSLITRNTNDVQQVQMMVVMSCTILVMAPIMCIGGIIMALRQDLNLSWILGI
FT                   SVPLLVVSMGFLIARMVPGFRVMQGRLDAVNRVLREQITGIRVVRAFVREPYEVERFGD
FT                   ANRELTETALGVGRLMALMFPLVMLISNVTSVAVIWFGGHQINEGSMQIGSLTAMLSYI
FT                   MQILMAVMMATFMAVMLPRASVCAERISEVLDTDSSVIPPENPVLELKDPGVVELRGAQ
FT                   FQFPGAEEPVLRDITFRAEPGKTTAIIGGTGSGKTTLLNLIPRLIDSTSGSVSVGGVDV
FT                   RDIDTELLCSVIGLVPQKPYLFSGTVATNLRYGNPEATDEWLWECLEIAQAADFVRAMP
FT                   EGLDTPVAQGGTTVSGGQRQRLAIARALVRKPQIYLFDDSFSALDLTTDARLRAALRPV
FT                   TQNACIVVVAQRISTIVEADQIIVLDDGAIVGIGTHDELVVSCPTYGEIVASQLAVQDA
FT                   S"
FT   CDS_pept        381376..383307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03420"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31050"
FT                   /db_xref="GOA:C0ZM73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM73"
FT                   /protein_id="BAH31050.1"
FT                   /translation="MSNRPTSSPPIGPPGGGDPTKKAMNFGPSLKRLLGRLSPDKPIVI
FT                   LIFALVTASVVLSSIAPKILGNATNLIFDGIVSKQLQPGTTKEQAVEGLRASGQGQLAD
FT                   MVSGMAVVPGTGIDFDAVGKVLMIVLLLFVCASLFSWLQAYLLNIVVQRTVRRLREDVE
FT                   QKIHRLPLRYFDTHARGDVLSRVTNDIDNVAQSLQQTLSQLVMSVMTVLGILVMMLWIS
FT                   PLLALIAVATVPLSIMVTAFIAKRSQKHFVAQWKSTGGINAQVEEAFSGHELVKVFGRQ
FT                   QEVEERFRKQNEDLYESSFKAQFISGLVMPAVMFLGNLNYVAIAVVGGMRVASGTMTLG
FT                   DVQAFIQYSRQFTQPLTQIASMTNLLQSGVASAERVFALLDQDEQSEDPKGAKSPTVDK
FT                   GRVKFENVTFSYKPEQPLIEDLSLTAEPGQMVAIVGPTGAGKTTLVNLILRFYELNSGR
FT                   ITLDGIDIADMTRDDLRSRIGMVLQDAWLFGGTIRENIAYGKPGATDEEIRRAAEMSYV
FT                   DKFVHSLPEGYDTVIDEEGSNVSAGEKQLITIARAFISQPSILILDEATSSVDTRTELL
FT                   VQSATAVLRSDRTSFVIAHRLSTIRDANLIVVMEEGRIVEQGSHEALLESRGAYFRLYN
FT                   SQFVGAEI"
FT   CDS_pept        383330..383998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31051"
FT                   /db_xref="GOA:C0ZM74"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM74"
FT                   /protein_id="BAH31051.1"
FT                   /translation="MLIAEDLLLLATDDVSGKLLRSSSYVDVALGGALLVELVLADRVR
FT                   LDGAGWRARAVVIDNRPLADPTLNAALARLAEKPPARPTAVVNRLAKGARKALYAGMGA
FT                   RGIVTAVEHQVLGFFPTVRWPATNPRYEDQLRFVLREILLGVRQPTPTEGALVSILAGA
FT                   NMLKVVVPADQFKAAKARAKVLSQGNWASEAVRQSIAATQAATTAALTATIAVSTSSGS
FT                   "
FT   CDS_pept        384080..385342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="RER_03440"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="protein synonym:queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31052"
FT                   /db_xref="GOA:C0ZM75"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM75"
FT                   /protein_id="BAH31052.1"
FT                   /translation="MPAVDKRPESIFTIGTRLEDRLGRTGTIHTPHGDIATPSFVAVGT
FT                   KATVKAVLPESMKELGAQSLLANAYHLYLQPGPDIVDEAGGLGKFMNWDGPTFTDSGGF
FT                   QVMSLGVGFKKVLAMEAVGVQSDDVIAKGKERLATVDDEGVTFKSHLDGSKHRFTPEVS
FT                   MQIQHQLGADIMFAFDELTTLLNTRGYQERSVERTQAWAIRCINEHEKLTAERAEKPYQ
FT                   ALFGVIQGAQYEDLRRQACRGLESIEGENGYGFDGYGIGGALEKQNLGTIVRWCNEELP
FT                   ENKPRHMLGISEPDDFFVAIENGADTFDCVNPSRVARNAAIYVRSGRFNINTSRFRRDF
FT                   TPIDDECDCYTCANYTRAYIHHLFKAKEMLASTLCTIHNERFTVKLVDDIRASIEGGYF
FT                   HDFKADMLGKFYAAKTPAPQT"
FT   CDS_pept        complement(385333..386058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03450"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31053"
FT                   /db_xref="GOA:C0ZM76"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM76"
FT                   /protein_id="BAH31053.1"
FT                   /translation="MTAQDQQDESTHETKFAHVSRGYYPTIVALFTATLLISNVAATKG
FT                   VAFFADSDFSLGPLQILPIITDGGFFLFPLAYVLGDVLSEVYGFKATRRAIYLGFGALI
FT                   LAAACFWIAVQLPSAEFYENQAALETVVGVIPRLLVAGLAAYLVGQLLNSLVLVMMKKR
FT                   MQEKHLWARLIGSTVVGEFADTLIFCSIAAGVIGISTWEDFINYVLVGFLWKTLVEVLV
FT                   MPITYRVIAYVKKREPTYV"
FT   CDS_pept        complement(386185..386799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03460"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31054"
FT                   /db_xref="GOA:C0ZM77"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM77"
FT                   /protein_id="BAH31054.1"
FT                   /translation="MGAAITYGWNKFKDNALVWIGISIIAFLIAGLIQGAFNGFDYTNT
FT                   EFSALSIVGGLVTAIVGYIIQAAFLRGALSELDGIKPAFGTFFQFTNIGAVVLGGFLVA
FT                   VATYVGLVLCIIPGIIAAFLLYYTLTFIVDKNQDAISGIKSSYALTSSNVGTLILLALA
FT                   LIGINIIGALLCGIGLLVTAPVALIASTYAYRVLTGGHVAA"
FT   CDS_pept        complement(387140..387475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31055"
FT                   /db_xref="GOA:C0ZM78"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM78"
FT                   /protein_id="BAH31055.1"
FT                   /translation="MVSDSDSLILISGLFSGILTFAYFIAMEVTQGRTLGKMILGLSVH
FT                   GPGGAPRPSVQQSAIRNAFTLLSIIPIIGGILALVAYIVIAVTINNSPTKQGKHDELAG
FT                   GTQVVKG"
FT   CDS_pept        387993..388646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31056"
FT                   /db_xref="GOA:C0ZM79"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM79"
FT                   /protein_id="BAH31056.1"
FT                   /translation="MTSSGGNNDDSSSDYQAKPGYGEFPSLPPEGYGVSPSETQSSPEV
FT                   PGYTTPNEQYPGYPPPSYNPTGNTPQPGGIGEPNPYLPPQNFGPPNQYQPNQYQQPGQY
FT                   GQSQYGQPQYGQPPNAYGQPNQFAGGYIPPMQPVGTNGLAIASLVVSLAGGCFYSLGGI
FT                   IGIILGIVALNQIKQTGQEGRGLAIAGIAVGATFLAIFAVILVVALIASASSSY"
FT   CDS_pept        complement(388675..389415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31057"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM80"
FT                   /protein_id="BAH31057.1"
FT                   /translation="MVRELREALDDHQFEVLYQPQVNLNSSAIISYEALLRWRHPLRGL
FT                   IEPQDFMRSAESSGLIIPIGLQALDMICAQTASWPEHMMVAVNFSPRQLATPHAAHEIL
FT                   GALDSSETPLSRIIVEVTELGVVGRHAAETLHVLHNEGIRIALDDFGAGFASFSALSEL
FT                   PLDILKIDQSLTWAVSAAGRAGDRAFMVMESIADIARKLGLDSIAEGVETAEHAANVLQ
FT                   AGCDMGQGYYFGKPLPASSIVTPV"
FT   CDS_pept        complement(389671..390567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluQ"
FT                   /locus_tag="RER_03500"
FT                   /product="putative glutamyl-Q-tRNA(Asp) synthetase"
FT                   /EC_number="6.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31058"
FT                   /db_xref="GOA:C0ZM81"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM81"
FT                   /protein_id="BAH31058.1"
FT                   /translation="MAGAGRFAPSPSGDLHLGNLRTALLAWLFARTSGRDFLIRVEDLD
FT                   RVRPGSMERQLDDLRRLGLTWDGPVVLQSHRLPLYHNAIELLRERHLTYPCFCTRKEIL
FT                   QAPSAPHAPDGAYPGTCRNLSAAERAEKSASGRSPALRLRADIDSFTVHDELFGEVTGQ
FT                   VDDVVLLRGDGVPAYNLAVVVDDGAQNIDQVVRGDDLLTSAPRQAHLAQLLDIEPPSYA
FT                   HVPLALNSEGKRLAKRDGAVTLADQLEAGRSAEQVLTMIASSIGLAEPGEVVTPPQLAD
FT                   RFDSRTIPRTPWIFPAK"
FT   CDS_pept        complement(390569..391177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03510"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31059"
FT                   /db_xref="GOA:C0ZM82"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM82"
FT                   /protein_id="BAH31059.1"
FT                   /translation="MPERRKSSTSPDLLAAALFDVAAESGLENASVREVAKRAGVSIGA
FT                   VQHHFSTKDEMFAFALRTLVDRLLTRLAESSADADPHTALFQALSQLLPLDEQRTREAH
FT                   VLAAFAVRAATSEPLSEIRRTTLFTIRTGISTVLIGIGTPEAETRAALLLSTVNGLALD
FT                   ALGSPAMYPPQYLDHALETQIRLTLHDAENPLASVGLAS"
FT   CDS_pept        complement(391229..391840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31060"
FT                   /db_xref="GOA:C0ZM83"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM83"
FT                   /protein_id="BAH31060.1"
FT                   /translation="MSEIINHDAPRWRRIAVMTSTEISPAHRYRDLAAGFTARIDAVPA
FT                   DRWDNDSPCEGWTARDVVRHVLDSERDMVKVVGLELAPGPSVDDDPSAAWAAVRDSMQA
FT                   ILDDPAKSTLEYDGHFGRTNLGATVEGFLCFDLVIHGWDLAAATGTDTTMRNTDVEWVS
FT                   EIAAGLGESIRMSGVCGPEIQVPDNADKATKLLAFLGRKA"
FT   CDS_pept        complement(391841..392932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03530"
FT                   /product="putative AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31061"
FT                   /db_xref="GOA:C0ZM84"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM84"
FT                   /protein_id="BAH31061.1"
FT                   /translation="MKMHDTCNMIEETQDSAVLDDVDLALINCLQLDPRASWRTVGDAL
FT                   KVDPVTVARRWQRLQDSGTAWVSARATGHGRPESCLAFVEVDCTTSNALAIAERLARWP
FT                   QVLSVEHTSGPGDLTLLVEVRDMAFLSRFLLRSLASVPGIVSSRAHLVTEVFAIGDDWK
FT                   LQVLDATQRAVMTDRPVRYKYAPTDQRHHGKTFDAVDRQLILKLGEDGRSSIAELTVGT
FT                   GLSESTVRRRLAELTSRNQIVFRCDVSLPLSGWPLVTWVWGYVDPTDRSTIRALVERVS
FT                   GTRVCMRISGGRANTLLAIAAHSLRETPITEVQLAQEAPGLVVLNRSVVLRSMKRVGRL
FT                   LDDEGKSAGVVPMDIWAEAPEIE"
FT   CDS_pept        393020..394207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="RER_03540"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="protein synonym:N-acetylornithinase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31062"
FT                   /db_xref="GOA:C0ZM85"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM85"
FT                   /protein_id="BAH31062.1"
FT                   /translation="MSSTTLSAVPTERSLDWVQRLIGIDTTSAVSNRPLIDLIAAELRR
FT                   HGVEPILVSDDEGSKLNLLATFTPPDGSTAGGVMFSGHTDVVPVDDQDWSSHPFTPEIR
FT                   DGSLYGRGTCDMKSFIGIVVAAIPDIVARPLAKPIHFAFSYDEEVGCIGAAGLVEEVVS
FT                   RNLRPDVCVVGEPSEMRVIRAHKSMNVIRVDLHGVSAHSSLTPRGVNAIEYGAELIRFV
FT                   RSAADELRASGPYDDAFDVAWTTCSVNLVSGGIAVNTVPEDCSITFEFRSISSAGAADL
FT                   LERFAAEANRIENLMQEENPSASVTMHVSASVPPLETDANASAAALVEQWGGRPSDEKV
FT                   AYATEAGMFASIGVPTVVCGPGSITQAHAPDEYVTLDQLAQCEQFVRNVIAHARA"
FT   CDS_pept        394235..395524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03550"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31063"
FT                   /db_xref="GOA:C0ZM86"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM86"
FT                   /protein_id="BAH31063.1"
FT                   /translation="MSTATTPTSGAVTPERLAAARKAVISSSLGAALEWFDVIVYASFA
FT                   VVIAHNFFPGGDNTLGLILTFATFAISYVIRPLGGMVLGSYADRRGRKNALTLTMMLMM
FT                   IGTLIMAVAPTTSMIGPWAGVVILVSRLIQGFSAGGEFGTATTFLVETAPHKKAFYSSW
FT                   QVASQGASVFLASLFGYVLNTHLSHEALYSWGWRVPFFFGIIVGPVGLYIRAKLDETDD
FT                   FKTSVPEKAPLKTTLTRHLGRVLTGAAVVGVATISIYLILYMPTFAVKNLGVSASAGYL
FT                   GGIVAGLVTLITVPLIGHLADRVGPARVMTWAAVAAIVLAWPLFKLMVDHPSTLTLVLV
FT                   VSALGVIMAFAFGPLPALMSSLFPAEIRATGMSLSYNLGVTLLGGIAPLVLTWLISTTG
FT                   SLDAPSYYYMTVAVLSLGGLWSARTLFSQK"
FT   CDS_pept        complement(395547..396326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03560"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31064"
FT                   /db_xref="GOA:C0ZM87"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM87"
FT                   /protein_id="BAH31064.1"
FT                   /translation="MGWYTPQSVAPELSDILVCGWTACAEGEHLLVPDACMDVLWIRGV
FT                   GIRVCGPETAAWSFTLPPGTRSVGVRFRPGSASPMLRTSASELRDSRADLSAVTDARTE
FT                   RILLNRLENSEDHEQVSILESAVRSWASSSFRHDPVINHVRTALSEHSWNVSTLADAAA
FT                   LTSRQLQRRCNDAFGYGPATLRSILRLQRFMALARSRPALGLAESAAHCGFSDQAHLTR
FT                   ECRRISSLTPAALLRTQAPDWHGSETVVALAEGDAVA"
FT   CDS_pept        complement(396366..397037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03570"
FT                   /product="putative OmpR family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31065"
FT                   /db_xref="GOA:C0ZM88"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM88"
FT                   /protein_id="BAH31065.1"
FT                   /translation="MSLILAATDRSELAQTLGAELVHFGHQTQLVRTGRRLLDDLDTDS
FT                   FDIAVIDLLLPDIDGYEIARQIRLRSSMPIMMLVDTHEDIDEAPHGAVSDFVLNPIDSH
FT                   ALDLRVTAILRETAHPAAGKHQRHGDLLLDRRAMTATMGGKLLVLSRTEWRVLLELSTE
FT                   PGRVYSRDHLIRNVWGSDHEKTRVVDATILSLRSKLESNPAKPKYIKTIRGFGYRFGPV
FT                   E"
FT   CDS_pept        397172..397480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31066"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM89"
FT                   /protein_id="BAH31066.1"
FT                   /translation="MGTLFALTLPGLLVLLVLFAFAETLWNRLTGGRALPWTRGRTTRP
FT                   VSAAGFEEVAALFQGSKHHEFEQRQSALMHREDGTDGDPPWVSVDPEANKVVLRRRS"
FT   CDS_pept        complement(397568..398386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31067"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM90"
FT                   /protein_id="BAH31067.1"
FT                   /translation="MLAGQTNLLADCSSCFGLCCVALPFSKSSDFATNKNAGDPCKNLQ
FT                   QDFRCGIHTGLRKKGFTGCTVYDCFGAGQKVSQQTYDGISWHDAPETASDMFETFPVVR
FT                   QLHELLWYLAEARSLKQTHSIRKELDAALAETESLTNGTPSQIQAVDVSAHRATVNTLL
FT                   LQTSNLVRSPISGKKGRKLDHRGADLIGAKFRGSDLRGANFRGSYLIGADLRGCELDRA
FT                   DLIGADLRGTDIRGAKLRGSIFLTQFQINAAVGDSATTLPDSLTRPGHWA"
FT   CDS_pept        398782..399135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31068"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM91"
FT                   /protein_id="BAH31068.1"
FT                   /translation="MIGAAAPRTDDQWTRMICSSWEAPEHVGGHVYATAAANDPVPMIG
FT                   DVFGGLSHGANPANDLPLIGFGATVIESAPGTGIDAGLLGELPSPVAHSEYWERTNPAL
FT                   AGMGHVIAGLGAP"
FT   CDS_pept        399132..399722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM92"
FT                   /protein_id="BAH31069.1"
FT                   /translation="MTNATRRRKALGMSSIAVAILLSACTTLLSACTTTENGKVMEANL
FT                   NLTLMQAQAKVIEYMTDTITVLPPGAYLTRYSELNQKVTLDPGGTVPCNDSNLSKDTSV
FT                   DYGVTYFLTSTETADIPGFGDPIRNLWTERGWKFRTYDSAGDSTSTETILPDGYRMVLE
FT                   EYARGASLTGSSPCFPRPDASDRPNAPVQIDQP"
FT   tRNA            complement(400207..400294)
FT                   /locus_tag="RER_t0080"
FT                   /product="tRNA-Ser"
FT   ncRNA           400430..400532
FT                   /locus_tag="RER_srp0010"
FT                   /product="bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   CDS_pept        400572..401864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspT"
FT                   /locus_tag="RER_03620"
FT                   /product="aspartate aminotransferase AspT"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31070"
FT                   /db_xref="GOA:C0ZN18"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN18"
FT                   /protein_id="BAH31070.1"
FT                   /translation="MPIQTQIGLMSHEELTSEHESQSAKYTQLQAQKLALDLTRGKPSP
FT                   EQLDLSAELLTLPGDGDFRDGSGTDCRNYGGLTGLPELRAIFGELLGIPVANLLAGNNA
FT                   SLEIMHDNVVFSLLHGTPDSARPWAQEEKIKFLCPAPGYDRHFAITESLGIEMIAVPMN
FT                   HDGPDVVKIAELVASDPQIKGMWAVPVYANPTGAVYSEEIVRTLASMPTAAPDFRLYWD
FT                   NAYAVHPLVGETAPSYDILSMAAEAGHPNRPLVFASTSKITFAGAGVSFFGSSAENLAW
FT                   YQKFLGKKSIGPDKVNQLRHLRFFGNADGVRAHMEKHRAFLAPKFELVLRILEDRLGAS
FT                   KVASWTEPKGGYFISLDVVDGTAKRVIELAKNAGIALTAAGSAFPYSTDPDDRNIRLAP
FT                   SFPSTAELEVAMDGVATCVLLAATESRLSEI"
FT   CDS_pept        401963..403318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03630"
FT                   /product="putative glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31071"
FT                   /db_xref="GOA:C0ZN19"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN19"
FT                   /protein_id="BAH31071.1"
FT                   /translation="MTGAINASDGPSFEAHTAKSESVIEADIPRRSLRVGVLGFSVLGV
FT                   LAVASVLMVLFAVPMNTRYWGIFENFLDLDVYRHGGSVVVQGLPLYDGPVLEGMMFTYT
FT                   PFAALLFTVWAVLSFKQAIVVWTGLNIAALFAVIVLCWKYLGYRLDVKAYAVSALATTI
FT                   FLFMEPIRTTLWLGQINIFLLLLIVWDLGRDEKSRLRGIGAGIAAGVKLTPAFFWAYLF
FT                   ITRQWRALVTAVVTFAATVAIGFVVIYNDAYKYWTGTLVDSERVGPTDAPSNQSVSGLI
FT                   AQITHTPTPSRILVLVFSALAVCLGLGAAWIAHRHGQKLLGLTMTGLTATTVSPFSWGH
FT                   HWVWFVPLVVLAAHYAMVSKKRWAWVAPFVFLLPVLNWSHTWWDPSVIPGTDRFVGMGL
FT                   FMFVPPEYLRIPTVGVYLWVFTLAAVSTLVLFGWKKWKIPAPDASAPVTTAA"
FT   CDS_pept        403337..403918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31072"
FT                   /db_xref="GOA:C0ZN20"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR017658"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN20"
FT                   /protein_id="BAH31072.1"
FT                   /translation="MALQLNLVGDPEADALLAEDPLALLIGMLLDQQVPMETAFLGPKK
FT                   LADRLSGIDVRRIADMDTDEFIAICAEPPAVHRFPKSMGERIQLMCQFIVENYDGDTAA
FT                   IWTSGNPDGKEVLKRLKALPGYGDQKARIFLALLGKQIGVEPKGWRQAAGDYGLEGSRR
FT                   SIADVVDEQSLLEVREFKKAAKAAAKADKK"
FT   CDS_pept        complement(403926..404834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03650"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31073"
FT                   /db_xref="GOA:C0ZN21"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN21"
FT                   /protein_id="BAH31073.1"
FT                   /translation="MTRRWPDLTTLELLVGIDDHGSLSAASRLAHIAQPNASRAVKALE
FT                   RQLGMPLIHRRSTGATLTPQGTVIVHWARRVLANSRQLLDVAEGMRTERSAELTVCASM
FT                   TVAEHLIPAWLGVFRSLHPGVTVHLQVYNSTRVLEAVEVGMCDLGFVESPTVPKSLPSV
FT                   TVARDSLVVVVHPDHPWARRRKPLTVAELAATPLLVREPGSGTRTTLDLALHEYERGAP
FT                   LLELGSSAAIRTSVLGGVGPAVLSTLAVEDQVKQGELRVVAVEGLELDRSLRAVWRPPR
FT                   QLEGPAGDLMKVVRASGSRKS"
FT   CDS_pept        404936..405982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03660"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31074"
FT                   /db_xref="GOA:C0ZN22"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN22"
FT                   /protein_id="BAH31074.1"
FT                   /translation="MNRDVKSVAEKPAVAPSSEVRRWSSVAALVPGVALCALGATVALI
FT                   AGQFTSAVSPLLIAIVAGAVLANTVSLPAKFQPGLAFSAKRLLRVGIALLGLQLMFSDI
FT                   VGLGWGVIAVVVAIVFLGIAGTMYAGKLLGLSWSQRILIACGFSICGAAAVAAADGVVN
FT                   AREEELLTAVALVVIFGTLMIPTIPLLADAFGMNEIEAGMWAGGSIHEVAQVVAAGSAL
FT                   GATALGVATVVKLARVLMLAPVMAFLSIRQRTMVDNTATKRPPLIPLFVVAFIGCMGLR
FT                   STGMLPNELLGLAKTVQTALLAAAMFALGLGVRLSVIRGVGARPFVLAAISTVWVATIA
FT                   YVGVVLVS"
FT   CDS_pept        complement(405975..407039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03670"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31075"
FT                   /db_xref="GOA:C0ZN23"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN23"
FT                   /protein_id="BAH31075.1"
FT                   /translation="MLNLTRHTTQHFGTSSKGGPMKPLARYASLNRYVDLCRTVDVDAV
FT                   ALMRSVGLSPASLANPDQWVPAASIASLLERSAAESGHEDFGLLLAGLRRLSNLGPLSL
FT                   VIREEPDVRSALDVLMRYEHTYNESLRIRLNEVNGLATLRISLEVGEPVDTRQSVELAV
FT                   GATLQILRSFLGSRWHPVSVGFTHNAPKDTSTHRRILGDTVEFDHEFTGIVFFAADLDA
FT                   ANQLSDELLRPYARQFLDSLPASETSDTLSRTKELIEVLLPTGRCSVEQVARSLGFDRR
FT                   TLHRHLAESGDTFTAVLNSVRSTLAERFVANPRYSLTEVAVHLGFSTQGSFSRWFRTQF
FT                   STSPSAWRTQRSIS"
FT   CDS_pept        407180..408154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="RER_03680"
FT                   /product="probable NADPH--quinone reductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="protein synonym:quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31076"
FT                   /db_xref="GOA:C0ZN24"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN24"
FT                   /protein_id="BAH31076.1"
FT                   /translation="MANAIRFHEIGTPSVMRWEEIEVGRPGAGEVRVRHEAVGLNFADT
FT                   YFRSGLYPAQLPAGMGVEGAGVVEEIGEGVVDFAVGDRVTYTGSPLGAYATERIMASSD
FT                   LIALPDGIAFDTAAAMTMRGLTAAYLLRRIYPLKAGDTVLLHAAAGGVGLIFTQWAKLL
FT                   GIKVIGTVSSDEKASVARAHGCDEVVIYTREDVVARVKEITGGVGVPVVYDSIGQSTFD
FT                   ISLDCLARRGLLVCFGTASGPTPPIQAMQLAVKGSLFLTRPALADYIADPEERAELAGE
FT                   LFSHVESGRIKIEINQRYPLEDAVRAHHDMESGRSIGSSVFSV"
FT   CDS_pept        408185..409084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03690"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31077"
FT                   /db_xref="GOA:C0ZN25"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN25"
FT                   /protein_id="BAH31077.1"
FT                   /translation="MTNTATLTENLPSSTSTIRVEKLTCSIGAELSGVDLGEVARDAAL
FT                   FAQIKGLLLEHKVLFFRDQNFSKAEHVELAQRFGELEDHPALGSDPDHPGLVRIYKDLD
FT                   SPPEHFENAYHCDATWRVNPPMGCVLRCVETPPVGGDTIWVNMALAYENLPARVKEQIK
FT                   DLRARHSIESTFGARMPIDQRHQLKERFPDAEHPVVRTHPETGEKILFVNSFATHLVNY
FT                   HTPENVRYGIDYAPGAGNLLTYLASQAQIPEYQVRWRWTENSVAIWDNRSTQHYAVQDY
FT                   WPAVRKMERAGIIGDAPF"
FT   CDS_pept        409136..410188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31078"
FT                   /db_xref="GOA:C0ZN26"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN26"
FT                   /protein_id="BAH31078.1"
FT                   /translation="MHFHDDSLFPETQDKLVITVAPYGPEWEPDDFAEDLPLSMDEHVQ
FT                   QAVDCFNAGATVLHIHVRELDGKGSKRLSKFNELLGRLREAVPEMILQVGGSISFAPEG
FT                   EGADAKWLSDDVRHMLAELEPAPDQVTIAINTSQMNIMELMTDDDIAGTSMQRPELADT
FT                   YREMTVPAGPEWVAEHLRRLQAAGIQPHFQLSSIPQLETVERLIRRGIYTGPVNLTWVA
FT                   IGGGFDGPNPYNMMNFVQRVPDGACLTLETLMRSVLPVNTMAIAMGLHARCGNEDTIWG
FT                   RKGEKMTSVQQIEQLVRIAGELGREVATAKEARDIYRIGETYADTDETLAKLGYAPNRR
FT                   IGQLGFTQHA"
FT   CDS_pept        410285..411646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03710"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31079"
FT                   /db_xref="GOA:C0ZN27"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN27"
FT                   /protein_id="BAH31079.1"
FT                   /translation="MGLQAPATPRVDTALGIGGRRKLYPWIVFALAFGLLLSDYMSRQV
FT                   LSAVFPILKADWDLSDSHLASLSSVVALMVGLLTFPLSLLADRWGRVKSLILMAVLWSV
FT                   ATLLCAIAQTYEQMLGARFLVGVGEAAYGSVGIAVVLSVFAPRVHAALAGAFMAGGSFG
FT                   SVIGVAIGGFIAVQFSWRWSFAAMAIFGLILVALFRALVTEKKLTAYAVEAAPDAAGEA
FT                   VRNDGFRAPVSSLFTNPAVLFAYISGGLQMFTAAVLLAWLPSFFNRYYDLAPDKAGVTA
FT                   SVFVLLVGSGMVVCGFITDRFSRDDSARKWTTAIVYCAISLVTLSIGLRLDTGTAQLVL
FT                   LGIGAFFSAGSSGPTAAMVANLTHHSIRASAMGTLTVANNLLGLALGPFVVGILADHLG
FT                   LLGALQLSPFVYVVAALALVAGKRAYPAGMRRLATLQNRPEIPGATEVAEVRSS"
FT   CDS_pept        411646..412269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31080"
FT                   /db_xref="GOA:C0ZN28"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN28"
FT                   /protein_id="BAH31080.1"
FT                   /translation="MDESPTVVIVPGLRDHVEDHWQTHLARRLDNVLTVPPLETDKLSR
FT                   DARVAALDEVLTSVSSPVVLVAHSAGVMTVAHWARAHHRDVAGALLVTPADLELPLPES
FT                   YPSLEELDRNGWLPIPRQRLPFPSTVAASRNDPLAGYRRVVGLAEGWGSRLLDLGEVGH
FT                   LNPASGYGYWPRAESLVRELRESVSRAASSHATDSDAQVEHSHA"
FT   CDS_pept        412262..413851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03730"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31081"
FT                   /db_xref="GOA:C0ZN29"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN29"
FT                   /protein_id="BAH31081.1"
FT                   /translation="MLDLAALLEDSARRYPERDALVLGEARLTYAQFDAYANRIAHLLV
FT                   SRGVEPGDKVALSCPNVLEFPIVYYGILKAGGVVVPLNILLKGREIAYHLADSEAKLYF
FT                   CFEGSPELPIAEYAIAGFEQSETCSALIMISAEPGAPSSILGVETLGEALASVSGTETP
FT                   AAAVVREPTDTAVILYTSGTTGKPKGAELTHCNMVLNALSTNRLFESAPSMHERYLLTL
FT                   PLFHSFGQTVTMNAGICVGATLVLMPRFDATAALEIMGREKISVFAGVPTMYWGLLGVL
FT                   EEVVKSGVDVETVAQNMRCAISGGAALPVEILTQFRERFGVQILEGYGLSETSPLALFS
FT                   DPESDPRPGSIGVPIWGVEARLVDDSWRTITGPDEVGELAIRGHNVMKGYFNRPEATAE
FT                   VMCDGWFRTGDLARVDTDGNYYIVDRAKDMIVRGGFNVYPREIEEVLLTHPAVSLVAVV
FT                   GVPDTSLGEEVVAFVIREPSEEISESDLVEWSREQMAAYKYPRRIEFVPSLPMTATGKI
FT                   LKRELNQAFSIV"
FT   CDS_pept        413860..414231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31082"
FT                   /db_xref="GOA:C0ZN30"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN30"
FT                   /protein_id="BAH31082.1"
FT                   /translation="MTDVRASEAFPVTQAMKDSGGWNPLWDGLSELDPEWTELYMKTAM
FT                   QPWNSGVLSPQVIQLLCIAVDAASTHMYAPGVRRHIRAALDMGVTPKEILEVLKLTTVV
FT                   GIHSCNVGVPILMEEIANR"
FT   CDS_pept        complement(414238..415569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt"
FT                   /locus_tag="RER_03750"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31083"
FT                   /db_xref="GOA:C0ZN31"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN31"
FT                   /protein_id="BAH31083.1"
FT                   /translation="MREEKTVPATIDAGATAWLLVSTALVLLMTPGLALFYGGMVRSTG
FT                   VLNMIMMSFVSIALVTVAWLFVGYSLVFGDDHGGIIGGLEHIGMAGIDPSTVHGNVPEV
FT                   LFATFQLTFAILTAALISGAIADRAKFSAWMIFVPIWSLLVYVPVAHWVWNPQGWLAQM
FT                   GALDYAGGLVVEIVSGASGLALALVLGQRMGFKAESMRPHNLPFVLLGVGLLWFGWFGF
FT                   NAGSALAADGMASQIFLNTLVAGCTGLLGWLFVEQNRDGHPTTFGAASGVVAGLVAITP
FT                   SCGTVNMFGALVIGLIAGIVCSYAVGWKHKLGYDDSLDVVGVHLVGGIVGSLLIGLLAT
FT                   AVMTGGPEGLFFGGGFAQLGKQFVGVVVVALYAFGVTYGLGKLIDKTFGFRISREDEAR
FT                   GIDVALHAESAYEHGVLGHGPIGGQNPSPFLQRQREERENRERD"
FT   CDS_pept        415714..417960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="RER_03760"
FT                   /product="DNA polymerase III gamma/tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31084"
FT                   /db_xref="GOA:C0ZN32"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN32"
FT                   /protein_id="BAH31084.1"
FT                   /translation="MALYRKYRPASFAEVVGQEHVTAPLSTALDTGRINHAYLFSGPRG
FT                   CGKTSSARILARSLNCEQGPTSTPCDVCDSCVSLGPGGTGNLDVTELDAASHGGVDDTR
FT                   ELRDKAFHAPAASRYRVFIIDEAHMVTAAGFNALLKIVEEPPEHLIFIFATTEPEKVLP
FT                   TIRSRTHHYPFRLLAPSTMRGLLEKICAQEGVPVEPAVYPLVIKAGGGSPRDSLSVLDQ
FT                   LLAGAGEEGVTYPRALSLLGVTDVALIDEAVDALSASDGAALFGTVDRVMDAGHDPRRF
FT                   ALDLLERLRDLILMQAVSDASERGLVDAPEAELVTMREQIQRVGPATLTRFAETVHAGL
FT                   SEMRGATAPRLLLEVMCARMLLPSASDTESAVLQRLERLEQGIPAAGVAAAAAPRAAAT
FT                   PAPTVPPLEPEIASKFQRPSQRKAEPEARPEPAAPAPAAPPVVEAPVVEPPVAAAPVVE
FT                   PPTVEIVEPPVAEAPVVEAPVVEAPVVEAPVAEAPIVEAPVVEPPAPAPVEAEELIGLA
FT                   EPEPDYEPEPEYEEPAAAEAAPVSAGPTVETLRESWNTLRNKVGERNKVLPAMLSAATV
FT                   HDVRGHVVVIAHGSPVLGARVTQPHNAAVICEVLAEMFGGTWQVEYQEGAPTAPAASSA
FT                   PKATEAASRPAAAPRFSRPSQERAAQQPKAPQSQRGDSDDIPPPEAPDYPEDPGPAPAP
FT                   EVDYEATPPPATPEDEDEMFAEAAEPADPTARRDPEDVAKELLKDVLGARRLES"
FT   CDS_pept        418578..424757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03770"
FT                   /product="putative polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31085"
FT                   /db_xref="GOA:C0ZN33"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN33"
FT                   /protein_id="BAH31085.1"
FT                   /translation="MVSLRSIESPVDARENRKCKMTEDSTNPAIAIVGMSMWSPGAHDL
FT                   QGFWENVLARRMQFRKFPESRMSLDDYWSASPDDVDKTYADRGAFMDGFEFDWVGRRIP
FT                   ERTFKSTDLTHWLALETALGALADAGYSRGSVPTGRSAAIVGNSLTGEESRMWSMRLRW
FT                   PYVKRALAVAAEARQLDSSVADALAETMEEVYKGPLVEPSEDTLAGMLSNTIAGRICNY
FT                   LDFNGGGYVVDGACASGMLAVATAAEKLASGAADFVLAGGVDVSLDPLELVGFARLGAL
FT                   TRGDMNVYDASRSGFIPGEGCGFVALKRLEDARADGDYVYATIRGWGISTDGKGGITKP
FT                   RAETQAEMIRRAYSGAGFAASEVAFVEGHGTGTPVGDPVELAGVQQAAQTDGPVEARSI
FT                   GMTSLKSLIGHTKAASGILALIKATMAVNQRILPPLAGCTDPNPAFGTEAPALFPLVNG
FT                   EIRDPSEKMRAGAQAMGFGGINCHVAIESADAPSSKLTPSQDVRTMMASYQDTEVFVLS
FT                   ADSAVDLATRARDVADLAVPLSVAELLDFSAKLSRVISPTAPFRAAVVAGRPAQLAERM
FT                   RQLAVICENSAPASGQVKVVSNEISISNSVRHDIGFLFPGQGSQQLEMARVLIERFEWA
FT                   RELATKADGWLEGVGAEAITPRILRNPVKSADAAELAKWKRDLAQTQFTQPAVALASLL
FT                   WFEYLRRLGVTPSAVAGHSLGELTALYAAGAYDQKTLITLAAAKGAAMAVSGGGNGAMA
FT                   SLTCDRSTAEAIIAEAKGYATVANLNTPTQSVVSGTKDAVDDVVAIAKTRGVSAQALAV
FT                   SNAFHSEMMNEAERELKSTAPVEEQVDSLTCPVYSCVEGERVQTPLALREFVTKQVVSP
FT                   VDWVKTVSGISQEVDLLVEVGPGRVLTGLTKAINGTDGVRCFPVASKSGRDEDFNVALA
FT                   AMYVHGAQVRWNELFDGRFVREFVPADQKVFIENLAEAKLTVTSAPEPLALGTSGGDPA
FT                   AALADYLSRRGTFLVDVIRADVGSGATSPSSPSVPSAPTSRAVTNGHESVAAKAPSPVS
FT                   APVVEEPAVAGAGSVESELIRILADTTGFPAESITTDLRLLDDLNLDSISAAEAISKVA
FT                   HQFEVVDLDPAELANATIGEAASLILAASPHPGSAVPAASSAQSDVSRILLEVIAEDTG
FT                   FPVESLDVDLHLLDDLNMDSIKAADAIATVATRLGVQGDLDPAELVNVSLGELIEVLDR
FT                   SAKEKSGQQQPAARALPAKAKGISADSFTWVRDYTLEKVRSETALHGVRDLTDTTFVVI
FT                   GDDAGLVGRLESELRGRGAQVDIRTFSDSTTANAHHVVAVMPRVTDDSVTESGLRRGIE
FT                   HMYKIVPAQQSGGARTTLAVVQFTDVELSNPAPVPSVAAFTASVHHERPELDVRVIGFD
FT                   GSTADAEVAATVVSELDSVAPYVFATYDAEMGRTALQPRVLASNDYTVRESGLGSSDVV
FT                   VVTGGAKGIMAQCALALGRKTGAELVLIGSSQRQAGDEIASTLADFTSAGLSAHYYRCN
FT                   VTDAAAVAGVVAQIEVEVGSITGFVHGAGANVPRRFERVDSAAAFKEVAPKVLGAANFV
FT                   EALADRDLKLFVGFSSIIGFTGMPGNSWYAYGNELLDEMVVRYAAGHPKTRTFSLAYSV
FT                   WGETGMGARMGSVNHLAKMGVMPISTAAGVDHFLRLVDSGPEASRIVVTSRLGGLDTWA
FT                   PAAPALPAVSRYIDQVVTFEPQVELVTRTTLSTSADPFVLDHVWKGSALLPTVFGLEAM
FT                   SQAAAYVTGRVTLGRVRIDDIKLDRPIVVDTVEGTRVEIKASVVEQDRDAAGTRVHVTI
FT                   GTERTGYGRPHFSADFIFGLDESLPEFEKELPRPVLDIDPLDDLYSWLLFQEGDFRRLE
FT                   EISSLDSEHILFSAISRADRKQHLLGDPYFLDSLLQSGQIMVPREICLPVNIARIDMYD
FT                   GRFEARSFTAYAYDKVQTETHMQADVAVVKDGRVVMQLEGYRSQILSHDESRPTAEEIA
FT                   DPTARDAQIILDKLAQHSRALGVKSPRVVVAHTPGIHELTKSERHEQEKPIAEAAVNIH
FT                   LDEDVVIK"
FT   CDS_pept        424754..426340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31086"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN34"
FT                   /protein_id="BAH31086.1"
FT                   /translation="MSNAFAIEWQETGKPVVVGDIPPSVDVSLSHDGSKSLSSAGDWPQ
FT                   GCDIEPIRSRTVVQWKALLGSARIPLLDELIAGGESLDRAGTRLWAAAEAIRKATGQMS
FT                   VSLAMGAREDDAVTFRGGAEGSLVVLTFPALLTDNEERILAFVTDEADAAERVSDEADA
FT                   EEPAQGPAPQFDSGPLSAKSLAQFDPMAYGSDVHVVARSGYPAVSIRFPVGFRDACNVG
FT                   GSVGFASFALWLGALRERGTGPISKQIVEDMATGRWGMVTNNSEVFIDENLYTDDIVEG
FT                   TIWITELTGPDRATTNLHVEWCRVDGETRTHIGWSAMQTTWVEILSHGVVAARPMPQYF
FT                   HDFIEPMTIPTGAKNIAVPTQPKDVDRGSLIRSAPMVPRNPYLLESEVFSTTMQDGNVV
FT                   GNIYFGNYYIWQSRVRDKFLARSQREAMAARGALGELRCVHTRVEHLREVMPFDDVLVT
FT                   MSLAALYERGIDLEFEYFKVNQDGSREKLAIARHRTVWTMPGAPGELEISPPSKLPQSL
FT                   IDSVLEAIDGK"
FT   CDS_pept        426429..428276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03790"
FT                   /product="putative multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31087"
FT                   /db_xref="GOA:C0ZN35"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN35"
FT                   /protein_id="BAH31087.1"
FT                   /translation="MGIGVSRRSVLKGSAVGTVAVALGAKASAVPTGSADIESPLIFHS
FT                   PEFEPFCDELPSLSTLSGNEITLTAQVGQHAFHRDFPSSPALSYRSGEIGGGYLGPTVE
FT                   AHSGEPIMLTFENDLTGHPLAADMDMTLHGMQADFRANPPTSLHLHGGVTSPESDGHPE
FT                   LLVMPGQAAMHHFSHGQEAAHLWYHDHAMGITRLNVYAGLIGNYLIRDEFDTGKLGNPL
FT                   GLPAEEFEIPLILQEKIFTPTGAQNGRSTILIPEGSWEGGAVGDVGLVNGKVWPELSVA
FT                   RGLYRFRIVNASSASVWNLHFSNMMTFWVIGNDAGMLDAPVAVNAFRCAPGERYDLLVD
FT                   FTGLSEGSTVELRNDEAPPLPAAVIGEVTMPLFCRFRGDSRRGFTGGVPSQLRGGRRQR
FT                   DVLAPLEQPTVIRTVTVSQQLELRNPPAQMTLNNLTFSTTDVERPRQGTVEQWNIVNTT
FT                   PDPHPIHLHLVNFRILGRTPMRTLEYLIRHPQPVIGNKWTPSPDGFEAGPMIAPAPWEA
FT                   GMKDTVRVDGGTVTRIIVRFPTEDELGFDPDAMFDRLPSAVMTGGGMTGGDQAHQGNGH
FT                   HGMSNHDASNTGRLQGYVWHCHLLDHEDHDMMLPYRIVP"
FT   CDS_pept        428499..429713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="RER_03800"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="protein synonym:3-ketoacyl-CoA thiolase"
FT                   /note="protein synonym:fatty oxidation complex beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31088"
FT                   /db_xref="GOA:C0ZN36"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN36"
FT                   /protein_id="BAH31088.1"
FT                   /translation="MTTEAFIYEAIRTPRGRGKKTGSLHSVKPISLVTGLIQELRVRFP
FT                   DLDEDRISDLILGVVTPVGDQGMDIARVAVNDAGLPDTVGGVQLNRFCASGLEAVNMAA
FT                   QKVRSGWDELVIAGGVESMSRVPMGSDGGPWALDPATNYDNYFVPQGVGADLIATIEGF
FT                   SRDDVDAYAVRSQDLAAKAWTGGYFAKSVVPVKDINGITILDNDEHMRPGTTAENLAGL
FT                   ASAFGVIGEIGGFDAVSLQKYHWVEKINHVHHGGNSSGIVDGAALVLVGSEQAGKDMGL
FT                   TPRARVVATATSGADSTIMLTGPTPASKKVLAAAGLTVDDIDLFEINEAFASVVLKFQK
FT                   DLNIPDEKLNVNGGAIAMGHPLGATGAMITGTMVDELERRGGKRALITLCIGGGMGVAT
FT                   IIERV"
FT   CDS_pept        429759..431900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="RER_03810"
FT                   /product="fatty oxidation complex alpha subunit"
FT                   /note="multifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31089"
FT                   /db_xref="GOA:C0ZN37"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN37"
FT                   /protein_id="BAH31089.1"
FT                   /translation="MTDQNIINWDQDADGIVVLTINDPNQGANTMNDAYIASMKATVDR
FT                   LVAEKDSITGAVITSGKKTFFAGGDLKNMIKVGPEQAEEIYNHSVEIKADLRRLETLGK
FT                   PVVAAINGAALGGGLEIALATHHRIAADVKGVKIGLPEVTLGLLPGGGGVVRTVRMLGL
FT                   QNALMGVLLQGQQRGPVQAKEVGLIDEVVGSVEELVPAAKAWIKANPEGGVQPWDVKGY
FT                   KIPGGTPSTPAFAANLPAFPANLRKQLKGAPMPAPRAIMAAAVEGSQVDIDNALLIEAR
FT                   YFTSLVTGRVAKNMIQAFFFDLQSINGGGSRPAGIEKSTIKKVGVLGAGMMGAGIAYVS
FT                   AKAGFDVVLKDVSIEAANKGKAYAEGIEAKALSRGKTTQEKSDALLAKITPTADPADFA
FT                   GVDFVIEAVFESQELKHKVFQEIEDIVDPKALLGSNTSTLPITGLATGVKRQEDFIGIH
FT                   FFSPVDKMPLVEIIRGEKTSDETLARVFDYVQAIRKTPIVVNDSRGFFTSRVIGTFINE
FT                   AIGMLAEGVEPATIEQAGMQAGYPAAPLQLSDELNLTLMQKIRKESADAAKAEGKELPA
FT                   DPAGEVINTLVEKFDRKGKLGGAGFYDYAEGKRTGLWSGLRENFNSGTSDAPIQDLIDR
FT                   MLFIEAIETQKCFDENVLITTADANIGSIMGIGFPAWTGGVHQFIVGYEGGTAGFVARA
FT                   KELAAQYGPRFTPPASLGA"
FT   CDS_pept        431988..433061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31090"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN38"
FT                   /protein_id="BAH31090.1"
FT                   /translation="MYLQARRMPSHTEIDALQTVVDAQHGLVTHTQLHTIGFPRSRVKQ
FT                   RVEVGRWQTVLRGVYSVTTGPLTRYAVLEAALLYGGGSSMLSHHTAAEEWSMRRPDGTA
FT                   PVHITVPYGKSAISQAATFVRGLGADRHPSPLIGTVLHPGVVVHRSRAHRHIGVDAQMP
FT                   RTGKADTALDLAVAEPTPREAYVSLITTVTNGRIRLTDIRRRMEERSPRRYRKALESAV
FT                   KLLADGVQSTLEYHYAVDVEQAHGLPSARRQSPVRVDGRTLYEDCDYSEVGVPLIVRLD
FT                   GRWAHSMAEVAFRDRRRDNAAELAGRPRLVYGFDEVMKTPCQVAHEVETVLRRGGWERR
FT                   GENPCGACEWLRSTETP"
FT   CDS_pept        complement(433085..434386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="RER_03830"
FT                   /product="putative cyclopropane fatty acid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="protein synonym:cyclopropane-fatty-acyl-
FT                   phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31091"
FT                   /db_xref="GOA:C0ZN39"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN39"
FT                   /protein_id="BAH31091.1"
FT                   /translation="MTTFKDSKSQDKLSIAEILETLSDGMLPLRFTAYDGSTAGPEDAD
FT                   YGLHLKSTRGTTYLATAPGDLGMARAYVSGDLEAEGVHPGDPYEILRIMGDELHLKRPS
FT                   ALTLASITRSLGWDLLRPIAPPPQEHLPRWRRVAEGLRHSKTRDAEVIHHHYDVSNTFY
FT                   EYVLGPSMTYTCAAYDNAEQTLEEAQENKYRLVFEKLGLQKGDRLLDIGCGWGSMVRYA
FT                   ARRGVKVIGVTLSREQADWAQKAIEDEGLADLAQVRFSDYRDVAETGFDAVSSIGLTEH
FT                   IGVGNYPAYFEFLKGKLREGGRLLNHCITRPDNRSSAKAGGFIDRYVFPDGELTGSGRI
FT                   ISEIQNVGLEVRHEENLREHYALTLAGWCQNLVDNWDACVAEVGEGTARVWGLYMAGSR
FT                   LGFERNVVQLHQVLAVKLGPKGEAHVPLRPWWKA"
FT   CDS_pept        complement(434383..435786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03840"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31092"
FT                   /db_xref="GOA:C0ZN40"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040165"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN40"
FT                   /protein_id="BAH31092.1"
FT                   /translation="MGFEQHREGVERLLASYRAIPADASVRLAKKTSNLFRARAKTSAP
FT                   GLDVSGLAGVIAVDAQAHTADVAGMCTYEDLVDATLPYGLAPLVVPQLKTITLGGAVTG
FT                   LGIESTSFRNGLPHESVLEIDVLTGSGEIITATPDGEHAELFFGFPNSYGTLGYSTRLK
FT                   IALEPVKKYVALRHVRFDSLKKLEETMDRIVTEREYDGIAVDYLDGVVFTDSESYLTLG
FT                   VQTDEEGPVSDYTDQDIFYRSIQHPSLTQPKTDRLTIRDYLWRWDTDWFWCSRAFGAQN
FT                   PKIRRFWPKQYLRSSFYWKLIALDHKYDIGDRLEKRKGKPPRERVVQDVEVPIERTADF
FT                   VSWFLEEIPIEPLWLCPLRLREPSPAAASASRPWPLYPLEPKRTYVNIGFWSSVPIVPG
FT                   EREGAANRLIEEKVSDFDGHKSLYSDSYYSKEDFEELYYGGDRYIGLKERYDPKSRLLD
FT                   LFSKAVQRK"
FT   CDS_pept        435931..436119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31093"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN41"
FT                   /protein_id="BAH31093.1"
FT                   /translation="MIELLQSNSVNAPSGEPAHTEWVDGRDTRAQQAVWKGISAQFEVR
FT                   IRVVIRGIEPRWSSKET"
FT   CDS_pept        436125..436559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31094"
FT                   /db_xref="InterPro:IPR014488"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN42"
FT                   /protein_id="BAH31094.1"
FT                   /translation="MGQVNAMSSIVVTAAPDKVLAALADYETVRPRILSEQYLDYKVVE
FT                   GGQGDGTVAQWTLKATEKRSRNVKATVTVDGNVITEKDANSSLVTTWTVAPNGTGTTVT
FT                   TLTQWQGATGIGGFFERTFAPKGLQRIQAQVLDNLKRELV"
FT   CDS_pept        complement(436614..438125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31095"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN43"
FT                   /protein_id="BAH31095.1"
FT                   /translation="MQPTVSQLRTWSPEKLRTSTSELIGIDRQIEALGNDAGRSIDAVR
FT                   EFWQGQASSAAAVQWSGISLSSSRLSIAVRVVADLYGGAANTIGAARKSVLDLVEEATL
FT                   EHGLTVSDSGAVSAPETKQPWNLADVMQESENATAAEIFQQRISTALTALDDEDNRAAT
FT                   ALSEAFREIGSLLGNQTDRLNRTVVDIIDGRSTLPGTPTELHRLWESLTPNEKDALARW
FT                   DPSIGSRDGLPALDRDYYNRRYLTALEQLPDRTVAAGYTAVRGELRPDTFLLSVTDGHA
FT                   VVAVGNPDAADNVATLVPGTGSGLSGVGGDLQRTKAMYDAAVAAAPTEATSVILWSGYD
FT                   APPGIPDAASDRYANSAAPRLDSFQDGLRTSHDGQPSHNVVIGHSYGSTVVGAATTRGA
FT                   SLDVDELVFVASPGVDVERVNELSLDGVDSDEVARHVHSTTAFWDPVQLIPKILGVHGF
FT                   DPSDPEFGAQIFAGSPGQPGFGVHSDYWESRNPALTELGRIITGP"
FT   CDS_pept        complement(438125..438421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31096"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN44"
FT                   /protein_id="BAH31096.1"
FT                   /translation="MGPILQVDFAALQQLSADLSRIADQISGIDSAGPIFEAAAALNSS
FT                   AVAAVSTGNAGVIADAYRYLATQLGLMASGTAAAARLYDAAEGEVVSELRGAY"
FT   CDS_pept        complement(438506..439306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03890"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31097"
FT                   /db_xref="GOA:C0ZN45"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN45"
FT                   /protein_id="BAH31097.1"
FT                   /translation="MASRVFRSTALIAVVGAGLLSAACTIPTETAEATTSVEVSPLSTV
FT                   AADVPAALTGKVVFLDPGHSGANDDSINTQVPTGRGGTKNCQTTGTNTDAGFPEHTFNW
FT                   EVASLVKSELESQGATVVLSRPDDVSVGSCVDARAEAANSSGADVVVSIHADGAAAGAE
FT                   GFHVCYSAPPLNTVQAGPSVAFAETMRDSLVTAGLTPSTYIGDGGLAPRADLTGLNLSQ
FT                   RPSILVELGNMRNADEAARMTSPDGQQEYATAVTSGVTAFLTTP"
FT   CDS_pept        439416..439754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31098"
FT                   /db_xref="GOA:C0ZN46"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZN46"
FT                   /protein_id="BAH31098.1"
FT                   /translation="MQPGGAPDMSALLAQAQQMQQQLMAAQQEMAQAEVTGQAGGGLVV
FT                   ATVKGTGEVVGLQIDPKVVDPEDVETLQDLVIGAIEDASRKAQEVAAEKLGPLAGGLGG
FT                   GLPGLPGF"
FT   CDS_pept        439767..440387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="RER_03910"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31099"
FT                   /db_xref="GOA:C0ZN47"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN47"
FT                   /protein_id="BAH31099.1"
FT                   /translation="MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLSVEPPEIDRLKNA
FT                   LQRIRDGVQFCTVCGTVSDQEKCRICADARRDRTVICVVEEPKDVQAVERTREFKGRYH
FT                   VLGGALNPLSGIGPDQLRIRELLARIANQEDGVDVSEVIIATDPNTEGEATATYLVRMM
FT                   RDIPGLTVSRLASGLPMGGDLEFADELTLGRALSGRRELSRNA"
FT   CDS_pept        440387..440956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03920"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31100"
FT                   /db_xref="GOA:C0ZN48"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN48"
FT                   /protein_id="BAH31100.1"
FT                   /translation="MGGTEQGQQVRRTSEQTRAQIIASAGKAFATRPYREITLKDIAED
FT                   AGVSAPLIIKYFGSKEQLYDELVDFRAAAVTVFDAPNDSLGERMVSLFTKPLESYKPLS
FT                   MSLLFMSGVSEESNRKLRENYSTQMIDTLAARLSGPDARLRAELAMSMVVGVAIMRRRM
FT                   MAGHATGTQDEVVALYAPLVQKLLDG"
FT   CDS_pept        441004..442515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03930"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31101"
FT                   /db_xref="GOA:C0ZN49"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN49"
FT                   /protein_id="BAH31101.1"
FT                   /translation="MNGYLPSGNRRCGVTTLDRPPGTPAATTPDVSLAQPRSRFLFPIV
FT                   VAAAVFQAVLQTVIVPLLPELPHFTGAGRTAVSWLVTVTLLVGAVVTPIFGRLADMFGK
FT                   KKMLLVAFSMMTFGSMLCALSSDIAVLIFARALQGAGSAVIPIGISMLRDELPRNKVNG
FT                   AVAMMSSTLGVGTALGIPFSAMIAQYSNWHVLFWVTTAIGLSVTLAAVLFIRESEPNPS
FT                   GRFDGVGAVGLSAAMIALLVPITQGSSWGWTSGAVISMLAASAVLFTLWVIQQRRNVNP
FT                   LVDVRALVKRAVLIPHLAALLVGFAFFGNTLITTQLLQGMKGPGAGYGLSIIAAALCQI
FT                   PASIAMVLFSPVAVRITDRFGSRTAMLTGAVFLAGGYGIHAVAGKPLWGVVAALGITAV
FT                   GTAIVYSTLSLLILVAVPRQRLAAANGVNSLLRTSGSTICSATVATILAAFVISGSEHS
FT                   TSWTGFSVAYLVCAGCAVVVFAVSILLPQGRTPKHLDLPDLVRRP"
FT   CDS_pept        complement(442502..443092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03940"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31102"
FT                   /db_xref="GOA:C0ZN50"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN50"
FT                   /protein_id="BAH31102.1"
FT                   /translation="MEISVASPDRREKILESSAELFARKGVATTTVREIGDAAGVFSGS
FT                   LYHYFKSKNAIVAELMRGFITDIQLRFDQVEKTANDPEDVLRGLIRETLVVIELHPHPT
FT                   AIYQNDRAYLRDNDLLQSVDGPSRQVREHWMKAIAEGVDQGIFRKDVAPEIFYRSVRDT
FT                   LWSTTHWPDRQKYTTEEFADLMITLFLSGFRVA"
FT   CDS_pept        443206..443859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31103"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN51"
FT                   /protein_id="BAH31103.1"
FT                   /translation="MFPLPDSYASFKIKRLLNFRSRRISVQSLQTQFPNFIGAEAEPPR
FT                   VARYAVNEAMIRNWVEAHDDRNSIYVDAEAARSTGRRDVVCPPAMISTWVMAGYRRYRQ
FT                   VQQLRADGASEDFAYSRLLGLLDEAGYTSVVATNVEQEYFAELSPGDHVTAYFTIEAIS
FT                   PFKQTALGHGCFITLFKKYVDQDGKTLVEERFRLLRFKPDAQTDTKPEAQEVIA"
FT   CDS_pept        443856..444284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31104"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN52"
FT                   /protein_id="BAH31104.1"
FT                   /translation="MSETGSRHTAVPRLTVTDDNDFFFSAAKEGRLEIQRCADCKTLRH
FT                   PPAPACPECRSFSWDTVESTRRCTLHSFTVIHHPKDPAFEYPLAVGLVDLEEGTRLVAD
FT                   IAGIDHEELEFGMELEVAFSEHAHGEMLPQLRRRGSVQ"
FT   CDS_pept        444281..444694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31105"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN53"
FT                   /protein_id="BAH31105.1"
FT                   /translation="MTNLSNYEVGSTLPSLELPLDRTLIVATAIASQDFEDVHHDPGKA
FT                   QDRGTPDIFMSINTTNGLIDRYITDWSGPGSRIVKISLRLGVPNFPGDTMTFTGKVIDT
FT                   DGRTLTVTVLGKNARGTHVTADVTLEPAERVIA"
FT   CDS_pept        444691..445872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31106"
FT                   /db_xref="GOA:C0ZN54"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN54"
FT                   /protein_id="BAH31106.1"
FT                   /translation="MTRGFSRQAAIAGIGATEFSKNSGRSEWQLACESVIAALDDAHIE
FT                   AEEVNGFALFTMENNPEIAVARALGIPELTFFSRIPHGGGGACAPVQQAALAVASGVAD
FT                   VVVVYRAFNERSGHRFGAGPPPFAYNASTDQEYRNWINPYGLLTPAQQEAFLAKLYMHK
FT                   YGATSADFGQISVLSRKHAANNPKAWFYERPITIEDHQNSRMIADPIRLLDCCQESDGG
FT                   QALVIVSAERARDLPHKPAIISGAAQGVGPQQISMSSYYREDIDSMPEVELVARQLWDQ
FT                   AGIGPDDIDAAILYDAFTPMVLLQLEEYGFCGRGEAKDFIADGNLELDGRLPINTHGGQ
FT                   LGEGYIHGVNGIAEGVRLIRGTSTNQPTKTLDNVLVTGGSPVPHSALVLSADR"
FT   CDS_pept        445905..447113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03990"
FT                   /product="putative NDP-hexose dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31107"
FT                   /db_xref="GOA:C0ZN55"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN55"
FT                   /protein_id="BAH31107.1"
FT                   /translation="MSERITYARATHGEEEIQAVVDVLRSGHQGLRIGKNVFEMEERIA
FT                   ALAGKKFGVMCNSGSSGLYLAVELLGLPAGSEIITSPLTFSTDIAPIVRAGLVPVFVDV
FT                   EPNTFNVDVNKIEAMVTEKTGAILMPNLAGNCPDWDVIRDIADRHGLKVIEDSCDAIGA
FT                   TLRGTPTGSRADIVVTSFSMAHIITCAGTGGMVCVDDEASRDKALLLRRWGRRSEPNLF
FT                   GSTKSGRVFREELDGVDYDNDFIFELMSWNFEPSELGAAYGVVQLDKLEENYKTRKATF
FT                   AAFTAAYGAHPEFFTTPVELDGLDTAWLCYPVMINENAPFTRSDLQEAIEADGIDTRTV
FT                   WSGNVTRHPMMNNIEFRQPAEGLPEADAVFARGMTLGMSHGLREDEVARIAESINRFAS
FT                   KFK"
FT   CDS_pept        447115..447969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04000"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31108"
FT                   /db_xref="GOA:C0ZN56"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN56"
FT                   /protein_id="BAH31108.1"
FT                   /translation="MTRRFDGRRALVTGSSRGIGAGVAERLAAEGADVALVARTLGTHA
FT                   TLPGSLEETAARIAKYGTKVEIVVADLTDEQQRDTVVPLAIEKLGGTIDILVNNAAAAI
FT                   YQPLSDYPLRRRRLMFEANVHAPLDLMQAVVPGMVANGYGWIVNVSSGTVKPWHGPPFT
FT                   WVEPGTAMTVYGASKAALNRMSNGMGVELYGQGVRVNTVQPRAAVLSEGARVLVGETIR
FT                   PDQVESMEEMVEAVTALCDCDTEFTARSSVSLDLIDEWSLTVRGLDGAALPENPALRTE
FT                   ELA"
FT   CDS_pept        447966..449096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04010"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="protein synonym:acyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31109"
FT                   /db_xref="GOA:C0ZN57"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN57"
FT                   /protein_id="BAH31109.1"
FT                   /translation="MKPVIVDAARTPFGKREGWLSGVHAAELLGYAQRGVLDRVGVDPD
FT                   AVDQVIGGCVTPLGEQFGNIVRTSWMHAGLPLKAGCTTIDAQCGTAQQSVQLIAGQIAI
FT                   GAVDVGVACGVELMSRAPLTYKVGTGLGTPRPESWSLDTVDQYTAADRIAVKRGFSRED
FT                   LDAFGLRSQQRAAAAWEAGRFDSHIIDVVAPGSDVPVHRDQGLRESSLEGLAKLRTVRK
FT                   GGLHTAGTSSQVSDGASAALLMSEDRAKALGVRPSAKILAQCVIGGDTEFMLDGPVDAA
FT                   NIVLGRTGLTIDDIDLFEVNEAFASVPMSFAQVHGVDPELLNVNGGAIALGHPAGATGI
FT                   RLLANVIDELERRNKSIALIAICASAATTCLILERI"
FT   CDS_pept        449124..451334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31110"
FT                   /db_xref="GOA:C0ZN58"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN58"
FT                   /protein_id="BAH31110.1"
FT                   /translation="MALPLLEDHRDLAEAVAAFANRFGGIADTRSNVKRYAAGDRPDSW
FT                   DGLVRQGLHAVHLPEQYGGDGAGLAELAVVVEQLGDALYPGPYVPTVIASGILATAAGP
FT                   AAETMLTELAAGATGAVCTGTRLRAARSDAGWTVSGSADPALGLPGADVVLVRANSEDG
FT                   ELWFRLEPSTSAAVVIEDGVDLTRSIGTLTLTDHQVEAGLIVDGLQAHRTELIVNTVLA
FT                   AEASGIAGWALRTAVDYVKSRQQFGRPVGSFQAVQHKAAMMLVRSEIACAAAWDAARSE
FT                   EHDEDQQKLVSAQAALAALPVGIENALECVTLLGGIGFTWEHDAHLYWRRAISIAAVAG
FT                   SEVKWAHTLGDRSADSERDFSFVDPEMLPELREQVRRVLDEVALLPDDGTTSASWAPAK
FT                   GRARRARFADAKLVAPHYRAPYGLGAGPREQAVIAHEFAMRGWAQPSTVIGEWVLPTIL
FT                   EHGDAEQQDRFVEPSLRADIIWCQLFSEPGAGSDLAGLSTKARKVDGGWVLSGQKVWNS
FT                   GAHEADWGVCLARSDADAPKHRGLSYFLVDMTSKGVDVRPLKQATGKSEFNEVFLDEVF
FT                   VPDDCLVAEPGQGWKLAATTLSNERLSMGSTLHHGSSRLFRQVIADASHDCPREDAVEG
FT                   LGRSISRELALSAMNLRGVSARLAGQEPGAEISVSKVYNALAQREGSRDLLRLLGPRAA
FT                   VVDPSANYAIDHIGLPSILFGGGTVEIQLNVIAQRVLGLPRS"
FT   CDS_pept        451352..452557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04030"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31111"
FT                   /db_xref="GOA:C0ZN59"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN59"
FT                   /protein_id="BAH31111.1"
FT                   /translation="MYLDLSEESKTLRKELRAYFAEIINDEDRRALVDQTEGGPVFDRI
FT                   LRRMGKDGWLGLGWPEEFGGRGENPEALYVFYDEVIRANAPLSLVTLNTVGPALIKHGT
FT                   QAQKDFFLRPILAGELIFAIGYTEPNAGTDLAALETRARIEGDELVINGNKIFTSAGVF
FT                   ADWVWLAVRTDPDAPTHQGISVVLVPTNSPGFSVTEIHTVGGISTSATYYEDVRVPISN
FT                   VVGELNQGWKLITNQLNHERVALAARGGIANELFAEVVEWAKTEPAGDGHVYDIGWVRE
FT                   KLAEVYALLSAADLMNLRLVADVAANTLGGGDSAAAKIFGTEAVVSAYGMLQEVLGAKG
FT                   LLRPGTPGAVLEGRVENLGRRAQNNTFGGGTNEVMREIVAAKCLGMALAARRRPAAQNE
FT                   KS"
FT   CDS_pept        452559..453686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04040"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31112"
FT                   /db_xref="GOA:C0ZN60"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN60"
FT                   /protein_id="BAH31112.1"
FT                   /translation="MEFEFDDNLSAVRDLSVSIFSAKCGVDRLREVESTSGFDAELWKL
FT                   LADSDVLGIALPEEVGGAGLGMLGLAAVLEQQGRRVAQVPLWSVISTAALPISEFGSTE
FT                   QKASWLPGLLDGSVIVTGAFDTDYNAETAVRAEPAPDGWVLSGHVDSVPAAEFAAALVV
FT                   PVTMPDGSVSVMIVPTDRDALVRTPLAVTNRESNSAVQFDGVAVTAADALPADGAVVRD
FT                   WTLRRARVALAALATGVCEEALGMTAKYTSERVQFGRPLSTNQAVAVRAADAYLDTEST
FT                   RLTTHRAAWLMDSGVESEAEAAALVAKWWASRGGLRVVHATQHLHGGIGADVDYPIHRY
FT                   FLWGRQIAFTLGSAGAIGAELADQLEIRAQIGASA"
FT   CDS_pept        453753..454916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04050"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31113"
FT                   /db_xref="GOA:C0ZN61"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN61"
FT                   /protein_id="BAH31113.1"
FT                   /translation="MNRTSSFIRPLVPRDPHEPHRVATPLELLTDLCFVVAVAQAATGL
FT                   HHAISEGHAASGVGHFAMAFFAIWWTWLNFTWFTSAYDNDDGIARLLTIFQILGSLVLA
FT                   AGIVRFFNDDALLIIVGYVIMRIALVIQWLRVSRNDPEHALTARRYALGIVLVQIGWIG
FT                   FYFVPSAIYVPTFLVLVLCEFAVPIWSEKPGMTPWHPHHIAERYSLFFIIVLGETILST
FT                   TIAIQDAVDGEHPAAQVTYVVIGGILIVFSLWWLYFQRNAGEVIGGDNVSPFVWGFGHY
FT                   FIFAAAAAIGAGLASRVDFWTHHGDGSALVTGAAVTVPVAVILAALWFIHIRLHDSSVR
FT                   TLMPFSVAIVVVLGGTYTAVPELVAGLACAALLAVELVLTEGKSETV"
FT   CDS_pept        complement(454923..455636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31114"
FT                   /db_xref="GOA:C0ZN62"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN62"
FT                   /protein_id="BAH31114.1"
FT                   /translation="MSDSTIRIGLVLPDVMGTYGDGGNALILRQRLRMRGYDAEIVDIT
FT                   LSDPVPDSLDVYTLGGAEDSAQRLATRHLAKYPGLQRAAERGAPVLAICAAIQVLGNWY
FT                   ETSSGERVDGVSMLDVTTSPQEKRSIGEVITKPLIDGLTAPLSGFENHRGGTTLGSSAS
FT                   GFARVTHGVGNGVGDGFEGVVQGSVIGTYMHGPALARNPELADLLLMRALGVNELEPLH
FT                   LPEVDKLRKERLAIR"
FT   CDS_pept        complement(455629..456882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31115"
FT                   /db_xref="GOA:C0ZN63"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN63"
FT                   /protein_id="BAH31115.1"
FT                   /translation="MGTGLSITARGKLAMRAAAAASWASQKAGRGKGSMIGGLIALKID
FT                   PTLMTQLGRGKRTVVVTGTNGKSTTTRMTAAALATLGDVATQADGANMDAGIVAALAAR
FT                   TDATLAALEVDELHVPHVADAVNPEVIVLLNLSRDQLDRVGEINMIERKLRACVNAHPN
FT                   AVIVANCDDVLVTSVAYDATNVVWVAAGGGWAGDSVSCPRTGEPIVWEGKHWRSTGSDF
FT                   ARPEPTWWLDDDNLYGPDGLKIPMTLTLPGKANRGNAAQAVAAAAALGADPVGAVAAAS
FT                   TVQEVAGRYSTVEVGPHSVHMLLAKNPAGWQEALSMIDPTVDGLVIAVNGQVPDGEDLS
FT                   WLWDVKFEHFEGVKVVAAGERGTDLAVRLTYAGVEHTLDPDPLRAISSCPPGRVEVLAN
FT                   YTAFRDLNTAIAKESRNV"
FT   CDS_pept        complement(456908..457849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04080"
FT                   /product="probable amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31116"
FT                   /db_xref="GOA:C0ZN64"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN64"
FT                   /protein_id="BAH31116.1"
FT                   /translation="MTPRDRLLGLTVIVLWGLNFLAIRVGLDHFPPFFFAALRFLIIAI
FT                   PVVIFVPRPQVPLRWLLLYGFGFGFGQFVFLFWAMHSGMPTGLASLVLQSSAPFTVLLG
FT                   AFLLREKLSVWQVSGIAVAVVGMSLIGWDRSHHAALLPVILTLLGGLSWAFGNLGSRLA
FT                   AANTVGEPAPMRLMLWMCVIPPLPMLALSAVVEGPTAGWHALGTAFSADAWPSLVGLAY
FT                   IILLGTIAGSGLWTMLMGRYPAGMVAPLSLLVPVVGIGASGLFLHEDPSPLSLVGAVIV
FT                   IAGASAAQMRRKPANTVFSDTPAASPPARLGV"
FT   CDS_pept        457940..458833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04090"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31117"
FT                   /db_xref="GOA:C0ZN65"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN65"
FT                   /protein_id="BAH31117.1"
FT                   /translation="MDATRLRILRELADRGTVGATALALSMTPSAVSQQLKILGREAGV
FT                   SLLEPDGRTLRLTDAGRALVLRADDVVAALDRAADEMASYRGSPRGKVRVAFFPSGAAL
FT                   LLPGVLTALKNSDVDIDAHDVDKPASAVPGLLADHDVILTHRDERGAETSFPRVSVQPL
FT                   MREPIDLVLRPDHPLAEQDSVRLEQLADENWISVRGGFPVDDVLLSVASVTGVQPRVAH
FT                   RINDFRVIEELVAAGHGVALMPRYAITHPGVSRKPVAGVRAARVYELATRLHIDRSPAI
FT                   GVVLDAFRDVARAVGE"
FT   CDS_pept        complement(458929..459324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31118"
FT                   /db_xref="GOA:C0ZN66"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN66"
FT                   /protein_id="BAH31118.1"
FT                   /translation="MKWGSTMDSFWDFLWLIIISFAFIAYLILLFSIITDLFRDHKTSG
FT                   WVKAIWIVFLFFIPLLTSLVYLIVRSDGMAQRSMEAAQQVKNAQDSYIREVAGKSPAES
FT                   IADAKALLDAGTISEEEFAALKAKALA"
FT   CDS_pept        complement(459555..461363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="RER_04110"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31119"
FT                   /db_xref="GOA:C0ZN67"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN67"
FT                   /protein_id="BAH31119.1"
FT                   /translation="MSPADAFTTGTRTITPPTKPAPSDQPAWNTQKNSSMPTFRYRPFA
FT                   EEVETVTLPDRTWPDKIIDRAPQWCAVDLRDGNQALIDPMSPARKRRMFDLLVRMGYKE
FT                   IEVGFPSASQTDFDFVREIIEDGAIPSDVTIQVLTQSRPELIKRTFEACEGAENAIVHF
FT                   YNSTSILQRRVVFRADKDTIKKIATDAAELVLAESKKYPDTNWRWEYSPESYTGTELEY
FT                   AKEVCDAVTETLGATPANPVILNLPATVEMATPNVYADSIEWMHRNLARRDSVILSLHP
FT                   HNDRGTGVAAAELGYQAGADRIEGCLFGNGERTGNVCLVTLALNMFTRGVDPQIDFSNI
FT                   DEIRRTVEYCNQLPVHERHPYGGDLVYTAFSGSHQDAINKGLDAMKVDADNQDSDVDDI
FT                   LWQVPYLPIDPKDVGRSYEAVIRVNSQSGKGGVAYIMKADHGLVLPRRLQVEFSQSVQK
FT                   ITDGEGGEVSPKEMWDVFHEEYLAPVTPLERMKQKVTASEEDGGTDAITAIVKVNGKEQ
FT                   EISGTGNGPLAAFVDALGSINFDVRVLDYSEHAMSAGDDAQAAAYVECAVTGPDGQSTV
FT                   VWGVGIATSITTASLRAVVSAVNRAS"
FT   CDS_pept        461508..461999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31120"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN68"
FT                   /protein_id="BAH31120.1"
FT                   /translation="MRAACTALYSWISREIGGVRPHVQFVAELCCRFGLENGGLSSMDP
FT                   RIAVASTYLDALRSHDGSSVPLAPDAVRHEVGLKTGFSGNHLRRSLSGGPQYRVIRDIR
FT                   EVEWTVDGDDLTADYLLDAGLFGRNLMTVRVTETFRIPADDHRIHHITAKIRPARAKHT
FT                   "
FT   CDS_pept        461996..462952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04130"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31121"
FT                   /db_xref="GOA:C0ZN69"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN69"
FT                   /protein_id="BAH31121.1"
FT                   /translation="MMRSIRWIVCSLLIVLAGLGFAGSVLALFVHTQVNDTDSYVESVA
FT                   PLAADPAVQSAVVDRLTEELTQRLDGFPQVVTRQAERLVREAAQSLVSSDQFATLWTAA
FT                   NRRAHAQLAAMVTGRAADGIVRADESGTVTVSLEPVMTELRTNLRDRGFTVIDRLPALD
FT                   PQFEILQSDELVRAQDFSNTLDRAAAWLPWASVACAIAAVVVAPGRMRALSLVGLATAV
FT                   AMIALLVALAVVRRVYLQNSDIPSSEAAVAVYDALAVSLVSSIRVLLACGVAVAVVGYV
FT                   AGGSRSATLMRARISQLIPRGSEANSSTHREVPGPPR"
FT   CDS_pept        463002..464267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ask"
FT                   /locus_tag="RER_04140"
FT                   /product="aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31122"
FT                   /db_xref="GOA:C0ZN70"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN70"
FT                   /protein_id="BAH31122.1"
FT                   /translation="MALVVQKYGGSSVATAERIRRVAERIVETKKAGNDVVVVVSAMGD
FT                   TTDELLDLAQQVCPSPPAREMDMLLTSGERISNSLVAMAIHSLGAEARSFSGSQAGVIT
FT                   TGSHGNAKIIDVTPGRVRTALDEGSIVLVAGFQGVSQDSKDITTLGRGGSDTTAVALAA
FT                   ALNADVCEIYTDVDGVFSADPRIVPDAHRLETVSFEEMLELAACGAKVLMLRCVEYARR
FT                   YNVPVHVRSSYTTKPGTIVSGSMEDIPVEEALITGVAHDRGEAKITVVGLPDTPGHAAK
FT                   VFRAVSDAEINIDMVLQNISKVETNKTDITFTLPTADGPRAVEILTKRQEDIGFTQILF
FT                   DDHIGKVSLVGAGMRSHPGVTATFCEALAKADINIDLISTSEIRISVLVKDTELDDAVR
FT                   VIHAAFGLGGDEEAVVHAGTGR"
FT   CDS_pept        464274..465308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="RER_04150"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31123"
FT                   /db_xref="GOA:C0ZN71"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN71"
FT                   /protein_id="BAH31123.1"
FT                   /translation="MTTIAVVGATGQVGIVMRTLLEERNFPADKVRFFASARSAGKKLT
FT                   FRGEEIVVEDAEATSDEDLKGIDIALFSAGATLSRAQAPRFAAAGATVVDNSSAWRKDP
FT                   EVPLVVSEVNPQDTKNLVKGIIANPNCTTMAAMPVLKVLHDEAGLQRLIVSSYQAVSGS
FT                   GIAGVEELLGQVRAVVGDAEKLVHDGSAVDFPAPNNYVAPIAFNVLPLAGSLVDDGSGE
FT                   TDEDQKLRNESRKILGLPDLLVSGTCVRVPVVTGHSLAINAEFANPLSVARAKEILADA
FT                   PGVELVEVPTPLAAAGGNASLVGRIRQDPGVPEGRGLALFVSGDNLRKGAALNTIQIAE
FT                   LLVG"
FT   CDS_pept        complement(465371..465712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31124"
FT                   /db_xref="InterPro:IPR028956"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN72"
FT                   /protein_id="BAH31124.1"
FT                   /translation="MTSPSIEPLQLFETSPGNWSLMLTDQHFGKVAAVFEQVEGFEGSG
FT                   YDWASVAHAVVGRDAQHLDGRFGTDPEAGMFVAYGSDNEALGELGVLLAKAYSDAEYLG
FT                   GLVAISELD"
FT   CDS_pept        complement(465756..466397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04170"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31125"
FT                   /db_xref="GOA:C0ZN73"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN73"
FT                   /protein_id="BAH31125.1"
FT                   /translation="MTRSQADATDTPRRKYAPRMAPEQRREQLLDAAFEVTGRVGLHNL
FT                   SMESVAAEAGVGKPVLYTIFDTRTDLVAALLRREHERAIAQVLETMPTDLSELGPAASY
FT                   TGTVGAFVDAVLENPTRWRLILTSVENAPSEYHGLLKLSRGAVFARAEELARAGIALEP
FT                   KLEGLDPVLLAHTMMSFAEMLGRLAVSDPETYTRERLSSFAVALAQSVGR"
FT   CDS_pept        466557..468338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31126"
FT                   /db_xref="GOA:C0ZN74"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN74"
FT                   /protein_id="BAH31126.1"
FT                   /translation="MTASTSLVPNDLLLHPSTYDRPEFDATTRRLLGATVDWFEARGKN
FT                   RLLADYHDKTFYSDFLDFAAKEGLFATFLTPARDSGGDSDKRWDTSRIAALSEILGFYG
FT                   LNYWYPWQVTILGLGPVWQSGNETARARAASALDSGGVAAFGLSEKEHGADVYSTDMVL
FT                   TPNGSGGYLASGSKYYIGNGNCANTVSVFGRVDGVEGADQYVFFYADSDHPAFTVVKNI
FT                   VPAQMYVAEFSLADYPVAAEDILHTGEAAFSAALNTVNIGKFNLCFGGIGMSTHALYET
FT                   ITHAHNRILFGNPVTAFPHVRREFVDAYARLLAMRLFSDRAVDYFRTASPEDRRYLLFN
FT                   PVTKMKVTTEAQKVIGLLSDIAAAKGFEKDSYLAVAKMDVDGLPKLEGTVAVNLALIAK
FT                   FMPAYLFAPESFPAIPTRNDAADDEFLFRQGPARGLSKVRFDDWRAVYAKFADVPNVAL
FT                   FVEQAEALVTLLAEAAPDAAQQVDLDFGLAITELFTLVVYGQLILEQAEILGLDEGQRS
FT                   DGVLDQIFDVLVRDFSAAAVELYGKPSASEDQQRLALASIRRPAFAAERFEYVWQQVVA
FT                   LSGAYEMNGAGSTNGEE"
FT   CDS_pept        468340..469272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31127"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN75"
FT                   /protein_id="BAH31127.1"
FT                   /translation="MSELTMNRPREDYGFFGPGSPSWKIWAAPTALIGFQRSVVLEHFD
FT                   PFLAAAVADMSGIYSDPAGRLDRTLAYFLTVATADGRTALALSDHLMTVHAQATGIEPI
FT                   TGTRYSANNPASQLWIHVTGWHSVLKCYEMYGPGPLSAVEEQRYWEECVIAAELQTCKA
FT                   SDVPRSRDEVREYFAEVRPRLCTSERANRAMHYLLRTPRAQGKTKFATFSRLVAPATIA
FT                   TLPGWMRTMGGFDQPALLDRAIAPAVRTAVRVGSSPKNMTTALKVIAPMTGKVLERHLR
FT                   DEQPLDPRVVTPAEIRERFPRATKVPQAV"
FT   CDS_pept        complement(469357..470622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31128"
FT                   /db_xref="GOA:C0ZN76"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN76"
FT                   /protein_id="BAH31128.1"
FT                   /translation="MGLRGRLWQLSASELRAAAIEASAEILRLEAVRVAVVDELSMRPD
FT                   DQVIASRGVGAWLAANTMLQIRDGKKIAALGAALRPFPAVAARFDVGDCSFEHAVLIVA
FT                   FCESPPKGMPEEALPRCIDLLKAAASGVEATTTKVRNVIATLERIFESDLIPPAEDIDR
FT                   NELRIASTLNGRVVVRGDFDALTGEMLLSALSNLTMPTPAPDGTPDARSAAKRTADGFT
FT                   ELIRRYLDCAKTGVDGGQRPHVNVHINARDLAEHRDCATTSSSSGGGASASDLDVGHMP
FT                   WLGPLSVSQTRLLGCDCFLSTVLLDGHGAPLDAKPGKRLVTAEQRVALIARDKGCSFPG
FT                   CTCVPAWTDAHHIRHWANGGPTVMNNLVLLCRSHHRLMHRKTGFVGKWVIRIGVDNKPW
FT                   FIPPPSIDPQQHPRPANTTFKT"
FT   CDS_pept        complement(470711..471487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04210"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31129"
FT                   /db_xref="GOA:C0ZN77"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN77"
FT                   /protein_id="BAH31129.1"
FT                   /translation="MNKQAGRRDIARTISLLWRQPEAPSGRRGPKPVLSTDTVVDAAIE
FT                   VADANPTTPLSMRMIGDHLGRTAMSLYTYIPGKDELLDLMYDRVHAELPPIADTGDWRM
FT                   ALSDWAAALFALHTRHPWTLDVSLARPALGPHEQAGLESLLSILYSTGLDAPTIRRSVS
FT                   MLFHFIRGSARTLAEIRSASTIGDSESHWWAESSAALADAAPDFADDFPHTVQLGREAP
FT                   PIPGGDFYLERETEESFTQGLQILLDGIESRIRKHS"
FT   CDS_pept        471553..472392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31130"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN78"
FT                   /protein_id="BAH31130.1"
FT                   /translation="MVEARLHDGTTIDAEVLGHGPAVLMPVNPISATGIKADELRAWGV
FT                   DPSLGRTFMEGLASNFTVVAFDYEGHRMASPAPDTLTPDNITSDILAVANSAGIDQFAY
FT                   YGYSWLALCGLQLALRTDRLTALVMGGFPPVDGPYKAMLQVTEATHRMTSEPPQRTSQP
FT                   TASSDEFDWNSIDIALTGAQTRQFVTLYRALGEFDDRTIQGRILCPRMCFVGSQDVIEY
FT                   GDRWGGVRVAPADLDLDAARSAGWDIEVLDGLDHTQAMQPAHVLPILKPWLEKVVGV"
FT   CDS_pept        472449..474215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04230"
FT                   /product="putative multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31131"
FT                   /db_xref="GOA:C0ZN79"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN79"
FT                   /protein_id="BAH31131.1"
FT                   /translation="MDESHKIRRRSFVQGLGLLAGLSALSAGSATARPPDIDPLRPFQL
FT                   PSPRLEPFRETLPVLPGISGGNLELRAASSMHRFHPDLPSSPSLGYGGMDYLGPTIEAH
FT                   VDQLVTVRYANDISAYPLAADVDPGLHGVSDLDRTQVPTSLHLHGGVTAPQFDGHPELI
FT                   QRPGEGLVHEYTNGRAAGNLWYHDHAMGMTRLNVYAGLVGMYFLRDDVDTGAAGNSLGL
FT                   PTGEFELPMILQDKVFTSDGQQSVRSTWLTPQGSWDPATPGDVGVVNGVVWPKVEVARG
FT                   LYRLRLLNAATYSVWNLHFANRMRFWVIGSEGGLLAAPAPTDHVRLSPGERADLLVDFS
FT                   MLEPGTTVELRNDEPVPLAVAQRGTQVMPVFCRFDVGSAKGFTGSIPQQLNSVAAEPAS
FT                   PDVVRNLTIMQLSRPSDYPSITMSLNNLRFTDSDIELPRQGAVEQWNLINITTEPHPIH
FT                   LHLVAFRVVGRQSLDTAALMQRYPVPDLGVRWTPSAEEFVTSSLRPPEVWETGEKDTVI
FT                   VDANSITRVIVRFPTADELGFDPDATFARGSMADHSAHGEAGMGDLQGYVWHCHMLDHE
FT                   DHDMMLRYRVVT"
FT   CDS_pept        474252..475466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31132"
FT                   /db_xref="GOA:C0ZN80"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN80"
FT                   /protein_id="BAH31132.1"
FT                   /translation="MSEGAPTGPLDGYRVIELGTLIAGPFAGKLLGDMGADVIKIESPD
FT                   RPDPLRTWGQAEQDGHRFFWTVHARNKRCVTLDLRVDAGRDLFLNLIEHADVVVENFRP
FT                   GTLEKWGLGFDVLSARNPKLVLARVSGYGQSGPQAKSAGYASVAEAVSGFRHLNGYPGQ
FT                   APPRIALSLGDSLGGMFAVQGVLAALLSRERTGRGQVVDVALTESCLAVQESTIPDYDR
FT                   GGIIRQPSGTRLEGIAPSNIYQTSEGNWVVIAANQDTLFVRLCTIMGRAELAQDDRFSN
FT                   HVARGKHQDELDELIGAWVALQDPTSLVERLTEVGVVAGPINTVEDVVKDPQLIERGML
FT                   VDHYDERIGENVLGLGVVPTFSETPGSVRNAGAASPGYDNASVWGGLLGLSGDEQTELK
FT                   KKGVI"
FT   CDS_pept        475468..476379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04250"
FT                   /product="putative hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31133"
FT                   /db_xref="GOA:C0ZN81"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN81"
FT                   /protein_id="BAH31133.1"
FT                   /translation="MSVPEAGVPAVSIREVGPRDGLQIEDPVSLAEKLRLVEALAATGV
FT                   SRIEATSFVSPRAVPALADAELLAAELHQWPGIEFSALVAGIGGAKRAVAAGMKTVEYV
FT                   VSASNSHSEANTRSTTEQATERIGEVVRIVHEAGGRVEVIVATAWDCPFDGPTDPDRVL
FT                   RIAEQAKEFGADQFSIADTIGTATPGRVGRLIDAVGERVGDFGLGVHFHNTRGAGLASA
FT                   LAAVQHGVRNLDASTGGLGGCPFAPGASGNIATEELVYMLEDMGIATGIDLDASIRAAA
FT                   VAEEIVGHTVPSNLLRAGDRKR"
FT   CDS_pept        complement(476386..476691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31134"
FT                   /db_xref="GOA:C0ZN82"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN82"
FT                   /protein_id="BAH31134.1"
FT                   /translation="MIFELRPAHVARALAALCALPILWTFAVEGITTTTEYDYSTGEVS
FT                   SSSDLGSQIGSVAIWIVLAIACAAGAWYLEKQRIGWPPAAHEQLVKLQLASPNREE"
FT   CDS_pept        complement(476740..477837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04270"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31135"
FT                   /db_xref="GOA:C0ZN83"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN83"
FT                   /protein_id="BAH31135.1"
FT                   /translation="MTRPDGRDVRDLLGMHSRAARFMAACFALTCVISVAYTSSDVRAV
FT                   WPMVLAIIVCSTAAFTLVLSRGDPMPLGQSVLVSLTGAVTSGLVLSVVPVPVNDMTQLW
FT                   MFGMSTAVFTFMCVRGRTALAWLGLGLMVLVTAIWSSTTGQGAMYGVSLTVINAGPVLM
FT                   STFFAYTIRPQARVIYELREQSTQRIASASASAAILEERDAQLDRLDLLARPLLERVAS
FT                   GIPLTTAERQECELLEAQLRDSLRAPGLQQTDVIDAVHATRNRGVEVVLLDDHGMDGAD
FT                   PAVRDRIHASIVRELTAITRGKVTIRILPPRRTAMATILVDTEDVRRIEFDHNGMQLLR
FT                   QGDQRELGASSMSVHPTTDSAVYPE"
FT   CDS_pept        complement(477834..478901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04280"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31136"
FT                   /db_xref="GOA:C0ZN84"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN84"
FT                   /protein_id="BAH31136.1"
FT                   /translation="MSASWWTPLAVVATFGSGLVLGASTFHADTRWVKRAASANALLYV
FT                   VVILLWWPAWNGEHVTDFTLRISNFPGVASLAAAAAWRPAAAVVHLFVAATLAQLTNHI
FT                   IRTSPTTHLLVPDLAFAWTFCAVFVAAAVMALRTGRVLDATIATTHAAAAGAAAAEAKS
FT                   VERERFDALIHDTVMSTLLAASRNDADPSVIAQARRTVERLDELRSGTDHETSFDFDGI
FT                   LAQLRSAASEVDENITFETALSVGSDPSGYAPDSIRAMAGAMAEALRNSVKHAGSSARR
FT                   SVTVTATATHLEVVVADDGVGFDPSSVETHRLGITVSIRGRMRQLDGGSATIRSSPGRG
FT                   TSVTLTLSLPAAVMA"
FT   CDS_pept        complement(479033..479299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04290"
FT                   /product="putative LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31137"
FT                   /db_xref="GOA:C0ZN85"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN85"
FT                   /protein_id="BAH31137.1"
FT                   /translation="MTVTVENCMTQDPVGPHLSEREVEVLREWLLSDSKSRVAQNLYIS
FT                   VGTVGTHLSRIREKYADVGRNAPTKCELLVRAIQDQIVTIDEL"
FT   CDS_pept        complement(479465..480169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04300"
FT                   /product="putative NarL family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31138"
FT                   /db_xref="GOA:C0ZN86"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN86"
FT                   /protein_id="BAH31138.1"
FT                   /translation="MPEQTAFPHRRVGLVEDHESVAIGLSVMLKDEPDIELVCIATTVS
FT                   EMLAQNVSLDLAILDLRLADGSSPKSNVEELRAAGLETLIFTGAENPFLVRSAARAGVL
FT                   GVVRKSEPTAVVIDAIRAAASGRQVVTTEWAAAIDGDPGLDEVGLSPRQLEVLELYASG
FT                   EKADRVARLTGLAPQTVNDYLQRIRQKYAAAGRPAPTKTDLYKRAVEDGVLPIPERRNL
FT                   GRNLTLTNNDLQ"
FT   CDS_pept        480293..480877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04310"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31139"
FT                   /db_xref="GOA:C0ZN87"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN87"
FT                   /protein_id="BAH31139.1"
FT                   /translation="MTETTSDAKVSRTQAERTAAMRGRLLDAAVESLVELGYARTSTQE
FT                   IARRAGVSRGTQLHHFPTKESLVVAAVEYLVDKRLEEILTAEVDRGRGLEVLADAFSGP
FT                   LFYAALELWVAARTDPVLHAATVPLERKVSEALEFGSAELFGDRFDSESVELTIELVRG
FT                   LAVSALFRTPEADDALRARLLPAWQSRVEKK"
FT   CDS_pept        480874..482358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04320"
FT                   /product="putative flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31140"
FT                   /db_xref="GOA:C0ZN88"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN88"
FT                   /protein_id="BAH31140.1"
FT                   /translation="MKLPEHVETLIVGAGFAGMGLAARMLRDNRAADVVLIERGADIGG
FT                   TWRDNTYPGCACDVPTALYSYSFAPSADWSHTFARQPEIYDYLKKVAADTGIVDRVVLN
FT                   CELEAAVWDEDAALWRVRTSRGALTAKTLVAATGALSTPKIPDFPGLDQFSGTTFHSAT
FT                   WNHEHDLRGERVAVIGTGASAVQFVPEIADPAAHVTVFQRTPAWVIPRMDRTLPAAQKA
FT                   VYSRIPATQKVVRGAVYGFRELLGAAMSHATWVLPAFEAAARLHLRRQVKDPELRRKLT
FT                   PDFTIGCKRMLLSNDWLRTLDRADVSLVDSGLVSVTEGGVVDGHGVEHKVDTIIFATGF
FT                   TPTEPPVAHLITGKRGETLAAHWNGSPNAYKGTAVSGFPNLFLMYGPNTNLGHSSIVYM
FT                   LESQAEYVNDALNTMKRERLDALDVNESVQVHYNKGIQHELQHTVWNKGGCSSWYIDPE
FT                   GRNSVQWPTFTFKFRSLLEHFDRENYSARKIESVQA"
FT   CDS_pept        482355..484070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04330"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31141"
FT                   /db_xref="GOA:C0ZN89"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN89"
FT                   /protein_id="BAH31141.1"
FT                   /translation="MTTTHYDVVVIGSGFGGSVAALRLTEKGYRVGVLEAGRRFADDEL
FT                   PETSWRMRKYLWAPWIGCYGVQRIHLLPDVLVMAGAGVGGGSLNYANTLYQPPKRFFED
FT                   RQWAHITDWHDELAPYYDQAKRMLGVRTNPSFTPADAVMKDVAEEMGVGETFTSTPVGV
FT                   FFGEAGVSVPDPFFGGKGPERTGCTECGGCMTGCRVGAKNTLVKNYLHLAEQAGARVHP
FT                   LTTVTELRPSASGGYHLLARRTDGVRRREVLFTADQVVVAAGTYGTARLLLGMKESGAL
FT                   PDLSDTLGTVVRTNSEAVLAATSKSRRRNFTQGVAITSSFHPDDHTHIEPVRYGKGSNA
FT                   IGLLQTVLSDGGGRTPRVLKTLAVAARHPGAFFRSLSVRNWSERTVIALVMQTDDNSLE
FT                   LSKNTKRFGRSLTSRPGPGDPPPQWIPQGHTAIRKVAEKIDGDPGGSIAEIVNIPMTAH
FT                   FLGGCAIGDSAASGVVDPYLRAYGHAGLHVMDGSVVSANLGVNPSLTITAQAERACAMW
FT                   PNKGAADARPKTGEPYVRIDPTLPSNPVVPTHAPGALRLPLTVRAEKVSDVERA"
FT   CDS_pept        484099..484701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31142"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN90"
FT                   /protein_id="BAH31142.1"
FT                   /translation="MSDPPPWPASVRATLWWHRSTPAARELGPDDRTIPVTVAMMVDYL
FT                   DSPVGPYREILASPVLHAPGKRIGPMPRMAVPFVAVDSEPSVHGGRVHWQLPKVLAEFD
FT                   GDVQQKFTATGDGWRVRSDTRMLGPRLPIAGALGFAQPESGGGLAIASARLTGSFRYAR
FT                   VSVEAEGPTLPNWLASGTHHGAVILGGKMTTGAAKHR"
FT   CDS_pept        complement(485294..486127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04350"
FT                   /product="putative carveol dehydrogenase"
FT                   /EC_number="1.1.1.275"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31143"
FT                   /db_xref="GOA:C0ZN91"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN91"
FT                   /protein_id="BAH31143.1"
FT                   /translation="MTGRFEGKVAFITGAARGQGRNHALRLAQEGANIIALDSVKDNDT
FT                   VPYPLATEDDVQETIRLVEEAGGKIIFSHADVRNFDSVKLALEAGLDRFGHVDIVIANA
FT                   GILSFGNAHELDEEKWGEMIDVNLSGVWRTVKAAIPHMIEQGTGGAIVLTASVAGLRAY
FT                   TGVGHYVSAKHGVVGLMKTLAQELAPHRIRVNTVNPTQVDTEMVQNQAMYNQFVPGTDN
FT                   PGRDDFAKASGDMILYPIPWVENDDVTNAVKFLASDEARYITGVALPVDGGVLVM"
FT   CDS_pept        complement(486177..487028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04360"
FT                   /product="putative carveol dehydrogenase"
FT                   /EC_number="1.1.1.275"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31144"
FT                   /db_xref="GOA:C0ZN92"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN92"
FT                   /protein_id="BAH31144.1"
FT                   /translation="MTTTARTTGRVSGKVAFVTGAARGQGRAHAIRLAEEGADIIALDI
FT                   CSDIGGVPYSLASEADLAETVRSVEAVGGRILAEVADVRDFTAVKGVLDRGVVQFGHVD
FT                   IVCANVGINIPSPTHELTESQWGTVVDIDLSGTWRTAKAAIPYLIEQGGGGAIILTSSA
FT                   AGLKGYGNIAHYTAAKHGVNGLMKTLAQELAPHRIRVNTVNPTQVDTPMIMNDAMYRLF
FT                   CPDIDEPTREDFAPLSQAMNALPIPWVESVDVSNAVLFLASDEARYITGVALPVDAGVL
FT                   VK"
FT   CDS_pept        complement(487025..488050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04370"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31145"
FT                   /db_xref="GOA:C0ZN93"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN93"
FT                   /protein_id="BAH31145.1"
FT                   /translation="MRNAVTQTLSKQSPASDAAAPSGARGLLSRLDQHRNIVVPTVAVL
FT                   ILIIYFQWRTESFITATSAQNILNQMAFLTVLALAGTFVILIGGIDLSVAATATLAGIL
FT                   IATWIDKFGGPLAIVMVIVAGAVVGLVNGLITTMLKVPSFLVTLGMMSVLDGISNTVSK
FT                   GGPVSYNSNLLQSLVNESMIPNVPNGALIAILLTIGATVLAFGTSFGRHMYAVGGNERA
FT                   AALVGVRVRRTKLAVFAVAGAVAAIAGIIFTGQASTGVPMGAGPSLLNSIAAVVVGGTA
FT                   LSGGVGGPHRTILGALVIVLLSAGMDLTSVDPYTQLVIKGIVVIAAVALTIDRRRYGVI
FT                   K"
FT   CDS_pept        complement(488047..489591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04380"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31146"
FT                   /db_xref="GOA:C0ZN94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN94"
FT                   /protein_id="BAH31146.1"
FT                   /translation="MSHTKVSDTATISLRGVCKSYGPVHALQDVSLDVSRGDVLGLIGE
FT                   NGAGKSTLIGVLTGTVRPDAGSLDVNGTHVELGDSRTLRELGISVVVQEQSLVDALRVY
FT                   ENIYLGREGEIGGWGPGRRRRMRDAAQSLLDTLGIEGLRADAVVAELTYPQRQLVEIAR
FT                   AFSRITDATEAPVILLDEPTSALTETEVEILFALIEGWRDRVSFIFVSHILQDVLRIST
FT                   RLLVLRDGRSIETLSADGVTAERLHELMVGSERSADYYREGEQTGALSPKPLIELRDAS
FT                   SAGEFESVDLVVRPGEVVGLAGVIGSGKASVAAAVAGAESLSTGSIHVDGTAHEHWSVP
FT                   AAVAAGVLYVPPERAQDSLFRSASIRNNISIGFLDLLRHPWTRLLRLRTERERTTQLAR
FT                   ALQVKAPSLSTPIGELSGGNQQKAIFARWQGRECKVLVLSDPTRGIDVGTREEIYGLVR
FT                   SMAASGVGVLLCAESLEEVIGMSDRIVVMKDGVISAELAAPAERKPAEVDVIKHMM"
FT   CDS_pept        complement(489594..490898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04390"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31147"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN95"
FT                   /protein_id="BAH31147.1"
FT                   /translation="MIMPSIESKIVDVARNATFSHPLTRRSFFAAMGAAGIALGAVACG
FT                   AGGSSTSTAAGGGAGAGKVQEKTLCQVTTLSNDYFVAFSDGGKQAMDALGVSMSSVEDQ
FT                   GNVNTALGQVGNVRASGGKSIFGTPATEAQAAAVTKACQAAGILYASSYTAPAWYTPAD
FT                   ADKWVRFITPPSTKIAVATAKALFDKVGGSGTIIHVPGQKGSSSDDQRTAGLNAAAKDY
FT                   PGIKIVTASPGNWTSEDARKAFTNILPSVPDFVGVFAQNDSQAAGVIAALDAAKITGKI
FT                   VVGFDGNKQNVEYIAQGKQYLTSATVGGLTAGILGVTIFDQLNGVDLSLPERFLSQGAL
FT                   LVTPEIADDVLKTVYAPTLPFDWAKMSKALHPDDWDPQTVLNPIDPREYYAGVSQDQYT
FT                   LNSAWNSADITGVRTEYASAFRSGPLLQYKDQLVA"
FT   CDS_pept        complement(490966..491883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31148"
FT                   /db_xref="GOA:C0ZN96"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN96"
FT                   /protein_id="BAH31148.1"
FT                   /translation="MRREDVEFSSDGVTVRGWLYRPDTDEDVPAVVLAGGWCYVRELVM
FT                   PYYAEAFVTAGMAALVFDYRNLGVSDGEPRQHLDPKQQIRDYQNALSFLERTPGIDNDR
FT                   LGAWGISYSGGHVMILAATDPRVKAIVSQIPVIDGFRNMRRIHGTMGYRKLWDAILEDR
FT                   RLRFDDPDQRLHIAHASENPEEELSSWPFPETKTTFAALQATEAPLYQNSSTMESVDLL
FT                   LDYDVNYFVPRILDTPSMMIVAEGDDLTLWDLEIESYNSIPTPKKELVVLPHTSHMTLY
FT                   SDQSKLAVAAEHASRWFTTHLLAK"
FT   CDS_pept        491927..492130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31149"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN97"
FT                   /protein_id="BAH31149.1"
FT                   /translation="MRKKTDGLVAVRITASTRFARVNCPERIVADPKYPVIVSHLTAFV
FT                   KCHWTARKIRRYSPAHPLRMYS"
FT   CDS_pept        492151..494133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoA/acoB"
FT                   /locus_tag="RER_04420"
FT                   /product="putative acetoin dehydrogenase E1 component"
FT                   /EC_number="1.1.1.-"
FT                   /note="protein synonym:acetoin--2,6-
FT                   dichlorophenolindophenol oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31150"
FT                   /db_xref="GOA:C0ZN98"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN98"
FT                   /protein_id="BAH31150.1"
FT                   /translation="MFRLVNGEEVLCAYEKMLLIRVMEERISALYKGDIIPGFVHTSIG
FT                   QEACAVGALTHARVSDVITSTHRGHGHVLAKGLEPDRMMAELMGKVTGANNGRGGSMHV
FT                   ADPRLGIFGANGIVGAGLPIAVGAAFAAKDRGEGDLVVAFFGDGAIATGAFHEAMNLAA
FT                   LWKLPIIFLCENNGFSEFSSTVDQHPVPISARAAGYGMESITLAGNDVEAVADGIRPVY
FT                   AQVRGGSGPVFVEVTTLRVHGHYEGDPQVYRDKDEMTRDILAADPLTVTRGRLRERGIG
FT                   DDVLDLVDKRVRAVVDEAERFARASPQPEASSVMEYIYSPRRVYPPGHLDVSVDAGGAA
FT                   VSQSKIIKAALDDSLAADPDVFLAGIDVAGGNVFGLTRGLAAEYPGRVLDTPISESAIM
FT                   GLAVGSAMAGRRPVVELMYLDFLGVCLDQLMNQAAKLRFMTGGAVSLPLVVRTQFGSGR
FT                   SSGGQHSQSLEALLAHIPGLTVLMPSSGADAYGLLRAAIEDDNPVMFIEHRLLYEKKSS
FT                   LPSKDFRVPIGKAAVTRPGSDVTIVSWSRMAMHALVAAQTLTEEGIDAEVIDLRTIAPL
FT                   DRETILESFGRTNRMVVAQEAVVDFGVGAEIAAMAVDSGFYSLDAPVVRVGARYAPAPY
FT                   APVLEREWEVGPDDIVAAVRRVMSC"
FT   CDS_pept        494127..495746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04430"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31151"
FT                   /db_xref="GOA:C0ZN99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN99"
FT                   /protein_id="BAH31151.1"
FT                   /translation="MLSATRPRAMTGGGVLPEMLLDALRRDPEALALVDESVRWTYQEL
FT                   VDAATSFAGALHKSGFEPGEVVLVQLPNWWESVVAAWGTWLAGGILLPVVPIYRAHELS
FT                   FIIEQAEPSVIVAPQEYRGYRHVEQLGTVLRDLGREVLLVEARGEGGLRRTTFDDFLDF
FT                   GMEANRPDHRADPDDVALVLYTSGTTSAPKGVLHTHRTLMAESSSMIAHCGVDSQDRIF
FT                   MPSPLPHITGMSYAVVLPAAAACSTVLMQRWNPAEAVALIEREQCTFTVSATPFLRGLA
FT                   DAYEEDGYRRSHLTRFVCGGAGIPPELVRRAHRVMGTAVVRTYGSTELPTLVMGDPFGD
FT                   IGLQAEDEGAVIGGNEFRLGEDDELLVRGPELFVGYVDSSINAESFTEDGYFRTGDVAT
FT                   VDGPGQIRITSRIKDIINRGGEKFSAADIEWVLEAHPNVAEVAVVGYPDEELGERACAF
FT                   VVPHGEPPSVRDLRIFLLSEGFAVQKAPERVETVASLPRTESGKVQKFLLRRALGLGSA
FT                   QAVPETYGSEFGHDGNRRKATS"
FT   CDS_pept        495880..496443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04440"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31152"
FT                   /db_xref="GOA:C0ZNA0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA0"
FT                   /protein_id="BAH31152.1"
FT                   /translation="MGTSVGKTVRAERTRQGIPVRELARRLGVSPSFLSQFELGQSQAA
FT                   VNTLFAIATELNLSLDVLLGNSVDPERESESESKTHEPRISDCLTFRSGVRWQRLANTP
FT                   ENHHVQFLLTEYEPGADSAPGDAPQTHSGDDYGYVLEGTLTIDIDGMRRLLKSGEAIHL
FT                   VGNVPHRLRNETDQTVKAIWFVLG"
FT   CDS_pept        496556..497110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04450"
FT                   /product="putative Fur family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31153"
FT                   /db_xref="GOA:C0ZNA1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA1"
FT                   /protein_id="BAH31153.1"
FT                   /translation="MRDGEHDFDPRAQLRAVGLRITAPRLAVLDAVTAQPHSDADSVAA
FT                   LVRQQLGSVSTQAVYDVLKACVNAGLLRRIEPAGSPARFETRTGDNHHHLVCRGCGKVV
FT                   DVDCVVGQAPCLEPSDNHGFEIDEAEVVFWGRCEDCLKNSAESDTASDTVSQNRIDASR
FT                   TSEPAPSHAAHAFGSDAAPLL"
FT   CDS_pept        497142..498593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="RER_04460"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31154"
FT                   /db_xref="GOA:C0ZNA2"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA2"
FT                   /protein_id="BAH31154.1"
FT                   /translation="MTKPTTNNFGIAVASDDESLTAGIQGPVLLHDHYLIEKLAQFNRE
FT                   RVPERIVHAKGGGAFGELVITHDVSKYTKAAFLQPGKKTESLVRFSTVAGEQGSPDTWR
FT                   DPRGFAMKFYTEEGNYDLVGNNTPVFFIKDAIKFPDFIRSQKRLPGSGLRDHDMQWDFW
FT                   TLRPETAHQVTWLMGDRGIPKTWRNMDGFGSHTYQWVNAAGERFWVKYHFKTDQGIEFL
FT                   TQAEADSLAGSDPDYHRADLYNAIEAGNFPSWTLKVQIMPVDEAEGYRFNPFDLTKVWS
FT                   QKDYPLIEVGKWTLNRNPENFFAQIEQASFEPSNVVPGIGFSPDKMLLGRVFSYADAHR
FT                   YRIGTNYADLPVNAPKNEVNSYSKEGAMRYSFNSPSTPVYAPNSYGGPHADPSVAGDEG
FT                   LWSFDGKAVRAGYIEHAEDGDFTQAGTLVREVLDDAARERLVGNIVGHALAGVSEEVLL
FT                   RVFEYWKNVDADLGKRVEEGVRAGQ"
FT   CDS_pept        498863..499549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04470"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31155"
FT                   /db_xref="GOA:C0ZNA3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA3"
FT                   /protein_id="BAH31155.1"
FT                   /translation="MATGAVLFDIDGTLVDSNYLHVEAWSRAFFEVGRPVDAWRVHRSI
FT                   GMDGDQLLETLLGEDIDGCGPRAKELHTKYYRQSADRLRVLPGARELIRRVHSLGLHVV
FT                   LATSAPDDELELLRQTLDIDEMIYAATSSESVDEAKPDPHLIEIALAKAGVDAGDAVMV
FT                   GDAVWDMKAATSAGVVAVGVRSGGMSTDELEGAGAATVYDDARDLLDHLDGSVISELVS
FT                   GLDTGS"
FT   CDS_pept        499553..500545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04480"
FT                   /product="putative F420-dependent glucose-6-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31156"
FT                   /db_xref="GOA:C0ZNA4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA4"
FT                   /protein_id="BAH31156.1"
FT                   /translation="MMARFGYTLMTEQAGPKELVRHAVRAEEVGFDFEVMSDHYSPWLT
FT                   EQGHAPYAWSVLGAVAHATERVGLMTYVTCPTVRYHPAVVAQKAATIQILADGRFTLGL
FT                   GSGESLNEHVVGEGWPSVDTRHDMLQEAVSIIRALLAGDLVSWKGEYFDVQSARIWDLP
FT                   ENPVPLALAMSGDKSVERFGPMADDLIAVQPDSDLVHQWKHVHGRAYGLAPAGRTIGQI
FT                   PISWDPDRDTAIARAHQQFRWFGGGWSVNSELPTPASFAGATQFVRKEDVAESIPCGPD
FT                   LDVIVEAVKAYTDAGFTDVALVQIGGDTQDRFFDEAAKPLLEALHVELG"
FT   CDS_pept        complement(500442..501821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04490"
FT                   /product="probable two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31157"
FT                   /db_xref="GOA:C0ZNA5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA5"
FT                   /protein_id="BAH31157.1"
FT                   /translation="MKRPLSLQTRVAIASGLAAGIVIAAIGIAFAVFLRVNGSEQLERT
FT                   LDSVTLGVAASAPSPLFIETPTATTEPFVVSPGFNATTVSALATTDVRSRDVLVPGDSG
FT                   AALAVSIPEDPLTQAIREQQFQAAAAAVVAILAAAGLGWFLTGRAVRPLQQLTETTSSI
FT                   GNNLDVEGLSRRAPSVRGTREAEELSEAIHSMLSRIETDRSRTEEALESARDFARVSAH
FT                   ELRTPLTSMRTDLEVLATLDLTESQRRELSSELLEAQRQIERTLTDLETLALGEVADPE
FT                   DCADVDLVEVADRAVADAGRLHPQVDVRLKAPEELSVQAFPAGIRLVLTNAVTNSVRHG
FT                   NADEVEITVRSGAATGSATVYVDDNGTVIAPSEREAMFERFVRGTGAGDAGSGLGLALV
FT                   AQQARLHGGSARLDASPLGGTRLIFSINPIRRAEPRAVAWLPRRRIGLGYLHRSVPTPH
FT                   R"
FT   CDS_pept        complement(501818..502513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04500"
FT                   /product="probable OmpR family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31158"
FT                   /db_xref="GOA:C0ZNA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA6"
FT                   /protein_id="BAH31158.1"
FT                   /translation="MSTRERILIVDDDAKVLNSLERGLRLSGFDTATAVDGRSALSSVN
FT                   KQCPAALVLDVNMPGLDGVGVVTALRAIGNEVPICVLSARSSVGDRIAGLEAGADDYLT
FT                   KPFELAELVARLRALLRRTTRATPSVDHPITVGPLTVDLRGHRAHIDGGRIELTKREFD
FT                   LLSVLAEHAGVVLSRAQLLRLVWGYDFAADTNVVDVFVTYLRKKLEVDGAPRVIHTVRG
FT                   VGFVLRAER"
FT   CDS_pept        502642..503154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31159"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA7"
FT                   /protein_id="BAH31159.1"
FT                   /translation="MRPRREFENVRSRRTTMTRLKVNGKRASRTGVVVASVAVLGMAVA
FT                   PGIAWASNPISDGSPVAVRSIATAPSEAGVAPEVACGAATPISDEELQKLIDEGKVVRA
FT                   EEAGTAAITIEVPGDAATFIAREGVPALPTVESAPAIEGVPAEVLNMAGVAPLEEGVAL
FT                   SCAVAAG"
FT   CDS_pept        503306..504178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04520"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31160"
FT                   /db_xref="GOA:C0ZNA8"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA8"
FT                   /protein_id="BAH31160.1"
FT                   /translation="MCGVLQRVRYGLMRGAFRKVLCFMVMGPTHAMSGAAVGLVVAELL
FT                   PLDWGGPTSTAETLTFAGVCAGAALLPDLDTGQSTVSRSFGPLSKALAKGIDAISVTFY
FT                   RITKGKKDGKRRGGHRTLTHTALFAAGLGAGVSALVVQFGKPAIIITLFFCLGLAIRGL
FT                   AGELAKEKGWLAVSAVALVLSALTWQWYPSEAGSTGLGVAVALGCATHCLGDAITKEGV
FT                   PFLAPLIPLGGKRWWEQRLPSFLSIRAGGSLEKILIGPALTVLTAWLIISAFDGAPEAI
FT                   YAVFAPMVQ"
FT   CDS_pept        504275..506041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04530"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31161"
FT                   /db_xref="GOA:C0ZNA9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR015213"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016170"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA9"
FT                   /protein_id="BAH31161.1"
FT                   /translation="MVHQAERKAEHSSREDGVSRRGFLAASVGAAALAGISWAPAGAVP
FT                   WGSASTIAPPPGFPSDIPLSQQAYANWSREIMLESVWTATARHSDDVVTLANWAFDNGY
FT                   TVRAKGTMHGWSPLTVVPGAPSDRVLLVDTMANLNSVVVQHGTPATVTAGAGASIEAIL
FT                   TALEREGLGWANAPAIGELSIAGALAIGAHGATYPAVGETITPGQSYGSLSNLITEITV
FT                   VAWDEGRNRYGLKTFHRSDDEITAFLTHLGRTFVTSVTLQAGENYRLRCRSFTDIPWQE
FT                   LFAAPGSPGRTYESFVEKSGRVEAIWFPFTQTPWLKVWTPTPVKPPESREVSGPYNYFF
FT                   SDAIPEEVTTPLGMVAQGLQAATPLFGASQFGAVAAGLALTDTDDLWGWSKDVLFYLRH
FT                   TTLRVVAGGGAVITKRSNIGRVVHEMTSWLNERMTHYASLGQYPVNMPFEVRLCGVDDS
FT                   GEVLVDSAGVPDLSAVRPRADRQDWDTAIWMNVVSIPGTAGLPAFLREMERWMVANYSG
FT                   DYATFRPEWSKGWAFTDQAAYQDDEFLTSTVPATFRAGGDGNWDFALATLDEHDPHRVF
FT                   SNTFIDRVLPPS"
FT   CDS_pept        complement(506047..506799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31162"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB0"
FT                   /protein_id="BAH31162.1"
FT                   /translation="MQYGAGMRLPWSRSAQSRRSARSRQPATVLSAADIVAVREQAREL
FT                   VVPGFATFDEICEAARDCVEGGFENDELGRQIDAVVREVWDQRLGEQTQWTGPGDFERV
FT                   SAAFAELERNGIVARMNFTCCMQCGTTEIDDERTPSEPDENGYPFAQWAYTFFHMQDAE
FT                   RLGDEPSDLYLSYSAFRPAHDLDPALVSAAFGGDETAKAQMIAHTDQTVGRQVADALRA
FT                   QGLSVDWNGDNNQRIRISDVRWRKPLPQ"
FT   CDS_pept        complement(506811..508454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04550"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31163"
FT                   /db_xref="GOA:C0ZNB1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB1"
FT                   /protein_id="BAH31163.1"
FT                   /translation="MKLLHNGGLFVNISPTTRKWLGLIAIALGVALIVVDTTIVNVIVP
FT                   SIIEDLGINSVQAQWIQESYAIVFAALLLLVGRVADLVGARRIFIAGVVVFGATSLLAG
FT                   LAPNGGLLILARFLQGAGAAMILPTSLSLLNAMFTGKARGQAFAVWGSTIGAASALGPL
FT                   LGGWLAEHASWRWAFGINIPLAALILIGAVLFIAPSPRTAGRIDATGAALSIAGLGLLA
FT                   FGLVEGRTYGWLTTKEPFDLFGLSWSSGPSPVLVALVLAVLSLGAFAYRQTMLTRSDDP
FT                   SRALMDVRLFSISSFRNGNIATLIIGLGEFGIVAVLPLWLQFTLGYSALQAGLALVPIA
FT                   IGSFVASGASFGMASKVSPLGLVRIGLALEALGLAGLGFIAATDSPWWTIAAVLFFYGI
FT                   GVGFATAQVTNVVLEEIPEQSAGQGSGIQSAFRQLGSALGIAVLTTVFFSTLNSTLNND
FT                   LTESGVDQAQADQLTRAVTDSAGAAIDSLAGSPSTAFVADAAQSAMTHGITLGGYLAAG
FT                   FVVVGLIATALIPNKPAPSTEEETKAAADA"
FT   CDS_pept        508544..509020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04560"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31164"
FT                   /db_xref="GOA:C0ZNB2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB2"
FT                   /protein_id="BAH31164.1"
FT                   /translation="MEAPRDISVERERLMDEFRAYGGTFTEFSHRFASWLGLHSTDATA
FT                   LMEITAAEEKGAPLSPARLGERISLTSGATTALLNRLEKAGHIVRTRENADRRVVTLHS
FT                   SAHVQDLADEFFGPLAVRLDAMMEKYPPELLSRFEEFLVDLHSTMNEHLEQDNR"
FT   CDS_pept        complement(509076..510107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04570"
FT                   /product="putative iron-siderophore binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31165"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB3"
FT                   /protein_id="BAH31165.1"
FT                   /translation="MHSRTTLRSRTSVRVAMVALATVFAATACGSSDAGGNANGNTDVA
FT                   TGGKLFSTADTETAKLGSDAAPGEFPRTITHALGETTLEAKPTRVVVLDSGELDEVLSL
FT                   GITPVGIASPESAAGQPSYLADKLVGVPDVGTTNNLNLEAITALQPDLILGSKLRQDKL
FT                   YPQLSAIAPTVFSIRPGFPWKENFLLAGDALGEETKAEQVLNDYQAHADQVRESIDGSP
FT                   TISLVRFMSGKLRLYGNLSFIGVILKDVGLPRPAIQDINELAVEVSPETITEAEGDRIF
FT                   YSSYGNPADTGQTTVVAGPLWASMDAVKEGRATEVSDETWFLGLGPTGAGLVLDDLQAK
FT                   LGK"
FT   CDS_pept        510297..511853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="RER_04580"
FT                   /product="probable fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31166"
FT                   /db_xref="GOA:C0ZNB4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB4"
FT                   /protein_id="BAH31166.1"
FT                   /translation="MTLNIADLFEAVADAIPDRVPLILEDARLNYAELELRSNRLAHHL
FT                   QSVGVEPGQHVGIHMRNCVEYVEALLACLKIRAVPINVNFRYTDAELLYIYTNSQMVAL
FT                   LVEEEFAPTALAVVPQCPEISHVLIVGDDYENALAAQTDARDFGPRSNDDHFIIYTGGT
FT                   TGMPKGVVWRHEDFFFAALSGANLSGPPRRSLEEVVDAAVANTNPTVLLLIPPLMHGAA
FT                   IYSLLTAFLMGAPRVLTRSFDPMEVLRLVEAEKITGITVVGDAIARPIADAIAASEGRY
FT                   DLSTLKLIGSGGALFSPNLKAELTTRLPGLVIKDAFGASESGNDGVVEFGEDGSKRIRS
FT                   NPNMILVDDEFRRIEPGSGTTGFIARAGHVPVAYFDDPAKTAATFPVVDGVRLAVLGDM
FT                   GTMEADGTIVLLGRGSMCINSGGEKVYPEEVEQALKTHPAVFDALVAGAPDARFGEKVA
FT                   AVVQVRPGFEDVATESLSEHCRTHVAGYKIPRSIVLVPSILRSPSGKADYRWARETVAG
FT                   V"
FT   CDS_pept        511894..513312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31167"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB5"
FT                   /protein_id="BAH31167.1"
FT                   /translation="MCVTGNDAGAGHVFVVRGRLESVDWDAAVVSTSGNFVPREHWWPA
FT                   LGLTSPVERAPAGGNRVRSFPKDGRPAWLLNVASRISVSWLVDGVYEVLDAIASADIRP
FT                   GGRRVKPLVALPTFGVGSGGQGMVRGHVIKALIETAVECADKYDFDIAFVVANAADYAA
FT                   YQSIRRGHLLSAGIPPQVQQLADRLQTGEASLLLGAGVSIPAGLPSWDSLLEAIRQKEL
FT                   PGVSSAEFAELNVLDRAQLLSKELQTEDDGSNDLGERVVQLTGVDIKPTLSHCLLASLR
FT                   VKKVVTTNYDALYERAFESAHGENSVAVLPREEARAGVPWVLKLHGDVADASSIVLSRR
FT                   DFVRYDAERRPLGSIVQSLMATGHLIVVGASMTDDNVLRLAHEVLALDARNKRPRTLGT
FT                   VITLQRDEIRTALWKNDFDYVAVSDSLDQQVAARDLEIFLDKLAILTSVDAPYLLDTHT
FT                   KGCSRGEKSVWQKI"
FT   CDS_pept        complement(513525..513848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31168"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB6"
FT                   /protein_id="BAH31168.1"
FT                   /translation="MASQPDFAHNDMASRSRREKAVGLAKFAWDRDISSAELLEMPDDR
FT                   LRKLARAAGANPPSTRETWTIAAGLLDEKAVWAAANPDRPEARREHPDEKIMWVKKPIE
FT                   PWL"
FT   tRNA            complement(513923..513996)
FT                   /locus_tag="RER_t0090"
FT                   /product="tRNA-Pro"
FT   CDS_pept        complement(514051..515019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31169"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB7"
FT                   /protein_id="BAH31169.1"
FT                   /translation="MSSQFRTNLTRTALGAAGAAALGIGYASGIERNAFALREVTMPVL
FT                   APGSSSLRVLHLSDLHMMPNQRLKQNWLRELEGLDPDLVVNTGDNLSHQRSVPAVVQAL
FT                   GDLLARPGLFVFGSNDYFAPKPKNPLSYIFNKDKRITGDPLPWGDLRAAFTERGWLDMT
FT                   HVRRELEVAGIRIAAAGVDDPHLKRDRYDTVAGTPNPVAQLKLGLTHSPEPRVLDRFAD
FT                   DGYDLVLAGHTHGGQLCLPFYGALVTNCQIDRSRVKGPSKWGAHTQLHVSAGIGTSPWA
FT                   PARFCCRPEATLLTLVPATRREPEHVSAHSSAESPASVLRN"
FT   CDS_pept        515152..515628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31170"
FT                   /db_xref="GOA:C0ZNB8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB8"
FT                   /protein_id="BAH31170.1"
FT                   /translation="MSDTTPSLKATLRTDMVASMKAKDPLRTATLRMLMAAIQTEEVAG
FT                   KEARVLTDEEIIKVLAKESKKRGESAEIYTENGRGELAAKERAEAQIIDEYLPTPLTDA
FT                   ELVDVVDTALAQVSEELGERPGMRQMGQVIKAASALAKGKADGARISAAVKSRL"
FT   CDS_pept        complement(515723..518110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pon1"
FT                   /gene_synonym="ponA2"
FT                   /locus_tag="RER_04630"
FT                   /product="penicillin-binding protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31171"
FT                   /db_xref="GOA:C0ZNB9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB9"
FT                   /protein_id="BAH31171.1"
FT                   /translation="MSIAKTVAKLAGSSALAGVLVAGVMFPVAGGFGFASNRAADTVDN
FT                   VSAELVEGTVPAVSTMVDAAGNPIAWLYDQRRFEVPSEKISNNMKLAIVSIEDRRFPDH
FT                   KGVDWQGTLRAFLTNTTTGEVQQGASTLDQQYVKNYQLLVVAKTDAERRAAIETTPARK
FT                   IREIRMALTLDKELTKDEILTRYLNLVPFGNGSFGIQDAAQTYFGVDAADLTVPQSAML
FT                   AGMVQSSSALNPYTNVEGVTERRNTVLDTMITNIPDRADEFRAAKEEPLGVLETPNNLP
FT                   RGCIAAGDRGFFCDYALKYLSDAGITRDQINEGGYLIKTTLDPQVQASTKAGLNANASA
FT                   NLDGIANVMNVIRPGQDSHKVIAMASSRTYGLNADADETVQAQPYSLAGDGAGSVFKIF
FT                   TTAAAMEKGLGINATLDVPKRFEAKGMGSGGAAGCPVSTYCVENAGNYPPTLSVTDALA
FT                   QSPNTAFVKLIEATGVTPTVDMAVRLGMRSYADPNTSGFDERSMADFQKEQNLGSFTLG
FT                   PTWINPLELSNVAATLASHGKWCPPSPIDSVFDRYGKPVAVTEQGCEQVVEPGLADTLA
FT                   NAMSRDDVGAGTSAGAASSAGWSLPMSGKTGTTETHKSSAFLGFTNNLAAAVYIFGDSP
FT                   TPGEICSSPLRPCYSGNLYGGTEPARSWFAAMNPVANNFGPTSLPPIDEKYARGSQNGQ
FT                   VPEVVGLSQSAATSRLQASGFTVNSVTTASGARAGTVTGVSPSGSAIPGSTVTIYISDG
FT                   SVRAPAAPASPAAPAAPAPGATPPDATPPGREPAPPAGTPPN"
FT   CDS_pept        518386..518709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04640"
FT                   /product="WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31172"
FT                   /db_xref="GOA:C0ZNC0"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC0"
FT                   /protein_id="BAH31172.1"
FT                   /translation="MYTATPSSRLDIEQAEARIAWVTQARCREVDPDQLFVRGAAQRKA
FT                   ATICRHCPVLMQCGADALDNRVEFGVWGGMTERQRRALLKQHPDVDSWSEFFEDQRQHH
FT                   SAV"
FT   CDS_pept        complement(518729..519910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04650"
FT                   /product="putative anion-transporting ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31173"
FT                   /db_xref="GOA:C0ZNC1"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC1"
FT                   /protein_id="BAH31173.1"
FT                   /translation="MMTETTENVTVGSSRTGRRAAPALDISAIIKDPTARIVVCCGAGG
FT                   VGKTTTAASLALRAAEEGRRVVVLTIDPARRLAQALGVAELDNTPQPVKLGPEATGELH
FT                   AMMLNMRRTFDEMVIEHSSPEKAEQILANPFYQTVATSFSGTQEYMAMEKLGQLASNDA
FT                   WDLVIVDTPPSRNALDFLDAPQRLGTFLDGRMIRLLSAPGRGLTRLVAGAMGLALKGVS
FT                   TIVGSQILSDASAFVQSLDSMFGGFRERATKTYELLRQPGTHFLVIAAAEPDALREAAF
FT                   FVDRLAGDSMPLAGLVLNRTHPTLTALPADHAVTAADKLEAKESATEAEALTAAVLRIH
FT                   AHRAVIAKREIALLSRFTAAHPRVPLIGVPSLPFEVSDLEALRAVGDQLTRKG"
FT   CDS_pept        complement(519907..520920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04660"
FT                   /product="putative anion-transporting ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31174"
FT                   /db_xref="GOA:C0ZNC2"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC2"
FT                   /protein_id="BAH31174.1"
FT                   /translation="MVASQDELSRTWPESATKARLHFVSGKGGTGKSTVAAALALALAE
FT                   GGKRVLLVEVEGRQGIAQLFDVPPLPPQETKVAAAEGGGEVMALAVDIETAFLEYLEMF
FT                   YNLGFAGRAMRKFGAIEFATTIAPGLRDVLLTGKIKECVIRTDRTGKRVYDAVVVDAPP
FT                   TGRIGSFLDVTKAMADLAKGGPVHSQSEGVVRLLHSPETVVHLVALLEALPVQETADAA
FT                   AELARDDLNLGAIIVNRASPRFLPEDQLAGAAAGNIDAASIRSTLSDVGIDLSDDDFAG
FT                   LLTETIEHAAVLEAQESSAEKLREIDGARVQLPALADGVDLGGLYELAEYLTEQGV"
FT   CDS_pept        520974..521138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31175"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC3"
FT                   /protein_id="BAH31175.1"
FT                   /translation="MSEITSWEYTVTPLLVHNPKAILDNWGVDGWELVAVLPSASGEQH
FT                   VAYMKRPKG"
FT   CDS_pept        521144..521614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31176"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC4"
FT                   /protein_id="BAH31176.1"
FT                   /translation="MAEATQTWSERLAELGIALPAVAAPVAAYVPAVRSGNHVYTSGQL
FT                   PFVDGKLALTGKLGAGVSDEDAKAAARTCALNALAAIDALVGIDNVVRVVKVVGFVASA
FT                   EGFTGQPGVINGASEFLGEVLGDAGIHARSAVGVAELPLGSPVEVELIVEVR"
FT   CDS_pept        521614..522399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04690"
FT                   /product="putative beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31177"
FT                   /db_xref="GOA:C0ZNC5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC5"
FT                   /protein_id="BAH31177.1"
FT                   /translation="MSTVHPAYAQLRRVTDIASVLLENNPGMMTLDGTNTWILHAPGSV
FT                   ECVVVDPGDNDEEHLQRVAGIGPVALTLITHRHYDHTGGVDRFHELTSAPVRSVDPTFL
FT                   RGGASALVDGEVIEVAGLKLRILATPGHTADSVSIVIENDASVLTGDTILGRGTAVLDD
FT                   TDGDLGDYLTSLRSLAALGEGLTVLPGHGPDLPDLQAISQQYLAHREERLAQVRDALTT
FT                   LGESASVREVVEHVYSDVDPKLWPVAEKSVNVQLAYLRR"
FT   CDS_pept        522588..524063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04700"
FT                   /product="putative 2-aminomuconic semialdehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31178"
FT                   /db_xref="GOA:C0ZNC6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017628"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC6"
FT                   /protein_id="BAH31178.1"
FT                   /translation="MTSQCDGWIRNYVDGSYVEPDESSSFDQVDPATGRVLARVHEADK
FT                   ALVDRAVTSARRALDNGWADTPVRERTALLRRAADRIEERFEEFVAAEMADTGKPITQA
FT                   RELDVARALTNFRTFADIVAAAGQESFVTDLAGGKQALNYAIRKPLGVVAVIVPWNLPL
FT                   LLLTWKVAPALACGNSVVVKPSEETPATASLLAEVLEEVGLPAGVYNVVHGFGANSAGE
FT                   FLTTHPGIDGVTFTGSSATGSHVMKTVAPRVRPVSFELGGKNAAIVFDDVDIDEALTGL
FT                   TKSVFTNTGQVCLCTERVYVHRSIFDDIAGGLVERAAGLRLGDPTLDATTTGPLISQAH
FT                   RKKVLDYFEIAEQEGAKVLTGGGIPDLGQELSGGSWIEPTLWTGLTNKDRVVREEIFGP
FT                   VAALIPFETEAEAIALANDTEYGLAASVWTNDLRRGHRVAQKMNVGISWVNTWFTRELR
FT                   SPFGGMGLSGIGREGGESSLHFYTEPTNVCVQL"
FT   CDS_pept        524106..524879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04710"
FT                   /product="putative 4-oxalocrotonate decarboxylase"
FT                   /EC_number="4.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31179"
FT                   /db_xref="GOA:C0ZNC7"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC7"
FT                   /protein_id="BAH31179.1"
FT                   /translation="MTAPEDTVSALARRLDDAAQTRTDTPSLADEYTIDIDEAYRIQNE
FT                   LLERRTSRGESIVGIKLGFTSQAKMAQMGVSEVIVGQLTDAMCVSNGGEVDLRKFIHPK
FT                   IEPEVAYRLSKDVDLDDPNVDIETCVDALAPAMEIIDSRYRDFRFTYTDVVADNTSAAG
FT                   YVIGRWLPLQNVEDRSVRMEVGGETVVGSTSAILGDPARALHALLDIARRRRIPLRAGQ
FT                   VILAGAATAAVRLDEGVAQCTIDGLGTVTVKGVKR"
FT   CDS_pept        524876..525328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04720"
FT                   /product="putative 2-aminomuconate deaminase"
FT                   /EC_number="3.5.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31180"
FT                   /db_xref="GOA:C0ZNC8"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC8"
FT                   /protein_id="BAH31180.1"
FT                   /translation="MSGAQVIEKLAKPRGKFPHVKVVGDFVYVSGTSSRRPDNTFVGVE
FT                   VDEMGTTALDIRAQTRAVIENIAAILAEVGGELSDLVQVTSYLVSMNDFGGYNEVYAEL
FT                   FDENGPTRTTVAVHQLPHPHLLIEISGVAYVPASKRSASEDTENAS"
FT   CDS_pept        525325..525846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04730"
FT                   /product="putative 3-hydroxyanthranilate 3,4-dioxygenase"
FT                   /EC_number="1.13.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31181"
FT                   /db_xref="GOA:C0ZNC9"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC9"
FT                   /protein_id="BAH31181.1"
FT                   /translation="MTTIPPVIDFKKWIDDNRHLLQPPVNNQTMALGDDFIVQVVGGPN
FT                   QRTDYHLDPYEEWFYQLEGDIHVNVMTEDGPQRVDIREGETWLLPGDIPHSPQRPTAGS
FT                   IGLVIERVRKEGTLEKFQWYCLECDHKIHEVELQVRDIVADLPPVFVKFYESEEARTCD
FT                   KCGTLHPGKG"
FT   CDS_pept        525847..526845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04740"
FT                   /product="putative 2-amino-3-carboxymuconate-6-semialdehyde
FT                   decarboxylase"
FT                   /EC_number="4.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31182"
FT                   /db_xref="GOA:C0ZND0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND0"
FT                   /protein_id="BAH31182.1"
FT                   /translation="MMSNLIDIHTHYVPNGWPDLTEDAGPQAPWLKVESETEAMIMMGT
FT                   KEFRRIQSDAWDAEVRLRDMDADGVHTQVVSPTPAFFNYGRSGEQASRIARIFNDLALE
FT                   IVEPAKDRLIPFCQVPLQDTDAACRELERCIANGHRGVEIGNHVGDLDLDSEGVVTFLQ
FT                   HCASLDVPVFVHPWDMANSPRLDRWMAQWLTAMPAETHLSILALILGGVFDKIDDRLKI
FT                   GFAHGGGSFAFWLGRMENAWHGRNDIIGTSEFPPSHYLGRFYVDSVVFDERALRLLVDT
FT                   VGVDRVMVGSDYPYPLGERPVGEVVRKSEFLDDTARQLISRGNAERFLGLV"
FT   CDS_pept        527030..528388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04750"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31183"
FT                   /db_xref="GOA:C0ZND1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND1"
FT                   /protein_id="BAH31183.1"
FT                   /translation="MSDKISNSTTSDGKPLPEKAARSRVAMATLAGTTLEWYDFFLYGT
FT                   AAALIFNKQFFPSLSPTAGTLAAFSTFAVGFIARPVGGLVFGHFGDRIGRKATLVVSLV
FT                   MMGVGSTLIGLIPNYDSIGFWAPVLLVAMRVVQGIGLGGEGAGATLMSMEHAPAGQKNR
FT                   YAGFPQMGTPAGLVLANGIFLTTNAVMSDSAFASWGWRIPFLLSFVLVAIGLVIRLRVT
FT                   ESPSFAGIMEKGEIVRFPLRESLKVGFPRLSLTLAACLANSAVAYAFMVFTLSYGTQHL
FT                   GYDKQFLVLSVTAAAVLWFLSIPFWTKIADKYGRRHMFIGGSAAILLWCIVFFPLLNTE
FT                   NKVVAVIAFLGMGLIVPVTHCVQGSIIADTFPAKVRYSGSSLILQSGAILGGGLAPMIA
FT                   TALLDATGSSVGVTWYLASICTISLVGAIALFKIVPDSSRGLEHEEIRVSENA"
FT   CDS_pept        complement(528449..529375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04760"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31184"
FT                   /db_xref="GOA:C0ZND2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND2"
FT                   /protein_id="BAH31184.1"
FT                   /translation="MDMPKLLDGRLKLRHLLLVDALSRQGSVVGAAAALHITQPVATRS
FT                   LHDIESILGVSLFDRGPRGITPTIFGEAFTTHARAVIAQLTEAGRHVVELADANRGTVI
FT                   VGTHLAGSNVLLPGAIARLKVHHPLLTVIVREGTPEQLLTDLEAGRIDLIVGRLTSPTD
FT                   DTAIRRNLYAESVELVTRVDHPLAHREDVQLEELRGFPWILPGVETVLRRELEEFFARN
FT                   SLPLPENRVEATSFLTVRQLLVETDMIAVLPSLIPRDDARLTTLSITLDPIGHSVGITS
FT                   SATRTSSPSAQALIATLESFAAELMRP"
FT   CDS_pept        complement(529426..530718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04770"
FT                   /product="putative carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31185"
FT                   /db_xref="GOA:C0ZND3"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND3"
FT                   /protein_id="BAH31185.1"
FT                   /translation="MPSSETVIASTASGKIRGLKRDGSYYFGAIPYARAARFEKPRPAG
FT                   PFSDVFDATALGTVFPQPPSRLERIMGPPLPEPEQSEDSFTVTVTTPSLTGHRPVMVWL
FT                   HGGGYSSGGGSLPWYDCGALSAEGDVVVVSVNYRVGVLGYLLLDGVSEGNLGVHDQIAA
FT                   LEWVRENIEAFGGDPDSVTVFGQSAGAHSIVNLLSSNNSRTLFHRAILQSTPRPDLNFT
FT                   QAAAIENGETFARLLDGDPRTAPLSRILDAFRSTAIEFSRRSPNVVQPPFAPISELDPV
FT                   IRTFETAPDVIVGYTRDEGSAFVRDVAGVPDPERVAEKALTQNMFAEPAMELADAFTAA
FT                   GASVYTYRFDWAPTDDVFGATHCIELPFVLGTDQSWKSSPMLGSSDWQNIDALGRRIRR
FT                   HWTSFAHTGSPDSSETWEKYTSAQPIGITFF"
FT   CDS_pept        complement(530804..531364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04780"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31186"
FT                   /db_xref="GOA:C0ZND4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND4"
FT                   /protein_id="BAH31186.1"
FT                   /translation="MARQVAERSDTIPALANVFRTYGFDGASLAVITEHTGLGKGSLYN
FT                   FFPRGKEEMAEAVLDEVDGWFRTEVFEPLRAESVPPQQRIESMFATVADYFRSGQRICL
FT                   FGAFALGEERNRFGAKVRTYFDEWTAALEAALVGAEDSTGLAEEAVAGIQGAIVMSRAL
FT                   DDGAVYSRVTTRLEDRLVQALTP"
FT   CDS_pept        complement(531380..531850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31187"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND5"
FT                   /protein_id="BAH31187.1"
FT                   /translation="MTVRAPIPPFTHETAVQKVRLAEDGWNSRDPHKVSLAYTPDSWWR
FT                   NRSTFVTGRSEIVELLTEKWTRELDYRLIKELWAHGDDRIAVRFAYEWHDHDGQWFRSY
FT                   GNENWEFDADGLMHHRHASINDVPIAESERKFFWDSTGPRPHDHPGLSELGL"
FT   CDS_pept        complement(531981..532655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04800"
FT                   /product="CRP/FNR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31188"
FT                   /db_xref="GOA:C0ZND6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND6"
FT                   /protein_id="BAH31188.1"
FT                   /translation="MDDVLARAGIFQGVEPSAVAALTKQLQPVDFPRGHVIFNEGEPGD
FT                   RLYIIVSGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSTATTVTEVRAVSM
FT                   DRDALKAWIQQRPEIAEQLLRVLARRLRRTNNTLADLIFTDVPGRVAKALLQLAQRFGT
FT                   QEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWLRLEGKSVLISDSERLARR
FT                   AR"
FT   CDS_pept        532923..533153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31189"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND7"
FT                   /protein_id="BAH31189.1"
FT                   /translation="MCPNFAQAGALGSLRLTALPLPVEASERMGKPIACQAGDVVVTCL
FT                   IEEVFYFVLLNREPTQSPFDSFHRQGKEHQQ"
FT   CDS_pept        533264..534049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="RER_04820"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="protein synonym:DNA-(apurinic or apyrimidinic site)
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31190"
FT                   /db_xref="GOA:C0ZND8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND8"
FT                   /protein_id="BAH31190.1"
FT                   /translation="MQTTPTGSSEQRKKPRSGGARKEESHLGLVRRARRMNRELAVAFP
FT                   HVYCELDFTTPLELAVATILSAQCTDVRVNMVTPALFARYPDAKAYAEADRTELEEYIR
FT                   STGFYRNKTTSLIGLGQALLERHDGQVPNKLEDLVKLPGIGRKTANVVLGNAFDIPGIT
FT                   VDTHFGRLVRRWKWTEEEDAVKVEHAVGALIERKEWTLLSHRVIFHGRRVCHARKPACG
FT                   VCVLAKDCPSYGLGPTDKTEAAALVKGPETDHLLALAGL"
FT   CDS_pept        534056..534709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04830"
FT                   /product="putative thiol-disulfide oxidoreductase"
FT                   /EC_number="1.8.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31191"
FT                   /db_xref="GOA:C0ZND9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND9"
FT                   /protein_id="BAH31191.1"
FT                   /translation="MTSAGRWSLAALVVVAALVVAIWPRGGDDTTPTSTGPSSSAYQPP
FT                   TFTPSSESLDQLRSQASLAPCPTPTGEAPAGSALAGITLDCVSDGRPVDLAAAVGGKPT
FT                   LLNLWAYWCAPCAEELPYLQEFAERAEGSINVLTVHSDPNQENALTRLIDYSVRLPGVQ
FT                   DGDGKVRIAVGAPPVLPVSVLVRADGTVAKVLPQPFRSADEIAAAAAQYLGVVV"
FT   CDS_pept        534811..535425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31192"
FT                   /db_xref="GOA:C0ZNE0"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE0"
FT                   /protein_id="BAH31192.1"
FT                   /translation="MTRPAAVLVLFGGPREADPLAVGGLPEGADVLLTQRASTMRQHSG
FT                   QVAFPGGAADPGDDGPIGTALREAQEETGLDPSGVQPLTVLPEIFIPPSGFDVTPVLGY
FT                   WEQPTTVGIQDEGEVGRVARVPLRTLLDPDNRFQVRHPLGYQGPAFRADGMLVWGFTAG
FT                   ILAALFTVSGWEIPWNYEDVRDLDTALSEFGEGVEDSAVPR"
FT   CDS_pept        535422..536612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04850"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31193"
FT                   /db_xref="GOA:C0ZNE1"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE1"
FT                   /protein_id="BAH31193.1"
FT                   /translation="MTGSRWVDIAIVLVALIAATSGWRQGAVASALAFVGVILGAVAGI
FT                   LLAPHLLVHVTEGKLRILAGISLIVVLVIIGEVAGMVLGRAARSGMHSPTARSVDSVIG
FT                   AGLQAVAVVVAAWLLAIPLTSSSQPNIAAAVRGSDVLASVDELAPQWLRRIPTEFSALL
FT                   DTSGLPDVIGPFGRTPITEVEAPDASVLASPLAAQLRPSVLRINGVAPSCQRALEGSGF
FT                   IVAPERVMTNAHVVAGTESITVDTMEGALPAQVVLFDSAVDIAILAVPGLDAPVLPFAP
FT                   EQAQTGDNALVLGYPGGGPYTASAARVREVLNLNGPDIYKAGTTQREVYTVRGSIRQGN
FT                   SGGPMVDDQGRVLGVVFGAAVDDSDTGFVLTAQEVSRQLNAAASASTPVPTGACIL"
FT   CDS_pept        complement(536616..537551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04860"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31194"
FT                   /db_xref="GOA:C0ZNE2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE2"
FT                   /protein_id="BAH31194.1"
FT                   /translation="MAAPDPSTVRFDGPWIHRDIHANGIRFHVVEVGDAEPDAPLVVLL
FT                   HGFADFWWSWRHQLTALSEQGFRVVAMDLRGYGDSDKPPRGYDGWTLAGDVAGLIRAMG
FT                   YGKATLIGHADGGLVCWATALLHPRLVRSIALISSPHPMALKKAVVRDPYQRRALLPSF
FT                   LAYQVPLRPERRLTADNGAEVERLVRSRSGPTWPQQPEFADVMTKMRAAIRIPGVAHST
FT                   LEYQRWAFRSQLRPEGRRFMRLMDQVLRIPIVQIHGELDPYVLTRTVRRDKHWAPGEKL
FT                   RTIAGVGHYAHQEAPERVNRELEDFLLTEK"
FT   CDS_pept        complement(537567..538076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31195"
FT                   /db_xref="GOA:C0ZNE3"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE3"
FT                   /protein_id="BAH31195.1"
FT                   /translation="MSLTNGESQRFTGDGVPNTVSSIPLTDVDARTPGEATIGALVKDA
FT                   TAQVSTLVRAEVELAKAEVTGEVKKGLQGSVFFILAFTVLLFSSFFFFFFLAEMLDTWV
FT                   PRWLAFLIVFLIMVVTTAILALLGYLRVRKLRAPEKTIESLKQAKNVLPGSHDDAKPSV
FT                   DFNARR"
FT   CDS_pept        complement(538073..539407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="RER_04880"
FT                   /product="probable Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31196"
FT                   /db_xref="GOA:C0ZNE4"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE4"
FT                   /protein_id="BAH31196.1"
FT                   /translation="MHSMLYNVDHVHVCCIRTRVHEQRSSPRVISTLRSELSRYLRTET
FT                   VGGSILLIAAAVALIWVNSPFGESYIALRDFQIGPSALHLDLSLGTWAQDGLLAVFFFV
FT                   AGLELKRELVVGELADRKAAMLPIIAACGGVLVPAIIAASIGFGTPGMDKGWAIPVATD
FT                   IAFALGVLALTGSKIPASARVFLLSLAVVDDLLAIILIAVLFTGSLAMLWLLTAAAALA
FT                   VYAYAQHKRITTPFLYVPLALLTWYAMHEAGIHATLAGVALGLLTRVRRDPDEEYAPGS
FT                   RLEHRIQPYSAGFCVPVFALFASGVPINAAVLGDIFTDPVGQSVVVGLLVGKTVGIFGI
FT                   SLLAIKLGIATKPKTLELRDMFALSVLGGIGFTVSLLVADLALDGVGDGSEAEIAKAAV
FT                   LVTSLVASLIGSALLWRRGRVHAARDDASTAIATDARELPGEVDK"
FT   CDS_pept        539581..540972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04890"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31197"
FT                   /db_xref="GOA:C0ZNE5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE5"
FT                   /protein_id="BAH31197.1"
FT                   /translation="MSTSVSENPPKPEGGDADTVAGVPRSRIVVASMVGTSIEFYDFYI
FT                   YATAAVSVFPHLFFPKGNDTTALLASLATFGLAFVARPLGSILFGHFGDRVGRKATLVG
FT                   SLLTMGVATFLIGLLPTYHQIGLLAPALLALMRFCQGLGLGGEWSGAALLATETAKEGK
FT                   RAWAAMWPQLGAPIGFFMANGLFLIITLFMNHDNSSPDLEGAFLSWGWRIPFLLSTIMV
FT                   MIGLYVRLKLEETPVFARAVERGEKVKTPVAEVFKTSWRQLIIGTFVMLATYTLFYIMT
FT                   TWVLSHGTGKTAADGGTGAGFKYTDFLVLQLIAVVFFAAAVPVSGWLADRYGRRITLLI
FT                   ITGLIMVFGLTFGVFLEPDGMNDGRMLAFLIVGMLLMGLTFGPMSAVLPELFPTNVRYT
FT                   GSGIAYNTASILGAAVAPFIAVYLAKNYGVGWVGIYLLVAATLTFVALLVMRETKGESL
FT                   DDVGA"
FT   CDS_pept        complement(541028..542713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04900"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31198"
FT                   /db_xref="GOA:C0ZNE6"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE6"
FT                   /protein_id="BAH31198.1"
FT                   /translation="MTAVNEQVSAGAPDRADLGENAALKETLEDYTLRFAPRSYRKWGT
FT                   GVVATSALGGIAYLADFSIGANIGISYGTGNALLGIAVFAVVIMATGFPLAYYAARYNI
FT                   DLDLITRGSGFGYYGSVVTNVIFATFTFIFFALEGSIMAQGLKLGLGIPLSIGYAVSTL
FT                   MVIPLVIYGMKALAKLQVWTTPLWLVMMVLPFLYLLFKHPDSVSAFFAFGGEDGANGKG
FT                   VNFGSVMLAAGVCLSLIAQIAEQIDYLRFMPPKTPENTRRWWAAVILAGPGWVIFGAFK
FT                   QIVGLFLAVYIIANVVDGSSIANQPVHQFLEIYQDMMPHWLAMTLAVILVVISQIKINV
FT                   TNAYSGSLAWTNSYTRVTKTYPGRMIFVLVNLAIALILMEANMFDFLNTILGFYANCGI
FT                   AWVVVVASDIAINKYWLKLSPKVPEFRRGMLYDVNPVGFVSMLLAAGISILVFFGAFGS
FT                   AIKPFSPIVAIVIALVMPPVLAVATKGKYYLRRTDDGIDLPMFDEYGNPSGETLLCCVS
FT                   GIEFERPDMLASNVPGPNGEKQYISSLALSTDKTGEHVLPAQLP"
FT   CDS_pept        complement(542849..543889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04910"
FT                   /product="putative ATPase"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31199"
FT                   /db_xref="GOA:C0ZNE7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE7"
FT                   /protein_id="BAH31199.1"
FT                   /translation="MLHDRNSAAPPPPAEERSEPVPVGAFDARKLSKALSSKIVGQQAA
FT                   VDAVVRAISIAHVGATDPTRPLANILLVGPTGVGKTELVRRVAAELRSGPDDLCRIDMN
FT                   ALAQEHYAASFSGAPPGYAGSKESFTLFDKNTVEGDPYTPGIVLFDEVEKADPTVLRAL
FT                   LQVLDNGELRLANGQQKISFRNSYVFLTSNLGSAAVAERRRSRVRQLTDRVRIDRPHHG
FT                   HHLVQRALEKFFDPEFFNRIDETVILDEFDEQTAEQVTRLEIELITTRLARRGVDVDVD
FT                   DSAVALLQRRGFDPVYGARGLRRTIRNVLADPVAAAVLNLRPVGTQPLALQARAVGDQI
FT                   QVKKVP"
FT   CDS_pept        complement(543918..544955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiE"
FT                   /locus_tag="RER_04920"
FT                   /product="aliphatic amidase"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31200"
FT                   /db_xref="GOA:C0ZNE8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR023719"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZNE8"
FT                   /protein_id="BAH31200.1"
FT                   /translation="MRHGDISSSNDTVGVAVVNYKMPRLHDRAGVLENARKIADMMIGM
FT                   KTGLPGMDLVVFPEYSTQGIMYNEEEMYATAATIPGDETAIFSAACREADTWGIFSITG
FT                   EQHEDHPNKPPYNTLILIDNKGEIVQKYRKILPWCPIEGWYPGDTTYVSEGPKGLKISL
FT                   IICDDGNYPEIWRDCAMKGAELIVRCQGYMYPAKDQQVMMSKAMAWANNCYVAVANAAG
FT                   FDGVYSYFGHSAIIGFDGRTLGETGEEEYGIQYAQLSVSAIRDARENDQSQNHIFKLLH
FT                   RGYSGVHAAGDGDKGVADCPFEFYKLWVTDAQKAQERVEAITRDTVGVADCRVGNLPVE
FT                   KTIEV"
FT   CDS_pept        complement(544982..545602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiS"
FT                   /locus_tag="RER_04930"
FT                   /product="putative amidase substrates transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31201"
FT                   /db_xref="GOA:C0ZNE9"
FT                   /db_xref="InterPro:IPR003211"
FT                   /db_xref="InterPro:IPR038523"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE9"
FT                   /protein_id="BAH31201.1"
FT                   /translation="MGSVGLLYVGAVLFVNGLMLLGTVPVRSASVLNLFVGALQCVVPT
FT                   VLLIQAQGDSSAVLAASGLYLFGFTYLYVGISNLAGFEPEGIGWFSLFVACAALVYSFL
FT                   SFTVSNDPVFGVIWLAWAALWTLFFLVLGLGRENLSRFTGWAAVLLSQPTCTVPAFLIL
FT                   TDNFHTTPAVAAGWAGALLVLLGLAKILAAPKAAVPQTHPVFN"
FT   CDS_pept        complement(545713..546792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiC"
FT                   /locus_tag="RER_04940"
FT                   /product="putative aliphatic amidase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31202"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF0"
FT                   /protein_id="BAH31202.1"
FT                   /translation="MSATGALERARSAVWRLGMVVPLQGPAGLFGPSCEAISELAARDL
FT                   NNSGGVLGREVQIEVIDGGASPGVVAARVQQLLDAGDIDAVSGWHISSVRHALAPVVAG
FT                   RIPYSYTSLYEGGEVRPGIYCSGETPRQQIAPALKWLRDNVGARKWFVVGDDYIWPHSS
FT                   LGAVRQFATELDLTLVGGSFVDLGRGNMKQLVETVSNSGCDGVIMLLVGQDAVDFNRAF
FT                   ARRGLDESMIRFSPLMEENMLLASGPRATRNLFASAAYFRSMVDGNSMDLLGRYIALHG
FT                   AHAPALNNAAESCYEGIHTLSALVRRADSTHPHALDAVVEGAAYDGPRGTVEFRDRVAR
FT                   QKIQLAVADGLDFSIIATL"
FT   CDS_pept        546870..547325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04950"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31203"
FT                   /db_xref="GOA:C0ZNF1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF1"
FT                   /protein_id="BAH31203.1"
FT                   /translation="MKYATAGERSVGKSDSGILDASLTTALVRAARMAAAAAEKTLAAE
FT                   NLTLDHWMTLEALASTEGLTMAELRDRTGTPAPTLTRVADKLVSLALIYREVGEDDRRK
FT                   VRVFLSSRGKSLHKRVAADIRVAEESWLTSKEEVKLREGLRPCAPFR"
FT   CDS_pept        complement(547363..549294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="RER_04960"
FT                   /product="acetate--CoA ligase"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31204"
FT                   /db_xref="GOA:C0ZNF2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF2"
FT                   /protein_id="BAH31204.1"
FT                   /translation="MTSAAETDVPQAYPPSAEFAAAANAGPELQAAADTDRLAFWANQA
FT                   ERLHWHEKWTDVLDWTDAPVAKWFVGGKLNVAYNCVDRHVLAGNGDRVAIHFEGEPGDS
FT                   RDLTYNDLLAEVSRAANTFTDLGLVAGDRVAIYMPMIPEAIVTMLACARLGLTHSVVFA
FT                   GFSATALRSRIDDAQAKLVVTVDGQWRRGAAAPIKTAVDESVAGADSVQNVLVVNRTGI
FT                   DVEWTDGRDLWWHETVAAASPEHEAQAFDAEHPLFILYTSGTTGKPKGIIHTSGGYLTQ
FT                   ASYTHHNVFDHKAGQDVYWCTADIGWVTGHSYIVYGPLSNGVTQVVYEGTPNSPNEHRH
FT                   FDIIEKYGVSIYYTAPTLVRTFMKWGREIPDAHDLSSIRLLGSVGEPINPEAWRWFRDV
FT                   IGGNKAPIVDTWWQTETGAIMISPLPGITATKPGSAMAPLPGISAKIVDDDAKPLGPGG
FT                   NGYLVLDEPWPAMLRGIWGDMDRYRDTYWSRYAEEGWYFAGDGAKYDDDGALWVLGRVD
FT                   DVMNVSGHRISTSEVESALVNHHGVAEAAVVGAADETTGQGIVAFVILREGVENTGEVL
FT                   IAELKAQVSTDISPIAKPRQITIVPELPKTRSGKIMRRLLRDVAEGRDLGDTSTLVDPK
FT                   VFDAIRGK"
FT   CDS_pept        549644..551275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04970"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31205"
FT                   /db_xref="GOA:C0ZNF3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF3"
FT                   /protein_id="BAH31205.1"
FT                   /translation="MEGIPLRISRIATGAVALGMTAVLITACSSGDSSGGSSSGVVNAW
FT                   AGEPQNPLIPTNTSENMGGRVLDSLFSGLVSYTADGGTENEVAESIESTDGQNFTVKLK
FT                   DGWTFTDGTPVTAKSFVDAWNYGALSTNAQLQASFFDPIKGYDEVAAEVPTAQTMSGLK
FT                   VVDDSTFTIELKQPESAFPDRLGFTAYYPLPEVAFKDMTAFGENPIGNGPYKLDGTGAW
FT                   QHNVRIDTVVNPDYNGNRKPKNAGVDFIMYNSLDTAYTDLLANNVDVLDQVPPSAVTTF
FT                   ESDLPGRTVNQPSATIETFTIPGRLPHFSGEEGMLRRQAISMAINRDQITQQIFNKTRT
FT                   PALDFTSPAIKGWNDSLTGNSNVKFDPEAAKAAWAKADAIAPWSGSFEIAYNSDGGHQE
FT                   WVDATANSIRNTLGIDAKGKQYATFAQIRTEATDRTIQSSFRSGWQGDYPQQYGFLAQN
FT                   YQTGGSSNDGDYSNPEFDRLLRESAGQTDQAKAQELLDQAQEVLLKDLPAVPTWYRNAA
FT                   SGWSENVSNVTISWNGVPVYEDIEKN"
FT   CDS_pept        551401..552327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04980"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31206"
FT                   /db_xref="GOA:C0ZNF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF4"
FT                   /protein_id="BAH31206.1"
FT                   /translation="MLWYIGRRVLQMIPVFLGATLLIYAMVFLLPGDPIAALAGDKALS
FT                   PAVAAQLRERYHLDLPFYQQYLLYLKGIFTLDFGTSFSGRPVSEVLAQAFPITMKLAFM
FT                   ALIVETVFGVGFGLIAGLRKGGFFDSTVLLFSLVLIAIPIFVIGFLAQFFIGVKWGIVP
FT                   PTVGGNTSFTNLLLPALVLGSVSFAYVLRLTRTSVAENLTADYVRTATAKGLSRGRVVR
FT                   VHVLRNSLIPVVTFLGADLATLMGGAIVTEGIFNINGVGGTIYQAVTRGEAPTVVSFVT
FT                   ILIVIYLIANLLVDLLYAALDPRIRYV"
FT   CDS_pept        552320..553276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04990"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31207"
FT                   /db_xref="GOA:C0ZNF5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF5"
FT                   /protein_id="BAH31207.1"
FT                   /translation="MSETVKTGRAVRQSHFVAPPEVAAPGETDAVKLDQAPTSMWTDAW
FT                   RDLRKRPLFIISTIIILAVIVIAAFPSLFTSTDPRFCDLTYSMQGPTSGHWFGFDRQGC
FT                   DVYSRTIYGARASVLVGVGVTASVLVIGVIFGALSGFYGGWTDSILSRVADIFFGIPLI
FT                   LAAIVLMQLFTDRTIWTVVGVLALFGWPQMARIARGAVISAKNNDYVMASEALGVSKLK
FT                   TLIRHVIPNSLAPIIVVATISLGTYIVAEATLSFLGIGLPSTEVSWGGDISNAQVTLRQ
FT                   GSTILFYPATALAITVLGFIMMGDALRDALDPKSRKR"
FT   CDS_pept        553273..555006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05000"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31208"
FT                   /db_xref="GOA:C0ZNF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF6"
FT                   /protein_id="BAH31208.1"
FT                   /translation="MSTMTTKETLTSEETPLLEIRDLEVSFQSNSGPVPAVRGVSLTVY
FT                   PGQTVAIVGESGSGKSTTAHSIINLLPGTGKVTAGEIIFDGKDISKVSEKDFVHIRGSQ
FT                   IGLVPQDPMSNLNPVWKVGFQIEEALAANGIAKGKAAKVRAAELLEEAGLAEAESRLGQ
FT                   YPHEFSGGMRQRALIAIGLSARPKLLIADEPTSALDVTVQRQILDHLDGLTTELGTAVL
FT                   LITHDLGLAAERAEHLIVMSKGRIVESGPALEILKRPQHPYTQKLVAAAPSLASKRLSS
FT                   SVARAEIREQAEEVAEAVKAEESAAESFGKATDDVLVVDHLTKVFKLRKGFRKTTDFTA
FT                   VNDVSFKVRRGTTTAIVGESGSGKSTVAQMVLGLLEPTAGNVVFDGQDVSKLGSKETFA
FT                   FRRRVQPIFQNPYGTLDPMYSIYRTIEEPLRTHKVGTKAEREARVRELLDKVGLPQSVM
FT                   RRFPNELSGGQRQRVAIARALALQPEVVICDEAVSALDVLVQDQILTLLNDLQAEFGLT
FT                   YLFITHDLAVVRQIADNVLVMSRGSIVESAPIDDVFGNPQQDYTRKLLDAIPGGSITLG
FT                   S"
FT   CDS_pept        555063..555812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31209"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF7"
FT                   /protein_id="BAH31209.1"
FT                   /translation="MTDPLQPLVDLPGVRAAADHARDALGEVHRHKTNRRGWPTTAAEA
FT                   AVRAARASASLAGGTTELPAEGMAGDPILAGALRVAQALDGDSLPLMESTWKRAPLQAL
FT                   ARLHLLAAADLVEDADQLGRPRSDRGVGERLDALAQLVTGGTSAPAPVLAAVVHGELLA
FT                   LSPFGTADGIVARAASRLVAVSSGLDPHNLGVPEVSWLRRPQAYTDGAAGFASGNPAGV
FT                   GSWVILCCGALEAGAREATSIADAATG"
FT   CDS_pept        complement(556203..557021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31210"
FT                   /db_xref="GOA:C0ZNF8"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF8"
FT                   /protein_id="BAH31210.1"
FT                   /translation="MTDKPANGLNTGRTAAFFDLDKTIIAKSSTLAFSKPFFAQGLINR
FT                   RSVLKSSYAQFLFLLSGADHDQMERMREHLTAMCAGWDVEQVKAIVAETLHDIVDPLVF
FT                   AEAADLIADHKLRGHDVIVVSASGEEIVAPIARALGATHSVATSMREEDGHYTGEVDFY
FT                   CYGPGKVEAMEKLAAEYGYDLAASYAYSDSVTDLPMLEAVGHPTAVNPDRALRKEAAVN
FT                   GWPILTFSNPVSLRARLSAQSTTTVATTAAVGIAALVAGAMTFGLLRRKR"
FT   CDS_pept        557334..558428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31211"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF9"
FT                   /protein_id="BAH31211.1"
FT                   /translation="MNTTINSRETGAPILVLVDDAKVLASVRRVAAAVDRCLDEAEHPV
FT                   SRQQWNRASAVVLDASAARDALTRSPKRTRVFLVCDGTPTVDDWKSATAIGADSVLSLP
FT                   EEENALVAVLADHVDVSGDGTVVSVVGGCGGGGASATAAAVALTSAARHVPTLLVDVDA
FT                   LGSGADVLLGIETTPGLRWGALTVEGGRLAPDALRDALPAKGKFLRVLASSRREIDGPT
FT                   VTAVRAVLDAGRSSGGLVVCDVPRHPSEVGQAALEMSDLVLVVVPATVAACVAAEKVGA
FT                   WVVRHNSNVGLVVRGPAPGGLRGADVADMLGLPLTAVMRGHRSLAPMLERGGLELTRGC
FT                   PLSAVATAVLDAVESGARPRRAAA"
FT   CDS_pept        558425..559606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31212"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG0"
FT                   /protein_id="BAH31212.1"
FT                   /translation="MSALVTTELLDRVRERLTASSVAEPTAATVADAVRAESSGVLADT
FT                   DLLEVVRVLQTELTGAGPLEPLLHEPGVADVLVTAPDQVWVDRGVGLERSGVRFTDEAA
FT                   VRRLAQRLALSAGRRLDDAQPWVDGRLRGVGDGHFGVRLHAVLAPVAQGGTCVSLRVLR
FT                   PATQGLDALCAHGAVEPDARELLDHIISCRLAFLVIGGTGAGKTTLLSAMLGAVDPRER
FT                   IVCVEDAAELAPPHPHVVRLVARAPNVEGVGEVTVRDLVRQALRMRPDRIVVGEVRGAE
FT                   VTDLLTAMNTGHDGGAGTVHANSPEEVPARLEALAALGGMDRHALHSQLAAAVQVILHV
FT                   HRSADGSRRLEQIGVIDRGADGYVQIMQAWPDGGSGGERLERMFRLRNREVGT"
FT   CDS_pept        559603..560391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05050"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31213"
FT                   /db_xref="GOA:C0ZNG1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG1"
FT                   /protein_id="BAH31213.1"
FT                   /translation="MTVSFLVLALAVSIAPVRDSRARLATYAPSIRKPSRQIPWQLVAA
FT                   FFAVSAAWVLGGLSAGCAAVVLAGTLIFRGRRAKAAENRDLSQKMLLSGLEVLIAELSV
FT                   GAHPAVASSVAGEECSGEVSAVFRSAGARARLGGSAAAAFAVPDSCIEREFSRIGSVWR
FT                   VADQHGLALAELLGAVRTDMLGRRRFRQRTEAGLAGARATAAVLAFLPLLGIGLGQLMG
FT                   ASPLRVLFGGGLGGVLLVIGTACVSAGLLWTDRITAEVTS"
FT   CDS_pept        560388..560972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31214"
FT                   /db_xref="GOA:C0ZNG2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG2"
FT                   /protein_id="BAH31214.1"
FT                   /translation="MSWASVAMIALALAIIPARRGASARAAEILFADTTTENSVAAPDK
FT                   PDPLAVAASLDLLGACLRAGLPVSAAITAMASTAPKPMADTLSRVADLLTLGADPDAAW
FT                   SEAALDPDTEALARMARRSARSGSSLSSSMAELAERSRGDAEDLAAAAAERAGVLISGP
FT                   LGLCFLPAFIALGIVPVVIGLATTVLGNGLL"
FT   CDS_pept        561038..561241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31215"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG3"
FT                   /protein_id="BAH31215.1"
FT                   /translation="MISKTFRTMSARFALLVTEDDGMSTAEYAIGTIAAAAFGAVLYTV
FT                   VTGDSIVSALTGIIDKALKTAV"
FT   CDS_pept        561238..561600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31216"
FT                   /db_xref="GOA:C0ZNG4"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG4"
FT                   /protein_id="BAH31216.1"
FT                   /translation="MMLSTRGIRQADDGAVTVEAAIALASIVTVVVLCIGGVLAVSMQV
FT                   RCVDAAREAARLVARGDRESAVATARRIAPQDASISVEIVDGFAVAVVSAESTLLPLVD
FT                   ISSEAVAAVESGVEEG"
FT   CDS_pept        561597..561947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31217"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG5"
FT                   /protein_id="BAH31217.1"
FT                   /translation="MNLRDDEGVATVLACCVLAAIVMVTGGMLHVGSAVVARHTAQSAA
FT                   DLSALGGAGALDGGEASACAKSAAIAERMRTVLAECEVQGWDVVVEIRAPVLLSGFGIG
FT                   DARASARAGPVG"
FT   CDS_pept        complement(561955..564303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05100"
FT                   /product="putative ATP-dependent helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31218"
FT                   /db_xref="GOA:C0ZNG6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG6"
FT                   /protein_id="BAH31218.1"
FT                   /translation="MNAPSPIPAPGGKPGDTYGQMLLDRVVAGVSGSEKPLMFTAQLPA
FT                   RVAEFTEWPEWVHPSVVRALAEHSVRSPWIHQSEAADLAHEGKHVVVATGTASGKSLAY
FT                   QLPVLTAMATDPLATALYLSPTKALGSDQLRAVLSLTDFDVELRSTNASAYDGDTSQEL
FT                   RTWARENSRWLFTNPDMIHISLLRTHQRWAHFFRNLKYVIIDECHSYRGVFGSNVALVI
FT                   RRLRRIAARYGAEPTFILASATTADPGAAASRLIGAHCSEVTEDGSPHGPRTVALWEPP
FT                   LLEALTGENGSPVRRPAGAEAARIMADLMIEGARTLTFVRSRRGAELTAMATKRLLAEV
FT                   DPDLAERVASYRAGYLAEDRRELEAALADGTLLGAATTNALELGVDIAGLDAVVVAGFP
FT                   GTVASFWQQAGRSGRRGEGSLVVLIARDDPLDTYLVHHPSAVLDKPVEATVTDPGNPYV
FT                   LGPQLLCAAMELPLSDVEVDAFGALEVLTRLSEEGKIRRRKHGWFVTADSNPHGSLDIR
FT                   GGIGTQVAIVDGESGRMLGTVDAGRAPATVHPGAVHIHQGETYVVDELDLDVGLALVHT
FT                   ENPDWTTSARETTEITITEQLEHKNYGDIAVALVQVEVTHQVVGYLRRLTSGEVLDSIE
FT                   LDMPAHTLPTRAVMYTVTPELLESIGVPPERFPGSLHAAEHAAIGLLPLVAICDRGDIG
FT                   GVSTAMHADTGLPTVFVYDGHAGGAGFADRGHSELSRWLTATRDAILSCECAHGCPSCV
FT                   YSPKCGNGNDPLDKDGAVKVLTAVIETIN"
FT   CDS_pept        564700..564903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05110"
FT                   /product="probable cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31219"
FT                   /db_xref="GOA:C0ZNG7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG7"
FT                   /protein_id="BAH31219.1"
FT                   /translation="MAQGTVKWFNAEKGFGFIAPEDGSADVFVHYSEIQGNGFRTLEEN
FT                   QRVEFEVGQGTKGPQATGVRAV"
FT   CDS_pept        565051..565671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31220"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG8"
FT                   /protein_id="BAH31220.1"
FT                   /translation="MPSVPSWLTFHSVSQLSFFSAESIPPAVTDLAGMLAGPGQVVTSE
FT                   DRARISIVVDRDWRAQAVAELIAQCGLGAEVTRSEEGSPLVRTQSTPALLPLSVQWTKG
FT                   AVKAVPVGWVPNSRQLRVWAVAAGRLEEGGERFVFGLDPHAKETHAPLAQALMRVGIAP
FT                   TQLGNRTPGPGLRVSGKKRLTKLVEYLGEAPKHVDTSVAWPHV"
FT   CDS_pept        565887..568823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="RER_05130"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31221"
FT                   /db_xref="GOA:C0ZNG9"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG9"
FT                   /protein_id="BAH31221.1"
FT                   /translation="MAKADNGSGQGASGNPRRLVIVESPTKARKIAPYLGKDYVVEASV
FT                   GHIRDLPRGAADVPAKYKGESWARLGVNVDHDFEPLYVVSPEKKGKVAELKSLLKDADE
FT                   LFLATDPDREGEAIAWHLLETLKPKIPVRRMVFHEITEPAIRAAAEDTRELDTDLVDAQ
FT                   ETRRILDRLYGYEVSPVLWKKVMPKLSAGRVQSVATRVIVQRERERMAFKSASYWDISA
FT                   TLDAGAEASPRSFGARLVSVDGSRVASGRDFGADGKLKGSAVTVLDEAYARRLAEALQG
FT                   VDLTVSSAEDKPYTRKPYPPFMTSTLQQEAGRKLRFTSERAMRIAQRLYENGYITYMRT
FT                   DSTTLSESAIAAARAQATELYGPEYVHPTPRQYTRKVKNAQEAHEAIRPAGDVFQTPGQ
FT                   LHSKLDSDEFKLYELIWQRTVASQMADARGTTLTLRISGTAGTGEDCTFSASGRTIVFA
FT                   GFLKAYVESVDEEAGGQSDDAESRLPVLVKGQEVTATKLDPDGHSTNPPARYTEASLIK
FT                   TLEELGIGRPSTYSSIIKTILDRGYVYKRGSALVPSWVAFAVIGLLEVHFGRLVDFDFT
FT                   AGMEDDLDAIAGGREQRGNWLSSFYFGGETGAEGSVAREGGLKKMVGVNLEEIDAREVN
FT                   SIRLFDDAEGREVHVRVGRFGPYLERMVQNPDDPEGDLISQRANLPDDLPPDELTPEYA
FT                   EKLFSTPQEGRKLGVDPLTGHEIVAKEGRFGPYVTEILPEPPAEPEPDIVPVSAPEPEE
FT                   ISSGSTKTAVKKAAAKKAPAKKAAKKVAGPKPRTGSLLKSMDLATITLEDALRLLSLPR
FT                   VVGVDPESKEEITAQNGRYGPYLKKGTDSRSLANEEQMFTVTLDEALKIYAEPKRRGRQ
FT                   ASATPPLRELGVDPVSEKPMVIKDGRFGPYVTDGETNASLRKDDDVESISDARASELLA
FT                   DRRARGPVKKKAAAKKAPAKKAAAKKTAAKKAPAKKAAAKKAPAKKDS"
FT   CDS_pept        568857..570086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="RER_05140"
FT                   /product="putative DNA polymerase III delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31222"
FT                   /db_xref="GOA:C0ZNH0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH0"
FT                   /protein_id="BAH31222.1"
FT                   /translation="MSTEVAERGVFGRLVGQHDVEQSLRDAALSARGDSSGSEMTHAWL
FT                   FTGPPGSGRSVAALCFAAALQCTSDGAPGCGECHACTTTMGGTHGDVRRIIPDGLSISV
FT                   KGMREIVNIASRRPTTGRWQVIVVEDADRLTEGAANALLKVVEEPPDRTVILLCAPTTD
FT                   PEDMSVTLRSRCRHMPLVTPSVESIAQVLIDRDGLDPERARIAASISGGHVGRARRLAT
FT                   DESARDERQRSLRLAADAIGASTAYKAAENLVKSIEADTKAFYAELKEQELEELKVSLG
FT                   GGGTGKGTAGTLRGSAGLIKDLEARQKSRDTRARRDLLDRTLIDLAGMYRDALSYSLGS
FT                   TSTATHPDMARQAAELAARTSPEGLLKCIEAVLECREAVDFNVKLQWALDAMVASIGAA
FT                   FRPPFSRSGG"
FT   tRNA            570117..570189
FT                   /locus_tag="RER_t0100"
FT                   /product="tRNA-Thr"
FT   CDS_pept        570311..570877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05150"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31223"
FT                   /db_xref="GOA:C0ZNH1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH1"
FT                   /protein_id="BAH31223.1"
FT                   /translation="MSDQNWGPGQPSQNPPYGQMPPMPPQGYQPPTPAYPFASWISRVF
FT                   ASILDGFVVPLPGVILAGIGAVIAFSGSEVTTYDDGSVSAEGGNPVGVIVMVVGILAIF
FT                   LIEVWNLVFRQGNTGQTLGKKWLGISVIRESDGVPLGPVMALLRWIMMAILGGACFLNY
FT                   LWPLWDSKHQCWHDMVVRSVVVRAR"
FT   CDS_pept        570899..571330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05160"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31224"
FT                   /db_xref="GOA:C0ZNH2"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH2"
FT                   /protein_id="BAH31224.1"
FT                   /translation="MGVMELEVVASRRRALAAPVGVAAVAVTAAAVLHFRDPHSAGSYG
FT                   VCPMYALTGLWCPACGGLRAVNDLTNLDVGAAVSSNVLIVPFVAVLVIAWIGWTVRRWK
FT                   GTRDRMIVLRPTVTIVVLGVLVAFTVVRNTPWGSWLAPA"
FT   CDS_pept        complement(571519..571797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31225"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH3"
FT                   /protein_id="BAH31225.1"
FT                   /translation="MSLTLAGGSRCPCRSDLDKVTRRSTQHQIARSEHCGRLTSRNPVP
FT                   LGQFFDDRIAFLGLFQRFEIVVDRHQPGIVTLSFLNRVPAVLGELPQ"
FT   rRNA            572193..573712
FT                   /locus_tag="RER_r0010"
FT                   /product="16S rRNA"
FT   rRNA            574059..577194
FT                   /locus_tag="RER_r0020"
FT                   /product="23S rRNA"
FT   rRNA            577344..577463
FT                   /locus_tag="RER_r0030"
FT                   /product="5S rRNA"
FT   CDS_pept        577867..579291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05180"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31226"
FT                   /db_xref="GOA:C0ZNH4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH4"
FT                   /protein_id="BAH31226.1"
FT                   /translation="MTDILDRTKIYVDGAWIESTGSGRIDVLNPATEELIGTVAEGTVE
FT                   DVDAAAKAARKAFPAWSALSGGERAEYLSKAAAIIAERTDDLAALVSQDMGMPIGFAKP
FT                   VQIGMPLANLNAFAELARTYDFDAHEVGNSLIVREPAGVVGAITPWNFPLHQVVLKVGG
FT                   ALAAGCTVVLKPTEVAPLITYALADIFDEIGLPAGVFNLVSGYGPVVGEAIAGHPEVDM
FT                   VSFTGSTRAGKRVAIVAADTIKKVSLELGGKSANVILDDADLEKAVTDGVAKCFINSGQ
FT                   TCSALTRMLVPAEKVDEAAAIAAAVAAHFPVGDPTQPTSVLGPLVNANQLGRVRGYIEK
FT                   GVSEGATAVVDGRETGLASGYFVGPTVFANVTEDMTIAREEIFGPVLSIMGYKDEADAV
FT                   RIANGTEYGLAGGVWSGDPDRADRVARQLRAGQVEVNGGAFNTNAPFGGYKQSGVGREA
FT                   GTFGLEEFLEIKAIQR"
FT   CDS_pept        complement(579355..580116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05190"
FT                   /product="putative aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31227"
FT                   /db_xref="GOA:C0ZNH5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH5"
FT                   /protein_id="BAH31227.1"
FT                   /translation="MSAQEFAARIRGRERILGYWSVINSPVSTEWIAHVGWDYIALDMQ
FT                   HGLIGYSGMVAGLTAIDSSPSTVGMVRVEANNPTPIGRALDAGAVGVIVPLINNAEEAA
FT                   AAVAAAKYPPFGIRSYGPMRSQLRIGPVPADANRDTVVFAMIETPQGLANVEEICAVPG
FT                   LDGVYVGPSDLRIAVGGKHSNDPDVAEEFEAALTRVREASAVSGVAAGIHTPSGQVAAQ
FT                   RLGEGYTFATVASDLTHLANISAQHLDAAKS"
FT   CDS_pept        complement(580151..581110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05200"
FT                   /product="putative aldo-keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31228"
FT                   /db_xref="GOA:C0ZNH6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH6"
FT                   /protein_id="BAH31228.1"
FT                   /translation="MTAPLELPKLVLGTMTFGDTVDISGAGSMLDAALGAGISHIDTAN
FT                   GYAGGESERMLAKLLHGRRDSVTLATKAGMPHPDAGDNSPLSAKGLRASIEGSLRRLDS
FT                   DYVDLFYLHQPDRTVTLTETLTTVAELVAEGKIRTLGVSNFAAWQISEINYTADTVGAP
FT                   RPIVAQQLYNLLARRIEEEYAEFADVTGLTTMVYNPLGGGLLSGRHTFEENPADGRFGD
FT                   SRLASMYKERYWNTQIFDAIAQLTAIAEQSGISLTELALRWLVSKPVAGSLLLGGSKVT
FT                   HLESNIAAIGRGPLDASTVEECDLVGAALRGPMPNYNR"
FT   CDS_pept        complement(581110..581976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05210"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31229"
FT                   /db_xref="GOA:C0ZNH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH7"
FT                   /protein_id="BAH31229.1"
FT                   /translation="MNPHETPLLAVEDLVVEYPVPDGVFRAVDAVSFSVEKGKTLAIVG
FT                   ESGCGKSTIARSIVRLLTPTSGRILVDGNDIAQMSEKSLRPFRSRVQMVFQDPYGSLDP
FT                   HLTAEDIIGEPLRLKGVRSKSERAKAAAELVDRVGLPSSALHRRPAEFSGGQRQRIGIA
FT                   RALASGPEILVCDEATSALDVSVQAQVLALLREIQADTGLTYVFISHNLGVVREISETV
FT                   VVMSKGTIVESGSTDTVLASPHEPYTRALRGAALDPTTMVGIKPRHVVAALSKNLLAKQ
FT                   TESRGVA"
FT   CDS_pept        complement(581973..582806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05220"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31230"
FT                   /db_xref="GOA:C0ZNH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH8"
FT                   /protein_id="BAH31230.1"
FT                   /translation="MGNLLRVDDLQIELVTANGVIRAVDGVSFCIDAGEAVTIIGESGS
FT                   GKSTTAMGILGLLPDDLAVLSGKAVFKGQDILGNTKILNDIRGKHIALIPQDPMTALSP
FT                   VHTIGSQLREAVRHSGVTAKKQQIERAVQLLEQVRIPYPDQQLDKYPHQLSGGMLQRVL
FT                   IAGALAAGPELIVADEPTSALDVTVQAGILDLLLELQERTGIGMLVITHDLGVARLVSD
FT                   RIYVMKDGRFVETGNADVLVDSPQSAYTQKLLDAIPHLGPWDGDPARSTQIGASA"
FT   CDS_pept        complement(582810..583757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05230"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31231"
FT                   /db_xref="GOA:C0ZNH9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH9"
FT                   /protein_id="BAH31231.1"
FT                   /translation="MTTVLEPPTTPRASAVTEADFARAGATRRKRDSRVKIWAGSICAL
FT                   LVILPVALAGLLPLADPNQTNLSSRRLPPLTDGHLFGTDQLGRDLLSRILHGGQVSLTI
FT                   GILAVIVSGVIGIVAGSAAGYFGGWVDTVISRLLEAQLSLPLLMMLLLVVALFGPSIPV
FT                   ITFVIAIAQWPEVARLTRSLVLVEREKPYVAAARVLGLTRMAILLRHVIPNIVKQASLV
FT                   VLLLLAQAVLLESSLSYLGAGPQRPFATWGRIIADGQDYITTSWWIVTLTGLMIVLLVV
FT                   GVNLLGDGLRDRPAGSKRLGASLFRRGNAQKAKA"
FT   CDS_pept        complement(583757..584761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05240"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31232"
FT                   /db_xref="GOA:C0ZNI0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI0"
FT                   /protein_id="BAH31232.1"
FT                   /translation="MTLTAPKPQTALGISPRRRTRINPTVKYVLKRLAQSALTIFLTLT
FT                   TVFVLIRMAPGDPAYALAGPLASTEDLAQIRADMGLDKSVFSQYLIYLWDLVHLNLGTS
FT                   YSFQAPAMDVVLGRLPYTITLAVSSILLTAVLSIPLGVWMARHADTRRELGANVVAVGG
FT                   QSMPEFWSGLMLVTIFAVLIPVLPAAGFTTWPSLILPTVTIAILQIALISRMVRREMVS
FT                   AFASPYITVARSRGVSERELTWRYAMRNSAIPIVTALGTRFAGMLNGVVVVEVVFAWPG
FT                   VGSLVVRALETRDYPLIQATVLVTAVLAVLVQLAVDLLYPLLDPRVRLGKGAN"
FT   CDS_pept        complement(584766..586328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05250"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31233"
FT                   /db_xref="GOA:C0ZNI1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI1"
FT                   /protein_id="BAH31233.1"
FT                   /translation="MRTPQLSRRSFLQFTGLIGGATLLGTTAACAGPTGKPTQDTLVLG
FT                   LNRSLVSLDNKLNQFDAAVTAQRGVRQGLTRIGDNLTPQLVLADRFESTGPTEWTVRLR
FT                   EGIRYSDGTPVLIDDVTTAMQMYQQVSGSFVAPQFPEWPTVVPIDDRTFILRTNSPVPV
FT                   LDSLMSNILITPAAANEPNELQSGIGSGPFVVSESNRGTGDYTLVANDNYWGPAPGVRR
FT                   VQVRFIPEEAGRVVALRSGEVDVIDSISPDSAEQLADLPGVQVDTVPSTRINQLFFNFR
FT                   KPADHPLSNPRVREALTYAIDGESLARDVLIGSAVPATGPAPSTLDGAVKTGTYQYDPR
FT                   KARQMLEAEGADDLELTFIWETGEFTNDVSVMESVLEMMKAVGVRVKLQQFEPGGDISS
FT                   WRQGKTGDWDVLGNGYGNQTGLALTTLQGMYAGTAEKEATRDTYHGYVFPEITAKIQAA
FT                   SSEPDPTKRAALLDAAQQDIWNTWPCLWSFVPNALLAKRTRVQNVSLTPINSYDLGAVR
FT                   LEA"
FT   CDS_pept        586336..586581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31234"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI2"
FT                   /protein_id="BAH31234.1"
FT                   /translation="MVIGDLSILTGQRGGDAPSGLLVNNRVGLSLVTQLTMALLRTSRK
FT                   SRNFDCVLRASVAMLCILDSDRKGVEEFDETTGNHR"
FT   CDS_pept        586736..588796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="RER_05270"
FT                   /product="probable 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31235"
FT                   /db_xref="GOA:C0ZNI3"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI3"
FT                   /protein_id="BAH31235.1"
FT                   /translation="MRSVLQSSDGSEIVKKIDSLLRGNIAAEVGELSRDGSPVIVAAGL
FT                   PRQGRTVQGGVVLVDGVALHATDLWRAESKPAPRSIAEALGSSAITSGVSLDDIRSGRL
FT                   SQVLASISEAGSVAICDVETDSDLELIVAAAQEVRGSRLVGTSALATAVARRRTEQSPV
FT                   VRPSLRDSRFTLVVVGTADASAGDQVALLRDSGAHHIEVNSAELLAHSVDPLPILNALD
FT                   RGNVVVSVSGPVVPAESVHLVSALADLIAAVDAGFSHGEYPIDLVLTGGETARSVLDRL
FT                   LIDTLSPIYEIEHGAVLSVDHTGRYIVTRPGSFGNAHSLFSITKFLARPIPVDAPDSPP
FT                   SDNEVNPMSIESTPLPLIAVTMGDGAGVGPEVIVPALLDAETRKRCRPVVVGDAKRLRL
FT                   AATVLGIDVDVVAIEEIKDAEFIDGRINVIDLDLLPEDLAWGELSAVAGDAAYQYIRVA
FT                   SELAVRGEVQSICTAPLNKEALHAAGHIYPGHTELLAHLTGTEEVSMMLSTPKLKVIHV
FT                   TTHIGLLDAVARIEPGLVERTIRRGHEALVRTGNPSPKIGVCGINPHAGENGLFGYGEE
FT                   EQKIIPAVELLKAEGIDVHGPLPADTAFFLAGRGDYDLIVAMYHDQGHGPVKVLGIEAG
FT                   VNITVGLPVIRTSVDHGTAFDIAGKGIAEAGSMVEALRQAAELATSTFVSK"
FT   CDS_pept        588824..589591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05280"
FT                   /product="putative DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31236"
FT                   /db_xref="GOA:C0ZNI4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI4"
FT                   /protein_id="BAH31236.1"
FT                   /translation="MAIRESEARRSEIARLARTSGLASVEDLSAQFGVTASTIRRDLSQ
FT                   LTAQGVIARTYGGAIALNPHPESSLRQRAMEGFDAKRGIAEWAAEQVRPGETVLLDAGT
FT                   TVGAMGEFLRHVTNLTVIAAGLTALEALVDADGVRVECLGGTLRQLSQGFVGPLAEASL
FT                   QRVSFDKAFLGADAVTADLGICEAELDQTRLKEMMIERAGEVYILAHSAKLGERPFHAW
FT                   APIPPGAVLVTDAAVDAKQVALFEDVGIRVQVV"
FT   rRNA            590239..591758
FT                   /locus_tag="RER_r0040"
FT                   /product="16S rRNA"
FT   rRNA            592094..595229
FT                   /locus_tag="RER_r0050"
FT                   /product="23S rRNA"
FT   rRNA            595379..595498
FT                   /locus_tag="RER_r0060"
FT                   /product="5S rRNA"
FT   repeat_region   595780..595785
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(595786..598364)
FT                   /mobile_element_type="insertion sequence:IS1415"
FT   repeat_region   595786..595797
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(595899..596690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="istB"
FT                   /locus_tag="RER_05290"
FT                   /product="transposition helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31237"
FT                   /db_xref="GOA:Q3L9G1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L9G1"
FT                   /protein_id="BAH31237.1"
FT                   /translation="MSTPLRTVTSANGDPLAEAIDLTKRLKLPHIRRSLSDIIPTAKAQ
FT                   RWDPAEVVRVLLAEEAAGRDRANLHTRRKRAGFPTGKTFGDWDETKSSIPRATQDALRT
FT                   LEWVGRRECFCVCGPSGTGKSHFTEALGQAAVEAGLAVSWFTIEDLGALVRRHRADDSI
FT                   ARALTRIIRSDLIIVDDIGLLPVSEDAAEGLYRLVDAAYERRAIAVSSNLHPSGFDEIM
FT                   PKTLATATVDRLLHHAHVVVTDGDSFRLTEATTGKGVKPFS"
FT   CDS_pept        complement(596690..598231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="istA"
FT                   /locus_tag="RER_05300"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31238"
FT                   /db_xref="GOA:Q3L9G2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L9G2"
FT                   /protein_id="BAH31238.1"
FT                   /translation="MKSSREIMEILEAYDLTGSYRAAAELAGCDHHTVARYVQMRAAGQ
FT                   PPDRRRHRARAIDDFLPKIEELVVRSQGKVRADVIHERIVALGFTGGERTTRRTVAEAK
FT                   AQFRAGRRRVYRPWVTEPGLWLQYDFGDGPTISGRKTTLFCAWLAWSRFRVVIPIWDKT
FT                   LPTVAACLDATFRRLGGVPVYVLTDNEKTATIDHVAGIAVRNPEIVEVARHYGTTLRTC
FT                   LPADPESKGGSEATVRIAKADLLPKEVNLREQYHSFGELESACRQFCTDVNTRVHSSTR
FT                   RRPVERLAEELQRLHPLPKSPFTAVFGTTRRVNWESTISVEGVRYSVPHTLIDTRVWAR
FT                   FHGEELIVTAVDNDGGAVEVARHRRGQPGSPVLDNDHYPPRPDRDAADRVPKPRTAAEL
FT                   AFLQLGQGANSWLVEAAAAGARRIRAKMAEAVDLSKLHSPDAVDRALGTAAMTGRFADR
FT                   DLISILDYQVTHEHADPVRRSEDHTLQPGTAAWSTFGQTPAPASPATTDDESDDA"
FT   CDS_pept        complement(598279..599748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05310"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31239"
FT                   /db_xref="GOA:C0ZNI7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI7"
FT                   /protein_id="BAH31239.1"
FT                   /translation="MMNSWANLGFDLHIELPQGIGIRAALLQTLRDAIDSGLLKPGTRL
FT                   PPSRTLALDLGVARNTVADCYAELAAAGWLVTRPGSGTVVATLASTHSREVDPSPTRRR
FT                   LTYSLLPGSPDASAFPRTAWISSARRALTTAPTDAFATTDPRGRVELRNALTTYLSRTR
FT                   GVRVDPSRIVISASSGHGISLLARALGGTIAVDAFCLHLHRQLLVDEGLLTIPISVDES
FT                   GTCTDELVSTSAESVLLTPTHQFPLGGPLTPARRATALEWASTTGGVIIEDDYDGEFRY
FT                   DRKPVGALQGIAPQHVAYLGTVSKTLSPAIRIGWMVLPDRLIEPVLATKGPYERWVSST
FT                   DQLTLADFIESGRFDSHIRKMRTSYRRRRDQLVATLAQQVPRVRVAGISAGLHAVIRLP
FT                   SGTEQSVLAAAQARDLGLEGLSVFRHPDVSSVGGDGIVVGYSTPTQSQYSRTLDVLCEV
FT                   LQEVSTAIVSSPLAAIYGAFCGHGFSPRTAR"
FT   repeat_region   598353..598364
FT                   /rpt_type=INVERTED
FT   repeat_region   598365..598370
FT                   /rpt_type=FLANKING
FT   CDS_pept        599795..600253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31240"
FT                   /db_xref="GOA:C0ZNI8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI8"
FT                   /protein_id="BAH31240.1"
FT                   /translation="MTTTTGQRLDIAKLAPEVYKAMIALDAAARKGLEPTLVELVLTRA
FT                   SQLNHCAWCLDMHTRDARKVGVTEQKLYLLNAWEEARGMYSDRERAALALTEAVTVLTD
FT                   GFVPDEVYSEAAGEFSEEELAQLISVIFTINAWNRIAVTTRKAPPVRD"
FT   CDS_pept        600870..602321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31241"
FT                   /db_xref="GOA:C0ZNI9"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI9"
FT                   /protein_id="BAH31241.1"
FT                   /translation="MMTVSGSRRRPLVLRLSLTAAIAATVAGSSVAFASPAVSAPMPVR
FT                   TAAAPAFTAGLCEGTEYTPSEQMLDISGIRLDHYNDGNIVPMYGTTDRGTSAAVDAPVC
FT                   GVRDVDGIAKSEWMYCTDFDLDPCAGVDENGLPVDKHNDEMGATVPSSGNPDLSADDLA
FT                   VISWLLQNPAKLDGVVSGNGSEDARSARQTLVWCVSDYDNPLMADFKSLCDRNIGDDER
FT                   ARIVEIMNVTQTLDLVRKTPATGTLKAGETAVFTLNTNMYRKPINVQSSAGTELTVCGD
FT                   NAKATLSANQLTVDGRGDAPTAVDLCLTTADSGDYSVTASVIPDSVENLHWNTAGAQCQ
FT                   IFASFDTVRPALMNASASVGYAAAPTTTPATTTPATTTPATTTPATPVVPIVPIVPIVP
FT                   IVPIVPIVPVVPVVPGAPVPSQPVATPAAPAPSAPKQATGPRPVAIDGGAAEQNSGRNV
FT                   AVAVTGLGLVGMAAAGAVALRRKRS"
FT   CDS_pept        602457..603149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31242"
FT                   /db_xref="GOA:C0ZNJ0"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ0"
FT                   /protein_id="BAH31242.1"
FT                   /translation="MYESDPNPSNPYDDSNRDQPANIGKGRRVAFILALVAVLVAGASM
FT                   AFVGLRSSDDDAAIPPSPGVVMSHSANPAAPSDELMAPNTLSLDPVGVQAPIVDATVPE
FT                   GVLTPPENVKNVGIWLDGASLNSVTGTTLIAGHVNLTGQGNGALFDLGTIEPGEVIRTS
FT                   DATGKSTSWKVTAVTTRPKADGVEESVLAGPEGPRKLAVVTCGGELQFEDGVGNYADNV
FT                   YLYADLMV"
FT   CDS_pept        603227..604024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31243"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ1"
FT                   /protein_id="BAH31243.1"
FT                   /translation="MDLHLSGKRAIVAGGSKGIGLAIARGLAAEGVDIAILARTEQTVV
FT                   DVARDLASEFGIRATGVVTDTRDDDAVQASVRQVVEEFGGVDILVNSAATPFSAGKPTD
FT                   FEATTDDVVRDEVEVKVLGYLRTARAVAPYLIDQGWGRIINISGLGARQATSIAHTIRN
FT                   VSVSALTKNLADELGPKGINVTVVHPGVTRTERLTARIARESEESGRSQAEVERGIATN
FT                   SIHRIIDAEEVADVVTFLASPRSIAITGDAVAAGGGVPGPVYY"
FT   CDS_pept        complement(604039..605160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31244"
FT                   /db_xref="GOA:C0ZNJ2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ2"
FT                   /protein_id="BAH31244.1"
FT                   /translation="MTSQMKSMRTLTREWLALPDQYDRFTRYLRDNGLTTATRLLLGII
FT                   VIGLGVCALLNRFSPAGPTSTIALFFNTVVVISCFMVGVSWWVFGPTKRRSFGFVVFCD
FT                   IAVTISVLGDSSQLARLLTCVIYALIGIYIAYFHNPKLQIAHLTFSVVMIVVAAQPILF
FT                   GPERDPALGVSKVLVVVTALVVCAFISQIVLTMLSMDASSSDLDPLTGLLNRRGLDRHV
FT                   EKVLAEFQRQESAALLVIAIDIDRFKTINDVHGHDVGDRIILRVSQRLSAWAHADAVVA
FT                   RVGGDEFILAQRLSVPAIGPMLDSIGPAMHSNTDEIPSTSSIGIAVRTHKFVAGEERAT
FT                   AFTDMQKVADSAMYESKRLGGGRVHTIVTTASR"
FT   CDS_pept        605330..605980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05370"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31245"
FT                   /db_xref="GOA:C0ZNJ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ3"
FT                   /protein_id="BAH31245.1"
FT                   /translation="MSMLYSASETVFREVKELILSGELAGGELISEGDIAARTNVSRTP
FT                   VREAFLRLESEGWMRLYPKKGALIVPVADGEAEHVVSARQLVETQSVRVVSVRPHARET
FT                   LVAALRANLIEQREIADRGDVAAFSAIDADFHKMIVAAGGNPLLDSFYASLRDRQRRMT
FT                   ARSISRDPGQLSRILADHTALTDLVETGDADGYNTAVLTHMRQVHGLGFEGTL"
FT   CDS_pept        605980..607254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05380"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31246"
FT                   /db_xref="GOA:C0ZNJ4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ4"
FT                   /protein_id="BAH31246.1"
FT                   /translation="MSTQTIDAGTAAERRPGSERGTAGKWLWLTVAASMFAAAWGGNEF
FT                   TPLLVMYRLDHGYSPVMVDFFLFAYVVGIVPALLLGGPLSDRLGRRPIMLPAPIIAIAG
FT                   STLLAFGADSAAALILGRILCGIALGIGMAVGGSWVKELSTQPWDSTASEGAGARRAAM
FT                   SLTAGFALGAGAAGILAQWAPLPSVLAYVLHIAITVLAAMALWRAPETRPAQAKSDRRR
FT                   LIDDLKIPSAGHRRFLYVVVPLAPWVFGAASVAYAVIPALMTGHSGDAPVAFSALLCMV
FT                   ALTCGFAIQSLGRKIDTDRSARGAVVALVFLVVGMAGAALVASTLTVAIAIVAAAILGC
FT                   GYGMALVSGLLEIQRIAGPDDLAGLTAVFYSITYIGFAVPALLAMLSESIPALSYTVTL
FT                   LFGSAAAAACLILILFKSRSHLPSA"
FT   CDS_pept        complement(607304..608875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31247"
FT                   /db_xref="GOA:C0ZNJ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ5"
FT                   /protein_id="BAH31247.1"
FT                   /translation="MLPIIIIAVVVAVIIFIVLPAIYVKNYVKVPPNEVAVFTGRGKPK
FT                   VVRGGARFKIPGIERVDIMSLEPFNVSINLKNALSNDGVPVNVEAVGLVRIGSADEAVQ
FT                   TAVQRFLTSDLDELQQQINEILAGSLRGITATMTVEDLNSNRDSLARSVVEEAGGDLAR
FT                   IGMEVDVIKIAGISDFNGYLESLGQRRIAEVKRDAAIGTAEAERDSQIQSAKARQAGSV
FT                   AQAEADTAIASANQKRDVELARLRAQTEAENAEADQAGPLAQATAEKAVGIAREQAEAA
FT                   RVEARTEVERRRAQQSEAALQADVIAPAEAERQASIARAEGERQAAILRAQAQAESARQ
FT                   AGGAQADARKLVADAVRSEQQADADGLRARLEAEADGRKVAADAVRAEQQAEADGLRAK
FT                   LEAEAAGKRQIAEALNSYTPQAAQLLTLPDVLAALVDATAAAAKPVGDIDRISIVGGSD
FT                   GAQGSIGSILGISPQVIAGVIETLESSGVDITGLLNGLNKTASVPVGSVHNSVHNSENG
FT                   SATVDA"
FT   CDS_pept        complement(608887..609402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05400"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31248"
FT                   /db_xref="GOA:C0ZNJ6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ6"
FT                   /protein_id="BAH31248.1"
FT                   /translation="MFVVFTICFVIGVVALIGAFAVGEVADLGGGHADGLPFLSLTTLA
FT                   TALFGFGAGGVAATLADAPTLVAVIAALALAAVLVVVTRGLLLPYLLKQQDNSHIGRNS
FT                   YHGLLGTVTLTIAAEGWGEVSFVDAEGNRVQAKAVSAQPMVLTTGTTVYIADVDDQYLH
FT                   VVTVDDAI"
FT   CDS_pept        609571..610395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05410"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31249"
FT                   /db_xref="GOA:C0ZNJ7"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ7"
FT                   /protein_id="BAH31249.1"
FT                   /translation="MYESGSKFDKSVDARAHWQSSPWGRLRYTVARANLDTYVGGRSGL
FT                   RVLDLGGGDGLESILLARNGNQVTLVDSSPAMLDIASGRADAAGVSASMTFVNSEVLDL
FT                   PRSIATGSFDVVLLHNVLQYLPQGIGALPAVTAPLADGGIFSVISINKFSEPIAAAARR
FT                   ADPTEALNLLGESRYRSVTFDSDLTMFAAGDIIDAIEATGDFGDVNHYGIRCFSDFIAA
FT                   DDEKWDPEFYSALEALELASTARWPYMHTARLFQIIGRRASKDARQSRGSGR"
FT   CDS_pept        complement(610371..611687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05420"
FT                   /product="putative M1 family peptidase"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31250"
FT                   /db_xref="GOA:C0ZNJ8"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ8"
FT                   /protein_id="BAH31250.1"
FT                   /translation="MKPNRMLEEPLDPYLPHNGNRGYRVSRYELELTYKVFSNRLAGKA
FT                   VITAVTTESRSKFSFDLAQNLQVSKVSVNGARGTKYAHLNNKLIITPSTKIPAGGALSV
FT                   TIAYSGNPEPIKSLWGEVGWEELDEGTLVASQPNGAASWFPCDDHPISKASYRISITTD
FT                   SPFYALANGKLIRKQTRASQTTWVYEQTEPMATYLATIQIGQYEHRQVSAGPVPVFAVH
FT                   PPRLRAAFDVDFGRQPQMLEVFEKLFGPYPFADYTAVVTDDELEIPIEAQGLSIFGANH
FT                   CTGRRGSERLVAHELAHQWFGNSLTLGQWCDIWLHEGFACYAEWIWSENSGGPSSNQLA
FT                   TNAYQGLGRKSQDLIVANPGPALMFDDRIYKRGALTLHALRGVLGDEKFFELIRQWTTK
FT                   HRHSTVSTEQFTDLASRFTDTPLRPLWDAWLNQRPLPRL"
FT   CDS_pept        complement(611684..615601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05430"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31251"
FT                   /db_xref="GOA:C0ZNJ9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR012728"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ9"
FT                   /protein_id="BAH31251.1"
FT                   /translation="MSRTGPTGLPLQSQSETEQSFGIPSVFLRSAHAPAPRTLIDIVRA
FT                   SAEANPEAPAIDDGDTTLSYSELLDEIALGARWLGDAGVGAGDRVGIRMPSGSRSLYVA
FT                   ILSILAAGAAYVPVDADDPEERAELVFGEAQVAAIITGDGIQPGTAPKRLEHPPVREPE
FT                   PEDDAWIIFTSGSTGTPKGVAVTHLNAAAFVDAEARMFLQDEPIGPGDRVLAGLSVAFD
FT                   ASCEEMWLAWRHGACLVPAPRSLVRSGMDLGPWLVSRDVSIVSTVPTLASLWPAEALEA
FT                   VRLLIFGGEACPPELAERLAVDGREVWNTYGPTEATVVACGALMDGKSPVSIGLPLDGW
FT                   DLAVVDAQSNPVAVGEVGELVIGGVGLARYLDPAKDAEKYASMPSLGWERAYRSGDLVR
FT                   LETTGLMFQGRADDQVKLGGRRIELGEVDNALQNLPGVSGAAAAVKKTAAGNQLLVGYI
FT                   ASTDPDFDLKAAHALLSEQLPAALVPRLALMDELPTRTSGKVDRNALPWPLPGAGEDAG
FT                   AALGLDGTAAWVAGLWGSILGAQITGLDDDFFEVGGGSLSAAQLVTALRERFPEVTVAQ
FT                   LYDHPRLGSLAEYLDELAPTETVEPRIVAPTPLKTQLAQIAVTVPLTTLTGLQWVTWLA
FT                   IANNVLGWFVDVSWAPTVSWWWILLAFIVFITPIGRMTIAVVGARLLLRKLEPGTYPRG
FT                   GSEHLRLWIALRLTEASGAANLSGAPWMLYYARALGADIGSGVDLHTLPPITGMLELGD
FT                   GCSVEPEVDLSGHWIDGDVIHIGEIKIGDGASVGSRSTLLPGARIGRDAVVEPGSAVFG
FT                   RVKANQQWAGSPATKVGKANHPWPAEHPKRAPGWVPVYGVTSVFLAGMPIFALMAGIAL
FT                   IGWWIRDTDTLASAVLQSLIMLPVATIVSLLVFAVVTLVAVRLLSIGLTPGYHPVRSRI
FT                   GWQVWATERLLDSARTFLFPLYASLLTPGWLRLLGAKIGKNVEASTVLLLPKFTTVADG
FT                   AFLADDTMVASYGLGGGWMHIEQAKIGKRAFLGNSGMTAPGRRVPKNGLVAVLSATPSK
FT                   AKSGSSWLGSPPVRLRRAAGDTDAARTFNPPMRLKIARGVVETCRLIPVMVTFGIGLGV
FT                   LFALEALVGAVGFWFAALLSGVILLVAGAVAGAITIAAKWIVVGRIAKVEHPLWSSFVW
FT                   RNEVADAFVETVAAPWFARAATGTAVLNIFLRGLGAKIGKGVWCESYWLPEADLVTLGD
FT                   GATVERGCVVQTHLFHDRIMSMDTVTLGAGATLGPHCVALPAAGIGAGATVGPASLVMR
FT                   GDTVPPSTRWQGNPIAPWVAS"
FT   CDS_pept        complement(615700..617577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05440"
FT                   /product="putative BCCT family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31252"
FT                   /db_xref="GOA:C0ZNK0"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK0"
FT                   /protein_id="BAH31252.1"
FT                   /translation="MPERSRSGMTAVKTAWRELRKPVFIPASIVIFALIAFAVIYAGTA
FT                   ADAFETLNNVISDGVGWWYILSATGFVIFALYCGISRIGNIRLGRDDEQPEFGMLSWFA
FT                   MLFSAGMGIGLVFYGVAEPLSHYVTPPVAGQIAGSTDAAANQAMELTLFHWGLHAWAIY
FT                   VVVGLGLAYMTYRKGRPLSIRWLLEPLLGRARIEGKIGHAIDVVAIVGTLFGVATSLGF
FT                   GVQQISAGLDYLGWVETDNWLVITIIVIVTGMATFSVVSGVTKGLKWLSNINMMLAAAL
FT                   ALFVLILGPTLFLMQSWVQNLGGYVQALPELMLRTSPFAEDGWQGAWTIFYWGWWMSWA
FT                   PFVGMFIARISRGRTIREFVFGVLLAPTLVGSLWFTIFGNSGILRQRNEGTMLDASGAV
FT                   DTNTSLFTLLDGLPLGTISSVLAIVVIVFFFVTSADSGSIVIDILATGGSLETSKITRV
FT                   YWTFLSGAAAAVLLIVGGSGSLTALQTVAIATAVPFSVIMVLACLSMLKAFRYEVASAP
FT                   RYLRVSTNASASTDVPQPTEKRLRDLKISSTFAGLTPSQSGIMTDPSDAHMLVAVHEVP
FT                   AHAVNIDPDTGAVDFSEESKVVDPLGGEVFDTPEFADSAEGHAQAASTD"
FT   CDS_pept        complement(617982..618386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31253"
FT                   /db_xref="GOA:C0ZNK1"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK1"
FT                   /protein_id="BAH31253.1"
FT                   /translation="MAEWWVPSRRVERWGQTIGLVLLVVVIGPSTIHTVATEPTTGNWV
FT                   RLAIWLFATVGFAYGTVQAWRTRNNPQPAWGEGTTAPTEIPADDVHSALASTDDRIPAI
FT                   KALRELHPDLGLKDAMDLIDAQRGEQGPHH"
FT   CDS_pept        618426..618752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31254"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK2"
FT                   /protein_id="BAH31254.1"
FT                   /translation="MVIMEIRDAVERLRADSGTSMIFGEPHQTSDGSTIITVSRLHRRW
FT                   RGDPIPVPVGVFSIHEGEPSWSPAVDHTRAALMGEFIGLAAAVIATLAVLRRPPWPDVT
FT                   IRKG"
FT   CDS_pept        complement(618768..618998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31255"
FT                   /db_xref="GOA:C0ZNK3"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK3"
FT                   /protein_id="BAH31255.1"
FT                   /translation="MHSSFEFACNKTTPTTENVGEPQPRREVTNMGSADVMAWLAEGYL
FT                   AGDPIRYPLYVGSMFLAMPFQLIGVILGHPF"
FT   CDS_pept        619153..619884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05480"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31256"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK4"
FT                   /protein_id="BAH31256.1"
FT                   /translation="MTTTPSPLSGKTVVLIGGGTGIGLRVAQLAVDAGAQVVLGGRTTS
FT                   KLEAAATQLGEAAHWFTVDTSDDDSVKAFFTNIPSVDALFTTAADYQVGSFREQSVEEA
FT                   ASPFTSKFWGQYRVVHAALDKLTPTASVVLMSGAASVRPPAAAAAYVAANAAIEGLGRG
FT                   LAVELSPIRVNTVAPGTIDGHLWAQRPAEVREAAFTWSAENNVLGRVGNEDEIAQAVFY
FT                   LFANTYTTGSTLYPDGGYALR"
FT   CDS_pept        620035..621402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05490"
FT                   /product="putative cytosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31257"
FT                   /db_xref="GOA:C0ZNK5"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK5"
FT                   /protein_id="BAH31257.1"
FT                   /translation="MKNTSTTAAGGEVSDGDDYALTRVPDEARYSWFSVAVQRFGQVSA
FT                   LAQFLLGATLGYGMTFWNAFWALTVGAVILEVVCIFIGIIGVREGLNTSVVARWCGFGH
FT                   AGSAVIGLVIGVSLIGWFGIQSAVSASGLHGIMPFLPQWAWALVFGLLITAIVLRGFGS
FT                   MQLIANITVPLFLLLVGWAVISELRNHSLSDLMASAPAGPELSFLAGTTIVAGGFIAGA
FT                   VITPDMTRFNRTAGDVVKQTLVGITLGEYVIGLTGVLLAHAVRSSDIATIILSSVGWVG
FT                   VLIIVLGTFKINDWNLYSSGLGIVNFIDVVFGRRINRAVVTAVVGVTGSILAAAGILNS
FT                   FTDFLILLGVGFPPIAGIMVAEYFIVKTWRKDLEESRAAGTLPNSAPTWVPATLVIWIV
FT                   SALIGHYSTFGLPSINAVASAFVLYVVAGRLGLIRGVGRTTTEAPQEPSGTSALTH"
FT   CDS_pept        621433..623013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05500"
FT                   /product="putative hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31258"
FT                   /db_xref="GOA:C0ZNK6"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK6"
FT                   /protein_id="BAH31258.1"
FT                   /translation="MRIGIDVGGTNTDAVLMDGTTVIGHVKHSTSKDITGGIGGALTAL
FT                   QQQYSFSPSAVQAVMIGTTHFLNALIEQRGLAPTAALRLGLPATAALPPMVGWPRDLVS
FT                   AVQGRHYLAHGGHEFDGRRISPLDPDEIRRHAADMARSGTRSVAISSVFSPVNLECEAA
FT                   AAEIVRQELGPDVAISLSHEIGRVGLLQRENATIINAALRELADHIVDGLASSLVEHGI
FT                   AAPLYLSQNDGTLMDIEYARRYPVATFASGPTNSMRGAAVLSGLASCAVIDIGGTTTDV
FT                   GVLTNGFPREATTEVTVAGVRTNFRMPDVFSIGIGGGSLVDADGLTVGPESVGYELGSR
FT                   ALVFGGDTLTATDIAVAAGLADVGDRSAVAHLDRGLVSTALDRISRRVADAVEQMRTTS
FT                   DPLSVVAVGGGSVLLEHELPGLGTVIRPERFDVANAIGAAIAQVSGEVDRVEAVRDGRR
FT                   QILADDARQEAIDRAVAAGARPESVQIVEFDEVPIPYLPGNATRIRVKAVGDLALHSGL
FT                   VSTGQEGSR"
FT   CDS_pept        623010..624119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31259"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK7"
FT                   /protein_id="BAH31259.1"
FT                   /translation="MSWTLRKADLDDLARGAALLGTGGGGDPFVGKMLVTQALGEAGEI
FT                   TILDPEELDDDAWVIPVAQMGAPTVVVEKMPRGTEPELALITLEKHTGRTADATMPMEC
FT                   GGINSMIPLLVAARRGLPVVDADGMGRAFPQLEMETFSVYGISASPLAMANEHDEVAIF
FT                   DTGSDNARLEGLARGVTSRFGGMAHIAQYSMTGADVKRTAIPRTLSLASAIGRSIRLSR
FT                   EQRVDPVQALVDGLADTLYGYGRVLFHGKVIDVDRRTDEGFARGSVRIAGVGDEELEVQ
FT                   FQNENLIAVQSGVMVAIVPDLICIVEADTAEPITTEGLRYGQRVAVIGIATPPIMRTPE
FT                   ALAVFGPASFGLDRPFLPVETLEQPVLAE"
FT   CDS_pept        624126..625184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31260"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK8"
FT                   /protein_id="BAH31260.1"
FT                   /translation="MSRLHAVREADLDAIAAGAVVLGCGGGGDPRLFVEMLRPLMTSTS
FT                   VEVIAPDQLPSGAMIMPVGIVGSALALEEQLPSGHEFADTAAALTRWTGKRPTAVMTFE
FT                   GGGLNALSGIAAALALGIPVVDADLLGRAMPRLDHFSLAAAGLELCPVTLAQPGGLITV
FT                   VDGVDVLGAEVAVRSLIGRTSGWGALAIASIDARTVQEACIPGTLSRAYELGQHVGTLG
FT                   SWREIAESSGGRVMGTGRVRAVRRSRPNAGDRRGNVILEHDSAVIRVEFESEFLTVASD
FT                   GEMIATCPDIVTLLDVRTGAFVSCESVHQGQDVAVLVLPGPQWWAEDVSRLKVVGPRAF
FT                   GIDHDAVLMEAQ"
FT   CDS_pept        625181..626716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05530"
FT                   /product="putative CdaR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31261"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK9"
FT                   /protein_id="BAH31261.1"
FT                   /translation="MSASVSALLNNPIFVGLYRLAGEGDPVVTTVGALTGESAQSAEAV
FT                   SGAAGAGSVLVILDRIDVGEWRFDALLRRTAATGCRVLAVHSTAAEDANLSLLADRLGL
FT                   VVLGVSDPWQFSVDLRDLLSNSRAVMADAVLRATHAGQRAGGSVENLLSVLLNTFQRSF
FT                   ILLDASGRPLTGADLLSDADRAAAGMLSGRGAPTTVELDSGGVLIACPVMSGAAREPWL
FT                   AVLLPVRQSVEEASLSVVLDVASLAAGHRLAVARMVDEREARRRSALLGELIDTSADAT
FT                   PGLLRRALDAGWALDGWHIGIKVLAVGEVDLVARRSEVADALAAEGIDANVVEQADGWA
FT                   AWTTLPGEPRPESITRIAESIRAAQARLEPTMETWVGVGRAHDGPAGIGASLSEAGDAA
FT                   RLAGSRSQTGRFLHVDRLGLAQLLLAWTRTDTFQPAAAALLAPLRDSNGELLETLSTYL
FT                   DEESSLAHTATRMGLHRNTVSSRIDRIQRLLSVDLADPETRLALHLACRTIAP"
FT   CDS_pept        626945..628270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05540"
FT                   /product="putative cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31262"
FT                   /db_xref="GOA:C0ZNL0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL0"
FT                   /protein_id="BAH31262.1"
FT                   /translation="MTAVLSADTCRTTAIAKVSGADLQVPLVQGGECSYANFDYAASAP
FT                   ALAQVTDRIAELLPTYASVHRGAGYASRISTLTYENARESVARFVNCADDQVVVFTRNT
FT                   TDSLNLLAQCVPGSTVVLDVEHHANLLPWNDARIVTAADTIEETIERLIGELCTKPAAL
FT                   LAITGASNVTGEILPIARLADIAHRCGARILVDAAQLAPHRRIDLQECGVDYIAFSGHK
FT                   LYAPFGAGVLVGRRDWLDEAQPYLAGGGAVREVTIESTEWACAPARHEAGSPNVLGAAA
FT                   IATACETLHALDFDVIAEHEKALTAQLTDGLSAIESVSLVRLWNDAPDAVGIVTFTVDG
FT                   FEAGEIAAFLSAEHGIGVRDGRFCAHPVLARLGLSGGAVRASLGLGSSSDDVTRLVDAV
FT                   NILVSNQRDWNYAKTAGAWNPVPETRPFLGAADDNAGAAECV"
FT   CDS_pept        628481..629095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31263"
FT                   /db_xref="GOA:C0ZNL1"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL1"
FT                   /protein_id="BAH31263.1"
FT                   /translation="MSSRASHSLHVAVELTGSGHHPAAEGAPGNLPIIGGDYWVDLTEG
FT                   EKALDLASFPTNVVRIRAADLREAQLERARIRAAVAEEGRDPDSVAVLVDLEILIAPEA
FT                   RSARKELAQLDSALTAPRVPVSLHYVGTPSGLGSLIADIRAAEVADGVTLLPLALPRTL
FT                   EHLVDSTIPWLQDRGLVTPSTAVDEVLGRFGLPPRQRTLAS"
FT   CDS_pept        complement(629074..629937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31264"
FT                   /db_xref="GOA:C0ZNL2"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL2"
FT                   /protein_id="BAH31264.1"
FT                   /translation="MDVDVPTRILIEGLLRTDGTVDGRTLYATADALGKTDQQVRLCIK
FT                   RLVTEGKFTQEGRGRQATLRATPKALREMEPDVEFVRLAYQQDRDTVTPWDGYWHLAGF
FT                   AIPESSRKARDALRTRVVYLGGALVQGGLYVSPHAWEPYIRDAAAELDVEQHLSSLTTR
FT                   DLKVGMLEDPVKIAAQLWPLDQIADGYERLLDVATARLHKLQNSPGTDAVTMTIELAAE
FT                   FTRAMEPDPLLPPELLPTNWIGTRARSITAQCWTLLAQVDGADELPSLFHLYADAIGDD
FT                   QDASVR"
FT   CDS_pept        630042..631094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31265"
FT                   /db_xref="GOA:C0ZNL3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL3"
FT                   /protein_id="BAH31265.1"
FT                   /translation="MAAESMSEGKSKPRLRRWMVTSLAVVVVLIATLVGWTLYQNTYDI
FT                   REEKVTITGGSVPLQGVLALPEHGDGPFGLVVFVHGDGPVDATHETFYRPVWEAFAKAG
FT                   YASLSWDKPGVNGAPGNWLDQSMDDRAAETEAAIEWARGRSDIDPSRIGLWGASQAGWV
FT                   MPKVVNLDPDVAFVIAVGPAINWLQQGEFNTLAELSERNASADEFEKARVDRAKNLDQL
FT                   ARDASFDDLVASGEADGLTEDRWNFIRKNYLSDARADLETVKVPVLLIIGGQDVNVDVA
FT                   DTERVYRELLDSPGQLVVKKYPDATHSIVEKDLEDSELMSALVAVLAPRSIFAPGYLAD
FT                   QTAFLEGIHG"
FT   CDS_pept        631087..632298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31266"
FT                   /db_xref="GOA:C0ZNL4"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL4"
FT                   /protein_id="BAH31266.1"
FT                   /translation="MADGITVVALGGAGAMGSAAVRLAATLPGIGKVVVADRDIDAAKR
FT                   LSVELAQASAEVEARSIDVTDGRTLRELLDGADVVVNTVGPFFRFGVGILQAAIETGTH
FT                   YLDICDDWEPAVDMLELDCAARGAGICAVVGMGASPGMSNLLAAMAVSRLDVVDDLYTA
FT                   WPVDVEGEDESVDTLSAAAVHWMQQISGTVPVVRAGRIVNEEPLRSIALELPGGRRGNA
FT                   YVVGHPEPVMFHRTINPAGHSANLMVITPETVAFLDVLRSDIDKGRIDLDSAAEELGKP
FT                   SLRRMIRAAPRMLTRAGHGSLPLFFASATGVREGREMRVVARIADDSPVSELLSDMAGA
FT                   TAIPLALGLAQVVSRLADGTIRDRVGVHSAESVIDPDVLFTALARLFGRTDWSDIVTVE
FT                   SEFR"
FT   CDS_pept        complement(632299..632700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31267"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL5"
FT                   /protein_id="BAH31267.1"
FT                   /translation="MVGFRHPPRASNSRDRVFTVSTGTSTIYEDRTVRIDDQGVTIRHY
FT                   YFPFVSKFVPYSQIESVDLGVMSWLSGRLRIWGTTDFSSWYSLDLSRPWKETAVVLTLA
FT                   GRGAPSFSPKDADRVETEIRSRIGSHAAN"
FT   CDS_pept        complement(632736..633113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31268"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL6"
FT                   /protein_id="BAH31268.1"
FT                   /translation="MKHCADHRLPEILRDTHHRLRRAGTVASETPVVAADLYWSIGALA
FT                   QCLTAMDEVISQLGINARKQLRAGKFDVQSGPFEGEPDAALLTAVLALARASSSCEPVQ
FT                   AAIGNAQIAVSDLVVARTTSA"
FT   CDS_pept        633177..633755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31269"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL7"
FT                   /protein_id="BAH31269.1"
FT                   /translation="MQVVLDDYVVGASFATDLVNTSPRVWVEAGDALRDPQALHDLLDE
FT                   HGLSPDALRNGRRLTGGELADVQALREEIRSILDAPTSDELVDRTDQLLQTVPHHVRLV
FT                   PDAQFDYRWNALPDRRIDLTGELTLLIGYSLLGTLRTLGYERFRPCASPTCNGVFVDTS
FT                   RGGRRRYCMPALCGNRINVANHRQRQRRT"
FT   CDS_pept        633915..635522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05620"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31270"
FT                   /db_xref="GOA:C0ZNL8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL8"
FT                   /protein_id="BAH31270.1"
FT                   /translation="MKARSVSATAVISVGVFTLAGCGGASSPEGSVGEYAKDSSFTTVI
FT                   NADPGNLHPLITNLTSTQIVNAYSYDSLIDIDAQTRTVRPYLAESWREEGNMLKFVLKK
FT                   GVTCADGTSFTAQTAADDINWVMDPENASPLRGSTVPSSTVASANGDELTVTTAEPAPF
FT                   LLSRMGSMRLPCAATLEDPASIRSSSNGTGLFKVTEVVPNDHITMERRDGYTWSPNGET
FT                   TSDTLGVPKTVTIKIVTDPSTTANLVLTGGVNAAAVTGSDEERVLAAGLDSKTYTTLSG
FT                   EFIFNHFAALPTADRAVRQALVQAVDLDDYTEITTGGKGTRARALAVSEPLACDYNSVE
FT                   GTILDFDVDAAKKTLSDAGWKAGPDGILTKDGRPLALNVIFNNSRDTNSAAAEYVATQW
FT                   EGLGARVKLTGGDYSFVIANTFSTTDLSSWDVSIGLTLGSDTPSIFAKYFTGPPKPEGV
FT                   NFASLDNKKYIELSTEASLLPGDESCKVWEESERALFKDVDLLPVSTTPAHMFFNGATS
FT                   IYPPSSGILPGSAIRVLK"
FT   CDS_pept        complement(635878..637380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05630"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31271"
FT                   /db_xref="GOA:C0ZNL9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL9"
FT                   /protein_id="BAH31271.1"
FT                   /translation="MSSTTSPPPTTPPQTTKSPATTAVVAVLAFSGIVVSLMQTLVIPI
FT                   IPHLPEYLNAPASDTAWAVTATLLAAAVAVPTMGRLGDMFGKRRLLLISMALLVTGSVV
FT                   GALSSSVIPLVAGRILQGLAAGVIPLGISVMRDVLPPKKLAGAVAMMSASLGVGGALGL
FT                   PIAALIAEYADWHVLFWASAVLGALAAVLVVVLVPESTVRTGGTFDFGGAISLSAALIA
FT                   LLLAISKGGDWGWTSTLTLSLFGAAILIFGFWAWWELRTPKPLVDLRVSIRRQVLFTNL
FT                   ASIVFGFAMFAASMVFPQVVQLPEVTGYGLGGSMLTAGLVMAPSGIIMMLISPLSSRIT
FT                   NSHGPKVTLMLGAVVVAIGYGIGIFAMHSIWELIVIAVIIGAGTGMAYGAMPALIMGAV
FT                   PPSETGAANSFNTLMRSLGTSFASAIAGVVIAQMTMSIGGATLPSENAFRVVMALAAGS
FT                   AVVALVLAGFLPRFNSSNSRKEIGSQHTDTSPTTSKESVPTH"
FT   CDS_pept        637539..638213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05640"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31272"
FT                   /db_xref="GOA:C0ZNM0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM0"
FT                   /protein_id="BAH31272.1"
FT                   /translation="MTTRTEDASADVGGAANSARSAATRDRILAVAEQLFAEHGVFAVS
FT                   NRQVSEAAGQGNNAAVGYHFGTKTDLVRAIVNKHSQQVEKKRGELLCEIEGSTNVRDWI
FT                   SCLVRASTDHYAEMGGPTWYARFSAQILTDPVLRKIVYDEVLASPTLQETLRGLSDCLA
FT                   DMPMSVRRARADIGRNAIVHMFAERERTLAEEGPDAVTSWEDFTTDLVDALVGLWTAPI
FT                   SR"
FT   CDS_pept        complement(638203..639162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05650"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31273"
FT                   /db_xref="GOA:C0ZNM1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM1"
FT                   /protein_id="BAH31273.1"
FT                   /translation="MKNWKAIGSSRFAVVGALLLVGMLWGSSFPLVAVAAPTLGAVGTT
FT                   HGRFIVAALVLALITASSRSTWRAVGHRFPAFLLLAALNVAGPLTLVATAIVGLNSSTA
FT                   SILNATTPMFTVFVAAFWLRQKITWRKLSGVAIGIVGVSVLVGGIPSAIDSRAMLAIGA
FT                   SLTAALLYAVGGVYARKSFQDTPPLTLALGQQLAAVALLVPVSAVAPPPGPITVGPLIA
FT                   VVALGLGATAGGYLVYFWIIRQAGPVAASAVTLLVPISASAIGVLWLNEPVTFALVGGL
FT                   VIILAGVGLLLDLPPTRDPLRRVAPDRAASADKRPVSG"
FT   CDS_pept        639372..639713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31274"
FT                   /db_xref="GOA:C0ZNM2"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM2"
FT                   /protein_id="BAH31274.1"
FT                   /translation="MAVVSGSLCGPHPSRKRTGIPMSSCGCGNTPKSDAKGDVGAVGSA
FT                   MPTGVKDLLTAGSSELVECRVMPGSVIEKVRAEAEGLFRDFEGNRYWFCCKGCGPRFDA
FT                   NPRKYADVS"
FT   CDS_pept        complement(639793..641115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05670"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31275"
FT                   /db_xref="GOA:C0ZNM3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM3"
FT                   /protein_id="BAH31275.1"
FT                   /translation="MNRIAKSAPERNILRLFLIRDYRLLFSAQIIALFGTGLATVALGL
FT                   LAYELAGPSAGAVLATALTIKMSLYVVIAPLAAAYVDRLPRRAFLVALDAIRAAVVIAL
FT                   PFVSEIWHIYVLVGVLQAASAAFTPTFQAVIPDIVTDEADFTRALSASQVAYTMESLLS
FT                   PVLAAVALSFMTFNLLFVATSVGFAVSALLVLATRIPNARRSTHRKAWDRIASGVRIFV
FT                   TTPRLRGIMALNLVVAAAGSIVVVNTVNYVRDELGGTQSDVAWMLAASGTGTLVTALLL
FT                   PRVLDRTAERTVMTAGSVVLVVSAGAAAALAVAGVFTWMLTAAVWALVGAGMAMIVTPT
FT                   GKVLRRSVEPAGIPEVFAAQFSLSHLAWLVTYPIAGWVGSSAGFAVTWSILAALAAVGA
FT                   VAGFVLWPRETVVELPGQATYETTRGECTLAAAQCACARTV"
FT   CDS_pept        complement(641099..641626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31276"
FT                   /db_xref="GOA:C0ZNM4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM4"
FT                   /protein_id="BAH31276.1"
FT                   /translation="MSRLASLTPTTAVGASKDLLAELVNRHGQVGDMVAAMAHSPAVLG
FT                   GYLQLSRAMKRAKLSRKITERISIAVQVQQGCAVCLEAHVAAAHANGVEADEIERARAG
FT                   TSADPAIAAMIDLGLRVYREPASISDEHITGLRAHGYGDREIADVVGIVALNVLTGAFN
FT                   LVAGVKPNEPDR"
FT   CDS_pept        complement(641700..643259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05690"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31277"
FT                   /db_xref="GOA:C0ZNM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM5"
FT                   /protein_id="BAH31277.1"
FT                   /translation="MSSKSSISPCTPTKRCADVTQARLRHPLTTQASPIPRTGKELRMS
FT                   TQPKSTRKWWALALIAAAQFMVIMDTSIIGVALPQMQSDLGFSQEGLTWVFNAYVIAFG
FT                   GLLLLGGRLSDLFGARRVFSAGWLILLIGSVVAGAAGNVAVELAGRAVQGAGAALIAPS
FT                   ALTLLMMLFGSTQKEMTKALSIYGAAAPAGGTAGVFLGGVITEYTSWPWVFYLNIPIAV
FT                   IALIATPLLMPNAPARTGSIDFLGALAVTAGLAVGVFGIVRAPDVGWGSGQTWLALAVS
FT                   AALLGAFVLIQSKRREPLVRLGIFKAPNLGAANIAQLVLGAAWIPMWFFLNLYLQQVLG
FT                   YSAFPAGAALLPMTIFVMLGMVVVAPRAMARFGAKAMIVTGLLVLGIGLGWMSLIRPTG
FT                   NFWVDVLPASLVAAAGMTLAFIPSLGTAISAARPEEGGLASGIVNVSYQVGSAVGLAVM
FT                   TAIAAVFGADQLGDLTELTNGFSAVFLGAAAIAVVGAAITAIVMRSTKVDDPRPVQSTV
FT                   NS"
FT   CDS_pept        643382..644188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31278"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM6"
FT                   /protein_id="BAH31278.1"
FT                   /translation="MQNLTQTATKVLPTQTLEGKMFSDNGYTLELATSEATVGNHVPLQ
FT                   FRILDPVGTPLIRYTDTHDKQLHLIVVGLDLTGFQHVHPELNENGNWYVSVDFDHAGDY
FT                   RVFADFTPDGGDGITLSADVRVAGSYDPRPLPAATAATTVDGYTVSLEGAAHAGQTSKL
FT                   TLSVSRDGIPVTDLQPYLAAYGHLVALRASDLAYLHVHPDGYPGDGVTPAGPAITFYAN
FT                   MPSAEDYRLFLDFKHGGVVRTAEFTLTADNATTPGAEHSSHAHHGH"
FT   CDS_pept        644387..644764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31279"
FT                   /db_xref="GOA:C0ZNM7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM7"
FT                   /protein_id="BAH31279.1"
FT                   /translation="MSEATEVGSAPSSAPNSAQGSDATGDACCTSDSHGYITAKGDYLA
FT                   RLRRIEGQARGLQRMVDEDKYCIDILTQVSAMTKGLQAVAMGLLEDHIGHCVVKAAVAG
FT                   GPEADAKIKEANDAIARLVRS"
FT   CDS_pept        644769..645176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31280"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM8"
FT                   /protein_id="BAH31280.1"
FT                   /translation="MMNIDTLVRMFSIEIRRTFAVRQGLPAPVRDAKNLPPLMPAEGFR
FT                   VTMRVAFSFEDDQLGERGWFVDTDALDESVDRCAEQLASGAWPEIFDFRPSFENVAKWA
FT                   FSELASSIPQLTYVELDNETIGVATRYVRSQ"
FT   CDS_pept        complement(645218..646819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05730"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31281"
FT                   /db_xref="GOA:C0ZNM9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM9"
FT                   /protein_id="BAH31281.1"
FT                   /translation="MKHRSYSTLAATAGLALVLSACSSGGTSSGSGGGEPLTDGTFRYA
FT                   LQGDPGALNPIMSGSAATAEISKLAYDSLVYQDPETSEFKPWLAEKWEETPTSASFTIR
FT                   EGVTCTDGSTLTAQTVANNINFVADPAKGSQQRGTTVPIGASATADLATRTITVTTPAP
FT                   TPFLLLTISRLPIMCDAGLEDPTASNNKSLGSGMFEVTEVSANDHYTFERRDGYSWGPD
FT                   DTTSDTPGVPKTVIAVMAPNVSTAANQLLSGELSASPIAGPDKDRIDAANFDSVQRPLP
FT                   AGQMYFNQIADNPTSDPAVRKALVQAVNLDDLAEVITGGQGTRATSLVSVEPRACVYDS
FT                   VAGNIPDFDLSAAKATLDAAGWIAGSDGKRSKDGKPLTLRLFYAAGEDARSAAAELTQS
FT                   AWSDLGATVEVTGADQTKVVDVMLSGKDNNQWDIAWIQINNSVPSGFVPFFSGPAPAAG
FT                   KNFSSINNPAYEAAVAKASGLTGEEACAEWADAESQITKTVSAVPFADTVLSFYFNKAG
FT                   LAFGKTFIGSALRLYQ"
FT   CDS_pept        complement(646983..647420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31282"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN0"
FT                   /protein_id="BAH31282.1"
FT                   /translation="MFRLYCNSAGPYVLCCAHFPEFTGSNSDEEFSVQQSFDRAVEKIL
FT                   RDASFEPTTLTLVGEQQGYPVGDRLFDTTVPRTGTVSYAFQEAGPSWIVLGLDVSADEF
FT                   WSEIDDDADLHGLGPTSPLRSVPATVLTETGWPRRSDLDSP"
FT   CDS_pept        647464..648204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05750"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31283"
FT                   /db_xref="GOA:C0ZNN1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN1"
FT                   /protein_id="BAH31283.1"
FT                   /translation="MEKLLFQQRWLRELWKVVHPGCMSHEHHNHHENSDTTENPYAKAD
FT                   AQFWNSLYEERPARWSGNPNPQLIAEASDLEPGTALDVGCGEGADALWLARRGWKVTGT
FT                   DISSVALGRAQAHVEGEGVDIEWLEADLTKWDPQGRSFDLVSAQFFHMLEPARGELFRA
FT                   LGDLVAPGGHLLIVGHSPHESPTEHHRAMLHTPEYVESLFTDGWKVLVSESRERDLPAN
FT                   PEMHHTTDTVVLLQRLSASTDSNS"
FT   CDS_pept        complement(648168..649124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="RER_05760"
FT                   /product="putative agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31284"
FT                   /db_xref="GOA:C0ZNN2"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN2"
FT                   /protein_id="BAH31284.1"
FT                   /translation="MATNNPGSFIGPVDATRVPRYAEPTTFARLPRLDEVSRADVTILG
FT                   IPFDSGVSYRPGARFGPGHIRAASKLLRPYNPALKVSPFANQQVADFGDIGVNPFDIQE
FT                   ALTTVQSAVTDLRADGSSVLTLGGDHTIALPILRSLARDHGPIAVLHFDAHLDTWDTYF
FT                   GQPFTHGTPFRRASEEGLIDMERSQHIGIRGPLYSEKDLEDDRVLGFQVIRSDDYEVDG
FT                   VASIVERMRKRLDGGPVYVSVDIDVLDPAHAPGTGTPEAGGMTSRELLNTLRGLVGLNV
FT                   VGADIVEVAPAYDHAEITGIAAAHVAYELLSVLALNR"
FT   CDS_pept        649262..649906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05770"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31285"
FT                   /db_xref="GOA:C0ZNN3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN3"
FT                   /protein_id="BAH31285.1"
FT                   /translation="MGSVAKAKEAVEPVGPRIGARLKAARQSKRLTLDDLAEACGVTKG
FT                   YLSKLERDHVNASVATLIKVCAVLEIPVGSLFENASAGEVVRADAMPQISFGGEKMTEY
FT                   LLTPTSERRIQVLLGELEPGGGSGQEFYSLPIDVNFVHVLEGGLRVSFEGGRTDPNGEA
FT                   VDAEDVVLAAGDSFTFTPTHNHSFQAEGSALAKVLWVLNPALPEGPRASPS"
FT   CDS_pept        650040..650885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05780"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31286"
FT                   /db_xref="GOA:C0ZNN4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN4"
FT                   /protein_id="BAH31286.1"
FT                   /translation="MHVDSVRVGLFQGPLTTPDTFASVEFNLAAIDTAAREAAASGAKI
FT                   VLTPEMSATGYDIGELVSLRAEPADGPIFDSVAEIARSAGIAVVYGYPELDGGDIYNSV
FT                   QVVDRDGTSLAHYRKTHLFSTLDREHFRPGETLVVGFDFEGIRCGLLICYDVEFPEAVR
FT                   AHADAGTEWLIVPTGLMTPYEHIAQQVVPARAYESQMFVTYVNRCGAETELTYCGLSCA
FT                   IAPDGAELARAGGGQELLFADIAAATVSQSRTLNTHLDDRRLDLYPDLSVTTVSKENRR
FT                   "
FT   CDS_pept        650882..652570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05790"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31287"
FT                   /db_xref="GOA:C0ZNN5"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN5"
FT                   /protein_id="BAH31287.1"
FT                   /translation="MTIPVAPDSSSEPGKQPPLTMFGPDFPFPYDDYVSSPAGLGSVPD
FT                   LALGTEVAVIGGGLSGMIAAYELLKVGLKPIVYEADQIGGRMRSVEFDGHPGVVAEMGA
FT                   MRFPPSSTTLFHYLNELGLQTEEFPNPLAEVTPSTVIDLKGESHYAHTLEDLPPIYTEV
FT                   AQAWQRTLEEHADLIPLQQAIRDRDTAEIKRIWNDLVVRYDDQTFYGFLAASKHFKSFH
FT                   MREVFGQVGFGTGGWDTDYPNSILEILRVVITAADDDHRGIVGGSQQLPMRLWNRAPEH
FT                   MAHWPAGTTVASLNDGETRPRVTELRRTEPGNITVTDSEGFIRTYASAVVTVQSWMLLN
FT                   NIRCDDDLFPIDHWTAIERTHYMGSTKVFVLVDRPFWKDKDPVTGRDSVSMTLTDRMSR
FT                   GTYLLDQGEGKPGLICLSYTWSDDSLKLLALDATERMNIMLRSLEEIYPGVDFRSHIIS
FT                   SPVTLSWETERDFMGAFKANLPGHYRYQERLFSHFVQNDLEPRHRGIFLAGDDVSWTAG
FT                   WAEGAIQTAINAVWGVVNHLGGAAPTENPGPGDVFEELAPIRLGD"
FT   CDS_pept        652698..655919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05800"
FT                   /product="putative NAD-dependent glutamate dehydrogenase"
FT                   /EC_number="1.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31288"
FT                   /db_xref="GOA:C0ZNN6"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN6"
FT                   /protein_id="BAH31288.1"
FT                   /translation="MASTSSATKTAAAESRPAGGDRSGDPALELVAELAAAGQRLVFRQ
FT                   GDDLTSDDLNSGALNSDDLTCVVLWPSGEPSLSDLCENFESLGLRVSTHRPLPTVLGSA
FT                   HYFTFEPSTFDGSALEKMADAFEAVIAGQTRMDAFSSLIGRADITWRDAELLRAACRFL
FT                   AQARIGLSESYIVGVLAAKPLFVRQAIELFTARFDPAVAGSRETAVATAAAAIDESVDG
FT                   ADTLDEDRVLRGVRSFLQATLRTNWYLRGEAGEPLPYASFKIDSQLLSTPQKTVPFREI
FT                   YVSAPNVEGVHLRSSSVARGGLRWSDRYEDFRTEALSLMKTQSVKNSPIVPSGAKGAFV
FT                   VRGTSSPTPAQVQESYSTFIRGLLDVVDNIVDGAAVHPAEVIEYDGEDSYLVVAADKGT
FT                   ARFSDVANGIAVERGFWLGDAFASGGSAGYDHKAMGITARGAWVAVRRHFAERDLDVDT
FT                   DPFTVAGIGDMSGDVFGNGMLLSHKIRLVAAFDHRHIFIDPNPDTETTFAERARLFTVP
FT                   RSSWDDFDRTVMSPGGGVWPRSAKSIRLPLEARQVLGIAEEKLTPQELIRAILCAPVDL
FT                   WWNGGVGTYVKASTESNVDAADPSNDAVRVSADELRATVVGEGGNLGFTQRARIEYAAG
FT                   GGRINADFIDNAAGVATSDREVNIKIALAELDATSRNELLAAAQDEVAASVLEASEDQT
FT                   LAISLAEHRAPALLDQHERLIENLVSAGAMKRLEESLPDAKALAVRARAGQGLLRPELA
FT                   VLVAQSKNVLTAELGASTVPDNQIFADRLPQYFPLSVVEAAPDAVRAHRLGRDIIITSV
FT                   VDELVNRVGPGVLFRLEEHLGVHSPEAALAYAVVSEVLGTEELRREILNSELRATEQLQ
FT                   ALDRLQQLLESEMSWVLRRPGAAGRFTVNPRADIDRWAAPVRALTEGLSASDRIEASFG
FT                   ALALADIALQENTTVQAAAAIYRELSDTLDLGDVLGGVDVAVGASHWEVMGSAAVHARL
FT                   TARFADLVSGALGEGIPEVVELWTAANPQAVRRFTALMSSVSRSGALDTARLCTVDAEL
FT                   ELLVRGASSFGSVHAAERSATLPGE"
FT   CDS_pept        complement(655896..657413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05810"
FT                   /product="putative CdaR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31289"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN7"
FT                   /protein_id="BAH31289.1"
FT                   /translation="MTVPISWLLRQKHLSLALLTDRAAATHPVTFAQATELTDPTPWLS
FT                   GGELVLTTGLALVGADATDYSEYIDRLAAAEVSALGFGTGLSHESVPADLIAAARSRGL
FT                   PLLEVPFTTPFAAVTRAVMTRLSQQEYESVLRAAEVQTRITRVALRGGVSAIVRELATA
FT                   TKTSVAFVGGRITAVHPANQKSLITEVRAVAATTRDPNAPASISQSTPERTLTLSPVGV
FT                   TDSWHGYLAMAGAGPLSNIDRVLLGHAVSLLTLELEKPVRLRAERTRLNAMAFGLLLDG
FT                   RIPQDGVPSYLDEASDTHGNVRVVHVRGSGLGPVLRELDNALARAGRPLFAQSEDGSLT
FT                   VLLRGTDTIDTAKTLLAQLSPTEAKTVRAGISTPHRLLDAPRALVQARAAANLTTATAR
FT                   ILEFDALSGSTILASEPAREALIAMAADTIPVLTEHDQAHGTALVASLRAYLEANRQWE
FT                   SAAAELGVHRHTLRGRIARIEELLQCDLGQARVRAELLLSLLAWEGR"
FT   CDS_pept        657542..658906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="RER_05820"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31290"
FT                   /db_xref="GOA:C0ZNN8"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN8"
FT                   /protein_id="BAH31290.1"
FT                   /translation="MSAIEYRLPQERRIVTEFPGPRSAALAERRKKVVGAGVASTLPVY
FT                   VADADGGVIVDVDGNSLIDLGAGIAVTSVGASNPAVVSAVQDQVAHFTHTCFMVAPYEG
FT                   YVEVAERLAELTPGDHEKRSVLFNSGAEAVENAVKIARHATGRDAVVVFDHAYHGRTNL
FT                   TMALTSKSMPYKSGFGPFAPEVYRVPMSYPYREGLNVDGSKITGEQAAQRAITMIEKQV
FT                   GAANTAAILIEPIQGEGGFIVPAEGFLPTLVAWAKENGVVFIADEVQAGFARTGAWFAS
FT                   DHEGIVPDLVTLAKGIAGGMPLAAVTGRAELIDAVHPGGLGGTYGGNPVACAAALASID
FT                   QMRELDLCGRARTIETTVVGRMNALAKELDVIGDVRGRGAMLAIELVKPGGQEPDADIT
FT                   KKIAAECLAAGVVILTCGTYGNVIRLLPPLVISEELLDDALTVLETAIRTAAQGN"
FT   CDS_pept        658908..660353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="RER_05830"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31291"
FT                   /db_xref="GOA:C0ZNN9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN9"
FT                   /protein_id="BAH31291.1"
FT                   /translation="MSNVSDLLDSVPKGLWLGGKLVPAEKTFAVYNPATGEELAQVADA
FT                   TAADGIRALDLAAAAQEDWAATPARVRGEILRTAFELLHARAEDFALMMTLEMGKSLAE
FT                   SRGEVNYGGEFLRWFSEEAVRIGGRFTQAPAGNGRILVTKEAVGPVLAITPWNFPLAMG
FT                   TRKIGPALAAGCTIIVKPAEDTPLTMQLLGQVFADAGLPDGVLSILPTSDAASISGPLM
FT                   EDARLRKVTFTGSTGVGKLLVRGAADKLLRTSMELGGNAPFIVFDDADIDAAVDGAMLA
FT                   KMRNGGEACTAANRIYVANSVREEFTDKFTAKVAALKVGAGDAEGTNIGPLINTKQLAT
FT                   VTGLVDDAVSKGARVRTGGSAPEGAGFFFTPTVLDQVPADARLLKEEIFGPVAAVVGFD
FT                   TEDEAIAAANNTEYGLVAYFYTRDIDRAMRVSAKLDTGMVGVNRGAISDAAAPFGGVKE
FT                   SGFGREGGTEGIDEYLDTKYVAL"
FT   CDS_pept        complement(660406..660984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dszD"
FT                   /locus_tag="RER_05840"
FT                   /product="NADH-dependent FMN reductase DszD"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31292"
FT                   /db_xref="GOA:C0ZNP0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP0"
FT                   /protein_id="BAH31292.1"
FT                   /translation="MSDKPNAVSSHTTPDVPEVAATPELSTGICAGDYRAALRRHPAGV
FT                   TVVTLDSGTGPVGFTATSFSSVSLEPPLVSFNIAETSSSINALKAAESLVIHLLGEHQQ
FT                   HLAQRFARSADQRFADESLWAVLDTGEPVLHGTPSWMRVKVDQLIPVGDHTLVIGLVTR
FT                   VHAEEDDESAAAPLLYHEGKYYRPTPLGQ"
FT   CDS_pept        complement(661193..661666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31293"
FT                   /db_xref="GOA:C0ZNP1"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP1"
FT                   /protein_id="BAH31293.1"
FT                   /translation="MTSLLHPNASHVAETLISRGHHGVIVTQPEATHTAAEAAAAVGVE
FT                   VGAITKSLVFLLDDDPVLLLVSGAHQVNLKATGERLEGKLTRAPLEMAKSATGQPIGGV
FT                   APLGHPTNLPTYIDTALEQYPELWAAAGHPNTVFRTTYSELLRITAGLAVDMD"
FT   CDS_pept        complement(661682..662785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05860"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31294"
FT                   /db_xref="GOA:C0ZNP2"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP2"
FT                   /protein_id="BAH31294.1"
FT                   /translation="MTTTHPAHAAPDNSSTHDEHHHDNLLVKYGAPKVMAALFVGVLLL
FT                   QMGFILSYVAAFHQPTPRDIEIAVIADQGTPDGMDQQIADKLNAIDGSPLDAQVVDSTA
FT                   TARRMINDREIQGAFVINPAGPDTLITASAGGSSIATSLEAVFTKVEATQDRQFVVRDE
FT                   IPVGAHDNRGLSGFYLSVGWVVGGYLLAAAIGLFIGAPKTLRQASAHTGVIAIYSIISG
FT                   ALGALITSHVLGTFAGHWFPLWILGTAVVFGTAMFTLGLRAAIGVLAVPLAIAVFVILG
FT                   NPSAGGAFGSNVIPSFYAAIGRWITPGAGTEGVRSIVYFNNVGVGQPALTLFLYALIGA
FT                   VMLFGFTIRRNRKSTDTTPTPAVANAD"
FT   CDS_pept        662855..663496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05870"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31295"
FT                   /db_xref="GOA:C0ZNP3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP3"
FT                   /protein_id="BAH31295.1"
FT                   /translation="MTESRQPDWTPVTRPGRDVVRQRLLDAAAEEFAERGFSAARLTEV
FT                   ARRAGFTKGAVYSNFESKQDLFAELFAQRSLELAGRVLAEIAGMNPADAAGKGGEAIAT
FT                   WMVDDPGWSLLVLEFGVLAGRDPQIAQAYLRERRHLRSQLVELIGERAREWGVDDSFDV
FT                   RTTAISLMALISGLVLEHSVDPEEVDQSVMGAAVTALFAGAVARAGLPAV"
FT   misc_binding    663542..663715
FT                   /bound_moiety="magnesium ion"
FT                   /note="YkoK leader as predicted by Rfam"
FT   CDS_pept        664063..666756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtB"
FT                   /locus_tag="RER_05880"
FT                   /product="magnesium-transporting ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31296"
FT                   /db_xref="GOA:C0ZNP4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP4"
FT                   /protein_id="BAH31296.1"
FT                   /translation="MSFSVLALRPRPTRNSAQQTPSTVLAKESAQELVDYSASDTRTVL
FT                   ADLTTTANGLRDDQIDDLRRRYGRNDVRHDRPAPAIVQFAQAFKNPFILILVFLALIMV
FT                   GTDVVWADPEDGPSYEGIITLGLMIFVSVSLRFWQEYRSSRAAEALKAMVTTTVAATRK
FT                   INNTVVTAEIPIEQLLPGDVVQLAAGDMIPADVRIIRAKDLQVNQSMLSGESMPAEKSA
FT                   EPSTGIDVDRLLEAENIGFMGTSVVSGSGTAVAVHTGKRTYFGAMTAQLASKRPETSFD
FT                   VGVRSVSYLLIKFMLIMVPAVFIINGLTKDWSQALLFGVATAVGLTPEMLPLIVTANLA
FT                   KGALHMSRKKVIVKQINAIQNFGAMDVLCTDKTGTLTEDRIVLGEHLDTAGRKSEDVLR
FT                   LAAVNSVNQTGLRSLLDDAVIEAAGPEVVEEISRRHGLVDEIPFDFKRRRLSVVVDHGD
FT                   AVLIVTKGAVEELLSVCESVELDGVTHQLTPGWLARVDRLVAELNGQGKRVLAVATKTV
FT                   VEEQRREYSTADEEGMTLVGLLAFLDPPKESAAGAIEALASHGVAVKVVTGDNELVAET
FT                   VCGKVGIDVGTVVSGAEIEALSDDALDELVQRTTVFAKTDPMQKARIVESLRRVGHTVG
FT                   FLGDGVNDAPALRAADVGISVDTAADIARESADIILLEKDLGVLEQGVIEGRRTFGNIQ
FT                   KYIKMTASSNFGNVFSVLVASALLPFIPMIPVVLLLQNLIYDLSMLTIPWDRVDDDFLA
FT                   KPRKWETKSLRRFMVFIGPISSIFDISTFALMWFVFAANSPEHAALFQSGWFIESLISQ
FT                   TLIVHMIRTRKVPFIQSRASLPVLLSTGAACVFALVFPFTSWGHSLGLVSLPWNYFPWL
FT                   VLTLAAYCVVTQVAKGMFIRRFATWL"
FT   CDS_pept        666766..667470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtC"
FT                   /locus_tag="RER_05890"
FT                   /product="putative membrane protein MgtC"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31297"
FT                   /db_xref="GOA:C0ZNP5"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP5"
FT                   /protein_id="BAH31297.1"
FT                   /translation="MEIHVILVRIALGLVLGAAVGIERQWRARMAGLRTNALVSLGATL
FT                   FVIMGAYGFQGPDADPTRVAAQIVSGIGFLGAGVIMKQGASVTGLNTAATLWATAAVGA
FT                   LAGGGMYWVAVFGAGAIMLANTLLRPLGRMMDHQPARTGREEPPADYTFEVTCHGDAEA
FT                   HIRGLTVQSISRPEFQLRSVQSFDIPDSDRVRVVAELAAAERDDGLLESAVSRLSLEPL
FT                   VTHVRWEVEPSK"
FT   CDS_pept        complement(667489..668883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05900"
FT                   /product="putative lipase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31298"
FT                   /db_xref="GOA:C0ZNP6"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP6"
FT                   /protein_id="BAH31298.1"
FT                   /translation="MGRGTPMWRTSMSSRVLSRTVVGVLAVALTGVGAPAALAQPALAQ
FT                   SPDDSFYSYEGAAPLSSYAPGAVLETRTVPYTILNIPTPIQAVQVLYRSTDALGQPSAN
FT                   VTSILRPANAQPDKVVSYQSFYDSLNPDDSPSRAIAGNTPIGDWTPSGRNFNVGGTFTS
FT                   IEAALFGPLFALGYTIVVPDTEGPDANFAAGPEYGMMTLDALRAAKDVPETGITDDAEI
FT                   ALMGYSGGAIATNWASILAPAYAPEINDNLIGAAQGGVLVNPANNLRYASGSIGWGGVV
FT                   GMAIVGVARSYDIDFGKYLSDRGRDVMARLEDASIGNVLAQYPGLTWQELVKPEYADPN
FT                   TVPEYVDVVNKINMGTAATPTIPMFIAQAANGTIEGTQPGGPGVGAGDGVMITGDVRTL
FT                   ARKYCDAGLPIQYDQYDTISHFLGAMLWLPGALTWIDDRFTGKPAPSNCANIAPGNSLA
FT                   PQEHAR"
FT   CDS_pept        complement(668915..669364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31299"
FT                   /db_xref="GOA:C0ZNP7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP7"
FT                   /protein_id="BAH31299.1"
FT                   /translation="MVNIRVAAQTDLPFSREHDSHIAAEELASVIQRGRILVAEDSGKP
FT                   IGWLRWGLFWDEIPFMNMLTVLSSNRGQGIGRALVTDWEKRMSRAGHSQVLTSTLADES
FT                   AQNFYRAMGYSDAGVLLLPGESSEIFLRRDLEPAPDLTDPHITRE"
FT   CDS_pept        complement(669383..669859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31300"
FT                   /db_xref="GOA:C0ZNP8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP8"
FT                   /protein_id="BAH31300.1"
FT                   /translation="MNEIVIERATDEDAAEILVLQRCCWVSEAISNNSMDIPPLHEDLP
FT                   TVRAWVQESTVWTARRGGRLVGAVRGTADGTAWQIGRLMVAPDLAGNGLGRRLLQHVEQ
FT                   NAPEHTTSFELFTGSKSVRNIRVYTRAGYSQLPPDPSHIPGVVYLSKPNAINSE"
FT   CDS_pept        complement(669862..671856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31301"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP9"
FT                   /protein_id="BAH31301.1"
FT                   /translation="MEDQFLSKGQNIELPDELDQIDIVITWDNTEFGVDASALLLGADG
FT                   KVRSDADFVFYNQQESADGSVRYLGRREVESGPHERLLVHLAAVPEQVDAIALVGSVDS
FT                   GSFGDLGKLALQLVDSGGSPIAEYVTADASAETAFVFGQVYRRNGKWKLRAIGQGWASG
FT                   LAGLAEDFGVDVSEDAPVEEPSSSELETPQPISESDPPVTEPTTPPKPARQRGVRTAKP
FT                   VPKKAPLPEFKHAESETWQPARLFSVIGVGTGEEQERRTTSALVSTMQAVPLFARAVSS
FT                   RVGAPAGAFEGYVEVPYVKGESRVIPDAVWRIARGSRLWTGLLEAKTGAGTHTREQLEN
FT                   YLDVAKKNKYDVVISLSNDLPAGAGELPVEVDKRKLTKVALRHLSWAEVIHEARMVLSH
FT                   GGIDNPLQGWILSEFLRYIEHPKSGAEEFVDMGRHWVSIRDSVSAGTLRPGDPKAAAVA
FT                   QSWIALARNLALRFTADLGVVVKHVLPRRVVNDAEARTALTVNELANDGTFSATLRIPD
FT                   AAGELRVTADLRTNKVSCSTTVSAPDEGTAGKRVTWALRQLKNAPEDLLVEALFTGPAA
FT                   STCEILTSARATPRLLTDGQGGQLTSFVLTQSFPLGSKRAGTAASFISSVTSSAEVFYS
FT                   EVVQPLREWVPAAPKASDLPREEQVDNED"
FT   CDS_pept        complement(672085..673206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05940"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31302"
FT                   /db_xref="GOA:C0ZNQ0"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ0"
FT                   /protein_id="BAH31302.1"
FT                   /translation="MVLRIFGLSIAISIIAMIVAFIYGGPEALFLVIILSILEISLSFD
FT                   NAVINATVLRRMSDFWQKIFLTIGIVIAVFGMRLVFPLVIVWAASGLGPVAALDLALNP
FT                   PADDAAYFANGEPSYETILTDAHPQIAAFGGMFLLMLFLGFIFEEREITWLSWLEKPLA
FT                   RIGKLDQLSVVVAGIVLVLSGSFLAADDKVSTVMISGVLGMITYIAVNGLGELFNLPEE
FT                   GEEEETTKSGGPTEFAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGL
FT                   GFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAVILMVSIGVHINEIITGLVG
FT                   VFLIGAAFISSLIRNKRIANADPKLDENTPATV"
FT   CDS_pept        complement(673344..673919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05950"
FT                   /product="putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31303"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ1"
FT                   /protein_id="BAH31303.1"
FT                   /translation="MGVSLTKGGNVSLTKEAPNLTAVVVGLGWDARSTTGAAFDLDASA
FT                   IGAGSNKKVLSDQHFIFFNNLRSPDGSIEHKGDNTDGEGEGDDEQIDVNLAAVPAEIES
FT                   VVFPVSIYDAEARSQSFGQVRNAYIRVVDKANGNELARYDLSEDASTETAMVFGELYRN
FT                   GAEWKFRAIGQGYASGLSGIARDYGVNV"
FT   CDS_pept        674079..675308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31304"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ2"
FT                   /protein_id="BAH31304.1"
FT                   /translation="MVGRWSERFNRGARVGESVSRAREAQTAMVSAFLDMDKRQTIASA
FT                   AVDASAELYPERGLRAAWEPVRDRCFQAASDYLDTSERYGNDQVLHQNPNGARAAFEKS
FT                   VAELVEAAKGVDAFYNGHRAHLEQATVTMSAIPVLGQQARTLANAVREKLAATDQRYRE
FT                   YPSVVTASEHLDDAVAALDNARSSGRADAVRTRAESVREAVSTLEEALAEAPSTQHRAE
FT                   MTISSVSTRLSAVRTRVDRLDPAYSALLREFNAASSADLVDNSSRSRAHIDQADIDLKE
FT                   AKQSLAAGNPEHALALMAEARVHLADAEACADAVTDRLATLRAVRADPSQKEREVRFRL
FT                   KDAQMFAVNQGLVAEWGSVLDAQLARIERASASLSGTHPDYWSYVLQLDSVSTFITEVV
FT                   EKMRARAGKN"
FT   CDS_pept        675368..676558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31305"
FT                   /db_xref="GOA:C0ZNQ3"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ3"
FT                   /protein_id="BAH31305.1"
FT                   /translation="MDLIAVTERREMQHFQHLEDDVREQLFLHAPRSFADSDERDLLAI
FT                   ALGATLYVPATRAGLADIVVKRASEGVSSMVLDLEDAVADHEVESARANAVDALDKIAS
FT                   TDAVGMLLFVRVREVADIHKVAASLTEGRAALTGFVIPKFGSESGPVFLDAVADASELL
FT                   GKHLYAMPVLESPALVHRDTRDLELRTISGILAQHRERILAVRIGATDMCSTFGIRRDR
FT                   DLTIYDVRVVVDVIADIVNYLGRADGSGFVITGPVWEYFADHERMFRPMLRATPFEEHD
FT                   AVRFRQHLVSRDLDGLLREIALDRANGIQGKTVIHPSHVAAVNALSAVTHEEYHDALDI
FT                   LGADAGGVQASGYRNKMNEMKPHRNWAHQTALRAHVFGVTNKGITFVELLTALVDR"
FT   CDS_pept        676555..677844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31306"
FT                   /db_xref="GOA:C0ZNQ4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR022537"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR041688"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ4"
FT                   /protein_id="BAH31306.1"
FT                   /translation="MTEVVQSRDVPWATAEFGLDLVHGDSSLGHAVPDLVIPGLRRNPR
FT                   RAHLLVSTVLGKHVPTEPSVVIGAADDLGDLVRTTLGEGVDVVVLGFAETATGLGHCVA
FT                   ARLRAHCYLHSTRRDVPGATTLAGFEEGHSHATSHLMQPTSAELFENDLPLVLVDDEIS
FT                   TGATAIDAIRALHGQCPRSRYVVASLVDMRTEEHRAASEAAATELGVRIDYVSLASGST
FT                   VLPDGLTERVTALDAPDLNPIGHRRGTLSRMDLPWPAQVPDGGRHGFLDGDTAAFESAV
FT                   EAAVSILGSSIDASRAVIVIGHEELMYLPLRIAAGLESSGRAVRYQTTTRSPAYVVDVP
FT                   GYPLRRGFTFPAPELGENEPRYVYNAQWPDAAVDALALLVVDEPADTDRLTAMDGVIEV
FT                   LRNSGTDVLVATVRGADPSALRESRAGGSS"
FT   CDS_pept        677841..678950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31307"
FT                   /db_xref="InterPro:IPR011215"
FT                   /db_xref="InterPro:IPR028157"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ5"
FT                   /protein_id="BAH31307.1"
FT                   /translation="MNEPLVGPEFGSYAPGEVKWLLKDLSHVDLEADVSVREKRIQSGE
FT                   AHYAESLPIEYQPDQAYRDLFETVLAESAPRLARAVGTVMDLVLAERGSDITLVSLARA
FT                   GTPIGILMRRWAQQTRGLTLPHYAVSIVRGKGIDSVALDYLAHHHDSENVVFVDGWTGK
FT                   GAIARELDTALTEYHEAGGAKFDSDLAVLADPGHCVRTYGTRDDFLIASACLNSTVSGL
FT                   VSRTVLNDTLIGPGDFHGAKFYADLADVDVSNRLLDVVSAEFDSVRGDAADSLAAVLDS
FT                   DRTPTWAGWESVEKVQAEYGISTVNFVKPGVGETTRVLLRRLPWKVLVRELDAPEHAHI
FT                   RLLAQARGVPVEVVPDLAYSCVGLIKDIT"
FT   CDS_pept        678947..679804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31308"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR024197"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ6"
FT                   /protein_id="BAH31308.1"
FT                   /translation="MSRADTAASQVLIATDLDRTMIYSQAAIGGDPSGSDLDSAPSPLC
FT                   VEYYNGGPLSHMSVESIELLTALSSRVPVIPTTTRTIAQFQRIDLPGGPWKYAITSNGG
FT                   NILVDGEVDREWRNEIDRSTSKSGAELPQVQAELESRIDSSWVSSIRVADDLFPYLVVD
FT                   LAVMPSEFETEWNHWCVTRGWNVSRQGRKIYTMPDAVSKSRALAEVRRRLVESGDLDQS
FT                   AVVISAGDGALDADMLEYSDFAIRPRHGELEELNWQRPTVTVTERSGIAASAEILRWFS
FT                   SALG"
FT   CDS_pept        679832..681226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31309"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ7"
FT                   /protein_id="BAH31309.1"
FT                   /translation="MSVSLAKGQNGPLDVSDVVVSVQLAAAADLSALLVTSNGKVRSDA
FT                   DFVFFNQPTGPGVQLVPNPGGIASLRVSLAGVPADIEQVRAVITLDDASSNFGRSAAPT
FT                   ARVSDAAGNVLYEYVIDGLTTESIVIALEVYRRQGAWKVRAVGQGYAGGFAALVTDHGV
FT                   SVDDAPAPPPPTPVAAPAPITPPSSVAPTPPAYNQPPQQQPSYNAPPVPPAPPAYNQPP
FT                   AYNQGPTPPAYPPAQQPAYNQQPTYNQAPPAPPVQNQPPAQQPEVSLVKGRPVSLTKGQ
FT                   KVTLRKEGGVALTMIQMGLGWDPIKKSGLFGSRTADVDLDASALLYADGNLVDVCYYGQ
FT                   LTSKDGSVRHMGDNLTGDGDGDDEVMLVDLQRVPAHVTTVIFTVTSYRGHTFEQVSNAF
FT                   CRLVDSTTNSELARYTLQGGMAFTGMVMAKVYRANGEWKLQAIGEGIQAKHAGEAAPQL
FT                   GRFLTA"
FT   CDS_pept        681385..682278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06020"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31310"
FT                   /db_xref="GOA:C0ZNQ8"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ8"
FT                   /protein_id="BAH31310.1"
FT                   /translation="MITRGKLLGRAAAVAGVVLALVSTGIAQASVPQSAPPAGFSETGI
FT                   KYVALGDSRASGPRLEPMYPDACSRSYENFAGKISRALDVAEFADVSCSAARAENIIDT
FT                   PQLIPNYWPVQLDAVHPDTDLITISIGGNDSNSIFLGPLCVAPGPGTDRGCRYDPLANS
FT                   VAQSGIDRAAGELDRILTAVTQRAPNARIYLIGEGGMISSRGCWPNIPFSDADAAWFMD
FT                   YFARYNTKFDEVAHAHGVRTVDIAAASIAGGHDACASADQRWFEGLFSESTAQRLHFTD
FT                   AGMTAVADLVVADLQG"
FT   CDS_pept        682319..683875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31311"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ9"
FT                   /protein_id="BAH31311.1"
FT                   /translation="MTFVPGQNAPLQAPVVTFRAESQTPFDVSALVADANLRALTSADF
FT                   VFYNQPSTAGVQLDQSGIRVELDRLHPDAAAVLCIVSVDPAATAAGAFRTAGLSATLSD
FT                   QSGSVLAEFAIPTAGTETAVICWELYRKSGAWKIRAVGQGYAGGLAELISVHGVEVDDE
FT                   PAQPAPTAAPAWDSAVEPLEVGRGLERAWMIFEDASRSAASFVSSSEYALARLDEDLTA
FT                   AVADPSLRNSAAGVAARDAAQKRHDDLVSLARDNHARDSAQLAHELGVIDGVLPRSMAS
FT                   WKSVSWAGTTDPAQITAVSDGMRLGELSAPDRGTLTVPYCVPLPLRRPIWVDSTSSKAA
FT                   LGLISAVTVRVMAAGPMPLLDVVDLTGSLTPLTDRLAPMLAGPVITAHTEISARLRALA
FT                   EAVDMGELARMSGVADGPSSLRLLILSDFPHGYSAEDAQTIMFLAERGPAIGLSILIVG
FT                   EDESNFAEESVAGLSEGCQHLSAAGQTEVHDPWTRTQWHFTPDVLDPISESRILAVFDR
FT                   T"
FT   CDS_pept        683960..684415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06040"
FT                   /product="putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31312"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR0"
FT                   /protein_id="BAH31312.1"
FT                   /translation="MAFWDQLKAKAQEMNGQLKTKTSQFQNKEFKNASMAMCALIAAAD
FT                   GSIDPSERQKTAALIMSNESLAVFPPDELREQFDWYCSKLSSDYEFGKVEATATIAKLK
FT                   SKQDQARAVIQIGIIIGGADGNFDEHERGVVRDMCFAVGISPAEFDL"
FT   CDS_pept        complement(684472..684993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31313"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR1"
FT                   /protein_id="BAH31313.1"
FT                   /translation="MLLHQSIGLERFNELPRQKAVHALFECCCSLTWAGWVSDGRPFAD
FT                   HAEILSRAEDAILNLSDVDVERALQCHPPVGVRRNSVPSHLEQCSIWVPDDAVMATIYR
FT                   AGEEYERNFGFRYLWCSHGHDADDLLENIGQRMSNERSVERKVCVDELAKITRTRIERM
FT                   LGPEDGYPEY"
FT   CDS_pept        685320..685844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06060"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31314"
FT                   /db_xref="GOA:C0ZNR2"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR2"
FT                   /protein_id="BAH31314.1"
FT                   /translation="MQRDLILQARIIENLVGIFPANVDSATITSKLKTNTKVVNRALAA
FT                   KSAKRPVPRSTLSSCTDSRVSLRVQAQDVTIWRKIGVLFLALVWTLVAAALVLFGLWDS
FT                   IDTSCDGPAERDMAGGGWLVIATLSVWSGAFVVCALRLRTVTAAVLATLSVVSSTLVVV
FT                   NMLATASGLCW"
FT   CDS_pept        686014..686766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31315"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR3"
FT                   /protein_id="BAH31315.1"
FT                   /translation="MIKCPTDSLPQFRPFWTGFRVPLISHRGLGHTEVMTSRGVVRSWD
FT                   VGGMQGVIDSADTPGGSWTSWTSVVVHGFPGLVEGQEVEFEWNQLDEPADGYDFHTVQA
FT                   WPVGEDHTPPGPPGFRAWDIDPDGTVHEVTDLDITDLDDTIAPPIGTPAIGVVTTWNGE
FT                   EGWGVIDSADTPGGCWTFYSALHPDEVINARPGDSFSIGGGISALVVGEQVDFEWEPVI
FT                   DQDGYKFRAIKVRPRRDIPPWRVERIGR"
FT   CDS_pept        687206..688336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31316"
FT                   /db_xref="GOA:C0ZNR4"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR4"
FT                   /protein_id="BAH31316.1"
FT                   /translation="MIRRRLGQALMVIALASAAVSTAPVHAQEPSSITTPGAVTAATSL
FT                   PHSFWIPGAANASKLTYWSTGPLNQPALSTGALFLPPGDPPEGGWPVISWAHGTVGISD
FT                   QCAPTVTGTVGSPYLTNWLSQGYAIVATDYVGLGTPGIHAYLDGPSAAHSVIDMVRAAR
FT                   AVEPSLSPRWLALGQSQGGQAAMVTAAIATRYAPELDYGGAVATGAPSNLENLAPLVGP
FT                   DFPRLPLTGSTVFVSYLLAGLRAARPDLDIDRYLTPRGTDALARAETDCYQDMASGLGD
FT                   LTIGDLVNRPLDDPAVLAAARGMLEIPTTGYDRPVFLGQGLTDEMVPAPLALKLAAELA
FT                   ANRQPVTFRTYPTGHIETMRAALPESLSFVRNLFQP"
FT   CDS_pept        complement(688343..688825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31317"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR5"
FT                   /protein_id="BAH31317.1"
FT                   /translation="MFGWKKKRHDSKMTLDDVMSKLRPDLSRESLGVGPDFPGVAPNPL
FT                   MSSDARKRNAELRTGALALGVLVDWREVNSNPRAVLMFDVETFDGISFRGIADEDLTIT
FT                   ELTRLAPGQTLPVRYRPAVMDHYVALARNADPAHVQQLSDEIASRKRTPASHATNA"
FT   CDS_pept        complement(689342..689890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31318"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR6"
FT                   /protein_id="BAH31318.1"
FT                   /translation="MSAQVIILTGPPGAGKSTLAAKLARGYSKGVHLHTDDFWHCIVSG
FT                   AIPPYDPTSDAQNQTVMDVIAGAAYTFARGDFATVIDGIIGPWMLPHFRTHATQHPNLA
FT                   VHYIVLRPQRDITLKRAQARTAPSALIDEGPILSMWDQFSDLGELDDHVLDTSGDEEEQ
FT                   SAQQVAAAIRDDRFRLFAQ"
FT   CDS_pept        complement(690558..690956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31319"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR7"
FT                   /protein_id="BAH31319.1"
FT                   /translation="MVRSRHLVDNANMTTGAPAQTVHFDQKHYTAVVSGAKVSTVRWRE
FT                   DIHEGPAIFIFDNHPTARPLTGQVTAVETYDLAHLSPLAARQPPGTDMTNFARQLRVNY
FT                   YPEMPEDAVVQVVVIATGHHGDSSLPTT"
FT   CDS_pept        complement(691193..693172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06120"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31320"
FT                   /db_xref="GOA:C0ZNR8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR8"
FT                   /protein_id="BAH31320.1"
FT                   /translation="MVTAADNEVPADNTAPSVKQRTEAWLLADITEEPAGHLGPHRMAP
FT                   KKEKRHPWWKVMCLTGVDYFSTLGYQPGIAALAAGTLAPIATVVLILLTLFGALPVYRR
FT                   VARESPHGEGSIAMLEKLLPKWRGKIFVLVLLGFAATDFLITMTLSAADATAHLVENPF
FT                   APTFLSGHTVAVTLVLLALLAAVFLRGFTEAIGIAVGLVAVYLALNVVVISVGLWHIAT
FT                   APSLVTDWTRAMTTEHGNPAMMILIALIVFPKLALGLSGFETGVAVMPQIKGDPHDTEQ
FT                   NPRGRIKGARRLLTTAALIMSGFLLTSSLVTTILIPENEFQPGGAANGRALAFLAHDYL
FT                   GEIFGTAYDLSTILILWFAGASAMAGLLNLVPRYLPRYGMAPSWARAVRPLVLVFSVIA
FT                   ITVTIYFDAGVDAQSSAYATGVLVLISSATVAVALSARKHGQRKLFVGFSFVAVLFVYT
FT                   TIANIFERPDGVKVASFFIAAITVVSFLSRISRAFELRATSVEFDETALRFIAEAAEKG
FT                   YLAMVAHDVDRLDEDEYRKKESQQRAESNIPEAESIIFIEVNVTDSSEFSTDLLVHGRQ
FT                   RGEHRILWVDSPAVPNTIAAVLLRTRDITGVIPDVYFEWTEGNPIMYLLRFLFIGEGET
FT                   APVTREVLRRAEPDQSRRPHVHVG"
FT   CDS_pept        complement(693177..693995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31321"
FT                   /db_xref="GOA:C0ZNR9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR9"
FT                   /protein_id="BAH31321.1"
FT                   /translation="MDRRRFLSALAAATLTGTAAVTMGTACSSRSVGTAVAAADEPADP
FT                   AAVPNLPPALLPPPPPSARVPLPAGGSLTALPGGGDLFALTVDDGASSEVVRLYTQFAK
FT                   DTGIRLTYFVNGQYNSWTENAGLLRPLVESGQIQLGNHTYSHPDLTSVSKQQIADELTK
FT                   NGTFLRNTYGVDAAPYYRPPYGRHNATVDSVAASVGYTVPTLWYGSLSDSSLITEEYIL
FT                   QMANQYFNPGAIVIGHLNYLPVTHVYPQLVDLIRSRNLRTVTLNDVYLKP"
FT   CDS_pept        694118..695647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06140"
FT                   /product="putative LytR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31322"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS0"
FT                   /protein_id="BAH31322.1"
FT                   /translation="MEPRPRHSATRHRRRRQPQRSTLSVGRKLAAASLSTTILVGVGIG
FT                   WYVQSDLTSGLYRSDALSALGEDAGSSLDGDTNILLIGLDSRKAMDGSDLPAEFVTDKL
FT                   HAGDSDVGGYNTNTLILLHVPGDGGKASAVAIPRDDYVSVPGYGMAKIKEAYGMAKADA
FT                   DAKLVADGVTDPAAREQQAREVGRRSTLTTVQNLLKVPIDHFAEVNLMGFYDVVSAIGP
FT                   VQVCLNNPVQDDFSGANFPAGVQTLDASQALSFVRQRHGLDNGDLDRTHRQQAFISAVI
FT                   ANLKGSGVIGNIPKMTALADVVKKDVVIDSAMDPVRFASQASALAGGNIDFYTLPIEGY
FT                   ETVDGQDVNMVDPARLRSEVSRIFAGGDSASAPAMDTAISTGNEVVDIRNGTATDGLGA
FT                   ALAAAMKASGVEVGEVSTAAATAKSVVSYGVGAKAVAEALAEQLGVAAVPNEQAAAESV
FT                   SVLIGEDNAQTVFSAAPAQSDSSVSAGTVPDTGAQGSPIRADANGGIPCVD"
FT   CDS_pept        complement(695651..695833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31323"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS1"
FT                   /protein_id="BAH31323.1"
FT                   /translation="MVLARERVGFCTAAVVAMSVILSTTQSQSGTPKVKYPTEFDFSNV
FT                   DPQIEEVSVSFVRIT"
FT   CDS_pept        696034..696864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06160"
FT                   /product="putative enoyl-CoA isomerase"
FT                   /EC_number="5.3.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31324"
FT                   /db_xref="GOA:C0ZNS2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS2"
FT                   /protein_id="BAH31324.1"
FT                   /translation="MTEQKSWNAFTVEREDNIAQVTLIGPSKGNAMGPDFWSELPEIFA
FT                   DLDADPEVRAIVIAGSGKHFSFGLDLPAMSGEFGAVLADKAQAGPRTKFHDMIKRMQSG
FT                   INAVADCRKPVVAAVQGWCIGGGVDLITAADIRYASADAKFSIREVKVAIVADMGSLAR
FT                   LPAIIGDGHLRELALTGKDIDAARAEKIGLVNDVFEDADAVLAAARATAKEIALNPPLV
FT                   VHGIKDVLDHTRSASVNDSLRYVAAWNAAFLPSQDLTEAITAVFQKRPPVFQGE"
FT   CDS_pept        complement(696952..697443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="RER_06170"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31325"
FT                   /db_xref="GOA:C0ZNS3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS3"
FT                   /protein_id="BAH31325.1"
FT                   /translation="MEFDVTIEIPKGQRNKYEVDHVTGRVKLDRYLYTAFGYPADYGFI
FT                   ENTLGEDGDPLDAMVLLPESVFPGVIVEARAVAMFKMVDEAGGDDKVLCVPAGDPRWDH
FT                   IQDLGDISQFELDAIKHFFVHYKDLEPNKHVEAANWVGRAEAEAEIEASIKRLAANGGH
FT                   "
FT   CDS_pept        697631..698956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dac"
FT                   /locus_tag="RER_06180"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31326"
FT                   /db_xref="GOA:C0ZNS4"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS4"
FT                   /protein_id="BAH31326.1"
FT                   /translation="MVVLAVAGVVVVKLGTSNDTAGSATVTTSPQPALVTPSPQVVPVP
FT                   TDAPIPSASGIAAAIGPAVANPDLGKFTGVVADALTGNILWSADPSTPMTPASTTKVLT
FT                   ASAALLKLPLDHRLATTVVPGASPGQVVLVGGGDPTLTATPKGQSGYYANAAHIADLVD
FT                   QIKAAGTPVTSVVVDSSLFKGDNMATGWFPADIAAGYITPIESVMIEGGRYDGTQDESP
FT                   RSETPALDAGKVLAQALGVDPANVSLGAAPAGAKPIATVQSAPLSDRLLQMMEHSDNVL
FT                   AETIGREVAIASGIEASFTGAVDATGKTLQAAGFDYTGVSLHDSSGLSVDDLIPAQVLD
FT                   RVMTAAAGDGDPKLRPLLDYLPVAGGTGSLSDRYASGNRTGAGWVRAKTGTLSTASALS
FT                   GFVVDQNGRVLTFALMSNDRPPEVSRPALDAIAGALRNCGCQ"
FT   CDS_pept        698956..700029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31327"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS5"
FT                   /protein_id="BAH31327.1"
FT                   /translation="MAEKTPQDDEASAPLGGAVDWSLAAKAGIKLARGGPAMSRYTAET
FT                   ATAELAEASKRAELPVREVTGLADGLPVPAADVLDRAGWITAASRSMAHLTGADPDGSG
FT                   NLIVGKPAGLQAGAMLAYLSSAILGQYDPFTGEHGTLLLVTPNIVSVERSLRLNPSDFR
FT                   LWVCLHEVTHRVQFSSSPWLAEYMKESVETLGATVDESMTDVVGRLAAELRSRKEPDSS
FT                   DGATAGGIIGLLRASQAEPQRDALDRMLVLGTLLEGHADHVMDAVGPAVVPSVATIRAA
FT                   FDKRRQRKSNPVQRIIKMLLGMDAKMAQYVRGKAFVDAVVLKVGMEQFNTIWTGPEALP
FT                   LLDEIDNPDAWVKRVLG"
FT   CDS_pept        700030..701007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="RER_06200"
FT                   /product="putative tRNA(Ile)-lysidine synthase"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31328"
FT                   /db_xref="GOA:C0ZNS6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZNS6"
FT                   /protein_id="BAH31328.1"
FT                   /translation="MLLPETPALLALRQAVRAWTVAFEPRRRVVVALSGGADSLALTAA
FT                   AVAETDSVDALIVDHRLQPGSDAVARSAADQALALGCRTATVLTVDVAEGGSLEAAARE
FT                   ARYSALRDARTDLPVLLGHTLDDQAETVLLGLSRGSGGRSIQGMAAFDAPWGRPLLGIR
FT                   RSVTRAACVDLGITPWEDPHNNNPEFTRVRLRHEALPLLEEILGGGVAEALARTATQLR
FT                   EDGEALDEYAEALLLRAVVDGEVEVDTLAEAPTAIRRRALRAWLLQGGAKALTDKQLRA
FT                   VDALVIDWRGQGGVAIGGGTPEARLVAARRRGRLILGFEDRRRV"
FT   CDS_pept        701011..701565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="RER_06210"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31329"
FT                   /db_xref="GOA:C0ZNS7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS7"
FT                   /protein_id="BAH31329.1"
FT                   /translation="MYEGDIASVLISEEQIRARTAELAEDIAKRYPTGAPEGDLLLIGV
FT                   LKGAVFFMTDFARALPIPSQMEFMAVSSYGSSTSSSGVVRILKDLDKDIAGRHVLIVED
FT                   IIDSGLTLSWLMRNLKTRNPASLEVVTLLRKPDAVKIDVDVRDVGFDIPNEFVVGYGLD
FT                   YAERYRDLPYIGTLDPEVYGG"
FT   CDS_pept        702485..704131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31330"
FT                   /db_xref="GOA:C0ZNS8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS8"
FT                   /protein_id="BAH31330.1"
FT                   /translation="MLSELDPVETRQVRPSLPKKSSTSDLESILFVIVERGERTPREQH
FT                   YPYVTLERDPWDDYTFRTLFSLTIYLDRTSMVRIGDVKIMKLGQGGGPTSFVDRRFKGL
FT                   PVNYCSLGQSYTYYNLVKELPAKVADMLLRGINDVVYRPGIRDAFEDEEVFQLSLLRTG
FT                   SAMTAFRDAPNLFISGLVQVSEPTVILGFNTDVGGGTFPIRFIFNDSPNLPDRINAIIG
FT                   YNGSGKTQLMANLAMVATASIHRRNVDEYGVFEDAATIFSSVIAISYSAFDTFAMPDEI
FT                   WHTDRERSMVSARLRLGASTFGYTYCGLRRLVSVGSQENSPPVRPLKSIEDLTADFTIA
FT                   LDIAQGSDKGAVLTKALQSLGREPSFGRIGLDRFLAMESTNWHSQFEKLSTGHKIVLNI
FT                   IAHIVCYSEPKSLVLIDEPESHLHPSLLSAFMNSLSGILRDLDCFAVIATHSPVVIQEI
FT                   PRRYVRVLKRIGNSTRVEEVVQETFAENIGSLTSSVFDLDSTATDFHEVLRNLAENRSL
FT                   EEIDTIFGGEMSIQGRAYVRSIQRQLRDSNA"
FT   CDS_pept        704082..704954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31331"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS9"
FT                   /protein_id="BAH31331.1"
FT                   /translation="MLMYGPSSDSLEIAMLERSPLLRDEIADFETVCASRKLNSVKIML
FT                   GSLRDTVVSLYSVYRSKSGSPLISPVCVFSPEVLAALESNYNLTYEGKSLGDLRVEILK
FT                   NSIGNFCSLCGARPFYGLDHYLPKVIYPEYSILSSNLVPCCSQCNTKKASIVGSANGRF
FT                   LHANFDSFASVESWLHCDVRSDAEFVDTVFSVSKRLPAAVQGDAEFHLLKLELDSAYSK
FT                   MAIGELISIKGLLEEAFLDGGEIAVIFELRRLQRSIVRGFGVHFWKNALYEGLCADRGF
FT                   VSGGFAKIC"
FT   CDS_pept        705159..705326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31332"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPK4"
FT                   /protein_id="BAH31332.1"
FT                   /translation="MLADLDDTIAQQADVPESSARLSARLDQLAHRIIDGDPSGAADAV
FT                   AESSPARPDE"
FT   CDS_pept        705587..708151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="RER_06250"
FT                   /product="ATP-dependent protease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="protein synonym:cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31333"
FT                   /db_xref="GOA:C0ZPK5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZPK5"
FT                   /protein_id="BAH31333.1"
FT                   /translation="MNRKTVFRNVLLVAVVLLVIYAFSYFSNDTRDFKTVDTSVAISQL
FT                   DAKNVASAQIDDREQQVRLWLKNGNDATDGKTQILAKYPASASEQIFDKVEGAGADKFN
FT                   TTVTQESWLTSILLFVLPMIILFGIFFFVMNRMQGGGGRGGVMGFGKSKAKQLTKDMPK
FT                   TTFADVAGADEAVEELYEIKDFLQNPARYQALGAKIPRGVLLYGPPGTGKTLLARAVAG
FT                   EAGVPFFTISGSDFVEMFVGVGASRVRDMFEQAKQNSPCIIFVDEIDAVGRQRGAGLGG
FT                   GHDEREQTLNQLLVEMDGFGDRTGIILIAATNRPDILDPALLRPGRFDRQIPVGAPDLA
FT                   GRRAILRVHSQGKPIDPNADLEGLAKRTVGMSGADLANVINEAALLTARENGTVITEAS
FT                   LEESVDRVVGGPRRKSRIISEHEKKITAYHEGGHTLAAWAMPDIEPVYKVTILARGRTG
FT                   GHAMTVPEDDKGLMTRSEMIARLVMAMGGRAAEELVFHEPTTGASSDIDMATKIARAMV
FT                   TEYGMSAKLGAVRYGQEGGDPFLGRSMGVQSDYSHEIAREIDEEVRNLIEAAHTEAWAI
FT                   LNEYRDALDLIATELLERETLTRKDLEKILAGVEKRPRITAFNDFGGRTPSDRPPVKTP
FT                   RELAIERGETWPEPAAAPVLVKAGAPNSGVPNGGVPNNGGLPNNGNQGPSNGYAQPSYP
FT                   QPSAPQQTPQPGTPDYGAPAGWSAPGWPPRENPSPTYPGQQSGGYTGGQNPTPPNQSQG
FT                   QYGQPQHGQPQPDQGQYGQPHPGQQAYPEQPHPGRRYPAQPDYPVQYPDGGPFADPNRG
FT                   NPSGENQWQSPTPEQPQTPPPHHSAEDDGPSTARWDGPDGSR"
FT   CDS_pept        708211..708828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="RER_06260"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31334"
FT                   /db_xref="GOA:C0ZPK6"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPK6"
FT                   /protein_id="BAH31334.1"
FT                   /translation="MSVNDVASELVSLGTGRPFDQARAEAAVRELLIAVGEDPERPGLL
FT                   DTPARVARSYKEIFAGLYSEPDDALNTTFDEGHQELVLVRDIPMFSTCEHHLVSFHGVA
FT                   HVGYIPGKSGKVTGLSKLARVVDLYAKRPQVQERLTSQIADALMRKLDPRGAIVVIEAE
FT                   HLCMAMRGIRKPGASTTTSAVRGLLQSSAASRSEALDLILRK"
FT   CDS_pept        708825..709694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="RER_06270"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31335"
FT                   /db_xref="GOA:C0ZPK7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPK7"
FT                   /protein_id="BAH31335.1"
FT                   /translation="MSEMSAAPVAGSDPARMVVMGILNVTADSFSDGGQFLDRDAAIAR
FT                   GLELQRIGVDIVDVGGESTRPGATRVDPKLEADRIAPVIEELVAAGIRVSVDTMRASVA
FT                   AAAIEAGAGIVNDVSGGRADPDMASVVADAGVPWILMHWRSAGDYVHRGSADQYDHVVR
FT                   DVRDELLSQVDLALKAGVDSSSIILDPGLGFAKNADHNWALLRALPEFNATGFPVLVGA
FT                   SRKRFLGSLLSDPDGNPRPPGGRETATAVVSALAAREGAWGVRVHDAQASLDAIAVVDA
FT                   WNRGRERA"
FT   CDS_pept        709696..710061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="RER_06280"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31336"
FT                   /db_xref="GOA:C0ZPK8"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPK8"
FT                   /protein_id="BAH31336.1"
FT                   /translation="MGDRIELRGLKVRGNHGVFDHEKRDGQDFFIDITVWMDLAPAAAS
FT                   DDLTQTLHYGELAEAAAAIVAGPSRDLIETVAAEIADDVMKDSRVESVEVVVHKPSAPI
FT                   PLVFADVAVVAHRTRSA"
FT   CDS_pept        710058..710561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="RER_06290"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31337"
FT                   /db_xref="GOA:C0ZPK9"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPK9"
FT                   /protein_id="BAH31337.1"
FT                   /translation="MTRAVLSIGSNIGDSVAHLQSVVDGLGSAVVAVSPVYSTAPWGGV
FT                   EQQDFYNAVVVVDDPEADAAEWLRRSQALEEAADRVREQRWGPRSLDVDVVDCEGVVSS
FT                   DPVLTLPHPRAHLRAFVLVPWLDVEPDATLIVDGQKLPVAQILDGLDRTEREGVRTTDV
FT                   VLAR"
FT   CDS_pept        710558..711046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06300"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31338"
FT                   /db_xref="GOA:C0ZPL0"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL0"
FT                   /protein_id="BAH31338.1"
FT                   /translation="MTENDKGLKPTRISELVVLAAVAAVATWILIRVFYGSMPPIPVYA
FT                   GASLYFVAVAEAVFAFVIRSRVKNRQVGDGLRQLHPITAARALALAKASALVGSATVGV
FT                   WVGVLVYLIPQRSVLQAAASDTPGAWVGLGAAIALVAAALWLEHCCKTPEDTPDEPAH"
FT   CDS_pept        711115..712200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31339"
FT                   /db_xref="GOA:C0ZPL1"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL1"
FT                   /protein_id="BAH31339.1"
FT                   /translation="MTNSGRSKSARRSKRSASQMIIAALLALAVIASLFLIFSNSVQLL
FT                   RVGLVVALWAATLGAIAMTKYRRESALDKAKVADLQTVYELQLEREISARREYELSVEG
FT                   RVRREVTADAEELAGLRAELVALRRNLEALFEGGLLPEQTALKTDSTRVPELGGSSYGA
FT                   YQPAPSGLYVPGAGQSGPSQPTPNVGGLASPNDDPVTAETTVVFAETSWRDSSFVAPRV
FT                   IPTQKSQETQKPQSGNQAPSSPVSSSPSRTVKDVPVKKDPEPVAPVEPEVKAPAQAPNI
FT                   EDAVIEDAVVEEAPEVVPEIVAEAEPAAEPDAEPRRRRRAAPEDAASGAHSNGLTVAEI
FT                   MANLSSSNPSEGSGRRRRRED"
FT   CDS_pept        712311..713252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31340"
FT                   /db_xref="GOA:C0ZPL2"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL2"
FT                   /protein_id="BAH31340.1"
FT                   /translation="MTSFGITNGPAPARLTVGIVSAGRVGTAVGAALERAGHVVSACSA
FT                   VSSASVARAVKRLPDTEILPAADVAARSELLILAVPDDQLADLVRGLAATQAVKPGTLV
FT                   AHTSGANGIAILTPLTELGALPLAIHPAMTFTGHDEDTARLSSACFGITAADDIGYAIA
FT                   QSLVLEIGGEPVRVREENRALYHAALAHGSNHLVTLVVDAVEALRASLQGDELLGQQLV
FT                   DGDPGGVAERVLQPLLSAALDNALRRGPSALTGPVARGDAAAVDTHLRVLTELDPELAA
FT                   GYRAMSLRSAQRVGAPTELFDILTETGGDRRE"
FT   CDS_pept        713236..714177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="RER_06330"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="protein synonym:pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31341"
FT                   /db_xref="GOA:C0ZPL3"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL3"
FT                   /protein_id="BAH31341.1"
FT                   /translation="MTVVSDLQGGYKRGELTVHHDPDRLRRVSRALRGVGRQVALVPTM
FT                   GALHAGHIELVRQAKVTGAVVIVSIFVNPLQFGAGEDLDAYPRTLDADLDLLRAEGVEL
FT                   VFAPSAKTMYPRGQRTTIVPGPLGSELEGGARPTHFAGMLTVVAKLLQIAAPNHAYFGE
FT                   KDYQQLTLIRQMVWDLNFDVQIIGVPTVREFDGLALSSRNRYLDEGQRAAAVALSAALI
FT                   AGAHAASGGAEAILETARAVLAAVPEIEVDYLEVRGVDLGPAPERGDGRLLVAAKLGTT
FT                   RLIDNVGVAVGTGFLERDTDPSADAIDDLLSH"
FT   CDS_pept        714205..714651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="RER_06340"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31342"
FT                   /db_xref="GOA:C0ZPL4"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZPL4"
FT                   /protein_id="BAH31342.1"
FT                   /translation="MFRTMMKSKIHRATVTHADLHYVGSVTVDQDLMDAADLLEGEQVC
FT                   IVDIDNGARLETYVIAGERGTGVIGINGAAAHLVKPGDLVILIAYGVMNEQEVKEYSPR
FT                   VVFVDADNKQIELGSDPAHAPEGSGLITPRMLSTLEASRESSLV"
FT   CDS_pept        714655..715470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31343"
FT                   /db_xref="GOA:C0ZPL5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZPL5"
FT                   /protein_id="BAH31343.1"
FT                   /translation="MLLTVDVRNTNIVLGLFSGTGEYSKLLQDWRMRTDPRMTADELAL
FT                   TFRGLLGTHVDEITGVAALSTVPSVLREIRVMLERYWGHVPHVVVEPGIRTGVPLLVDN
FT                   PKEVGADRIVNSLAAHHLYEGPCIVVDFGTSTCVDVVSAKGEFLGGCIAPGLEISTDAL
FT                   ASQSAALRKVELVRPRSVVGKNTVECMQSGAVFGFAGLVDGLVNRVRDELPEFGGDDVS
FT                   VIATGDSAPLIIPESDTIDHLERDLTLEGLRLVFERNQARRGSGRRPVA"
FT   CDS_pept        715732..716250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06360"
FT                   /product="putative cysteine dioxygenase"
FT                   /EC_number="1.13.11.20"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31344"
FT                   /db_xref="GOA:C0ZPL6"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL6"
FT                   /protein_id="BAH31344.1"
FT                   /translation="MPTRLRPADLLRLTDEGANGVLDGRFDHLIPDAFPTLDRWSTRLH
FT                   ADDDVDVWLISWVPERNTELHDHAGSFGALTVLSGSLTEFRWAGDALVERQLDAGDQAS
FT                   FPLGWVHDVVRSTDAPGAPIEISSDAPTLSVHAYSPPLTAMSFYEVTDHRTLRRTRTEL
FT                   TDLPEGGTK"
FT   CDS_pept        716247..716669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31345"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL7"
FT                   /protein_id="BAH31345.1"
FT                   /translation="MTIDQMLDDARAQIDRMYVFQLTEAFHRGAIFVDIRPQAQRAIEG
FT                   TLPGALAIERNVLEWRLDPTSSAHLALATDHDVEWVIVCSEGYTSSLAAASLQQLGLHK
FT                   ATDLVGGYQAIKAAGLLGALSGVRHCSRELAAVSAH"
FT   CDS_pept        complement(716691..717650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06380"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31346"
FT                   /db_xref="GOA:C0ZPL8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL8"
FT                   /protein_id="BAH31346.1"
FT                   /translation="MDALSMMLAGSRAEGAFLLRSLLDPPWSLRIEDHAPITVLVLVRG
FT                   SAVVVSDTGQTEDLEAGDIALLRGPDPYTVADHPGTPVHVLIDEAQNCAAVDGSPLEDM
FT                   SVLGVRTWGNSTSGQTVMLTGTYRLDSYVSRQILDSLTPVAVVRRSMETTPMTKLLEQQ
FT                   IAADGPGQEVLLDRLLDLVLISAVRTWFAENPNRSPRWIKAYEDPVIGHALRLIHNRPE
FT                   HPWTVASLAQESGSSRAAFARRFTGLMGLGPVGYLTEWRLSVAADLLADPARTVSSIAR
FT                   EVGYSSPFALTTAFTRHHGMSPKIYRQTRCAPLLTARG"
FT   CDS_pept        717731..718564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL9"
FT                   /protein_id="BAH31347.1"
FT                   /translation="MTTTSDIQSAVVIGGTGKTGARVAQRLTAVGIRTRIASRTSGTRF
FT                   DWNDQSTWQPAMSGVEAAYVTYAPDLAVPESSTHIEELAELAYREGVRRMVLLSGRGEP
FT                   AAQKAEQVLADTGLEWAVVRASWFAQNFSEGYLLDPIREGHLELPVGEVGEPFIDVDDL
FT                   ADVAVATLTRTDLLGRVLEVTGPELLTFAEAVEAISAASGRAMSFERIGLQQFSDGMAE
FT                   VGVPSDVVELLTYLFAEVLDGRNQSVTGVVEEVLERPARDFTTFAAEAARTGVWS"
FT   CDS_pept        718561..719064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06400"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31348"
FT                   /db_xref="GOA:C0ZPM0"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM0"
FT                   /protein_id="BAH31348.1"
FT                   /translation="MKKSEIFLELLVGVTALGALVAGGALFAFSSFVMPALRSVDAHAA
FT                   ITSMQAINVEAPRSALMLPLVGSALTAIAAGIWAAISRPDGWVLAVVGCIGVLASFAVT
FT                   AIYHVPRNDAFASVSATDAAAWASYEAGWTVWNHVRVALYFLSGSVLAVAAVLPATNAV
FT                   DTAQ"
FT   CDS_pept        719076..720587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="RER_06410"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="protein synonym:LysRS"
FT                   /note="protein synonym:lysine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31349"
FT                   /db_xref="GOA:C0ZPM1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM1"
FT                   /protein_id="BAH31349.1"
FT                   /translation="MSDVEAQPVDDTPEQLRIRREKRERILAQGQEAYPVSVDRTHTLA
FT                   QIRAEYPELEPDTATGVLVGVVGRVIFMRNTGKLCFATLQEGDGTQLQAMISLAGVGEE
FT                   ALAAWKSDVDLGDFVFIHGEVISSRRGELSVMADAWQIASKSLRPLPVAHKEMSEESRV
FT                   RQRYADLIVRPEARDNARKRVAVVRALRNALESRGFLEVETPMLQTLHGGAAARPFVTH
FT                   SNALDIDLYLRIAPELFLKRCVVGGIEKVFEINRNFRNEGVDSTHSPEFAMLETYEAYG
FT                   TYDDSAKMIRELVQEVAQEAFGTQVLTLADGSEYDVSGEWQVLEMYPSLSAAIGTEVTP
FT                   DTTVDELLALAEKVGLEVPKDKGYGHGKLVEELWEHQCGDQLYVPTFVRDFPVETSPLT
FT                   RDHRSKKGVTEKWDLYIRGFELATGYSELVDPVIQRERFVDQARLASAGDDEAMVLDEE
FT                   FLAAMEQGMPPTTGTGMGIDRLLMALTGLGIRETILFPIVRPSAR"
FT   CDS_pept        complement(720814..721263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31350"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM2"
FT                   /protein_id="BAH31350.1"
FT                   /translation="MGLISAGYASRLVLRQRQCRYIPCGASGDASRRGNHDRRRLETRP
FT                   LPSAIFASKNGTLASIAYSGPTNFTISGRPAIRHTATVTNIPADKECDPPSAHFDVVTT
FT                   PGHSTAEVMVVLVQSDQGLPEHSTRARSTKSSQQFESPRLRRPHG"
FT   CDS_pept        721343..721681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06430"
FT                   /product="LSR2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31351"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM3"
FT                   /protein_id="BAH31351.1"
FT                   /translation="MVKKVVVTMVDDLDKKSPADETVEFSVDGVAYEIDLTAAHAAELR
FT                   DALKRWIPHARKSNSAKSVNGAVTKSRPVADRDQSAAIREWAKGAGFEISARGRISTEV
FT                   RRAYEKAV"
FT   CDS_pept        721814..722728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lip"
FT                   /locus_tag="RER_06440"
FT                   /product="triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31352"
FT                   /db_xref="GOA:C0ZPM4"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM4"
FT                   /protein_id="BAH31352.1"
FT                   /translation="MVLAALMLVGFTSVASAQAPLPVPNAFLAGVPQELGNPGGSAPGS
FT                   NDFSCKPTAEHPNPVVLVHGTGGNRQTNWATYAPLLANEGYCVFALTYGNFPEQPWPLS
FT                   AIGGMQEIPSSAAQLSNFVDQVLGATGATSVDLVGHSQGTIINGYYAKFLGGADKVDNI
FT                   VSVASLWKGTLGNEQASIGRSLRELGVSEAAQAGFPICKACLNMGAGSEFIENLRAGGV
FT                   YAPGVHYTNITTRYDELVLPYTNGLEPGPNATNIVVQDGCEQDISDHLAIAASLRAATF
FT                   ALNALDPAHQRPVPCNSVLPVVG"
FT   CDS_pept        722734..723624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06450"
FT                   /product="putative triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31353"
FT                   /db_xref="GOA:C0ZPM5"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM5"
FT                   /protein_id="BAH31353.1"
FT                   /translation="MWRPSVGIRTCVGALALAGAVAATAAPLASANEPLPVPSGFFSGI
FT                   ALEATNPGGSAPGTNDFSCTPSAAHPDPVVLVHGTAANRQTNWGVLAPVLANDGYCVFA
FT                   LTFGNRTDQPWPISAAGGLAPLGDSAGQLSDFVDDVLSATGASKVDLIGHSQGTTVSAY
FT                   YAKFLGGDAKVSKIVSIAPLWDGSEVGPPEGVGGPDFDNATFVTELRDAGVYSDDVKYT
FT                   NIVTRFDQVVVPYSSGILAASNASNIVVQDGCEQDLSDHIALVASQRTATLTLNALDPS
FT                   NPREVPCTRVLPIFG"
FT   CDS_pept        723922..726465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="RER_06460"
FT                   /product="putative ATP-dependent Clp protease ATP-binding
FT                   subunit ClpC"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31354"
FT                   /db_xref="GOA:C0ZPM6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM6"
FT                   /protein_id="BAH31354.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKEPTETGGTRGEAGTP
FT                   STSLVLDQFGRNLTQAALEGKLDPVIGRSKEIERVMQVLSRRTKNNPVLIGEPGVGKTA
FT                   VVEGLAQAIVNGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDII
FT                   LFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRF
FT                   QPVQVGEPTVEHTIEILKGLRDRYEAHHRVSITDGALVAAATLADRYINDRFLPDKAID
FT                   LIDEAGARMRIRRMTAPPDLREFDDRIADARREKESAIDAQDFEKAANLRDKEKTLVAQ
FT                   RAEREKQWRAGDLDVIAEVDDEQIAEVLGNWTGIPVFKLTEEETTRLLRMEEELHKRII
FT                   GQEEAVKSVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELAKSLANFLFGDDDALI
FT                   QIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNT
FT                   LLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISKAVGLGFSSGTGTESNYERMKL
FT                   KVHDELKKHFRPEFLNRIDDIVVFHQLTNEQIVQMVDLMLARVEAALKNKDMAMEVTDK
FT                   AKSLLAKRGFDPVLGARPLRRTIQREIEDQMSEKILFGEIGPGHIVLVDVENWDGEGSG
FT                   EDAKFTFTPTKKPIDVPDAPPIELTKAGESESAAE"
FT   CDS_pept        726543..727022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06470"
FT                   /product="putative deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31355"
FT                   /db_xref="GOA:C0ZPM7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM7"
FT                   /protein_id="BAH31355.1"
FT                   /translation="MNDIELGHLRRCVELATEALDAGDEPFGSVLAAADGTFLAEDRNR
FT                   IAGGDNTRHPEFELARWAAQYLTPEERSTATVFTSGEHCAMCSAAHAWVGLGRIVYICS
FT                   SAQLGDWLAEWGAAPAPVKSLSVNEVAPNVPVEGPVPELVPLVRELHRKLHSQSA"
FT   CDS_pept        complement(727080..728669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06480"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31356"
FT                   /db_xref="GOA:C0ZPM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM8"
FT                   /protein_id="BAH31356.1"
FT                   /translation="MASTDAVSEAQRSRRTNWNNQIARHAQMIPDRTALRFLGDSITWS
FT                   TLDARVEKLADALARRGVSFGDRVLILMLNRPEYLEIVLATNALGAIAVPVNFRLTPPE
FT                   VAYLVNDSGSKVIVAEGPLAPLAGAARAVSEGIDISITVGAPAEGDSLNYEDLISEAGE
FT                   PHAFVDIPDDTPALIMYTSGTTGRPKGSVLSHSNLSSQALTCIRAFHLFNADSIGFCAS
FT                   PMFHIAALGSIAPSLQLGTTTVIHPVGAFDPGQLLDILEAEKVTSLFLVPVQWQAVCAV
FT                   QKAQPRALSLKNISWGAAPSSDTILRAMAETFPDAFNVAVFGQTEMSPITCVLDGEDAI
FT                   RKLGSVGRVIPTISARVVDENMDDVAPGEIGEIVYRGPTMMSEYWNNPTATADAFHGGW
FT                   FHSGDLVRVDDEGFVYVVDRKKDMIISGGENIYCAEVENVLYEHELIVEAAVVGRPDAK
FT                   WGEVPVAIVAMAPGSAVDLTIEELSSFLNDRLARYKHPKDIVVVEALPRNASGKVVKGE
FT                   LREKVRAVDAVS"
FT   CDS_pept        complement(728765..729544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06490"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31357"
FT                   /db_xref="GOA:C0ZPM9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM9"
FT                   /protein_id="BAH31357.1"
FT                   /translation="MTATAETGFRSEITDGVLRLTFDRPKRMNAIDLPTMTAFAAAVRE
FT                   GGADPRVRTIVITGSGRAFCTGADLAAAALNPADPKVVMDAATSLIRAITSAPVPVIAA
FT                   VNGPAAGVGVSIALAADLTYAASSAYFLLSFVNIGLMPDGGASALVPAAIGRARAAEMA
FT                   LLGERVSAEDAERFGLVSRTVADDAFDALVDSVVDRTSKAPRRALELTKRALNAATLDR
FT                   LDAALELENTGQAELLTGDDFKEGAMAMLQKRAPHFK"
FT   CDS_pept        complement(729541..730530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06500"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31358"
FT                   /db_xref="GOA:C0ZPN0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN0"
FT                   /protein_id="BAH31358.1"
FT                   /translation="MIRTRFTEMFGVDHPIVQGGMMWVGRAELVAATANSGALGFLTGL
FT                   TQPTPEDLVKEIARTRDLTDKPFGVNLTILPSITPPPYAEYRQAIIESGIKIVETAGSN
FT                   PIDHLPHFKDAGVKVIHKCTAVRHAVKAERLGVDAVSIDGFECAGHPGEDDIPGLILIP
FT                   AATQQLTIPVIASGGIADSRGLVAALALGADGVNMGTRFMCTVESPVAQSVKEQIVANT
FT                   ERDTKLIFRTLHNTARVAANAISAEVVDIEARGDAQFSDIQHLVAGARGRKVFEDGDLD
FT                   AGIWSAGQSQGLINDIPTVADMIDRMVSEAEHLITSRLSGFVTAVSAA"
FT   CDS_pept        730893..732092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06510"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31359"
FT                   /db_xref="GOA:C0ZPN1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN1"
FT                   /protein_id="BAH31359.1"
FT                   /translation="MSGSGSAPRTRPKNRKAQIAAAAAEAFSERGYHAVGIDEIAAKVG
FT                   ISGPALYRHFPTKYALFVYTVNNLTQALLDASDPAVHGNDDPREQLNSTMVGVIRATIE
FT                   NRRRGGLYRWEGRYLVDEDREQLREGMRTLNLRIAGPLAAVRPELDPADVELIAPAVLS
FT                   VIASITGHRSALSAKQIESLILAACWSVIGVELPVGAKDSGKKAAPERKPGLARTSKRE
FT                   VLLQEAVLLFDQRGYHDVSIEEIGAAAGINASSVYRHFASKADLLAAAFYRASDRLTMT
FT                   LGSALAESETPLAAVETLAKMYVEVSFGRSELLAVYFAEIGSLPDRSRTELRNIQRLNV
FT                   EEWAHLCVEARPELTIVQARFLVHAALGLVFDIGRIVHFSSENSAQARVEKLLTATLLG
FT                   "
FT   CDS_pept        732191..732625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="RER_06520"
FT                   /product="putative hydroperoxide peroxidase OsmC"
FT                   /EC_number="1.11.1.-"
FT                   /note="protein synonym:osmotically inducible protein C"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31360"
FT                   /db_xref="GOA:C0ZPN2"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN2"
FT                   /protein_id="BAH31360.1"
FT                   /translation="MPTRTARTAWNGTLEAGSGQVELTSSGVATFDVSFPKRAAEEAGG
FT                   TTSPEELIAAAHSSCYAMQLSALIAEAGGTPQSLDITADVSLGPDTVGFKLTGIKLTVR
FT                   AEVDGLDADGFAKVAQAAKETCPISKALTGVDITLDAALD"
FT   CDS_pept        complement(732600..733082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06530"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31361"
FT                   /db_xref="GOA:C0ZPN3"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN3"
FT                   /protein_id="BAH31361.1"
FT                   /translation="MNRPGDLLLSPWALVSVAVILVNDHVLKGAFGNTMTGKLSDVAGV
FT                   FLFPLLLLSVLEVLRRKLAGRAAIAWSIAVTGIGFAAVKTVSPIGDAYEWVIGFFRWTA
FT                   GGFRGELLPIVVFRDPSDLWVLPILFASYLVVTHNRTRAPQGAPEHEVISPVPHPT"
FT   CDS_pept        complement(733079..733651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31362"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN4"
FT                   /protein_id="BAH31362.1"
FT                   /translation="MSGPHIVDLCHTNSRKAHIMRSLRTPLALLAVGAALFATIASGET
FT                   DEAKKVDDNGSSAAPAAAFGIGDVVELGDWRVQVHGVVDPYVSTNQFITADPGNRYVVV
FT                   DTEVTNNSDKPSTVSSMMCFELQDSTNKSYNITFTDSSTSSVDGELAPGAAKRGELAYE
FT                   VPEAATGLRLQFKCDLFSSGSATINLS"
FT   CDS_pept        733784..734974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06550"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31363"
FT                   /db_xref="GOA:C0ZPN5"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN5"
FT                   /protein_id="BAH31363.1"
FT                   /translation="MRRRVWTTAAVAFSLFCSFMTVGIAGASGNMPPALVGIGFVLGVA
FT                   GGISLVWRHQHPWVVLAITLVGPLFFPTDATAALIALFAVARIARGPRLAAAAAAVFVV
FT                   CGISLTYDAFRNREYSVLTMGTAKPKDGSVVVQYDVAIWIPWLVAAVMVGIVVALSLLI
FT                   RTRTELVEAEHVRDLATEKTDVMRDEMIRTEERTRIARDMHDTIAASLSRISLFAGGLQ
FT                   VSAADNPEKVVNTAAMIRTTAHEALDELKGIVGVLRGSGDRREHGGHQGIDAIGDLVNS
FT                   ARAAGIHCRLESELLPGDVGMLAGHVCYRVVQESLTNVQKYASDQMLVISVTGSPHEGI
FT                   RILARNKLSELAPMTSIGSRSGLRGLAEQAREIGGKVEAGALGDDFLVSCWVPWSS"
FT   CDS_pept        735023..735676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06560"
FT                   /product="putative NarL family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31364"
FT                   /db_xref="GOA:C0ZPN6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN6"
FT                   /protein_id="BAH31364.1"
FT                   /translation="MDADSRITVLIVDNDAWVRRGMKDILEAAPDIVVVAEAEDGDQVA
FT                   AKVTRFRPHVVLMDLKMARVGGLEATRELMTMSNPPKVIAMTAFDVDDMVVQAVEAGAH
FT                   SFLSKDAAPQAFQQAVRVVASDHSLFSCDSLRAIVASSPRRQAPDQTPLASLTEREREV
FT                   LTILATGAANSVIAERLYLGETTVKTHISSLFAKLGVPNRVSASLIAFRCGLVT"
FT   CDS_pept        735717..736376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31365"
FT                   /db_xref="GOA:C0ZPN7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN7"
FT                   /protein_id="BAH31365.1"
FT                   /translation="MTDQIVIDQDVTIEVWSDVACPWCYIGKTRFLSALDRFENKDRVN
FT                   VIWRSYQLAPETPVGEGRTELDALVEMKGMAPDQVRQMFAHVSATAAEVGLTLDFETVI
FT                   AANTFDAHRLLHLAGERQNELLEALFKAHFSDGLVIDDREVLVELAVSVGLDADVVREQ
FT                   LGSDAAAEAVREDLSMARQLQVSGVPFFVANRAVAVSGAQPEEVFLQLLTQASEPA"
FT   CDS_pept        complement(736355..737695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31366"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN8"
FT                   /protein_id="BAH31366.1"
FT                   /translation="MSSLKAASSLKAVSSLKKRLPEPAMPPGEDPRDYARTLAAVYDAT
FT                   MAGDRAPARPRDVVRQSWQRLRELGIDPEHSRVEPSMDVAELDLRRRESGLYDVLDDVT
FT                   RGLESITASGENIMVVADLRGTVLWRSGSHRVLDQAARLGFVEGANWAEDSVGTNAIGT
FT                   ALVSRQAVQIFSAEHYARSHHPWTCAGAPIRDPRDDRVIGVVDISGPAKTVHPTTLALV
FT                   DAVARLAQSHLRDKHRDNLDQLRSVAGPMLARSGSPALVIDTHGWVAAVDALPHRSRVL
FT                   LPAALAPGRAWFPALGLCELDPLPGGWLVRPITTGERISAPTVHIDLRDSENMSVTVTS
FT                   GFGEWAYAPTQRHAEILFLLGSERRGLTASRLAQDLFGDPARTVTARAEMSRLRKNLAG
FT                   VVAAQPYRFVDAAHVTLSCPVNGAHLLPFSNAPAVRAARLSQAGSEA"
FT   CDS_pept        complement(737701..738480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06590"
FT                   /product="acetoin(diacetyl) reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="protein synonym:2,3-butanediol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31367"
FT                   /db_xref="GOA:C0ZPN9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN9"
FT                   /protein_id="BAH31367.1"
FT                   /translation="MSITGKVVLVTGAGQGIGRGIALRLAHDGADIALVDLDQTKLDAV
FT                   ADEIRQIGRRATTFIADVSDRAQVHAAVEHAHSELSGFDVIVNNAGIALVGPISDATPE
FT                   EVSKIWSVNVDGVLWGIQAAAAKFQALGQRGKIINASSIAGHDGFAMLGVYSATKFAVR
FT                   ALTQAAAKEYASDGITVNAYCPGVVGTDMWVTIDKRFAELTGAPEGATYEKFVGGIALG
FT                   RAETPDDVAGFVSYLAGPDSDYMTGQAGLIDGGLVYR"
FT   CDS_pept        738700..739845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06600"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31368"
FT                   /db_xref="GOA:C0ZPP0"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP0"
FT                   /protein_id="BAH31368.1"
FT                   /translation="MTATVDTPTEPATPSRQPSRRWIGFGIANLVIVLVLAVASWYLLA
FT                   DPTTSPWSFYPLPFNAALFWAILFVVFIGFNCEFAGFDRLPQPAKGLAIMVATAVFAVV
FT                   VTWLLANGLGSLYPDFAADREGGLGYFAGALFVLFGFGTWVMVVLNWQHWPWTSLGMKQ
FT                   PLVGLCEIAFVAVPTLALYFVFGLPSVSLSATDPLMTVDTVLGWFYCVVVVVILTGQTL
FT                   DNWPWRLFGGGGKTALAATIGNFAVGTGLYFVALPVVKALVGSDAVAELGGVVHQFPAQ
FT                   LGVCWAFWMIFWANAFGNKPTGFSDGVNLAIRALFTFALAVVTFLFYYRFAAEHILHEP
FT                   AVVDGLHGNALGFVDWAVLWTLFYVVGFQSLGLGKFKPAEG"
FT   CDS_pept        740022..741821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06610"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31369"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP1"
FT                   /protein_id="BAH31369.1"
FT                   /translation="MKLTAVTPQERVDAWLADFESALAARDIERVAGKFALDSFWRDLV
FT                   SFTWNIKTVEGREQIADMLSERLDDTDPSGFRTTEIPDEADGVTSAWIEFETATGRAHG
FT                   HLRLKGDEGWTLLTSLQELKGHEEGKGTRRPRGAKHGADPNRITWAEQKEIEDRELGYT
FT                   TQPYVVIVGGGQGGIALGARMRQLGVPAIVIDSHERPGDQWRGRYKSLCLHDPVWYDHL
FT                   PYMPFPDNWPVFAPKDKIGDWLEMYTKVMEVPYWSSTTCTSASFDEKTQEWTVEVNRNG
FT                   EKLTLRPKQLVMATGMSGKANVPTFPGQDKFLGDQHHSSKHPGPDQYVGKKVVVIGANN
FT                   SSHDICGALWENGIDVTMVQRSSTHIVKSDSLMDLGLGDLYSERALAAGMTTHKADLTF
FT                   GSLPYRIMHEFQIPVYDAIRERDKDFYDRLEKAGFEHDWGDDGSGLFMKYLRRGSGYYI
FT                   DVGAAELVANGDIKLAHGNIRELTENSVILEDGTELPADVVVYATGYGSMNGWVADLIG
FT                   QDTADKVGKVWGLGSNTTKDPGPWEGEQRNMWKPTQQEALWFHGGNLHQSRHYSLYLAL
FT                   QLKARYEGIPTPVYGLQEVHHLS"
FT   CDS_pept        complement(741881..742657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06620"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31370"
FT                   /db_xref="GOA:C0ZPP2"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP2"
FT                   /protein_id="BAH31370.1"
FT                   /translation="MPLVDNFTKLLIRGLLAGLIAGILAGGVAFVLGEPHVNAAIAIEE
FT                   ANSATGEVAGEAAGHSHGDEEEPLVSRDGQRAGLFLATALAGLALGAIFSVVANYARRL
FT                   TGMSGPLLAITIAVGGWLAIEAVPFFKYPANPPAVGDPDTINQRTLLWLAAVILGLLSV
FT                   TAAAAAAKAVSGHEFLSVRIAAPVAAFLVIATIGYVSLPGINEVGEDFPATLLWEFRLS
FT                   SLATQATLWLVLGLAFAFLTERATKNTEVAKKYALR"
FT   CDS_pept        complement(742648..742842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31371"
FT                   /db_xref="GOA:C0ZPP3"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP3"
FT                   /protein_id="BAH31371.1"
FT                   /translation="MALAYSPDTSIDSTRLAFLAAAVVLFAMLALYLVGFDQGAISRTG
FT                   MYMHELMHDGRHLMGLPCH"
FT   CDS_pept        complement(743094..743402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31372"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP4"
FT                   /protein_id="BAH31372.1"
FT                   /translation="MAVVKINAIEVPEGAGPELEKRFAARAHAVENSPGFLGFQLLRPT
FT                   AGESRYFVVTQWESEQAFADWRDGPAREAHSGERAKPVASGASLLEFEVVLDVAAKS"
FT   CDS_pept        743439..744185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06650"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31373"
FT                   /db_xref="GOA:C0ZPP5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP5"
FT                   /protein_id="BAH31373.1"
FT                   /translation="MTLVLHDEGGTGQPILLLHGLMGSSRTWRRQVPWIREFGHVYTFD
FT                   AAGHGRPAPSELTTEAFVDDLASAVASIEEPMIVIGHSMGALHAWCFAASHPEKVCALV
FT                   LEDMAPDFRGRTAADWAQMISAWPQPFASEDAMKEFFGPVAGQYFLDSFDRRDDGWYLH
FT                   GEVSTFRDISEEWGTRHFWDQWKAIDVPTLLIEGEFTITPEGQMREMAERPGTRYVRIA
FT                   DAGHLVHDDQPQRYREVVTEFLQTVS"
FT   CDS_pept        complement(744170..744595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06660"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31374"
FT                   /db_xref="GOA:C0ZPP6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP6"
FT                   /protein_id="BAH31374.1"
FT                   /translation="MSTDTCVFCKIVALTEPAILVHESETTLAFLDARPVSRGHTLVVP
FT                   KRHAENLDALESHEGAEMFRVGTLIAGALRRCDIAADGVNFLVNDGRAAGQTVFHSHLH
FT                   VVPRHRGDKAKFAAGLLARRAVELEQVGASIRSQLTV"
FT   CDS_pept        complement(744634..747252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06670"
FT                   /product="putative LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31375"
FT                   /db_xref="GOA:C0ZPP7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP7"
FT                   /protein_id="BAH31375.1"
FT                   /translation="MFGRDGHDWAAIPERRTLTESIPRQALFAKLDRRAALTIVRAPNG
FT                   HGKSSLIASWLRAHLASERILVWVSAPQPSSTLEDFWAVVLDRIHAAGIALPDVDDLAD
FT                   PFTAAAKSLNALSRPVLLVLIRPDLISEPELDDQLIDLLTLCHNLDLVVTLSGFGMFAE
FT                   PYLLDTDHEVIGADELLFTTSDTAQLLEQAGVRTAEGDAEQITSLTGGLPALVRAAVAA
FT                   VRDSRNSNREREIKTNTAQAIDDYVTDSVLATAERLKQHEFLLATAFGRSITVGVATML
FT                   FESQRTDTAETVHEIRARLVTLETAGLLSRVEAEADETWELPPAIRRSILAHHTRVGID
FT                   PSQRLSFLAHNRLDNGHHASALDYAVEAQNWTLAVDIVEQHWVTMIVHNLDSVRSALQR
FT                   IPAEAADKHSAVEAGRALFTMHPSKRSTVIDLLPESPAELWELGAQPSAKDALSIACVQ
FT                   SIMLRMAGEYGLSAETTRRLSHLSRSALENNPEAVSAQLPLMRLQWAINFQLSGRFTES
FT                   TIKARMAYHGALSHGVDFIARNSAGSAALNWALAGEPRQARHWFELEQKHPDPGGWLEP
FT                   VVKIAGLTARALAALDTLDFGDARIALTELGVPSDTEELWAFVVYAHSQFALTQSSASS
FT                   ALSLLHNAIGVHSKQYTATSFALPLLQSAEIDLLLALGEGNKATALAKEIADPAANPWT
FT                   LASVARLRQRIGQNEAAVALCHQFDWSGESYPRAQMESLLVQAVAHSELGEPRLASQEW
FT                   SRACSIADQTGLLRPFATIGSADVEKLESMAVTKSRALAEFSKSAPAESFPGSVRIVEL
FT                   TEREQKVLSLLALGMGSAAMADKLYVSVNTVKTQLRTLYKKLDAHNRNEAITKARQLRL
FT                   L"
FT   CDS_pept        747504..748451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31376"
FT                   /db_xref="GOA:C0ZPP8"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP8"
FT                   /protein_id="BAH31376.1"
FT                   /translation="MPDRAPRVCHRRSVVRTRLSVVWSKAVTVRLRPRACARRVRGVVV
FT                   VTGVLLVGAAALGALPMQSDVRLAAEGESASPFTVELTAIDGAPPFDPGDGPGLDTGPS
FT                   NGIVREGDPVTYVVDIGVRGNPLSDVVVQLPVPRGFVLPSVPDYCGDGSGVDEFGLHCL
FT                   IGNLEADRYFTRTATMTAGKREDADGLSIAALVTADRGAARVRSDDVTVRVATTPGVCD
FT                   PQGNSVGGRRDQGTAVSADGRISGLVTSGISEAVVVNGVDQCGHAIARTVKPFEGRFSF
FT                   VGLLPGTYRVTVDGRAPVDVVLEPGAMAVGGLTF"
FT   CDS_pept        748510..749544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31377"
FT                   /db_xref="GOA:C0ZPP9"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP9"
FT                   /protein_id="BAH31377.1"
FT                   /translation="MEDPVRESLGVVFENNSISTALVDADTPLLGSIDEFRHPWGANGT
FT                   VPSAQASARALASAAEVATGRALRSNLCPTVVGVMCERADVRELVPGSLSSSTFENIEL
FT                   VNGLDARIAYLRTVDALNGISPILAFWPDGGETVIAAIDPSAGVVDSAHRYATAELLTD
FT                   SSTFAATLDLLVAERDPVPKMLVAMLVKEESRQLSAEAAESAGLGFLYLGERAQLAIGA
FT                   ALVAAGRGSEVRSAGGAAVQPVNRIRWAAAIVLPLLLMLTGLLIALSPDGSRAVSTDRP
FT                   NVGAEPANPTSGPPSGAALPILTLPPCDPVVPVVPAAFRRSDPDVTPPQTVEPAEACDP
FT                   MRVG"
FT   CDS_pept        complement(749541..750434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="RER_06700"
FT                   /product="putative adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31378"
FT                   /db_xref="GOA:C0ZPQ0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ0"
FT                   /protein_id="BAH31378.1"
FT                   /translation="MSVAVAVESSVLLKWYSETARDLPWRREGVSAWQILMSEIMLQQT
FT                   PVVRVAPIWEEWVERWPVPSAMAASSQAEVLRAWGKLGYPRRALRLHECAGVLAAEHGD
FT                   VVPEDVDTLLSLPGIGSYTARAVACFAYGQRVPVVDTNVRRVVARAVHGNAEPGNPSNT
FT                   RDLADVAALLPRTRARAATYSAALMELGALICTARTPNCENCPLPNCAWVASGKPAHTG
FT                   PPKKVQKFAGTDRQVRGKLMAVLRDSHRPVERAQLDIVWPTDPGQRDRALHSLLVDGLV
FT                   EQTDDGLFALAGEGTP"
FT   CDS_pept        complement(750539..751093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31379"
FT                   /db_xref="GOA:C0ZPQ1"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ1"
FT                   /protein_id="BAH31379.1"
FT                   /translation="MTETPQSQTPDSPTPESPTPTIVEKPKRLRKQTLLIVAGVLVVVA
FT                   ALGWGAFATWQKSADEDARTSALDSGRQFATDLATYNFQNLDQNLSVVRDNSVGEFAGQ
FT                   YAQVAANLQNMIVQYQATSSAQIISAGLASSDRDNAEVLVFLDQTITNTNSPDPRIDRN
FT                   RMQLSLVREDGEWKLSNVQLL"
FT   CDS_pept        complement(751090..752328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1F"
FT                   /locus_tag="RER_06720"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31380"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ2"
FT                   /protein_id="BAH31380.1"
FT                   /translation="MKNRTVYFEIVAFLLIAVVSTTYVLRQVGAGDPFTGTFSVTVELE
FT                   NAAGIAPGSEVAYRGVTVGDVESVEVDSAQDLVVMTLSIAADKQIPNDSHVAISQDTAV
FT                   PVLKVQLSSQTDGGPYLVEGSVVPTERTSIPVALGTVIANFNAAADTVDPADLRTLSHE
FT                   LGEGLNGLGPDLQALVDNFDVLARTVQADQPRVNTLVENSRSLFTANEENVDALPEVAL
FT                   TLRQLTDQVRNSDPQLRTLLDRSPSVLDNQILPLIEQSREPFSLLLANSLVSTQIVTAR
FT                   MPAVDALLVVVPKGFEKFGSIVKDGRAQLDLITALGPVCIYDTPRRSVQDTSPTTLDKN
FT                   QHCADQSGRIQNRGSQNVPTGTGTIDGVAEYDPALGTVAAGDGTSIRLGLNGGQYTVLG
FT                   DNSFAALLVQGTQ"
FT   CDS_pept        complement(752325..753398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1E"
FT                   /locus_tag="RER_06730"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31381"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ3"
FT                   /protein_id="BAH31381.1"
FT                   /translation="MASNKSVVSVVVALVIAAPLTGCSLNFQHLPLGRGLPGESYPLNM
FT                   EFVDASLLPVGGEVRIGQAVVGRVTSMSAETFAAVVHTEIESDIELPVGTRARIELSTP
FT                   IGDAFVNLEVPVDPTGPRLEPGSTIARSETVRGPDVAQLLGAVGTLLNGSGLAQVKNIV
FT                   SEADQILDGREETIRDLLARLDTFLGTLDDRKESINSALNSLNRLSALIGDESATIDEG
FT                   LRTLTPALGVIADQRQPLLDLLDETDRLSTATNSVLDQSADQISEITGRLSPILDQFSA
FT                   MGPTLSETMSNLDNARVLLERASPGDYVNIDLDVDVEGTVTGVLNEIIPGAAPPLPPLP
FT                   ASDRELPITTPLQGGTR"
FT   CDS_pept        complement(753398..754477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1D"
FT                   /locus_tag="RER_06740"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31382"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ4"
FT                   /protein_id="BAH31382.1"
FT                   /translation="MTTTVKKLAVLAAIMICAIGAVLFVTRDEHQLTLTAEFTSTDAIF
FT                   TGNTVTILGVPSGRVESVTPEGSRVRVAMSLPSGTRIPADAQAWVLSPSVISDRTIELG
FT                   PGYEDGEFLADGAVIPLERTHSPLTWDQLTASVNELTVALGPGADGGGIGDLIGEGAHA
FT                   LDGNGQAFNDAVRSISQASSVLAGASPDISELVKNLNTLVQLIADNQTKVDSLSNSVTV
FT                   TARAFSTQREDISGALDSLTTLLGQVSALLAEHGEAVTADLGVLAQLAGAVATKQDQLR
FT                   EIIETAPTGFENVANLVTEEGRARARLNVATDLSQFDTTRELCEKMPIPLCTGPGIVNP
FT                   IEFPSAGSSDLARILGGGN"
FT   CDS_pept        complement(754474..755466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1C"
FT                   /locus_tag="RER_06750"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31383"
FT                   /db_xref="GOA:C0ZPQ5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ5"
FT                   /protein_id="BAH31383.1"
FT                   /translation="MNWLTVKNPVRNGMICILVGVCVVLAALVVPQLILKVKTNEYNAV
FT                   FANATGLTQDDPVNVAGVPSGVVTSLAVSGNSVEVTFRLDDGVTLGENSRADIKISTLL
FT                   GRRSLDITPNGSRSLPGGSTIPIENTSVPFTLDDLGRGAQSTSENLDLQQLRNMLTVVS
FT                   DNSPDDPELIRRSLEGIDALSGVVNDNDVALRSLLTGAQQTTATLIEQKDTLETLLGNA
FT                   DLVMATIADRRDVLNALVQDLNQLSTTLAQFLGDNQALVDSVMGDIHEVTGVLSENEQS
FT                   LTTLLDNFAPSVRYVTNATGNGNWLDLNSPSTLIPDNWLCVVGLVQGCR"
FT   CDS_pept        complement(755463..756473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1B"
FT                   /locus_tag="RER_06760"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31384"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ6"
FT                   /protein_id="BAH31384.1"
FT                   /translation="MSVKKSLIRFGLFAALSILATVVVVSTLINPVSGSSSQYRAVFVN
FT                   ASGLVTGSDVQIAGVRVGRVDSVELVNNQAVVGFELESTQRIPTDGRAVVRYADLLGAR
FT                   TISIEPGQGELVAGNYLSPGATIPVEQTQPAIDLTDILGGFRPLFDALDPAEVNELAAQ
FT                   VVQVFQGQGSTIESLLERTVAVTENLTSRDAILDQLLTNLDRVLTVTTTNRPNFVEMIN
FT                   TLDTLVGGLAQDRQQISAAVDSAGALTSSLQDLVTRVEPDLAGALTSIDQSASVVVDNR
FT                   ESLATGITAFDQLFTQLGIAMSYGSWANIYICNFRLSALDQSVTLGGPERSAVCR"
FT   CDS_pept        complement(756470..757654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1A"
FT                   /locus_tag="RER_06770"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31385"
FT                   /db_xref="GOA:C0ZPQ7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ7"
FT                   /protein_id="BAH31385.1"
FT                   /translation="MIVTGTSRIALALRGLLAIVLLIVAYVFLFSRGTDTFSSTPQVSA
FT                   VVPASAGALRVGSSVQYRGVVVGSVADIEPGTTASTISLAIDEGAFEDIPSTSQVRLMP
FT                   RNIFGDFFVDLIQPDGLSRGPALAPGTELASDQSEVAVQLYQSISRIYSLVSSLDPADI
FT                   NVALTAVSDAMSGKGNQIGESLDSVHQALVGAQPVIDGLGDDLDDIATLADSLSTSAPD
FT                   MLAAFENSITTSKTVVEKSDGLAGLLRAGTSTGSAATSLIGDNRDRLITLVDDADSLTG
FT                   AITSRPDHITTFYNGLRNLTIKLPPALAHGPWLSTDLRLSVTDLYPYGKTDCPQYDGTR
FT                   GPNCPAAATAFGGTVGPVGSPAEQSLISAITQGGTALDTLVAGPVFRGTTVVGG"
FT   CDS_pept        complement(757651..758496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1B"
FT                   /locus_tag="RER_06780"
FT                   /product="putative YrbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31386"
FT                   /db_xref="GOA:C0ZPQ8"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ8"
FT                   /protein_id="BAH31386.1"
FT                   /translation="MHLPIAIRAKRASSRTVDGLSRLGDQFTFHARVITSIPATLKRYW
FT                   REVARLVAQVAFGSGTLLAGGGSVVVIFAISFFAGSQIGLEGYRGLNLVGLAPLSGVMS
FT                   AIANTREVAPLVAAITLAAKVGTGFTAQLGAMRISEEIDALEVMAIPSLRYLVTTRMIA
FT                   ALIAVVPLYLVGLFASYMATALAVIRVKGQSEGTYGYYFSLFLSPNDIWLSLIKVMVFA
FT                   VVVTLVHCYYGYTATGGPEGVGRAAGRALRTSIVFLAFTDVAMTIALWGLKPQVPGLTG
FT                   "
FT   CDS_pept        complement(758496..759275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1A"
FT                   /locus_tag="RER_06790"
FT                   /product="putative YrbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31387"
FT                   /db_xref="GOA:C0ZPQ9"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ9"
FT                   /protein_id="BAH31387.1"
FT                   /translation="MFSNLLSEIGLLFTFTVRVCVAAFTTLRHKRLAWREALDQMWFLA
FT                   HVTSVASALVMIPLGVGVALQIGSLADQIGAGSYSGAVVAFLIIGQAGPLVCALIIAGV
FT                   GGSAICADLGARTIREEIDALEVLGLPVLERLVVPRMIAIAVVCLLLNSIVLVIGLGAS
FT                   LFVHVLILDGNAQSFLRNLVQFSQPSDFVVSGIKAVAFALISGIVACYKGLTVKRGAQG
FT                   VGDAVNETVVLSFVLVFVANLAITQFYPLFVSVKGAY"
FT   CDS_pept        759563..760201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06800"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31388"
FT                   /db_xref="GOA:C0ZPR0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR0"
FT                   /protein_id="BAH31388.1"
FT                   /translation="MPRSSPISAWKSLREGNERFVNDASIHPSQGIADRAKLVDGQHPT
FT                   AVLFGCGDSRVAAEIIFDQGLGDMFVVRTAGHVLDDSVLGSIEYAVHVLNVPLIVVLGH
FT                   DGCGAVKATLDALDKGAVPDGFIRSVVERVAPSILMGRNEGLSTVDELEGRHVVETGSL
FT                   IMQRSRIIADKVDNGACAIVGVTYTLSDGHMRVQGAVGDIGESVETVEG"
FT   CDS_pept        760299..761042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31389"
FT                   /db_xref="GOA:C0ZPR1"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR1"
FT                   /protein_id="BAH31389.1"
FT                   /translation="MLEPNGPLPPEIYWRRRALAIGAAVIALALIIWAASALFGGGSDT
FT                   PEANSAAASSSLTTDVSFTPNPSGSNAPDGNGGSGGGAAGGSGGSGTQASGSSTSASSS
FT                   STTGAPVPAGQCADSSLAVKATADKATFAPGEEPSFTIVITNIGSAPCDRDLAGGLQQV
FT                   LVYSIDGKTRLWSNVDCYPQPAADVRNLAPGEQAAFKVAWSATTSTPECATAQNPERNP
FT                   VGAGAYTVVGQLGALRSSPEPFNIA"
FT   CDS_pept        complement(761068..762165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31390"
FT                   /db_xref="GOA:C0ZPR2"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR2"
FT                   /protein_id="BAH31390.1"
FT                   /translation="MISAMADTQSSSALRETIARLAPGTALRDGLERILRGRTGALIVL
FT                   GYDEEMEALCDGGFNLDVEFAPTRLRELSKMDGAVVLSTDGTRIVRANVQLVPDHKIPT
FT                   VESGTRHRAAERTAIQTGYPVVSVSQSMSIVSVYVGGIRHVIDGSATILSRANQAVATL
FT                   ERYKARLDEVTRQLSVVEIEDFVTLRDALTVVQRLEMVRRVSIEIEQDVLELGTDGRQL
FT                   ALQLEELVGDNDIARQLIVRDYLAGPEPIGTAAMDNVLVALDRVTDADLLDLTTLARVL
FT                   GYPGTIEALDTPMTPRGYRVLMRVPRLQFHQIHRLVGSFGTLQSLLAATAADLQSVEGI
FT                   GGLWARHIREGLSRLAETSITGSFN"
FT   CDS_pept        762250..762810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31391"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR3"
FT                   /protein_id="BAH31391.1"
FT                   /translation="MSSTWTLPDDLTVPEPVEFFPAAGEKLPQHWSKCFGCGDDQPAGM
FT                   AMSFRAGDGLEVTGRLEVAKKYQGGPGVIHGGILSTAFDEAQGMACMALGSPVVTGHLE
FT                   IDFARPIPLGSVLEFRARIDGVVRRKVYTSAEAVIVEGPTADPDTVVGTSRGLFLTITS
FT                   EHFAKTKEFVDGEPTSPFGTSSV"
FT   CDS_pept        complement(762834..764267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="RER_06840"
FT                   /product="putative DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31392"
FT                   /db_xref="GOA:C0ZPR4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR4"
FT                   /protein_id="BAH31392.1"
FT                   /translation="MAKVKSNYRCSECQSVVPKWVGRCPDCDSWGSMTEVAVVAPVASR
FT                   AGASLAKAGSSAVLPTTPATPLTQIDSTSTQAKPTGIGELDRVLGGGVVPGSVVLLAGE
FT                   PGVGKSTLLLEVVYRWAMRSADDRALYVTGEESAGQVRLRADRTNSVHERMYLAAESDL
FT                   ATILGHIEQVKPTLVIVDSVQTMLAADVDGVVGGVTQVKAVTSALTSLAKASGIPVLLI
FT                   GHVTKDGAVAGPRSLEHLVDVVLHFEGDKHSTLRMVRGVKNRFGAADEVGCFELSEQGI
FT                   NEISDPSGLFLHHREEAVEGTAVTVMMDGKRPLLGEVQALVAATPLPTPRRAVSGLDTA
FT                   RVAMVLAVLERRVGVSISKADVYAATVGGMRMTEPGADLALAIAVASAVKAKPVPKGLV
FT                   ILGEVGLAGEVRRVAGVNRRLIEAARLGFTSAIVPVDSGPNIPGMRVNEVANLAEALAY
FT                   AGLMGGKQAPSRPKLTPVK"
FT   CDS_pept        complement(764365..765000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31393"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR5"
FT                   /protein_id="BAH31393.1"
FT                   /translation="MTAIRKPTRRVATAIALAAGAAIALSACGSGQVSQTAVQQAAVNG
FT                   NSADLGEIALRNVHIAYPSSEEYSIEPGGNAVLAFTVVNDSAETTDKLVSITTDYAARV
FT                   IAGEEVGGLTIKPQTSLQAGQLPAGEGAATEAETQIKNNEENDDAPAALTLVVLQDIKA
FT                   GVRPGLTVPITFKFEKAGSVTVDVPVDAGPQLERNESDKSPDVAEAGH"
FT   CDS_pept        765266..765754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31394"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR6"
FT                   /protein_id="BAH31394.1"
FT                   /translation="MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLT
FT                   VRVPADNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRREQDRGLSAGEKRMLAKARQILVGELALAEGTDTEKAETILDEVLAAAS"
FT   CDS_pept        765777..766475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="RER_06870"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="protein synonym:4-diphosphocytidyl-2C-methyl-D-
FT                   erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31395"
FT                   /db_xref="GOA:C0ZPR7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZPR7"
FT                   /protein_id="BAH31395.1"
FT                   /translation="MAVVALVPAAGRGVRLGEKLPKAFVELGGCTMLARAVDGLRKSGA
FT                   IDRVVVIVPPELVESVVADLGRASDVDVVGGGAERTDSVRAGLSAAGDADFVLVHDAAR
FT                   ALTPPALIARVVDALRAGSSAVIPVLPVTDTIKSVDVLGAVTGTPLRSELRAVQTPQGF
FT                   STDVLRSAYDAGDVAATDDAALVERLGVSVQTIPGDALAFKITTPLDLVLARALLISET
FT                   ELSADSQDGK"
FT   CDS_pept        766476..766952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="RER_06880"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31396"
FT                   /db_xref="GOA:C0ZPR8"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZPR8"
FT                   /protein_id="BAH31396.1"
FT                   /translation="MRVGLGTDVHPIEVGRPCWMAGLLFEEADGCSGHSDGDVAVHALC
FT                   DALLSAAGLGDLGSVFGTGRPEWDGVSGARMLAEVRRLLEENQFTVGNAAVQVIGNRPK
FT                   IGPRRGEAQKVLSDILGAPVSVSATTTDGLGLTGRGEGIAAMATALVMTTEHDR"
FT   CDS_pept        766964..768358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="RER_06890"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="protein synonym:CysRS"
FT                   /note="protein synonym:cysteine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31397"
FT                   /db_xref="GOA:C0ZPR9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR9"
FT                   /protein_id="BAH31397.1"
FT                   /translation="MTLRLYDTGTRALRDFVPLAPGHASVYLCGATVQGDPHIGHVRSG
FT                   VAFDVLRRWLLAHGNDVAFVRNVTDIDDKILNKAAGAGRPWWEWAATFERSFTWAYDQL
FT                   GVLPPSIEPRATGHVTQMVEMMERLIENGHAYAAGGDVYFDVQSYPEYGALSGHKLDDV
FT                   HQGESAAEGKRDPRDFTLWKAVKPGEPSWPTPWGPGRPGWHLECSAMAEFYLGAAFDIH
FT                   CGGRDLVFPHHENEIAQAKCAGDDFAQYWLHNGWVTMSGEKMSKSLGNVLSVPNVLKKV
FT                   RPQELRYYLGSAHYRSNLEYSDEALDESAKSYQGLESFVLRTHKRAGGVELGTWTEGFA
FT                   AALDNDLSVPIALAEIHGKASEGNSALAAGDLDAARVAAGQVRAMLAILGVDPLDEHWT
FT                   QSGGDTETAMEALDVLVRADLDRRQQARTEKNWAVADEVRDRLIKAGIEVTDTPDGPEW
FT                   SLKAGQ"
FT   CDS_pept        768361..769338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06900"
FT                   /product="putative RNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31398"
FT                   /db_xref="GOA:C0ZPS0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS0"
FT                   /protein_id="BAH31398.1"
FT                   /translation="MAGNSSRRGAVRKGGTKKGQVAGSGGQHKRGLAGRGATPPAEART
FT                   KHPAAKRAARAARADEKQNQGRGGRPGPGRKVLDGPETVLGRNPVVECLRAGVPATALW
FT                   VAVGTESDDRLKESVQRAADAGISILEVPRSDLDRLSANGLHQGIALQVPPYRYAHPDD
FT                   LLSEARKHAEPPLLVALDNITDPRNLGAVVRSVAAFGGHGVVIPERRSASVSAVAWRTS
FT                   AGAAARLPIARATNLTRTLKDWASKGVQVVGLDAEGDTTLDDFDGSGPVVIVVGSEGKG
FT                   LSRLVRENCDAILSIPMAGPVESLNASVAAGVVLADIARRRRSS"
FT   CDS_pept        complement(769373..771154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06910"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31399"
FT                   /db_xref="GOA:C0ZPS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS1"
FT                   /protein_id="BAH31399.1"
FT                   /translation="MTDTLPDASAVPATSALPIASTTQTVRALIALLRPRGRALALTTV
FT                   VLLSATACGLSTPALLGLMVDAVTEGKPFVSLLRITAFMLGAAAAGVALTWWSTQLLAN
FT                   VAQNVLADLREDVFAATLAQPSSLVEDAGTGDLISRVSGDVEAVNTVIARVLPATVSAL
FT                   FMISLTLVGVGVIDWRFTVAIVAVAPIHYFALRHFLRRSGPVYRRSRAAQARRGQQLIE
FT                   TLGGAGTVTALRRTDEHIGRIAETSEHAISFDMQAVRLRTNFFAQLNGAELLGLAAVLS
FT                   VGYWLVTTGSVSIGAATAAALYFHSLFSPIAVFLSNIDELQDAGASLARLIGVTAMPGR
FT                   PASIPASARSAPIGVDVERVSYSYDNSTPVIDSISISIAPGERIAVVGSSGAGKTTLAK
FT                   LIAGIIPVGDGRITVDGTPIDDLSDAELRHKVVLVSQEVHVFVGTIADDLRLCAPDSDD
FT                   AKIAEAVETMKAQWIHELPDGLETRVGAGGYQLTAAQAQHIALVRLALLDPPVIILDEA
FT                   TAEAGTTAAGLLDQAAELAVTGRTAVVIAHRLSQAVRADRILVMSGGRVVESGTHDELI
FT                   GADGSYAALWEAWSVRS"
FT   CDS_pept        complement(771151..772779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06920"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31400"
FT                   /db_xref="GOA:C0ZPS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS2"
FT                   /protein_id="BAH31400.1"
FT                   /translation="MSALPETRSGPMEMIRVGSFSSGRGPRLVAAVTGQASYQVAQALI
FT                   PVLIGTVVDRAIGKSDSTALLVWLAVLCALFVGLALSWRIAVRLNTQVFVYGEHDLRLN
FT                   AARRVLDARGMQAQRSTGEVLTISTSDASHVSGFSWVVAEQGSAFAGLAAAVISLAFVS
FT                   WPLALIVVLITAAQLVFIHKISGPLDERVYAEQKKAAEAGMLATDFTLGLRVLKGFGAE
FT                   PTALSRYVKASRASMKAAIRTVRAMSSLTALNSGVSALVLASVALGAAWMAHQGTITVG
FT                   NFVTVVGLSRVIAGPMETLGFFGAELAAKRGSARRLSELLAEPHLIESPPSTAPISAVR
FT                   SEDALLISTDNGTVVSARRGEVVGVRADDSAHRLARQLAFQTPLDPDCYFVFGTDATEL
FT                   GPDGVRDQVFVSAHEGTVFTGTVFDNLAAPNIDSSAMTSSALDDVLTHLPDGHLSEVGE
FT                   QGKKLSGGQRQRLLLARALHQPQPILVLHEPTTSVDSVTEHRIAHSLRNFPDKAIVVIT
FT                   SSPTLLHSCDRVVTIDHAARDGDSL"
FT   CDS_pept        772979..773968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06930"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31401"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS3"
FT                   /protein_id="BAH31401.1"
FT                   /translation="MKSTTRIVAALAAIALLAGCQSSTESTASEDTTQLAEAGALPATI
FT                   AHAYGSTTIETEPQRIVTIGWNSQDSVLALGKTPVAMESFSGAGLENGILPWDEELLGD
FT                   VEPTLLDSTSGVPFEQILALEPDVIIAVVSGITEDDYARLSQIAPTIPFKETAWATTWQ
FT                   EQMSTIGSVLGQPKRAAELIEETDDSIADLAAGSPNLNGKTLTFLSGNIDGLTNYCADD
FT                   GRVILMSQLGLKQSAGSAELCGDTQGSVTASREQYNELDADVIVLNDASGQGLPGLMGD
FT                   KLFADLPAVKDGRLIQQLGLARVMALASPTSLSVKYAFAELVSKMNGF"
FT   CDS_pept        complement(773973..774770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06940"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31402"
FT                   /db_xref="GOA:C0ZPS4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS4"
FT                   /protein_id="BAH31402.1"
FT                   /translation="MSSTGFPYWAVPAGRYVPLPFAMTTSTIGRDQKRAWREIRHPEHE
FT                   LLWGASGEMSAYIDDVRWQIPPTVGMWIPAGTPRRITLGASTEARFTYFRPESFPHPWT
FT                   KPAIIGIDDVVKTMLIHLHQRNMPTEARLRAESVVFDTLAPIEAADVAVPMPADPRALA
FT                   VARRLIADPADQRGLADWAYVVGGSPRTLSRVFSQGTGMSFTEWRIQVRVRAAMSYLAA
FT                   GVPVSTVSRRVGYETPSAFTSVFRKVTGRTPKNYYSDACELSA"
FT   CDS_pept        complement(774943..775665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31403"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS5"
FT                   /protein_id="BAH31403.1"
FT                   /translation="MSRFSMRKTLTGVAIAALATSGLLIGTGAAHADAAHPKTNTVTSN
FT                   QVTITKSVVGDGEVAPGGRLTVRTTVSANGHPDFFVNKFVDRFPAGYTYIKDSASIDSW
FT                   HFLGLTQKTEKVSPTVDNAARTVTIPDAGWNVSITGSKTVTFEVSYLVPDNAQPGTYVE
FT                   LPSSIGISLWGSDQNIGDVYAKIRAKNPGEAAASGSADLGFGSSDGEGGTGSAGSSILD
FT                   NPAGFISDIISGVLANGS"
FT   CDS_pept        775975..776682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31404"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS6"
FT                   /protein_id="BAH31404.1"
FT                   /translation="MAKFGSRNRSLSTVGAGLGVIALAVGASALGAGVATAEIATSGAY
FT                   TFTRTVDNASPKVGDTITYTTVSKKSGIDGYISRFTETHAACLTFVPGSAKVTKFHVGG
FT                   TMTETTETPELTATTLEVTSAGWINNGSKPVTMKTSYTVTASCAPGTVYGSGLAVGATV
FT                   MGNGFQSSANFANLGPSITVRAADVVDPVDPVDPVDPVDPVDPTGPGTGGGTGSLGSLS
FT                   GGLGSLGGLFGSS"
FT   CDS_pept        complement(776771..777514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31405"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS7"
FT                   /protein_id="BAH31405.1"
FT                   /translation="MLPAALGRRQNLKDCHTMSPKSNTLALGIASLITAALVLSGCSSS
FT                   ESGDAVSSDTSTSETTASESSASSSSAAAATPTLRDGTPFIGERTTIETGDDPEAPSIS
FT                   VSLPPSWAHGENIPAGVTDALSSNSQEPSGFMPNTTVTVENQGTATKDEVLAAARETIA
FT                   TLDGWTEVKYTEIDVDGQQGFRLSGTWTAPNLDVPLYAVMTVVAYQADDNSPVYLVSFA
FT                   NQFTDTTNMQTSNQVEEINTSIEFG"
FT   CDS_pept        complement(777541..778413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31406"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS8"
FT                   /protein_id="BAH31406.1"
FT                   /translation="MAWLEVVRTGPLATVQDRGRRGYGALGVGRSGAVDMISHDSANRL
FT                   VGNTFRAATIEVTTGGFAMRAVGSMTVAVTGARVPLAVDGRPAPDYASIHLGGGSIIEL
FT                   GYSTTGLRTYISARGGVDVPQVLGSRSTDTLSGLGPPPLAAGDLLLLGAEEGTWPTEEL
FT                   IPPPAPALGAVPIEITLGPRNSWFTAASVHALLHTTWKVTEHTNRVGVRLQGQGPLHRS
FT                   RTEELPSEGVVMGSIQVPPGGQPVVFLADHPVTGGYPVIAVVSDAGIASLAQLRPGSTI
FT                   TLKATTRPS"
FT   CDS_pept        complement(778471..779085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31407"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS9"
FT                   /protein_id="BAH31407.1"
FT                   /translation="MITILPAGESAVLVEYDELPSVLGNFRALDASRIPGVIDLIPAAR
FT                   TILIEYDNTITGHKLVEKWVRGAVPIELTADESGPAVAIPVRYDGDDLVEVGKLTGLGV
FT                   DGVIEAHTSASWTVAFIGFAPGFAYLTSNERKLEVPRRSDPRRQVPAGAVGLAGPFSGV
FT                   YPRSSPGGWQLIGTTELSVWDAERRPPALLLPGTTVTFVRA"
FT   CDS_pept        complement(779082..779843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31408"
FT                   /db_xref="GOA:C0ZPT0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT0"
FT                   /protein_id="BAH31408.1"
FT                   /translation="MGYSVDLNSDLGEGFGAWTLGDDDAMLELVTSANIACGFHAGDPT
FT                   TLLATCESAATRGVRIGAQVGYRDLAGFGRRFIDMSPKDLTADVIYQIGALDGLARVAG
FT                   SRVTYVKPHGALYNAIVHHRRQARAVVAAVVAYDSSLPVLGLPGSVFLEEAREAGLDVV
FT                   AEAFADRAYTAEGTLVPRTESGAVLNDPALVAERVRRMVVDGELDAVDGSTLKITAESV
FT                   CVHGDSPAAVDMAAAIRDLLESSDVEITPFT"
FT   CDS_pept        complement(779878..780759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07010"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31409"
FT                   /db_xref="GOA:C0ZPT1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT1"
FT                   /protein_id="BAH31409.1"
FT                   /translation="MSNKFTDAMSRMFDVSATVDLLQYDFVQQALIAGAILGLLAGIIG
FT                   PLIVSRQMSFSVHGTSELSLTGASAALLVGVGVGFGAIVGSVVAAVLFGLLGAKARDRD
FT                   SVIGVIMAFGLGLSVLFLWAYDGRTGTSFSLLVGQIVAPGNSGLELLLLCAVIVIGTLG
FT                   FIYRPLLFASTDPEVAAARGVPVRALSIVFAVLVGITAALGVQIVGALLVMSLLITPAA
FT                   AAAYVTASPLKATILSVVFAELAAVGGILLSLAPGVPVSSFVTSVSFVIYLICRLFGSA
FT                   RRKNAGRIPAHA"
FT   CDS_pept        complement(780756..781679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07020"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31410"
FT                   /db_xref="GOA:C0ZPT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT2"
FT                   /protein_id="BAH31410.1"
FT                   /translation="MTETSANTPVPPGNTVPPGNTVPSKASVPAVTLKDARLSFGARTL
FT                   WDGLDLEVQPGEFIAVLGPNGSGKTSLLKILLGQLQLSGGSAQIVGTPARAGNSHVGYI
FT                   PQQKSIDDGLPLRGRDLVGLGVDGHQWGTGLLRRGRRRKIVDDAIAQVSAQSFADAPIG
FT                   SMSGGEQQRLRIAQALVGDPRILLCDEPLLSLDLANQHLVSTLIDKRRRSHDTAVLFVT
FT                   HEINPILPLVDRVLYLVDGKFRIGTPAEVMTSEVLSDLYNTDVEVLQVRGRLVVIGTGD
FT                   AIDALGSAGGLRPGEGVHHSDEDHHQ"
FT   CDS_pept        complement(781719..782669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07030"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31411"
FT                   /db_xref="GOA:C0ZPT3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT3"
FT                   /protein_id="BAH31411.1"
FT                   /translation="MRSSSKFRTATALAAVSVAAAFALTACSSSSSKDEGITVVASTNV
FT                   WGDVAQAVAGDKLTVTSIINEPSADPHSFEATPADAAKITDASLVVYNGGGYDQFITDV
FT                   LDAGKGEQKTVNAYNLLDGGIHAGETAGESHDGHTHGAVNEHVWFDIPTVDAVAHSVAD
FT                   QLSALDPDNAATYEDNAKAYSQKLAGVTAITDSIAAAHAGAPAAQTEPIAHYLLVAAEL
FT                   KDATPEEFTSAIEDGNDPSPAAIAATRQLLSEKQARALVYNIQTQDKVTQDMRTTAETA
FT                   GVPVVEVTETLPEGLDYIQWQTQTAESLANALSAQ"
FT   CDS_pept        782809..783897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07040"
FT                   /product="putative LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31412"
FT                   /db_xref="GOA:C0ZPT4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT4"
FT                   /protein_id="BAH31412.1"
FT                   /translation="MPRSRQPRRQATLASLAAELNVSRTTVSNAYNRPDQLSVELRDRV
FT                   LQAAKRRGYPGPDPVARSLRTRKAGAVGLLLTEALSYSFRDPAAMSFLAGLSESCEDAG
FT                   QGLLLIPAGPGRDEVDAAAVVQQAGVDGFVVYSVADDDPYLAAVLERHIPIVVCDQPRE
FT                   IPGASLVGIDDRAAMRKVADYLIGLGHRDIGVLCMRLGRDRMDGVVSQERLKSPHFHVQ
FT                   RERIEGVRDAMVASDMDPLSLTVIERYVHTSQSGHSAAAEALATNPEITALVCTTDVLA
FT                   LGALDWARWQGIDVPGQLSITGFDGVDEALRESLTTVRQPQEEKGRRAGALLMSPSGSG
FT                   VPIVEMLDTELLAGRTSGRIKG"
FT   CDS_pept        complement(783901..786393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="RER_07050"
FT                   /product="putative trehalose-phosphatase"
FT                   /EC_number="3.1.3.12"
FT                   /note="protein synonym:trehalose 6-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31413"
FT                   /db_xref="GOA:C0ZPT5"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT5"
FT                   /protein_id="BAH31413.1"
FT                   /translation="MARTPRLLVASDYDGTMAPIVANPDKAYPRAETVRALRSLASLAS
FT                   TTAAVISGRALKDLAALSRLPAEVQLVGSHGSEFDIGFVHAIDADARKLLDEIVTELGR
FT                   IAADTPGATVEKKPASVALHVRNTSADDAEKALIAVRTESALWPGVQVTEGKSVVELAV
FT                   IATDKGHALDLIRHQDGATAAVFIGDDVTDEKAFSRLQGPDIGIKVGSGDTVADYRVDS
FT                   TEDVAAALAFLLDERRTWLSGADAPPIERLSMLASPRTVALVTPDATLTWLCHPEPDSA
FT                   AVFAHLLGGTGAGHFSVGPRRTALPLSQKYIDSTMTVQTRWASLSVTDYLPHDVPQGRT
FT                   DLTRIISGQADAIVSFAPRPEFGQGQVTLEVVDEGIRVLGTNEPYVLRSPGVLWNIATD
FT                   GNQQTAHAIVEPSKGDVVLELRCGTEELGPSEVPELERRATSEAYWSDWAKTLELPKLK
FT                   PDLMKRSALTLRGLVHADSGSIMAAATTSLPEEIGGVRNWDYRYCWLRDAALTATALVS
FT                   VGSTDEAENYLDWVHRVLETLPGPERLHPLYTLYGTSLPPEAVIDSLPGYAGSRPVRVG
FT                   NAANQQVQLDVFGPIVELIVELANAREKAGAPDPLSDRDWELVCAMVEAVQRRWFEPDH
FT                   GIWEIRDNPRHHVYSKVMGWVTVDRAVDLATRFSREALPEWAELRDQIADEVRHKGWKD
FT                   DVQSYTAAYDGTDLDAATLHIGLSGLIDPTDPRFAATVVATEAELRSGSTVYRYHHDDG
FT                   LPGIEGGFHLCAAWLVEAYLLIGQRLQAEALFDQLVAAAGPTGLLAEEYDPIAERSLGN
FT                   HPQAYSHLGLLRCAQLLA"
FT   CDS_pept        complement(786529..787167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07060"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31414"
FT                   /db_xref="GOA:C0ZPT6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041642"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT6"
FT                   /protein_id="BAH31414.1"
FT                   /translation="MTTTSRSRSNAVASATLGDDDLSSNAQRERRKRILDATLALASKG
FT                   GYEAVQMRAVAERADVAVGTLYRYFPSKVHLLVSALAREFEKIDSKGKIPPGTSPLERM
FT                   QLILSLITRAMQRDPLLTEAMTRAFMFADASAAAEVDQVGQLMDRLFARAMTEEEPTEE
FT                   QLAIARVISDVWLSNLVAWLTRRSSATDVANRLELTVELLLGDGTRKPE"
FT   CDS_pept        787262..789424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31415"
FT                   /db_xref="GOA:C0ZPT7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT7"
FT                   /protein_id="BAH31415.1"
FT                   /translation="MTIATTDEQRAVQESIEAWARSATPMDMVRRGPAVSWREKWSEFA
FT                   SLGIFSVAVPESVGGAGAEIVDLAAMLEQAAIELVPGPVLTTALAALVVGRSSSPAAKR
FT                   WSEMLADGALPCAVVLDESPVAATANASGGIELHGEGGYAWGGDSGVSVLVSAGVVSEG
FT                   EGSRVVWALVDGDSEGVTYEAVDTIDKSRPLARVSFDRVTVDADRILDDIAPGSVSDLA
FT                   AVLGAAEAAGIAAWSLRTAVEYAKIREQFGKPIGSFQAIKHICAEMLCRVENAGAVAWD
FT                   GAVAAESGDELPIAAAVAAAVSLDAAVDTAKDCIQVLGGIGFTWEHEAHFYLRRALSLR
FT                   QILGGSSRWRARVAELTIGGARRHLQIDLSELESDRSDIREEVAQLVALPESEQRNALA
FT                   ESGYLAPHWPKPYGRGAKAAQQILIEEELAAVGIGRPDLVIGWWAVPTILEHGSAEQIE
FT                   RFATPTLKGEITWCQLFSEPGAGSDLAALRTTAEKVDGGWKLNGQKVWTSLAREADWAI
FT                   CLARTDREVPKHKGITYFLLDMKTAGIRISPLREITGDALFNEVFLDDVFVPDDCVVGR
FT                   LGGGWKLARTTLANERVAMSGGSSLGGAMEELLELAGDPDPVVADKLGGLIGTAMVGSL
FT                   LELRTTLRQLDGQDPGPASSVRKLVGVRQRQNVAEFAMELGGPAGWVEGPLSREFLNTR
FT                   CLSIAGGTTQILLTVAAERILGLPRD"
FT   CDS_pept        789508..790548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07080"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31416"
FT                   /db_xref="GOA:C0ZPT8"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT8"
FT                   /protein_id="BAH31416.1"
FT                   /translation="MDFTPDETQEAVAEVATALLARELEPDALWAAFAEADLLTLALPE
FT                   RLGGEGLSVTDVGSLLVEVGRAAAPIPALATLGFGVLPIVALGTDAQQDELLTGVSAGR
FT                   VFTAALGEPGQQFPAQPSTTAHQSGDWYRVSGTVLAVPFAASAHRILVPTDAGVVLVDP
FT                   TAAGVALTPTPSASGSPEFAVTMDEAVGELLGAGDEAVQTLYRIATASIGAVADGLVSG
FT                   AVDLTAAHVGSREQFGKPLATFQAVSQQIADAYVTSRTLHVAALSASWRVSEGLDAQSD
FT                   LDVMAYWIAQEVPATMQVLHHLHGGLGVDVTYPLHRYYSTAKDLARLLGGASQRLDLVG
FT                   ARCSSI"
FT   CDS_pept        790533..791684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07090"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31417"
FT                   /db_xref="GOA:C0ZPT9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT9"
FT                   /protein_id="BAH31417.1"
FT                   /translation="MFIDLTDSQRALQAELRRYFSTLISPEEAKIMRVERHGPTYREVI
FT                   RRMGKDGWLGVGWPVEYGGRGFGEVEQQIFVNEAVRADVPLPSVTLQTVGPTLQKYGSE
FT                   EQKQKFLPAILAGEVHFAIGYTEPEAGTDLAALRTSATRNGDEYVVNGQKIFTTGGHDA
FT                   DYVWLAARTGSADSRHRGISILIMDTKDPGYTWTPIITCDGAHHVNATYYEDVRVPANM
FT                   LVGEENQGWRLITTQLNHERVMLGPAGRVAGIYDHVFDWAKRENLLDHVDVRRALGEIH
FT                   ATYRLNELLNWQVASSDSESVDIADASATKVFATERIQRVGRLAEEIVGRYGNPIDPET
FT                   ADLMEWLDMQIKRNLVITFGGGVNEVMRELIATAGLKLPRVPR"
FT   CDS_