(data stored in ACNUC7421 zone)

EMBL: AP008971

ID   AP008971; SV 1; circular; genomic DNA; STD; PRO; 1797577 BP.
XX
AC   AP008971;
XX
PR   Project:PRJDA18981;
XX
DT   14-FEB-2008 (Rel. 94, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Finegoldia magna ATCC 29328 DNA, complete genome.
XX
KW   .
XX
OS   Finegoldia magna ATCC 29328
OC   Bacteria; Firmicutes; Tissierellia; Tissierellales; Peptoniphilaceae;
OC   Finegoldia.
XX
RN   [1]
RP   1-1797577
RA   Hattori M., Yamashita A., Toh H., Oshima K., Shiba T.;
RT   ;
RL   Submitted (14-APR-2005) to the INSDC.
RL   Contact:Masahira Hattori University of Tokyo, Graduate School of Frontier
RL   Sciences; 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8561, Japan URL
RL   :http://www.cb.k.u-tokyo.ac.jp/hattorilab/
XX
RN   [2]
RX   DOI; 10.1093/dnares/dsm030.
RX   PUBMED; 18263572.
RA   Goto T., Yamashita A., Hirakawa H., Matsutani M., Todo K., Oshima K.,
RA   Toh H., Miyamoto K., Kuhara S., Hattori M., Shimizu T., Akimoto S.;
RT   "Complete genome sequence of Finegoldia magna, an anaerobic opportunistic
RT   pathogen";
RL   DNA Res. 15(1):39-47(2008).
XX
DR   MD5; c41f80fa1d898699c77330162516130a.
DR   BioSample; SAMD00060918.
DR   EnsemblGenomes-Gn; EBG00001247443.
DR   EnsemblGenomes-Gn; EBG00001247444.
DR   EnsemblGenomes-Gn; EBG00001247445.
DR   EnsemblGenomes-Gn; EBG00001247446.
DR   EnsemblGenomes-Gn; EBG00001247447.
DR   EnsemblGenomes-Gn; EBG00001247448.
DR   EnsemblGenomes-Gn; EBG00001247449.
DR   EnsemblGenomes-Gn; EBG00001247450.
DR   EnsemblGenomes-Gn; EBG00001247451.
DR   EnsemblGenomes-Gn; EBG00001247452.
DR   EnsemblGenomes-Gn; EBG00001247453.
DR   EnsemblGenomes-Gn; EBG00001247454.
DR   EnsemblGenomes-Gn; EBG00001247455.
DR   EnsemblGenomes-Gn; EBG00001247456.
DR   EnsemblGenomes-Gn; EBG00001247457.
DR   EnsemblGenomes-Gn; EBG00001247458.
DR   EnsemblGenomes-Gn; EBG00001247459.
DR   EnsemblGenomes-Gn; EBG00001247460.
DR   EnsemblGenomes-Gn; EBG00001247461.
DR   EnsemblGenomes-Gn; EBG00001247462.
DR   EnsemblGenomes-Gn; EBG00001247463.
DR   EnsemblGenomes-Gn; EBG00001247464.
DR   EnsemblGenomes-Gn; EBG00001247465.
DR   EnsemblGenomes-Gn; EBG00001247466.
DR   EnsemblGenomes-Gn; EBG00001247467.
DR   EnsemblGenomes-Gn; EBG00001247468.
DR   EnsemblGenomes-Gn; EBG00001247469.
DR   EnsemblGenomes-Gn; EBG00001247470.
DR   EnsemblGenomes-Gn; EBG00001247471.
DR   EnsemblGenomes-Gn; EBG00001247472.
DR   EnsemblGenomes-Gn; EBG00001247473.
DR   EnsemblGenomes-Gn; EBG00001247474.
DR   EnsemblGenomes-Gn; EBG00001247475.
DR   EnsemblGenomes-Gn; EBG00001247476.
DR   EnsemblGenomes-Gn; EBG00001247477.
DR   EnsemblGenomes-Gn; EBG00001247478.
DR   EnsemblGenomes-Gn; EBG00001247479.
DR   EnsemblGenomes-Gn; EBG00001247480.
DR   EnsemblGenomes-Gn; EBG00001247481.
DR   EnsemblGenomes-Gn; EBG00001247482.
DR   EnsemblGenomes-Gn; EBG00001247483.
DR   EnsemblGenomes-Gn; EBG00001247484.
DR   EnsemblGenomes-Gn; EBG00001247485.
DR   EnsemblGenomes-Gn; EBG00001247486.
DR   EnsemblGenomes-Gn; EBG00001247487.
DR   EnsemblGenomes-Gn; EBG00001247488.
DR   EnsemblGenomes-Gn; EBG00001247489.
DR   EnsemblGenomes-Gn; EBG00001247490.
DR   EnsemblGenomes-Gn; EBG00001247491.
DR   EnsemblGenomes-Gn; EBG00001247492.
DR   EnsemblGenomes-Gn; EBG00001247493.
DR   EnsemblGenomes-Gn; EBG00001247494.
DR   EnsemblGenomes-Gn; EBG00001247495.
DR   EnsemblGenomes-Gn; EBG00001247496.
DR   EnsemblGenomes-Gn; EBG00001247497.
DR   EnsemblGenomes-Gn; EBG00001247498.
DR   EnsemblGenomes-Gn; EBG00001247499.
DR   EnsemblGenomes-Gn; EBG00001247500.
DR   EnsemblGenomes-Gn; EBG00001247501.
DR   EnsemblGenomes-Gn; EBG00001247502.
DR   EnsemblGenomes-Gn; EBG00001247503.
DR   EnsemblGenomes-Gn; EBG00001247504.
DR   EnsemblGenomes-Gn; EBG00001247505.
DR   EnsemblGenomes-Gn; EBG00001247506.
DR   EnsemblGenomes-Gn; EBG00001247507.
DR   EnsemblGenomes-Gn; EBG00001247508.
DR   EnsemblGenomes-Gn; EBG00001247509.
DR   EnsemblGenomes-Gn; EBG00001247510.
DR   EnsemblGenomes-Gn; EBG00001247511.
DR   EnsemblGenomes-Gn; EBG00001247512.
DR   EnsemblGenomes-Gn; EBG00001247513.
DR   EnsemblGenomes-Gn; FMG_rrnA_16SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnA_23SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnA_5SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnB_16SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnB_23SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnB_5SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnC_16SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnC_23SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnC_5SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnD_16SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnD_23SrRNA.
DR   EnsemblGenomes-Gn; FMG_rrnD_5SrRNA.
DR   EnsemblGenomes-Gn; FMG_tRNA01.
DR   EnsemblGenomes-Gn; FMG_tRNA02.
DR   EnsemblGenomes-Gn; FMG_tRNA03.
DR   EnsemblGenomes-Gn; FMG_tRNA04.
DR   EnsemblGenomes-Gn; FMG_tRNA05.
DR   EnsemblGenomes-Gn; FMG_tRNA06.
DR   EnsemblGenomes-Gn; FMG_tRNA07.
DR   EnsemblGenomes-Gn; FMG_tRNA08.
DR   EnsemblGenomes-Gn; FMG_tRNA09.
DR   EnsemblGenomes-Gn; FMG_tRNA10.
DR   EnsemblGenomes-Gn; FMG_tRNA11.
DR   EnsemblGenomes-Gn; FMG_tRNA12.
DR   EnsemblGenomes-Gn; FMG_tRNA13.
DR   EnsemblGenomes-Gn; FMG_tRNA14.
DR   EnsemblGenomes-Gn; FMG_tRNA15.
DR   EnsemblGenomes-Gn; FMG_tRNA16.
DR   EnsemblGenomes-Gn; FMG_tRNA17.
DR   EnsemblGenomes-Gn; FMG_tRNA18.
DR   EnsemblGenomes-Gn; FMG_tRNA19.
DR   EnsemblGenomes-Gn; FMG_tRNA20.
DR   EnsemblGenomes-Gn; FMG_tRNA21.
DR   EnsemblGenomes-Gn; FMG_tRNA22.
DR   EnsemblGenomes-Gn; FMG_tRNA23.
DR   EnsemblGenomes-Gn; FMG_tRNA24.
DR   EnsemblGenomes-Gn; FMG_tRNA25.
DR   EnsemblGenomes-Gn; FMG_tRNA26.
DR   EnsemblGenomes-Gn; FMG_tRNA27.
DR   EnsemblGenomes-Gn; FMG_tRNA28.
DR   EnsemblGenomes-Gn; FMG_tRNA29.
DR   EnsemblGenomes-Gn; FMG_tRNA30.
DR   EnsemblGenomes-Gn; FMG_tRNA31.
DR   EnsemblGenomes-Gn; FMG_tRNA32.
DR   EnsemblGenomes-Gn; FMG_tRNA33.
DR   EnsemblGenomes-Gn; FMG_tRNA34.
DR   EnsemblGenomes-Gn; FMG_tRNA35.
DR   EnsemblGenomes-Gn; FMG_tRNA36.
DR   EnsemblGenomes-Gn; FMG_tRNA37.
DR   EnsemblGenomes-Gn; FMG_tRNA38.
DR   EnsemblGenomes-Gn; FMG_tRNA39.
DR   EnsemblGenomes-Gn; FMG_tRNA40.
DR   EnsemblGenomes-Gn; FMG_tRNA41.
DR   EnsemblGenomes-Gn; FMG_tRNA42.
DR   EnsemblGenomes-Gn; FMG_tRNA43.
DR   EnsemblGenomes-Gn; FMG_tRNA44.
DR   EnsemblGenomes-Gn; FMG_tRNA45.
DR   EnsemblGenomes-Gn; FMG_tRNA46.
DR   EnsemblGenomes-Gn; FMG_tRNA47.
DR   EnsemblGenomes-Gn; FMG_tRNA48.
DR   EnsemblGenomes-Tr; EBT00001593104.
DR   EnsemblGenomes-Tr; EBT00001593105.
DR   EnsemblGenomes-Tr; EBT00001593106.
DR   EnsemblGenomes-Tr; EBT00001593107.
DR   EnsemblGenomes-Tr; EBT00001593108.
DR   EnsemblGenomes-Tr; EBT00001593109.
DR   EnsemblGenomes-Tr; EBT00001593110.
DR   EnsemblGenomes-Tr; EBT00001593111.
DR   EnsemblGenomes-Tr; EBT00001593112.
DR   EnsemblGenomes-Tr; EBT00001593113.
DR   EnsemblGenomes-Tr; EBT00001593114.
DR   EnsemblGenomes-Tr; EBT00001593115.
DR   EnsemblGenomes-Tr; EBT00001593116.
DR   EnsemblGenomes-Tr; EBT00001593117.
DR   EnsemblGenomes-Tr; EBT00001593118.
DR   EnsemblGenomes-Tr; EBT00001593119.
DR   EnsemblGenomes-Tr; EBT00001593120.
DR   EnsemblGenomes-Tr; EBT00001593121.
DR   EnsemblGenomes-Tr; EBT00001593122.
DR   EnsemblGenomes-Tr; EBT00001593123.
DR   EnsemblGenomes-Tr; EBT00001593124.
DR   EnsemblGenomes-Tr; EBT00001593125.
DR   EnsemblGenomes-Tr; EBT00001593126.
DR   EnsemblGenomes-Tr; EBT00001593127.
DR   EnsemblGenomes-Tr; EBT00001593128.
DR   EnsemblGenomes-Tr; EBT00001593129.
DR   EnsemblGenomes-Tr; EBT00001593130.
DR   EnsemblGenomes-Tr; EBT00001593131.
DR   EnsemblGenomes-Tr; EBT00001593132.
DR   EnsemblGenomes-Tr; EBT00001593133.
DR   EnsemblGenomes-Tr; EBT00001593134.
DR   EnsemblGenomes-Tr; EBT00001593135.
DR   EnsemblGenomes-Tr; EBT00001593136.
DR   EnsemblGenomes-Tr; EBT00001593137.
DR   EnsemblGenomes-Tr; EBT00001593138.
DR   EnsemblGenomes-Tr; EBT00001593139.
DR   EnsemblGenomes-Tr; EBT00001593140.
DR   EnsemblGenomes-Tr; EBT00001593141.
DR   EnsemblGenomes-Tr; EBT00001593142.
DR   EnsemblGenomes-Tr; EBT00001593143.
DR   EnsemblGenomes-Tr; EBT00001593144.
DR   EnsemblGenomes-Tr; EBT00001593145.
DR   EnsemblGenomes-Tr; EBT00001593146.
DR   EnsemblGenomes-Tr; EBT00001593147.
DR   EnsemblGenomes-Tr; EBT00001593148.
DR   EnsemblGenomes-Tr; EBT00001593149.
DR   EnsemblGenomes-Tr; EBT00001593150.
DR   EnsemblGenomes-Tr; EBT00001593151.
DR   EnsemblGenomes-Tr; EBT00001593152.
DR   EnsemblGenomes-Tr; EBT00001593153.
DR   EnsemblGenomes-Tr; EBT00001593154.
DR   EnsemblGenomes-Tr; EBT00001593155.
DR   EnsemblGenomes-Tr; EBT00001593156.
DR   EnsemblGenomes-Tr; EBT00001593157.
DR   EnsemblGenomes-Tr; EBT00001593158.
DR   EnsemblGenomes-Tr; EBT00001593159.
DR   EnsemblGenomes-Tr; EBT00001593160.
DR   EnsemblGenomes-Tr; EBT00001593161.
DR   EnsemblGenomes-Tr; EBT00001593162.
DR   EnsemblGenomes-Tr; EBT00001593163.
DR   EnsemblGenomes-Tr; EBT00001593164.
DR   EnsemblGenomes-Tr; EBT00001593165.
DR   EnsemblGenomes-Tr; EBT00001593166.
DR   EnsemblGenomes-Tr; EBT00001593167.
DR   EnsemblGenomes-Tr; EBT00001593168.
DR   EnsemblGenomes-Tr; EBT00001593169.
DR   EnsemblGenomes-Tr; EBT00001593170.
DR   EnsemblGenomes-Tr; EBT00001593171.
DR   EnsemblGenomes-Tr; EBT00001593172.
DR   EnsemblGenomes-Tr; EBT00001593173.
DR   EnsemblGenomes-Tr; EBT00001593174.
DR   EnsemblGenomes-Tr; FMG_rrnA_16SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnA_23SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnA_5SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnB_16SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnB_23SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnB_5SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnC_16SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnC_23SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnC_5SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnD_16SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnD_23SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_rrnD_5SrRNA-1.
DR   EnsemblGenomes-Tr; FMG_tRNA01-1.
DR   EnsemblGenomes-Tr; FMG_tRNA02-1.
DR   EnsemblGenomes-Tr; FMG_tRNA03-1.
DR   EnsemblGenomes-Tr; FMG_tRNA04-1.
DR   EnsemblGenomes-Tr; FMG_tRNA05-1.
DR   EnsemblGenomes-Tr; FMG_tRNA06-1.
DR   EnsemblGenomes-Tr; FMG_tRNA07-1.
DR   EnsemblGenomes-Tr; FMG_tRNA08-1.
DR   EnsemblGenomes-Tr; FMG_tRNA09-1.
DR   EnsemblGenomes-Tr; FMG_tRNA10-1.
DR   EnsemblGenomes-Tr; FMG_tRNA11-1.
DR   EnsemblGenomes-Tr; FMG_tRNA12-1.
DR   EnsemblGenomes-Tr; FMG_tRNA13-1.
DR   EnsemblGenomes-Tr; FMG_tRNA14-1.
DR   EnsemblGenomes-Tr; FMG_tRNA15-1.
DR   EnsemblGenomes-Tr; FMG_tRNA16-1.
DR   EnsemblGenomes-Tr; FMG_tRNA17-1.
DR   EnsemblGenomes-Tr; FMG_tRNA18-1.
DR   EnsemblGenomes-Tr; FMG_tRNA19-1.
DR   EnsemblGenomes-Tr; FMG_tRNA20-1.
DR   EnsemblGenomes-Tr; FMG_tRNA21-1.
DR   EnsemblGenomes-Tr; FMG_tRNA22-1.
DR   EnsemblGenomes-Tr; FMG_tRNA23-1.
DR   EnsemblGenomes-Tr; FMG_tRNA24-1.
DR   EnsemblGenomes-Tr; FMG_tRNA25-1.
DR   EnsemblGenomes-Tr; FMG_tRNA26-1.
DR   EnsemblGenomes-Tr; FMG_tRNA27-1.
DR   EnsemblGenomes-Tr; FMG_tRNA28-1.
DR   EnsemblGenomes-Tr; FMG_tRNA29-1.
DR   EnsemblGenomes-Tr; FMG_tRNA30-1.
DR   EnsemblGenomes-Tr; FMG_tRNA31-1.
DR   EnsemblGenomes-Tr; FMG_tRNA32-1.
DR   EnsemblGenomes-Tr; FMG_tRNA33-1.
DR   EnsemblGenomes-Tr; FMG_tRNA34-1.
DR   EnsemblGenomes-Tr; FMG_tRNA35-1.
DR   EnsemblGenomes-Tr; FMG_tRNA36-1.
DR   EnsemblGenomes-Tr; FMG_tRNA37-1.
DR   EnsemblGenomes-Tr; FMG_tRNA38-1.
DR   EnsemblGenomes-Tr; FMG_tRNA39-1.
DR   EnsemblGenomes-Tr; FMG_tRNA40-1.
DR   EnsemblGenomes-Tr; FMG_tRNA41-1.
DR   EnsemblGenomes-Tr; FMG_tRNA42-1.
DR   EnsemblGenomes-Tr; FMG_tRNA43-1.
DR   EnsemblGenomes-Tr; FMG_tRNA44-1.
DR   EnsemblGenomes-Tr; FMG_tRNA45-1.
DR   EnsemblGenomes-Tr; FMG_tRNA46-1.
DR   EnsemblGenomes-Tr; FMG_tRNA47-1.
DR   EnsemblGenomes-Tr; FMG_tRNA48-1.
DR   EuropePMC; PMC2650633; 18263572.
DR   EuropePMC; PMC3055811; 21284853.
DR   EuropePMC; PMC5654912; 28904182.
DR   EuropePMC; PMC5762925; 29321635.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01990; SECIS_4.
DR   SILVA-LSU; AP008971.
DR   SILVA-SSU; AP008971.
DR   StrainInfo; 106725; 0.
XX
CC   This work was done in collaboration with Takatsugu Goto, Kozo
CC   Todo, Kazuaki Miyamoto, Shigeru Akimoto (Wakayama Medical
CC   University), Hideki Hirakawa, Minenosuke Matsutani, Satoru Kuhara
CC   (Kyushu University), Tohru Shimizu (Kanazawa University) and
CC   supported by the Research for the Future Program of the Japan
CC   Society for the Promotion of Science.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1797577
FT                   /organism="Finegoldia magna ATCC 29328"
FT                   /strain="ATCC 29328"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:334413"
FT   CDS_pept        365..1822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07419"
FT                   /db_xref="GOA:B0S416"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B0S416"
FT                   /protein_id="BAG07419.1"
FT                   /translation="MTDKDELWLKISNTFKQEMSDLNFNTWIAPLKPLYLTNTEFILLS
FT                   PNRFTKKTIYNKYYDDIQKYLDFISNVKRKVVIIDRYEMDNYKDENIIQNQNIDGQRSI
FT                   LVNEDESEEKYKIEDPVATQPEQTQEQAEEQTDFSPYGKNLIAKYKFDTFVKGKNNELA
FT                   LAAALAVAQNPATAYNPLFIHGKAGLGKTHLMHAIAHEILKNNPKARVIYTTSESFTNE
FT                   LISSIGDKSTKKNSQFRQKYRNIDVLLIDDIQFIAGKQGTQEEFFHTFNELYNHNKQII
FT                   LSSDRPPKEIKTLEERLVSRFEWGLMADIQPPDYETRVAIVNEYLDRNNTSLPPEIIDY
FT                   IAMNVKSNIRELEGAVMNVVGQKTLIGDGNITLDLAKNVLKQLIAETQLRPVTIDLIIE
FT                   CVCDRYNVTLDDLLSKKRSKQIAYPRQIAMYVSRKLLDISLVSIASSFGKDHSTVMHGI
FT                   KKIESDIKKNSEFDEEIENLINYIQNS"
FT   CDS_pept        2110..3213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0002"
FT                   /product="DNA polymerase III beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07420"
FT                   /db_xref="GOA:B0S417"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B0S417"
FT                   /protein_id="BAG07420.1"
FT                   /translation="MKLKISQKELLKHINIAQKAVSSRTTIQILEGILFIAEENCLRLV
FT                   ATDLELIVDTRANCEIYEKGQIVINSSMIGNIIRKLPDADIYIEVDDNNINIKCLSTEF
FT                   NIQGQDSNEFPSLPYIDKDVKLTLEQSELRDSIRKTSFATSMDQTRPDLTGVLFNIMND
FT                   RIEFVALDGYRVSLDCLSNVSEFEMKAIVPARALNEVYKILEEGEITLNIITGNIIFKL
FT                   ENTDVYSRLIDGQYIDYNQVMKQDFSTVVTIEKRALQMALERASLMAKEDKANLVKLDF
FT                   SGNELHISSNTDIGKVDEYVKCEIGGEDLRIAFNAKYLLDGLKVIDDDDITLNMSGSLR
FT                   PMVFKPLNDTNYTYLVLPVKLAGGNND"
FT   CDS_pept        3206..3412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07421"
FT                   /db_xref="GOA:B0S418"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B0S418"
FT                   /protein_id="BAG07421.1"
FT                   /translation="MISVKIESEFIKLEQFLKFASIAQTGGMAKELIKESLVKVNDEVE
FT                   TRRGKKLYPGDVVEFEGEKYVVE"
FT   CDS_pept        3412..4479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0004"
FT                   /product="DNA replication and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07422"
FT                   /db_xref="GOA:B0S419"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B0S419"
FT                   /protein_id="BAG07422.1"
FT                   /translation="MIVQKLKLYNYRNFCEIELDFCDGLNLIVGRNASGKTNILEAINV
FT                   ALKGKSFKTNTNSHLIKFGEDEARIVMDVYDDGFEDKIDITIKSNEKILNVNEAFVNTI
FT                   KEYNEYFECIVFKPDDLKIIKESKSLRRKFLDESISGVDNYYRTVLKQYNQVLDERNKL
FT                   IKNHRYNSYFNEQLKALNIQLSDFGSYIMHKRKSYVERLHLIAKNVCKNLSDENDDLYM
FT                   ENKFSIRYVEDMTDQKNTYYKSLRDILEKDLENKQTNLGIHRDDLDILINDKQAKFFAS
FT                   QAQVRTAILSMKLAQLDLSRFYNDRMPIILLDDVFSELDDYRINYIIRYIKDFQAFLTT
FT                   SERAPEGLYTIKIGE"
FT   CDS_pept        4723..6639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0005"
FT                   /product="DNA gyrase B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07423"
FT                   /db_xref="GOA:B0S420"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0S420"
FT                   /protein_id="BAG07423.1"
FT                   /translation="MKKNREYTADQITVLEGLEPVRVRPGMYIGSTDEKGLHHLVYEVV
FT                   DNSIDEALAGVCDLIKVTIKKDNSIIVEDDGSGIPVETHPKTGKSTLETVLTVLHAGGK
FT                   FSNDAYQYSGGLHGVGVSCVNALSTYLIARVKRDGKMYEQRFEKGKTVTGLTVVKENVR
FT                   GTGTTIEFMPDDTIFETLNFDKNVLAKRFREMAFLNKGVKIEFSDERDGYKELFHYEGG
FT                   IKSFVEYINKSKKPLDHEVMYIEGEKDTTKVEIAMQYTESYNETIVSFTNNIKTVDGGT
FT                   HVVGFKSALTRALNDYARNKNILKEKDDNLSGDDVREGITAVVSVKLNNPQFEGQTKGK
FT                   LGNSEARTVVDSVVYEHLSFYFEENPKIVRTIIQKALASQKARLAARRARDLVRKKSVL
FT                   DNTTLPGKLADCQSSDIEYNEIFLVEGDSAGGSAKGGRDNKFQAILPLRGKILNVEKAH
FT                   LERVLNSEEIKAMITAFGTGIGKNFDISKLRYGKIVIMTDADVDGAHIRTLLLTFLYRF
FT                   MKPLVEKGHVYIAQPPLYGIIKGVKVMEYCYTEQELEEALEKYGERSNIKVQRYKGLGE
FT                   MNAEQLWDTTMNPEHRILIKVEIDGEDENELDNTFDVLMGDNVEPRREFIEQNAVYAQN
FT                   IDA"
FT   CDS_pept        6649..9069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0006"
FT                   /product="DNA gyrase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07424"
FT                   /db_xref="GOA:B0S421"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B0S421"
FT                   /protein_id="BAG07424.1"
FT                   /translation="MTERKLNIKPADLKREMESAYLDYSMSVIVSRALPDVRDGLKPVH
FT                   RRIIYGMQQQGLFPDRKYSKSARLVGEVMGKYHPHGDSAIYDAVVRLAQDFNMRYPLVD
FT                   GQGNFGSIDGDGAAAPRYTELRMDKLALEMLRDINKDTVDFQDNYDGEEQEPVVLPSRF
FT                   PNLIVNGSSGIAVGMATNMAPHNLGETIDALIATIDNPNITIEELMKYIKAPDFPTGGN
FT                   IMGLEEVKNAYTTGRGKVRLRAEARIEESKGRFKIIVTEIPYQVNKSNLIKKIADLVKQ
FT                   KKIEGISDLRDESDRKGMRIVIETKRDANPNIVLNNLYKYTQMQTTFGIINLALVNGVP
FT                   KVLTLKQLIDHYLVHQEIVVRRRTQFDLNKAKARIHIVEGLLKAIDNIDEIIHIIRTSY
FT                   DDALEKLMERFGFSEIQAQAILDMRLKRLQGLEKEKLQNEFDELSALIEKLTEILNNRH
FT                   MLLEIIKDELSEIRTKYADDRRTKILRDDGDFEDMELLEEEDMFITITNKGYIKRISTD
FT                   AYKVQHRGGRGVNAMGMKDGDFIKDMFATTTHQDLLFFTNKGKVYSLKAYEVPEASRTA
FT                   RGSNIINLIQIDADENVTQVLALDKEKENDQFIIFITKKGKVKKTSLSLYENIRKTGII
FT                   AIKFDEGDELIDVKLVEKNEEVIIVTKKGMSLQFNVDQLRDLSRNAIGVKAITLNKDDE
FT                   VISFDLVKDNEFLAVISENGYGKKTELSNYTTQNRGGKGIRTYKIAKKTGDVACAKALK
FT                   KDDEILLISKQAEVIRIKAEGISTLSRNTSGVLLKNTDKGEDAIVAVAKYFEE"
FT   CDS_pept        9080..9391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0007"
FT                   /product="anti-sigma B factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07425"
FT                   /db_xref="GOA:B0S422"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0S422"
FT                   /protein_id="BAG07425.1"
FT                   /translation="MQLNYDIVTKDEIIVRVQGDLDINTCDEFRDDLLEEYNKNPKDIR
FT                   IEATDLSFIDSTGLGALIKVYNEIKDNNHKIYIDNIKKHVNKVFTITEMDKIFVIKEI"
FT   CDS_pept        9391..9735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0008"
FT                   /product="anti-sigma B factor"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07426"
FT                   /db_xref="UniProtKB/TrEMBL:B0S423"
FT                   /protein_id="BAG07426.1"
FT                   /translation="MEEFRLSFQNEKENVSLIRLSASFVAMKCGFSLDDIEDIKLCASE
FT                   CLNLQRNRSEIIDCTMIIDDESLSLIFKLDGKNPRENNEKDKISEMIIQSLMDEYEING
FT                   SEIKVIKNRK"
FT   CDS_pept        9740..10516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0009"
FT                   /product="RNA polymerase sigma B factor"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07427"
FT                   /db_xref="GOA:B0S424"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0S424"
FT                   /protein_id="BAG07427.1"
FT                   /translation="MANKSISKEEQENIKELFLKFQETRDKKTRDTLVEKNLYIAEILA
FT                   KKYTGRGIEYDDLYQVACIGLIYAIDRYDPSKGYEFSSYATPTIVGEIKKYFRDKGWVI
FT                   RVPRRIQELNKKVATAKVHLSQTMQKSPTVEDIADYLSISNEEVLEVLEGAKVYAPQSL
FT                   DQSIDQSNEDRETNLSDLIGEEDKDMLKFENRDLINRCMQDLNKVERKILLGRYFDKKT
FT                   QIVIAEELDISQMTVSRMEKKILKKFKAALKEQLEF"
FT   CDS_pept        10517..11128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0010"
FT                   /product="glutamine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07428"
FT                   /db_xref="GOA:B0S425"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S425"
FT                   /protein_id="BAG07428.1"
FT                   /translation="MEILRFENVKFIKEYDDFTINKNEIVFIVGKSGSGKSTLLKLINN
FT                   TLQMKSGSIFYKDTNILNIKPVELRRNIMMTSQENFLFDMTIKENFHEFYKLRDLENLT
FT                   DDEIVKFLKIADFDVDVNLDVEKLSGGEKQRVFLAIALSMRPEVLLLDEPTSALDSNTA
FT                   FNMMKNIVDYCKHNDITLVVVSHARNLVDEFADKTIDLGD"
FT   CDS_pept        11130..11903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0011"
FT                   /product="glutamine ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07429"
FT                   /db_xref="GOA:B0S426"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:B0S426"
FT                   /protein_id="BAG07429.1"
FT                   /translation="MGIIKIPWTRFLLIYLLLLFVLFVMKKCRINKAKTLIIASFRMTV
FT                   QLIIVGFILTYVINANNNLFVIIYILIMATFSTLKVFKGNNLSDKFKVIIGLSILFSGI
FT                   LVECFYVGFVIRKPIFDAQYAIPISGMLFGNTMTAVNLGVNYLNENLKLNKNKITTLIN
FT                   LGVKADTALIPIVNQSVEMAILPNLNSMIAMGIISLPGMMTGQILSGVSPNTAIIYQIS
FT                   VMIAICASVNIASFLSLYLGYKSLINNREQINFEL"
FT   CDS_pept        11916..13274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0012"
FT                   /product="fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07430"
FT                   /db_xref="GOA:B0S427"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B0S427"
FT                   /protein_id="BAG07430.1"
FT                   /translation="MRIERDSIGEIEVNDDVLWGAQTQRSFNNFKIGTEKMPLEVIKAL
FT                   TRLKKACAISNNKLEKLSDEKKDLIVGACDEILDHQHDNEFPLAVWQTGSGTQSNMNVN
FT                   EVIAHIANKKYGENIIHPNDDVNKSQSSNDTFPSAIHIALKHMIDSELIAELENTEKVL
FT                   EKLMEENKDIIKIGRTHLQDAVPLRLSQEISGWLFMIKKGKQHIIEASKALNELAIGAT
FT                   AVGTGLNAVKGFDQMVVDEINKQTNGKFVTAENKFHALTSKDAISFTHGAITALANNLM
FT                   KIANDVRFLASGPRCGIGELSIPANEPGSSIMPGKVNPTQAEALTMVCVQIMGNNTTIQ
FT                   VAASQGNYELNVYMPVIIYNALQSVRLIKDATKSFTDNCLRGLKANREVIDYYLNNSLM
FT                   LVTALNTKIGYDKASTIAKYAHKNNTTLKQAALDLEILTEEEFDEYVDPTKMC"
FT   CDS_pept        13240..13437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07431"
FT                   /db_xref="UniProtKB/TrEMBL:B0S428"
FT                   /protein_id="BAG07431.1"
FT                   /translation="MTNTSTLLKCVRKKYFILKNISTKYIIGVRVMGGEYEKEINDICA
FT                   SSDDVSDANWIQHKLRSNRK"
FT   CDS_pept        complement(13836..14306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0014"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07432"
FT                   /db_xref="GOA:B0S442"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0S442"
FT                   /protein_id="BAG07432.1"
FT                   /translation="MEFIIKEIQNKKEKEKISREILNDLPEWFGMPESTEEYIVDSQNK
FT                   PFIACFLEENPVGFVVLNNTSPDCADIFVMGIKKKFHRQGLGKKLNEAYENLARKLGYT
FT                   YSQVKTVETGHYQEYDITNSFYQAMGYKKLEVFPDLWDQWNPCQIYIKFLGK"
FT   CDS_pept        complement(14418..15062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07433"
FT                   /db_xref="InterPro:IPR024211"
FT                   /db_xref="UniProtKB/TrEMBL:B0S443"
FT                   /protein_id="BAG07433.1"
FT                   /translation="MKQMKNPNETNGYVMLYTMQDKRSLDVLKKEKRFINKLEYASEHL
FT                   GDIYEFFREKYTYFVKQAETIVPKPDDVKLPIWCSVSNRNCMRPDENSVAYCLKVPAEK
FT                   IVYLDGSKWDYVLNNHYVPTDEDDLKQYYKYLKDHRMPNPFIIGSEDYRYLYPEEYKKI
FT                   YESYKKIFDIDNWNIFQVQGNIWEITEDMIIKVFYHDDPIDISEENLIDYL"
FT   CDS_pept        complement(15059..15718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07434"
FT                   /db_xref="GOA:B0S444"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B0S444"
FT                   /protein_id="BAG07434.1"
FT                   /translation="MTQKSESIEIMFILTLIGGFLDSYSYITRGGVFAFAQTGNLVLLS
FT                   INICYGNLDKIARYIMPIIAFILGTTLVRIFEKKYKYMKIVHWRQVIIVFEGIILALVG
FT                   FVPENLNKLACLLISFVCAMQIEAFRRFNGVDLMTTMCTGNLKKATDRLIDYFYTKDKN
FT                   LLKASFTTYAAILIFIMGCTIGTLTSFVFSTKSIFILPVVILIAFIIMHETERSKK"
FT   CDS_pept        15947..16135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07435"
FT                   /db_xref="GOA:B0S445"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:B0S445"
FT                   /protein_id="BAG07435.1"
FT                   /translation="MTSKTSREIIKMLKKDGWYLVSVNGSHHKFKHPVKKGIVTVAHPQ
FT                   KDFTTKTLKSIYKQAGW"
FT   CDS_pept        16174..16572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07436"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B0S446"
FT                   /protein_id="BAG07436.1"
FT                   /translation="MKNDILYPVVMSKEDGRYFAQCYDYEEIYAEGDTIEEALKNIKEV
FT                   FGLIFYDFEEDEYKKASNIEDIMKELKEGEFVVYVNVWLPYEFSKVKVVNTKKTLTIPN
FT                   HLNMLGQYKNINFSKILTEALEKELNVK"
FT   CDS_pept        complement(16646..17080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07437"
FT                   /db_xref="GOA:B0S447"
FT                   /db_xref="InterPro:IPR021486"
FT                   /db_xref="UniProtKB/TrEMBL:B0S447"
FT                   /protein_id="BAG07437.1"
FT                   /translation="MKNKLYKFIKIVICIFVIYNVVWWVVDHPIQSYFANKKLDQVLTL
FT                   QGTDRSNIKSIEKYNYANDNTTRFTIYFKDDPNTQYEYRYFLYSNVYLNPRKNNYNKMF
FT                   CFAYDMKLKKEKNMYDNHNYLARKPFADYIKYKKCLNTWK"
FT   CDS_pept        complement(17090..17488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07438"
FT                   /db_xref="InterPro:IPR021486"
FT                   /db_xref="UniProtKB/TrEMBL:B0S448"
FT                   /protein_id="BAG07438.1"
FT                   /translation="MKRLFKILLTIVIVYLIVGWTINHPVQYFCGKHRLYSFMQQQGTN
FT                   KDNILKISSSYDYKAGNHEFNVIFKDDPLVEYRYSYHLTHFSLSNLTHLFEDTNKISVD
FT                   IYEYATGSPIGNTYFKKAKYMKYTDGWH"
FT   CDS_pept        17596..17781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07439"
FT                   /db_xref="UniProtKB/TrEMBL:B0S449"
FT                   /protein_id="BAG07439.1"
FT                   /translation="MKKLKITSLNNVDGKNKKTSKTFSNLASNVTDEKLKNAADAINSL
FT                   ISASEKRIFVVEEKEL"
FT   CDS_pept        17793..18011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07440"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:B0S450"
FT                   /protein_id="BAG07440.1"
FT                   /translation="MQEYLQIKIGNDSNETMTINLTNYDRAKTDEQIKNAMDQILQTEV
FT                   FAGKTAAFNKKISADIITVDKKPMNIQ"
FT   CDS_pept        18350..19294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0023"
FT                   /product="putative zinc ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07441"
FT                   /db_xref="GOA:B0S451"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B0S451"
FT                   /protein_id="BAG07441.1"
FT                   /translation="MIKKFRKLLVLLALVLVFVTACSKQDSKTQDTKQEDTNKTNGKKT
FT                   IYATFFPVADLTKMIVQDKMDVKTIIKTNEEPHSFELTTDNMKDILKGDLVVYNGAGME
FT                   SFVDDLKKSMNDDGKFLDLSKGLTLLDSSSEGSDMKAINPHTWLSVKNAEKMLNTIYEK
FT                   VSAIDPENENFYKKNLEDSTAKFDLLDKKFEQELSKVKSKEKYFVVSHAAFNYLADDYG
FT                   LKQVAVTGISPEDEPTAKQLKTIADFVKDKHISTIFFEGKATPKVAETLAKNTNTKTST
FT                   LHTMENLDENQVAKGYLKLMEENLKSLVEAFNE"
FT   CDS_pept        19287..19949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0024"
FT                   /product="putative zinc ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07442"
FT                   /db_xref="GOA:B0S452"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S452"
FT                   /protein_id="BAG07442.1"
FT                   /translation="MSSDVISVSDLSFAYDKNLILDNVNFSVKEGDFVAIVGENGAGKS
FT                   TLMNLILHNLNNYDGEIKLFGTDIKEDNHFRDLAYISQNSVLSYRNFPTTIEEAVKIHL
FT                   SFLKKKTDASIYLKQVGLFEHRKKALDELSGGQLQRLGIVLALIKDAKIIFLDEPTSGI
FT                   DKKFADEFFQNLSTLKNQNKTVVVITHQLDLAKKYIDYAIKIKDKKSMIINNNEISL"
FT   CDS_pept        19957..20748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0025"
FT                   /product="putative zinc ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07443"
FT                   /db_xref="GOA:B0S453"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0S453"
FT                   /protein_id="BAG07443.1"
FT                   /translation="MDIFEYEFMQRAFIVGGLIAIILPCMGQVVLLKRLSMIGDTLSHS
FT                   SLAGLTIGLALGFNPLLAAIIACVFAGLSIEVIRNRLKSYQEISTVIILAASIGLAGIF
FT                   SSMVKNTNSISSYLFGSIVTISDEEFYLVIAVSAFVLISYSLLYKSLYLSIFDQKAASI
FT                   LGINIKFINFCVTFLSAIAISISAKTIGSLIVSSLLVLPSISAMQYTKTYKNTLIVSII
FT                   FSVIFVYLGLFISYALNLRPGSVIVLLSVIWLIISLIIKRK"
FT   CDS_pept        20757..23078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07444"
FT                   /db_xref="UniProtKB/TrEMBL:B0S454"
FT                   /protein_id="BAG07444.1"
FT                   /translation="MKNSNKKIILAVVLCSTILSSCSLFSKPEKKSEQTNESTKKVEQT
FT                   TDSNKQSTIKKDKTTEVLIDSEIKKEDIAKIVKHGDHWHVFTKDGREKITYKDPSKLQN
FT                   TSNFEMVSVVGKNRLKGENVVAIKKHGDHWHVYLRNGGEYLTYEDPSAMFPHIKVGTYV
FT                   GSHGDHRKHNSKRMDARTIAHEKQKIKQTIEKNDERVIKILKHGDHYHIYTSKGNEFVS
FT                   YTDPRSLYPNAEYGQYVGTHANRKQMIEKIIREDRQKQKQSSKKTLAKQNSDKLIKDEN
FT                   LVKVEDNKKKHNVVKILKHGDHWHIYTKNGEEFITYEDPSSKYPDVAVGTYVGSHTQEN
FT                   TQQPQQPRKDNKDNKPQENLPENPTDTPQNNKPDKKEEQPTEKTREQKIQELKITKVLG
FT                   KDGTVNEINRFDIVKILKHEDHYHIYDSNGNEAITYTNPQDLYPNAYFGNYEGTHNNSQ
FT                   NNNSQNNNEFKWPENITKIVDHKDHWHLYRGDEEVAVVRVNPKDHYPNAEYIKDYIDVG
FT                   NVEVEDTDVFNYDDIKPNKVEGIEAVLNDNLRNMTGYGKLTDGIAIMGTEDKQDNVFYW
FT                   LHGDHYHALSIKDLVKMEKSGALKGFTAKDVVATLKYKFQHPQEDLTYKSDLNIEEVIE
FT                   FLKSHYKINDSSRIFSIGQETVDIYSNDTTNSFHISQFEKKNGQIIFKGQLPQIPSDEE
FT                   LEKQQSEEVEESEETVDETNEKIGEKETAEPTNNKPVEDKVEEKQQENKENNKKQIPED
FT                   KQHPTTEKNQNTTEKNSANI"
FT   CDS_pept        complement(23139..23921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07445"
FT                   /db_xref="UniProtKB/TrEMBL:B0S455"
FT                   /protein_id="BAG07445.1"
FT                   /translation="MEFKNLGGMSVTQRVKSVEQPRGGYIKPSDFEENVLGDYDESIFD
FT                   DINVHASLIGMAVDYLSRFMLSKDLVESFKISIYGAISIKKEEDAAILLNNVTGLDDTS
FT                   IFNAIKLTGFDVVLRAGVQNYVPVESINPNEQAIAATRILVERTLKFFDIYGPIVSDGF
FT                   TFEGGYTDVISTGDGDYLTNDTLWDLKVLKNKFNKNHTLQILIYWRMGLRSDYEAFKNV
FT                   KYLGIFNPRKNTAYRFDVEKLSDDIIKEIDEKVIGYEN"
FT   CDS_pept        complement(24016..25128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0028"
FT                   /product="putative transglutaminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07446"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B0S456"
FT                   /protein_id="BAG07446.1"
FT                   /translation="MKKALKILLLLVFVISLSACAKNNTQETKQEETKKEDSNKVEIKK
FT                   EEKKEENFSERKGTLTTNVDLSKYEKGKSVKLWLPIPQDSEYQKITNVKVDLDEAHAKQ
FT                   QQTTDKLGNKMLYVEWDKEATDRKVSLSFDADRKEIKRGELAEKEDQAKKDELKEFLQP
FT                   NSMMPVDGKVKELADKITEGKTTDLDKVKAIYEWTIANMNRDESVKGCGTGEVEKLLDH
FT                   PQGKCTDIHSVFVSLCRAAGVPAREIFGVRMSKKPSDDETKGQHCWSEFYLQGHGWVKA
FT                   DPGDVLKAVLKQKLDKSDEKTKELADYYWGGMDSLRVALTTGRDLVLEPKQDDKPLNNF
FT                   GYPYAEVEGKALDYYNPADFEYNIKFEEAK"
FT   CDS_pept        complement(25198..25734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07447"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0S457"
FT                   /protein_id="BAG07447.1"
FT                   /translation="MKKFIKALTLFAMILVLATGCQKAAPGAAKGPGTAKDGNEQKIET
FT                   ASMKLVNAVNKGGYELVSTEDLNSWVEQKKDMVIVDTMPAKSFDKNRIPGAVNAELPMK
FT                   ADELKPEQKEAFLKALGEDKNKTVVVYCGFVGCARSDVGAVLAKEAGFTNVYRHPGGIV
FT                   AWMDAGYKIEGSAAK"
FT   CDS_pept        25971..27560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0030"
FT                   /product="antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07448"
FT                   /db_xref="GOA:B0S458"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B0S458"
FT                   /protein_id="BAG07448.1"
FT                   /translation="MYILIVAIVLLLALLAVKFSDKFGIPSFLLFILLGISFNFFGKDF
FT                   NNFKFVDEFSSVALLFIMFYGGFGTNLKMAKPVTTQGVIMASAGVVLTSVLTGVFCYFV
FT                   LKISFVESMLLGSVVGSTDFASVSSILRSKNLNLKYSTASMLEIESGSNDPTAYTMTMI
FT                   FLSILVGSKTSVFKLILLQVGIGLLIGFVMAKLTEKLIFKIDFSEDGLFTVLIISCALL
FT                   TFAISKNLGGNAFLSVYVLGIMIGNLEYYRKKEVVFFFDGFSGIMQIGLFFLLGLLANP
FT                   QSIVKAIPVAFLVMVFITIIARPLASILLLKPFGYKKNQLIVISAAGFRGAAAIAFAIM
FT                   VINSNAKLSVDLFHIIFVICLLSCLIQGSLFPIICRKTDMIDPDDTVLKTFNYYSSKSD
FT                   VGFIETQINEHSELVGKKVKEIGLNFDIIVAKIIRNNKLVIPRGDTVICANDTVVIGGK
FT                   SYFDPTGYGLIEITISDKNNWNGKKLKDIDMIDSELVVMIQGKNGEIIVPTGSVTLNAG
FT                   DKLIILKETVKF"
FT   CDS_pept        27629..28810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0031"
FT                   /product="cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07449"
FT                   /db_xref="GOA:B0S429"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B0S429"
FT                   /protein_id="BAG07449.1"
FT                   /translation="MIDYLIQKFVRNYEDTQSFATRRSYGNLSSAVGLFINLFLFSTKL
FT                   IIGLLTNSIAIMADAINNLSDCFSIVLMVLSFSMSTKPADEKHPYGHSRLEYIFSSLIT
FT                   ILVIYIGIKLVVASFKKIIHPEVITFNVYSLVVLIIAIVAKFWLSKFYHKISKKIDSDL
FT                   LMATSVDSRSDCISTSIVLISVVVFKLTSLNIDAYIGLLGGLIIIKNGYEMITDTVDKL
FT                   LGTGASAKFEREITDFITSYGGIYGAHDLRVHDYGPGYIFITADVQVDSSEEFIKLHSL
FT                   VDQIERDLIEKKGVYSTIHMDPLAVNNPKVQNLHEIVEKIIKDVNEDWILNDFRICPKK
FT                   EGDEMIFDIRVDIDEKMEDKEIVDIVKNKILSQITDYKPIIAIARGYQRRNFY"
FT   CDS_pept        28812..29450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0032"
FT                   /product="Ser/Thr and Tyr protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07450"
FT                   /db_xref="GOA:B0S430"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B0S430"
FT                   /protein_id="BAG07450.1"
FT                   /translation="MKNIKRIYDQNPLKFILAVYAVYLVWFFSMEKIPNRNYHIVYSKL
FT                   DDYIPFYKPAILIYSSWFLMLVIPFVYLLKKKSYDNLYNIIIPMFAAMFISLIIYVIYP
FT                   TALDIRVTDITGNDICSWIIRKIQGIDAPNNVCPSIHVSTTVIIYNQFRKILKDNKKSK
FT                   AFFLLWSVGICISTMLVKQHSIIDVVCGIILAHVILFVFNKKQNTAYHY"
FT   CDS_pept        29702..30061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07451"
FT                   /db_xref="GOA:B0S431"
FT                   /db_xref="UniProtKB/TrEMBL:B0S431"
FT                   /protein_id="BAG07451.1"
FT                   /translation="MKDISKKKIFYIGTIISVLIFTIGIIITIVHNPSENSVINFFESN
FT                   YFAEITMFIPFSIWAWLVIFAILFVKKNWVVVTLCILLAIPHIIFIIVLCAFSYSPLEI
FT                   LRWYVMILSFGIINI"
FT   CDS_pept        complement(30125..30625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07452"
FT                   /db_xref="GOA:B0S432"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:B0S432"
FT                   /protein_id="BAG07452.1"
FT                   /translation="MNTKKITTAAIFIALTTFFTMIVKIPVSPAMGYVNLGDFIILLST
FT                   VAFGPIIGMIAAAFGSALADLLLGYAAFAPFTFVVKGLMALVMGLFLKKVNNQKTSTVL
FT                   TAGVICELVMVVGYYFTSVILYGNKTAIATILPNSVQAAVNFVIFALIWKRFLKITESM
FT                   LKN"
FT   CDS_pept        31023..36905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0035"
FT                   /product="cell wall-associated serine proteinase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07453"
FT                   /db_xref="GOA:B0S433"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B0S433"
FT                   /protein_id="BAG07453.1"
FT                   /translation="MKPYSKKFLAGVLLFSLALPSATTFATNQTDSTTYAKLQEQGVKA
FT                   DQEVKVIVETSDKTAIEREPNVKSARFSKAVKASEAEVKKTSEKIETKLKKENVKVDKD
FT                   DEFSAVITGFSAKVKAKDIDKLRKQPGVKKVTTQMKAERPKVGASPSLASAPKMIKADT
FT                   LWDSKYNFTGQGMLISIIDTGVDPTHKDIQLESNDFQKYKSKEDVQKVIDANKLKGKWF
FT                   SNKIPYGYNYADESQEIRDSGIGGYHGMHVAGIVAANGNTETGGVRGVAPNAQLLAMKV
FT                   FSNDALVSTVYEEVWLKAIDDSVKLGADVLNMSLGMGSGYSREGVSPTNDAFKRAKKAG
FT                   VVCAVAMGNDRVTNWGGEGKTNLAINPDFGTTGHPAVADPSYSVASMENINMRGRVVEY
FT                   KDNDKVVEIPTGTAEGENEKTTTGMLPFVYVGKGNDQKKDYGDKVVKNKIVLAERGGAS
FT                   FNDKAELAASLGAKGIIIFNSKDGSNLSFMSGMENKDFPSVFISHDDGLKLIELLKKPN
FT                   QLINITKVQSVANPKAGQMSEFSSWGITPDLRLKPDIAGVGGQIYSTINNNQYTMMSGT
FT                   SMATPQVAGASALVMQRLYKDGLLVRKDGKPDPRQEFLTVLVMMNTATPIKDTEVKGAS
FT                   YYTPKQQGAGLVNLKNVAETYVTVTATGGKDTKPDGKLELGEVGEDFKATFKLKNYSDK
FT                   DITFTPKYISLKDEVKDGRYTEHSSEVKKETLPKVTVKAKSEVTYTATISTDKIDKNQF
FT                   AQGYVMFESDTDHPTLSVPYTGFKGNWSQPQFLDNMPDFSDKVNYKPLVYDNGGIDKSG
FT                   FMRRQEKGGWNYWNAWNVDGKPTVFVNSNKQEGMNVEVAPVITIMRNALDVKYDILDKD
FT                   GKTLRNLFIDPILLKVNGLYKGGDNQYRFEYVPGGAAWDFKDSKGKPVEEGNYIYQITG
FT                   HVDYKNAKEQKYQYNIVLDNTAPKLKGTYNPEKGTITVTAHDDGSGVFSVGYENIKTGE
FT                   WHEQQVREDHRYDDIGIVRDYSYEFKIADGFDLANLSIYAWDNARNVDGKDVDTQVKSS
FT                   DVQIDPIKIMVGDPVPTEEQVKKQIKAKVKDIPENAEFKILRNIENTEKPGEFTIVVSV
FT                   KNGEEQTNYTVPVKVEAIKPIELKVGDKPLITEQVKAHLDFLPKDAKVRIVKNVDTKEP
FT                   GEFGLKVEVKIDGKKIYYTIPVIVKAEEKKEEKPEEKPEEKQEVKDQTVYNLPVIKVEN
FT                   PDYYAAFGKYEDEKNPDAYKKIHVKGNVTKIKQLDHLTLTITKDGKKVEGTEVQEIKVN
FT                   KEGDSNFSFDHELDISNLEDGSVYELQIKAEGENVRGDGIQDTIIRRIRKDFVAPTVEY
FT                   TVEHKDEKAPMAKIKVKGHENMTYLEMYLDGNMLSRVDKTWDNFELKEGVDGEFEVEVP
FT                   LEVGENKFQIKAYDDAGNETLQEVVINRKDPNEKDPVNTKELADNMLKANSIVSVSEKY
FT                   DVTDEQIAELKKLIEEAKTAITEQQPQDKVDAVNKKLTDALAKIKEKEVKKVDKKQLIG
FT                   QKEDAQNLLDKKEVKLTDEQQKALQDLIKKAEDLTKKEDATQEEVDKLAKEIKDEIAKI
FT                   QEAGKENPTKPGKEDPTKPGKEDPTKPGKEDPTKPGKEDPTKPGKEDPTKPGKEDPTKP
FT                   GKEDPTKPGKENPANPGTTTPSVPGTPTPAPKTPAQTTKATTRVAGVDRINTAVEVSKK
FT                   YYNSAETVIIANYEKFADSLSASALSKALKAPILLVQKDQLDSVVAQEINRLGAKNVVV
FT                   IGGDHSVDKAKNSLAKYNVQTIAGSDRYETSAKIAQEIIKRTGTTQAVIASGETFADAL
FT                   TVAPLANKHNMPILLVQPNNIPKATQEVLKQINKVIIVGGEKTISNEVANKLPNPTRIA
FT                   GANRYETAKKIYEYGFKDRKEVNIANGTNFADSLVIGSIDCPILLAESNEVPESTKQAI
FT                   KDSKFEKVNVFGGENSIGESVVKELIK"
FT   CDS_pept        37243..41907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0036"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07454"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B0S434"
FT                   /protein_id="BAG07454.1"
FT                   /translation="MRKILSIIIAFLMVFNTSVMAIAAEEGYNDWNAKLPTKLLDVDQS
FT                   YIDSHKDELFNGENVVEDPNLREAVNYMYKRKGDLKKLDVTAEMMKHIIELSPEKCVAH
FT                   NPGEKDFQVKSLKGIEYATNLEWASLVNQPIEDLSPLKDLTKIRLLDIRNNDKVKDFEF
FT                   LKKLNNLEQVDMHEVYHVDLSNFVGKSKLRSLNLQSCKISDLKPLKDLKELRYLNLSFN
FT                   KIDNIEALKDLTNLRFLDISNQNRFDYIAGVERPMIDSLKPLEGLAELSELAFSSHNVS
FT                   DLTPLTKLTKLKKVTLTNNKIKDSEFKKLNSDIEILGKQPQEVKKTTEPESKPEDSMLK
FT                   IISLNDKPESTQQIFEKSYEHKDAPKLEELKNALPKTIKAKIQSNSKEDNSLENLGFKD
FT                   GELKLLILDDKNKPVVDGTEVKLTTVFQAIYPFLTAKTEKGIAVFKKLVDGTTYTLKPA
FT                   TKEINEKLQFTVKKGKLKESYSLNNAGNITEKNFDYGDKIDSKYFVGRIIDPSAKRLEP
FT                   YEVKEDANKSEEITESLNIEWNNSTPAYEQKEGTYVFEGTLKSDKKIDNINDFKVTAKV
FT                   TIKQEKKKDESYNDWSAVMPEHSLDIDNEYIKNNEEKLFNGENVVEDANLRKTINALYH
FT                   RKGDDTQGVTAEMMKHLIYLSPEECTCHNTSEIKVQIKSIKGLEYASNLEWISLVNQPI
FT                   KDLSPLKDLTKIRYLDIRNNYEVKNFDFLKNLKNLEQADVHGTSLGSLANFADKTKLRS
FT                   LHANSTNVSDLSPLKSLKELRYLSVAYNNIDNIEALKDLTNLRFLDISNQFRYNYVTDK
FT                   ETPKINSLKPIENMVELKELSFSSHNISELTPLTKLKKLEKITLTNNKIPQSEFKKLNP
FT                   NIVVFGSDNQEIEEQQVPQKEQDDAKYTIIQQPWGNTRVRLLVTKEYKLKDAPKYEDVI
FT                   KELPKKTSVLVKKEVANKKETSNLGYKDKKLKFKILDNSNKPVVDGTVVKLKPSLIWNQ
FT                   ELSANTKDGIAEFSGLKNASTYTLKPSVSGKIINETIKVTIKDDKLKLEYSLNKEGNVT
FT                   EKTFDYGKSIEEKYFVGRIINETDKRLDMYAPSVDKPVVQEVENEIGIKWTKSTPLYEQ
FT                   KEGDYIIEGVLESDKKIENISDFKVTAKILVKKDDSKKPGEGTTPGEEKPGDKPGKEDP
FT                   TKPEKPGKEDPTKPEKPGKEDPAKPEKPGKEDPAKPEKPGDKPGDKDPDQPGDKPGDKD
FT                   PDQPGTVTPTPAPTPAPTPTPAPTPTPTPSVPGTPTPAQTTKETTKETTRVAGVDRINT
FT                   AVEVSKKYYKSAETVIIANYEKFADSLSASALSKALKAPILLVKKDQLDSVVAQEIKRL
FT                   GAKNVVVIGGEQSVDEAKNSLSKYNVQTIAGSDRYETSAKIAQEIIKRTGTTQAVIASG
FT                   ETFADALTVAPLANKNNMPILLVQPNNIPKATQEVLKQINKAIIVGGEKTISKEVANKL
FT                   PNATRIAGANRYETAKKIYEYGFKDRSEVNIANGTNFADSLVIGSIDCPILLAESNEVP
FT                   ESTKQAIKDSKFEKVNVFGGENSIDESVVKELIK"
FT   CDS_pept        42004..43179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0037"
FT                   /product="putative collagen adhesion protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07455"
FT                   /db_xref="GOA:B0S435"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B0S435"
FT                   /protein_id="BAG07455.1"
FT                   /translation="MKILKKILFVLVVIMMIPQITNASEIDKIDNIINPNRHQNDSVSK
FT                   KIMQNFKANLSFAVKQVLDENNATFKITVLDKKSRPIPKVELIVTDVETGKSRENQTNE
FT                   KGEIQFRGLAPTEHTIKIVSAPSGYFFDEDVITLENNVVNTKTIFGKTKEDKDKTYKVT
FT                   YRITDKYGIALKEIEVRLQSGNKKYISKTDVFGYAHFEVEDTGKYEVYVDKMSEYFEEH
FT                   DNFKIDDIEINPNSEESIYSSQINEKMKKEFESALIINVKKADKPQEKVLVSLKDRRTD
FT                   MYAFQYTNEEGKVVFDNLFPGNYVLTVNNEDRLTENGVGAVHLIEGQVREFDVVLSQSD
FT                   LSKKSLVVEKKEHVDEKLPESGSKDERMMILFSLGIIVLAYLYLNKQKREI"
FT   CDS_pept        complement(43214..43666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0038"
FT                   /product="putative small-multidrug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07456"
FT                   /db_xref="GOA:B0S436"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:B0S436"
FT                   /protein_id="BAG07456.1"
FT                   /translation="MSKIIYMFILSMLPVLEIRGSMIYALANNINPALAFFLSVIGNIL
FT                   PIPFLILLTQKVLQWLDTIDTFKPFVDWINKKAQEKSKTIDKYGRLGLYILVAIPLPGT
FT                   GAWTGALVASFLGLSPKKSMLPITLGVITAGTIVMLSTMGVLNVIK"
FT   CDS_pept        complement(43675..44325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0039"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07457"
FT                   /db_xref="GOA:B0S437"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0S437"
FT                   /protein_id="BAG07457.1"
FT                   /translation="MIKYAIFDMDGTLINSMYKWNRVILDYIDDLGIKPDDDFIKKIKT
FT                   KTLLTSIDYIHETFDIKKTTDDGLNFIYYTIRNGYMNEFDLKPGVVDMLEKLKSMGIKM
FT                   CVATATEDHLAIPALEKQGILDYFEFVQTCKSVGYHKYENEYWNNALEKLGSNVDNTIV
FT                   FEDALYCIDTVDKMGFKVVGITDESTVNDYDVIDEKVEQHIESYDELDYDLFK"
FT   CDS_pept        44487..45719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0040"
FT                   /product="aminopeptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07458"
FT                   /db_xref="GOA:B0S438"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B0S438"
FT                   /protein_id="BAG07458.1"
FT                   /translation="MENFDKKLNNYARLIIEKGINANDRPLVIRCAVERADFARLLVKY
FT                   AYEKGASEVIMEWNDDEINRMYYENASEEALKDVPDFIVEKSKYYFEKKAGVISVSCQD
FT                   PENLKGVDADRVQMRSKVFAEKMKPIQKYTMNDINSWCVVAAPSVGWAKRVFPELSEEE
FT                   AVEKLWDQIFKATRSDTEDPIKAWDEHLDTMDKHAEFMNKHQFVKLHYTNSLGTDLTIE
FT                   LPKGHVWMAAQSTDNYGNVFVPNIPTEEVFTAPHKDKVNGVVYSTKPLNYGGNTIDKMR
FT                   FEFKNGKVVDFDAEVGKETLKNMFDTDENGKYLGEVALVPYESPISKSNVTFIKTLYDE
FT                   NASCHLAFGQAYPTCVEGGVDMTDDELKENGINDSLIHVDFMVGSKDMRIVGTTADGKE
FT                   IEVFKEGNWAI"
FT   CDS_pept        45719..47515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0041"
FT                   /product="oligoendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07459"
FT                   /db_xref="GOA:B0S439"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B0S439"
FT                   /protein_id="BAG07459.1"
FT                   /translation="MDILKYCKREEADPQYMWDLSALYKTEEEFEKAVKTIDLMADDFK
FT                   KNYENKLKSADIIKNAMDDYRDIVANIDRIAHYASLDVEADGHNEKSQKRAMATFTKIA
FT                   DIENKMSFFETELVQVDEQTLEEVKNDTNNTRYIDDLLKKKEHILSKEVENAISKFSQT
FT                   FSSFYEIYNTTKIHDITFPDFEVNGKKYEMTYNLFEGVYDNDPDTDLRRKSYEVFYNEL
FT                   AKYKNTTAMIYLSHCQAEKAESELRGYDSVIDFLLDRQNISRELYDRQLDVIMQELPKH
FT                   MRKYAQIIKKEYDLDQVTFMDLKLDVENSFSKNISVEDARNLLKDGLSILGEDYSKMLD
FT                   RAFDEKWIDFVNTFGKSTGAFCASPFLAHPYVLISWTGKLTEAIVLSHELGHAGQSYIS
FT                   QKTQNVLDNDPSMYFVESPSTTNELIMSRYLLEKATTDQERRYLSGQIISRTYFHNFVT
FT                   HFIEGYYQREVYKLIDKKEGFTADDLSRIFKETLQKFWGEDVEINEGSELTWMRQPHYY
FT                   MGLYPYTYSAGLTIGTQVSKMIVEEGKPAADRWLKALALGSTEDSVGIAKAAGVDITTD
FT                   KPLKDTIEYIGKVIDDIEKYDK"
FT   CDS_pept        47566..48450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0042"
FT                   /product="putative antibiotic ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07460"
FT                   /db_xref="GOA:B0S440"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S440"
FT                   /protein_id="BAG07460.1"
FT                   /translation="MYIQFNNIKKSFDGNTVLDVENLQIEKGEIVSIIGKNGSGKSTLI
FT                   KILCGLLYQDQGECSVDNISNKNSKIREHTKLVLESGGGYYDYLTATENIMYFLGLNHV
FT                   NYNEDEVHNLMSKLDFTEFKDKKVSELSQGNRQKLSLIVTLLTNPDIICLDEPTNGLDI
FT                   NSMNILLNFLHKIAVEDQKTVIFTSHDLSFMKNINSRLILINEGKIVLDKPSKQLFDSK
FT                   DLQKDIIEIENTDRNLLDNLKKTKYEFTDNSIILSVYDEAEKEFLLKNCDIISMRKESL
FT                   TAEDVYFRVISNV"
FT   CDS_pept        48443..49195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0043"
FT                   /product="putative antibiotic ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07461"
FT                   /db_xref="GOA:B0S441"
FT                   /db_xref="UniProtKB/TrEMBL:B0S441"
FT                   /protein_id="BAG07461.1"
FT                   /translation="MFSKLLLEFNRDFSEIKKYKFNVIFANIAVLLMSLFIIDGLFVKE
FT                   KEIVFLMMILWYYATYAIESPTFLIQNEITDRTLILIVQSKTGILSVVLYRNLVECLMN
FT                   TIKVIVIFTLIFVSVDFDYSKFNHIPIMILVMVVSVFILYQLGTFLSSFTLLYKRLGSF
FT                   VALAETYMLFFGDITVKVNNKLLLFINKIIFPFNNARTIFTQLQLNNVRYDLIVQLLIQ
FT                   AVVLSVLVKISYDKNIQKSMKRGNLYGI"
FT   CDS_pept        49185..49856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0044"
FT                   /product="putative antibiotic ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07462"
FT                   /db_xref="GOA:B0RZL5"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZL5"
FT                   /protein_id="BAG07462.1"
FT                   /translation="MGYKYGELRKYIDENKNYKIEFFSKLISDIIMLAGVSFMLKSTDN
FT                   WNNESFTYFLIWYLLQTVLFELVKSIEFEIKSDGLINMISSRTSITMIYFKRSIVWLVK
FT                   AAILFAIVITLSGNGLNGIIQFKPNLILAIIFSLILMYGVFFLFMALTFIYERVASFTG
FT                   FITTAFLIFGYKLTITQEIRKIIVGNQADMKKIVLNLILLYAVSYHFMKKARMKLQYRG
FT                   F"
FT   CDS_pept        49856..51157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0045"
FT                   /product="macrolide-efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07463"
FT                   /db_xref="GOA:B0RZL6"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZL6"
FT                   /protein_id="BAG07463.1"
FT                   /translation="MNEKFKKFMVVWFGQFVSMLGSGISSFGLSLWIFMMTKSATTFAM
FT                   TFLVQILPGIIFAPFAGSMADRKQRKHIIVLTDSLDAVLKVILMILLATGSMKVWMVYP
FT                   LTFLSQTLGTFQNPAFNATIPLLVEKKDIPRANGFMQLIRAIQNMLAPLIAGALFPFIG
FT                   LTGLFAIDFVTFFVAILTILPQKIEQEIEEVKESNFTKTIVSDLKIAFEVLKQKQGFIQ
FT                   IIVVFSILNFVANIAMVLVGPLVMSNFDTKIYGLVNSVSGIAMVLGGVISGAIPSEKNK
FT                   VRSIFLSLIICSIGLVVMGINYSWVVIAVGFFLFMIPTPYANGTFGSLMQLKIETKMLG
FT                   RVGSLVDCLMKIITPIAIILAGFLADNVFNPLLIKGGKLSDTFIAKIIGVGNGRGIGLL
FT                   FVICGTILLIICVMMLLNKNINRLEELNPDVIND"
FT   CDS_pept        51213..51572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0046"
FT                   /product="superoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07464"
FT                   /db_xref="GOA:B0RZL7"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZL7"
FT                   /protein_id="BAG07464.1"
FT                   /translation="MAKLTETVQSGDWKAEKHVPVIHIDKKDDGFKVCAIVGEEIEHPN
FT                   TFEHHIAWIKVFFQPEGEKFPVEVASYQAAAHGEGEVFTKPHAHAYVKSTKPGKVFALS
FT                   YCNIHGLWESAEEVK"
FT   CDS_pept        51715..52617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07465"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZL8"
FT                   /protein_id="BAG07465.1"
FT                   /translation="MYLTVKQVAEKWKISDRRVRALCAQGKIDGAFQDGRLWKIPIDAQ
FT                   KPSDSRYKSTNSLLSQIDLKKQELDKKRRLTEGEVARLNEEFAVEYTYNSNAIEGNTLT
FT                   LRETDLVLKGLTIDKKPLKDHLEVIGHKEAFDFVRELVEKEADLNENVIKQIHYLVLSD
FT                   KIQDRGVYRRVPVKIMGATNEPVQPYLIEPKMNELMHNYKKNTEHIVSKLARFHIEFES
FT                   IHPFIDGNGRTGRLLVNLELMKAGYPPIDIKFKDRLTYYKAFDDYHEKHSTKTMENLFS
FT                   KYLNERLQHYLDILSDGNN"
FT   CDS_pept        53034..60317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07466"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZL9"
FT                   /protein_id="BAG07466.1"
FT                   /translation="MRHSIRKEIRRFLCFLMTFIMILTSMPVHLLAANGNHDNLSNNRS
FT                   EIINNKTPVKVAKPEEGKTAADLIENPKQQAIYTLRKEYKVQKGDKYEINYQPYIASVG
FT                   EAASPEEKAKVKKEITLPDLAGYDKSHLDDTFTITYDTVKNAANGKNETGDKTNGLKYS
FT                   ADEDFRYKAKSNSIKIKHLFQDMKDFTKYTNPGGEDKPEKITTQNGNTGSTMEVSPLNE
FT                   NDRRGFVPESDFITMRVPEDATDFMLEYRYNRAHYNVDFDTMGGTALPTRTYYYDQEIP
FT                   KIEKENIPTKEGCVFKGWMPSHEIKDKDGKNYPKGQIINKADGKPALDLDVHLKMPALL
FT                   LGTDIKSRERLKFTAVWEDKKKADYAIQFWAEKADHADGASLQDKYDYMSTRVYKDKDT
FT                   GMRPELDKEPVNGLKFPDLDQARLNKIWAGTKFNRGHDLFLNKFYVYNKDLTADQNKDP
FT                   ANVNLVKSVDATGKTVYNIYYDRQVYDLYFTKSNAQPEKNTIYPEIWGYDKAKGEAVML
FT                   GGPGKPYHYKARFNEMMYKWPNDAKQTKGFTPGYQSFGWGPNYTRPNWPTHLDTPPYRL
FT                   NADEFLDMANYDSWGGYAKPIDKGDGTSIDLKWFDFKTLSFGIKQDSPSIPHHMDFWMD
FT                   GFKKGETIIRYDLVRTKADTEASDYGHKYPKVTGFTPYGYNPRSAWPTIAEGSEEDGRV
FT                   NEERINDLNDERDEITPNTCGSYYNNYGTKLPIGQLDFISHFFSDSDEFGDVKEDGQEF
FT                   TENGYLQFHYTRNKYPLRFNYDPSIIRDDSYFKPTNSLDTFYEFPLKVLSPDLVDSKLD
FT                   REDKEYFKDDPKNFLDDPKNLQTLGLTDLVFTDPKDGKLKVKRPDNLSDQMVFKGWALD
FT                   PAGTKLVWENPKETMPFHPVNLYAKWGEPDYKWKVTFDPNGGKLRNIKEENLTTERKKI
FT                   QEGDIGQEEVNTYAKKGYLKEEPTTKDGKQIFTVIQRQKLVEPVKPERKGYDFMGWEVV
FT                   RYKKDNKGDYTDEVDTSYRDKYGVPELYTFGNDVVGPVYLKAIWNPNQRVDVKVVHHIL
FT                   DKDCKKDKEITEWLEDKRTGYYTATVGDKQGETLILAPNEELEKTTDEKIKELYKKYND
FT                   EFKFNNTYFQNQRIEPEKIKDPNTGEMIDNPAYKGNEFHFFYRPFRQREYKVNYIDERF
FT                   KGKETEDGAAIIKQELVKNGNRHYDARNYRQIPGWKLVSAPQQQLFFDVNEKTNEFLGI
FT                   NGTGKKEITFYYKDVRVIEVPGNVDPPKGYVRVTYKIDEKDKGGAFTDKDGKSVKELHY
FT                   DVIKGLKSDLLPVPQELKDGEEKVAGKYYVTPETGKKFTKWDNKPLLNKNTIINEAHEF
FT                   TAYFEWSGLSASGLVRTEAFKDPNGKWTNDFAPTIEQLKKQLVWREKDQVKPLPAGTEI
FT                   KLFDEAGNELKSDEDVFNLVNEKKRADTEELVRTVNVKAKVTFTNGKDPQELDIPITVY
FT                   KNVYEALNKAGDKPLFLKEAEGKEAKDGGLKDILKDNTENRYIKVTIKPNKDFKNKDDK
FT                   VYYVNPNAWVEIPELKVEDSEAAGTGFINWTADKAAQNEKQEKNGIFKFDKRHKFTEDT
FT                   IITPVDAKDVVEQTDPNKKPDVPKSYVKVIVKTTDKATDKTAFEKTFWVNPTKEVTIDV
FT                   TNPIGKTVAADTTKPGTVGYTMNFSKWETEDKAKTWEDKIVGKFEKETTIIAKYSVTPE
FT                   KIKDQVPSSDTVHTPQGKTPTVDEIKGKITPPEGKTISKVTIVKDPDVNTPGDSKVQVI
FT                   VEYTDGSSVGTNEKPIEIPVKVHEPIVKSNPDGSKPKDAMDNYVKVIFKAGTGGTVSGD
FT                   LVYYVSPEVEVDMTNSAKAITKTPNIGYYVNGEKWTNKDNKTLKDTFKDPETEFVFNFD
FT                   KSKDIVEKTDDNVKKPDGYVEVIFKTEDENKGKLDGNVKEKIYYVNPNAGIKLVKLADG
FT                   KMAGEKQLAVPKTAPAANYEFDKWFEEIDTENAITSERIHVAKFKLAKVTLTYEAGEGA
FT                   KGEVPAKVEVDHGTKVRLARPDKLSKDNAIFAGWKLDDDEKIYKPGDQVTLEKARTATA
FT                   QWEENPHTVKFISRDVEIGQQKVKDNEKLKAVNEPKLDGKVFMGWKEKGKENEKDYFDL
FT                   ATPITSDKTLIAIWQDSVQKIDENDPVEKQFIKVTFLKGSHGTLKDGETSNLEKVTYKV
FT                   AKGYDFEQAKAAGMTVPAIAPAKYYKAVDANKGWDNALDLTLAAGKIEKVFTALYKPKA
FT                   DVIPVDPKVTDEEQIKKETPEGMVLVEFKVSDDSSFYIPKNAKYYVKKETEVRVPTPVV
FT                   LEKTTDTVFNGWQDVNLVEEAINPTDKDPKAKKFIWVKQSFNEDTVISDEKTFDIKLII
FT                   TKPSAGDKRIYIEQMSDNSKGKIELIRNGNVIESVENKKFRRRRKEYNVFDFNNELQSG
FT                   DLIRYWQESSTKISDYTTEHIN"
FT   CDS_pept        60332..68017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0049"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07467"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM0"
FT                   /protein_id="BAG07467.1"
FT                   /translation="MLIMKKRILSGILAFILFVQVFALNISYAKDNKHSSDNLVKIGEL
FT                   SKNNYPKIDSATLLRVAKEERNKKKGKRMERGATLFSAKSPYINGQQPADPDKPKYWAN
FT                   VQGELTTRGIDGTTFDWDKVLGKGQKVKLLFTQTNGNVMTGVTYTLLVDKGGTYTWHGS
FT                   DGKPTYLPLYDVNGNPYTYNVQIERNYSKDIQLVIQESNGTPGVSWKPEGDKQVATISF
FT                   LNIKIQQVASTKFVSEWHTDVNEADRPQIEGYFKVDDETDNKFNFPKNDTTRTVLRSSF
FT                   LENFEEDEDNGPWSFLSSELETTPKTVEVKTDTQGLTFKEKDGVKTVKSGDHKFKYDFK
FT                   YDVINGGKLTMTEVIPVTFDANGGKFADFTAPDTEKQIVKEVDYDGTLTDKAEEPKKER
FT                   ETFKGWGIKDQTSGKLTPVKDSDFLNIKEAKTFYAIWDNNDIVADQLEVKESFKDGTVY
FT                   VNDFIPTLDQLKGQVKIKDANGDSQALETTDTFEILNDSGDAITGDALKDYLYEKLREK
FT                   ANPKGEPTRLETVRAKITHKNGTTQTVDIPIKVIKNIYEAKTLTEKPYYVPDDYVKVTL
FT                   DPTTKAKDPQKTYYYVNPKAKVVIPGKDPKGTDGNVFTKWLIDGTDTEYKLAEKPRYKF
FT                   SDETTIKAQYDKEKQGIVKIAYVDENKQPIDPKYHVDGQKYPSEKFGKLGASAEEGEFV
FT                   KQGPAFNGYIGGDRAQLKSEKYKNPAEYTVTYQYYKKVTIKEPTNKNIYFPVIFDANEG
FT                   KFESDPKDKKTVYVYFDGNNATVEKVTFKEVKDEFDKAYKNPTKDGFDFKEWQNAKTDG
FT                   IKPADDYEIQFKDWDWDADPDNGYVPETFYAHYGKASALVKYLELGGESIADKYKIDGV
FT                   DYPTEKDGKLDEAIRTDVYTKDTAPKFIGYKFNRIELNPADGKYSLDKKATIKIYYEKL
FT                   ADVIPDTTPEDDSDKPEGYVTVKFLPGDNGSLTGTTKFYVNPKSGKKNSDLTEPTIKAN
FT                   IGYKVADQKWDPKFDTETVIKEDKTYTAQYTDGTDVIPVPDPTNPPEKPEGYVTVKFDL
FT                   DGKGTSTDTKEFYVNPNKEVEITAPTVTGINNYSQKTGADAWSPTFATKAKYAKDKTFV
FT                   AQYTFGKDIIPQKPGENKPVVPDNYVKVEFKKGDHGLISSEETTIYWVNPDKEVDLTDK
FT                   APKVVANAEYKHTGWDKVLKDTFKNTTVITAQYKKKVETTNPNDTENYVKVDFVAEKNG
FT                   SIKAGETATYWVLKDETVELKTPAVEAKANYAFKAWNPEVKTSYSQDITHKAVFAYTGD
FT                   NVVPQKPGEDKPDVPDDFVKVIYNQGTNGTIDANATTTYWVNPKVKVTVTAPQVNANDD
FT                   YKHMAWTYGSKEETNLESVTDSFKAEETTITAKYLKKVLEDEPKTDKDAYVKVTFKSET
FT                   NGKLAGDNTEKSYWVLKDTPVSLTPPSVTANNGYKFIKYDPEVQTSYNIDTTHKAQYKK
FT                   IIETKDPKDKDYVKVSFDAAKQGTIKAGSNAEVWVLKDETIDPTAITPELEVKEKYAFE
FT                   KWDPAVQTSYSEDTKHTASYTYNGDDVVPQKPGENKPNVPDNFVKVTFVAGDHGSIANT
FT                   ETNIFWVNPEKQVTLTAPNLVANKGYKHMAWTYGSKEETNLLSVKDTFTEKETTITAKY
FT                   LKKVLEDEPETDKDAYVKVTFKSEANGKLAGDKTEKSYWVLKNTDVSINGPNVSPNSGF
FT                   SFTEWSPAIKTNYDADTTHTAQYKSKDKVLTQDPKDSDYIKVIFNANGGKIGLDNSKDL
FT                   WVLKGIATFADAKAKVADPTKVNSTFKGWQDKVSEGNQVKDTKVLNTDGETFYAAWTDK
FT                   GKIIEDPSSDTPDPDYVRLTFDATADGKIGDTDKTSKVIDVLKGTPYTDKDLKDVIGKI
FT                   KAVPNNAEKAFDKWTPAVPTTGFVDTATFVASYADYKNIIPYDPKDPMARPDGYVKVTF
FT                   KAENGLNLTEEKAYYVKKNAGIKLGNAELVKPAYEAQTGYKFDKWDKEDSLVIEATDIV
FT                   VTAKATKLDNVIPEKDEHGKQNEKPEGYITVTFSAEENGKLKGTSVYYVNPDKAVVLQD
FT                   KAPEVTPNTGFDFAGWDISIAKAIKYNDGDVIKARYNEKGDVIPQEKTDGTDKPAGYLT
FT                   VTFDKGDHGELSGKTVYYVKPNKEVTVPAPTVTPNTGFEFEKWDKELTQTFKEDTTITA
FT                   QYKKSTGTTPGDNPGGTTPGDKPGDKPGDNPGGTTPGDKPGDKPGDNPGGTTPGGTTPG
FT                   TNPETPGENPETPGTVPENPGAIPGTKPGVVEKHGNRYVERVAGKNRVRTAINTSNRFF
FT                   KKSKYVIIADSGNYPDALTATVLAHVLDCPILLNNTRYLEDDVAREIVRLGASEVIIVG
FT                   GHKSISENVKSQLAKYDQNKVQRIWGRDRYVTSSELAYEIERLTGKVNKAIIASGENFP
FT                   DALATAPLGSKEIAPILLVTRNQMDKKVSKALKDLNIKRVYVAGGQNSVSKKLEAQLPQ
FT                   VIRRFSGQDRYETAILVASYTYPESKEVFVASGETFPDALVIGPVCARRKAPILLSKST
FT                   PVKSTDDYIEKSKIEYLYIIGGTNTIHVDTAHKYAIED"
FT   CDS_pept        68142..69050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0050"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07468"
FT                   /db_xref="GOA:B0RZM1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM1"
FT                   /protein_id="BAG07468.1"
FT                   /translation="MIDGFYDRYMYTPMPEMHNEMIPVTVGCSYGKCIYCDLNVGKKFK
FT                   VFDIEDVKKYIRDRKDFYEDKRFTPKKFTLLEGNALCLKNDYLTEILKEIKKNFPNMKY
FT                   VSCFSRSDDILRKTDNELLELKNLGLDRICVGIESGSDWVLSYHKKGVTSQEQLTALHR
FT                   LDNLGIKYSVYIMLGLGGEAHSREHVMKTAEFLNKVNPFEIVVVNLVLFKNAKLIENVR
FT                   NQDFKRVSIRQQIIEEIMLVQNLNKRCIYNGTHKTKAVAVTSVIPDKKYEIIAVLKQRL
FT                   EDDDKEMNKKERKKWDRWDEG"
FT   CDS_pept        69050..69778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0051"
FT                   /product="putative biotin operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07469"
FT                   /db_xref="GOA:B0RZM2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM2"
FT                   /protein_id="BAG07469.1"
FT                   /translation="MDTEKIKKQTGINKVIFKKEVTSTNDEILNEKQDDTLMIAFFQSK
FT                   GKGRYGRKFFSPENGLYFSYLVNEEMTFQQSQFITPIMGIAVSYAIDEVFGVNTSIKWV
FT                   NDILLEKKKICGILTECKVEKNICHDIVVGVGINVYQTDFPEDIKDTAGFIEEKDDTDK
FT                   REDLVIKIMQNFKRFWSEDRDNLVEKYRNKATFIGNEIKVHKNGDYVKAVAMNINDDFS
FT                   LKVKYDDGTIEDLNIGEIFL"
FT   CDS_pept        complement(69791..70018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07470"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM3"
FT                   /protein_id="BAG07470.1"
FT                   /translation="MSRKINVRFNENEINALKKIADTHGVGLSTMIKTLALEKLSDDYD
FT                   IKVIKEYEESKKNKKIELVDHDDAWKEIDQ"
FT   CDS_pept        70144..70512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0053"
FT                   /product="putative transcriptional regulator ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07471"
FT                   /db_xref="GOA:B0RZM4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM4"
FT                   /protein_id="BAG07471.1"
FT                   /translation="MIDIDKFNDEKCEVTLIHEDNVKKAINELPDDELIADLSDMFKIF
FT                   GDQTRVKILMALESGELCVCDIAAVMDMSQSAISHQLRVLKQSNIVKTRRQGKVVYYSI
FT                   SDDHVKEIFDIAIVHVQE"
FT   CDS_pept        70557..70772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0054"
FT                   /product="putative cation-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07472"
FT                   /db_xref="GOA:B0RZM5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM5"
FT                   /protein_id="BAG07472.1"
FT                   /translation="MKRRYTLENLGCANCAAKMEEKIKELDGVNSVTVNFITTKMVLDV
FT                   EDDKFDTVLAQAKDIIKSIEPLVEVK"
FT   CDS_pept        70772..72583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0055"
FT                   /product="putative cation-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07473"
FT                   /db_xref="GOA:B0RZM6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM6"
FT                   /protein_id="BAG07473.1"
FT                   /translation="MNKEIKLTIVSAILFAIGFFIEQPYVKLAVFAVSYLIVGIPVIKL
FT                   AFLNLKNGQLFDENFLMMIATVGAFIIGEYAEAVAVMLFYQIGEIFQDKAVGKSRDSIK
FT                   ELMDIAPTFANLKTEDGYDKVDPYDVSVGDIIVIKPGEKVPLDCVVVDGSSMVDTKALT
FT                   GESVPITVAKGEELLSGYIVVDKVLNAKVTKDFENSAVTKILDLVENASSQKSQQEKFI
FT                   TKFARVYTPVVVFVAAALAILMPLILKQPFQVWLYRALTFLVISCPCALVISVPLSFFS
FT                   GIGASSKAGILVKGSNYIEKLAETDTVVMDKTGTLTQGVFKVVEAKSVGFSDEEMLQYV
FT                   ASAEKSSNHPIAQSIIDYYGDKEYLNLDSAENIAGQGIQAVINGKQILAGNAKLLKDVE
FT                   FEPIDTTDTVVYVAIDGKFAGYIKIADKIKQDSAQAIVDMKNVGIKKTYMLTGDNESVA
FT                   KSVAENLKIDEYKSKLLPQDKVEIVKDLIEKGRKVAFVGDGINDAPVLALSDVGISMGQ
FT                   IGSDAAIEASDVVIMTDELTKIAQAIKISKKTLKIAKQNAYFAIGVKIIVLILSALGLT
FT                   NMWAAIFADVGVTVLAILNSFRAMRVS"
FT   CDS_pept        72630..72941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07474"
FT                   /db_xref="GOA:B0RZM7"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM7"
FT                   /protein_id="BAG07474.1"
FT                   /translation="MKIVGYVFLGIFAIALIYGIYSISRILAIAKIRKNVNSEKVWQTI
FT                   SQNNRQPVALDRILMRKNNRKFTKKEQEMILKRISTCRKCILVGLLALILAIVFIAIG"
FT   CDS_pept        complement(72981..73556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07475"
FT                   /db_xref="GOA:B0RZQ6"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZQ6"
FT                   /protein_id="BAG07475.1"
FT                   /translation="MKIKTHKLVQCAVLAALCFITFTYLQIKVPVPGGDFTSIHFGNVF
FT                   LVLAALLLGGLYGGLAGAIGMTIADIMDPVYIMVAPKTFVLKLCIGLIVGAIAHKSKKI
FT                   NESNDNKYILKWAVIASCAGMLFNVFADPLVGYFYKLYVLGQPQQIASALAKISAGVTF
FT                   FNAVVTVIVANILYMAVRPVLKRSHLLD"
FT   CDS_pept        73918..77964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07476"
FT                   /db_xref="GOA:B0RZQ7"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR032237"
FT                   /db_xref="InterPro:IPR032239"
FT                   /db_xref="InterPro:IPR032240"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZQ7"
FT                   /protein_id="BAG07476.1"
FT                   /translation="MKSEKKYYIGLDVGTNSVGWAVTDEFYNILRAKGKDLWGVRLFEK
FT                   ADTAANTRIFRSGRRRNDRKGMRLQILREIFEDEIKKVDKDFYDRLDESKFWAEDKKVS
FT                   GKYSLFNDKNFSDKQYFEKFPTIFHLRKYLMEEHGKVDIRYYFLAINQMMKRRGHFLID
FT                   GQISHVTDDKPLKEQLILLINDLLKIELEEELMDSIFEILADVNEKRTDKKNNLKELIK
FT                   GQDFNKQEGNILNSIFESIVTGKAKIKNIISDEDILEKIKEDNKEDFVLTGDSYEENLQ
FT                   YFEEVLQENITLFNTLKSTYDFLILQSILKGKSTLSDAQVERYDEHKKDLEILKKVIKK
FT                   YDEDGKLFKQVFKEDNGNGYVSYIGYYLNKNKKITAKKKISNIEFTKYVKGILEKQCDC
FT                   EDEDVKYLLGKIEQENFLLKQISSINSVIPHQIHLFELDKILENLAKNYPSFNNKKEEF
FT                   TKIEKIRKTFTFRIPYYVGPLNDYHKNNGGNAWIFRNKGEKIRPWNFEKIVDLHKSEEE
FT                   FIKRMLNQCTYLPEETVLPKSSILYSEYMVLNELNNLRINGKPLDTDVKLKLIEELFKK
FT                   KTKVTLKSIRDYMVRNNFADKEDFDNSEKNLEIASNMKSYIDFNNILEDKFDVEMVEDL
FT                   IEKITIHTGNKKLLKKYIEETYPDLSSSQIQKIINLKYKDWGRLSRKLLDGIKGTKKET
FT                   EKTDTVINFLRNSSDNLMQIIGSQNYSFNEYIDKLRKKYIPQEISYEVVENLYVSPSVK
FT                   KMIWQVIRVTEEITKVMGYDPDKIFIEMAKSEEEKKTTISRKNKLLDLYKAIKKDERDS
FT                   QYEKLLTGLNKLDDSDLRSRKLYLYYTQMGRDMYTGEKIDLDKLFDSTHYDKDHIIPQS
FT                   MKKDDSIINNLVLVNKNANQTTKGNIYPVPSSIRNNPKIYNYWKYLMEKEFISKEKYNR
FT                   LIRNTPLTNEELGGFINRQLVETRQSTKAIKELFEKFYQKSKIIPVKASLASDLRKDMN
FT                   TLKSREVNDLHHAHDAFLNIVAGDVWNREFTSNPINYVKENREGDKVKYSLSKDFTRPR
FT                   KSKGKVIWTPEKGRKLIVDTLNKPSVLISNESHVKKGELFNATIAGKKDYKKGKIYLPL
FT                   KKDDRLQDVSKYGGYKAINGAFFFLVEHTKSKKRIRSIELFPLHLLSKFYEDKNTVLDY
FT                   AINVLQLQDPKIIIDKINYRTEIIIDNFSYLISTKSNDGSITVKPNEQMYWRVDEISNL
FT                   KKIENKYKKDAILTEEDRKIMESYIDKIYQQFKAGKYKNRRTTDTIIEKYEIIDLDTLD
FT                   NKQLYQLLVAFISLSYKTSNNAVDFTVIGLGTECGKPRITNLPDNTYLVYKSITGIYEK
FT                   RIRIK"
FT   CDS_pept        77964..78836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07477"
FT                   /db_xref="GOA:B0RZQ8"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZQ8"
FT                   /protein_id="BAG07477.1"
FT                   /translation="MGWRTVLISGRAKLDLKLNNLVIRKEEIVKIHIPEIAVLIIDSTM
FT                   VSFTTALIEKLIAEKVKIIFCGKDHNTIGEIVNYYNKHNSPLMIRKQISWQNNSKQKTW
FT                   REITKEKINRQALLLKFIGNENANLLLEYKSQVQDGDVSNREGHAAKVYFNSLFGKDFS
FT                   RSQDNPTNAMLNFGYSILLSIFTREITSSGYLTQLGIFHENQFNYYNLSSDLMEPLRPM
FT                   IDNIVYFYEPEKFDKEEKIATLKIMDEEVFIGKTRYTLLNAVNEYCKSVFLALEKGEEQ
FT                   LIKFIDYEL"
FT   CDS_pept        78841..79146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07478"
FT                   /db_xref="GOA:B0RZQ9"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZQ9"
FT                   /protein_id="BAG07478.1"
FT                   /translation="MRTIVFFDLPTISLDDKKRYRAFRKFLLSEGFMMLQESVYCKLSL
FT                   NQTNANTLKDRIEKNKPSMGIVQILTITEKQFQSMEYIVGENKSSMLDTDEGLIIL"
FT   CDS_pept        79143..79790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07479"
FT                   /db_xref="InterPro:IPR010146"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZR0"
FT                   /protein_id="BAG07479.1"
FT                   /translation="MNIKYDLLNEPFFIDYGDICNITIENKLEYRKIIENIYNQETIEL
FT                   YDDDELITKHKVIENSAILDFDDKKITTKIIKDLMEIISDEKHYEQKINLNSSIVNFIN
FT                   DITLDYPYMLEIGDEINFESLLKVVPIKPSVDYTDFLDKFVSFLDIYQNVLKIDVFYTI
FT                   NLLQYFTEEELKELSDYIKIKNICIINYDNILVDSNYISKKLLFDNDLCRVL"
FT   CDS_pept        80888..81919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07480"
FT                   /db_xref="GOA:B0RZR1"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZR1"
FT                   /protein_id="BAG07480.1"
FT                   /translation="MNNKNDIDRVHDDVFNSIKILMDKARNEVFREVNNILVQTYWEIG
FT                   RIIVEDEQGHSERAEYGRELINDLSRQLTKEYGKGFSKSNLFNMRNLYLSYPIFQTLSG
FT                   KLTWSHYCELLFISDEKKRSFYEKESINANWSVRELKRQIKTSLFERLLLSSGEENKEK
FT                   VLDLALKGNEINKPADLVKDPYVFEFLGLPEEKPMMESDLEKALIDHIEKFLLELGKGF
FT                   MYVGSQQRVTLGNTHYYVDMVFYNKILRSYVLIELKTTKLMPEAVGQINMYLNYYKSEV
FT                   NDEMDNEPIGIILCTDKDGVQAEYALGNLSNKIFASKYTLYIPNREELEEQVEKVIEKY
FT                   KEK"
FT   CDS_pept        complement(82670..83824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0063"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07481"
FT                   /db_xref="GOA:B0RZR2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZR2"
FT                   /protein_id="BAG07481.1"
FT                   /translation="MEDFKYFNNMQDIHSDIYDKLSEKLNEVKSVTVTADDVRRTLGKI
FT                   KNNEALDHFDYYNMLSDCAIDFIEELGDIAQKLRLQYFGNNVYLFSPLYIANYCENSCK
FT                   YCGFRAKSDIVRAKLTMDEIESEMKQMRREKIEDVLILTGESQKYSSVDYICDAVKLAK
FT                   KYFRVVGVEVYPTNVEDYKKLHEAGCDFITAFQETYNPTNYKFYHPTGHKSCFPYRLDT
FT                   QERAIMGGIRGVGFGALFGLSNGIEDCFCLGMHANLLQKKYPHAEISISFPRIRPTKNE
FT                   EDLNIKEVPETKLMQFIIATRIFLPFAQITISTRESNEFRNLSLLMGATKISASVDTGI
FT                   GRRNDEKDKGDEQFLINDTRTVDQVERDLAKYNLYPVYSDYIDV"
FT   CDS_pept        complement(83832..84596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0064"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07482"
FT                   /db_xref="GOA:B0RZR3"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZR3"
FT                   /protein_id="BAG07482.1"
FT                   /translation="MEDKLILGGKSFDSRFILGSGKYDPNLIKACVESAGCEMITVALR
FT                   RANTDDTKNILNFIPENVTIIPNTSGARNADEAIRIARLAREMGCGNFVKIEIMRDSKY
FT                   LLPDNVETLKATKVLADEGFVVMPYMYPDLNFARDLKEAGASCIMPLGSPIGSNKGLAT
FT                   RDFIQIIINEIDLPVIVDAGIGKPSQACEAMEMGASAIMANTAIATSGDINKMAEAFAL
FT                   AIKAGRLAHIAKPGRVLETGADPSSPLRDFFK"
FT   CDS_pept        complement(84586..85182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0065"
FT                   /product="molybdopterin/thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07483"
FT                   /db_xref="GOA:B0RZR4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZR4"
FT                   /protein_id="BAG07483.1"
FT                   /translation="MENIFKRQIPEHTHIFRKSKILILGCGGLGTNLCFMLAKSGIGTI
FT                   KIVDYDKVEYSNLNRQIYRPTDVGKYKVDAFKEICDDFLPFANISVENIKIAEDNIDEM
FT                   TEGYDIVLEALDDEYAKSLVLEHFIGTDKKLISVSGIGGVKKLDMKIKKMNNIVVCGDF
FT                   ETKTDIGLYYPNVMMAASTQAIIALNWLLEENNGR"
FT   CDS_pept        complement(85184..85381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07484"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZR5"
FT                   /protein_id="BAG07484.1"
FT                   /translation="MITVNSVKYPFEENSSLRKVLEDLNFNVELTVCEVNKNLVKKVDY
FT                   DNFIVTDNDEIEVFSFVGGG"
FT   CDS_pept        85601..86212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0067"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07485"
FT                   /db_xref="GOA:B0RZR6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZR6"
FT                   /protein_id="BAG07485.1"
FT                   /translation="MKLYYAPGTCAVACWIALEWAGADYEVEKVQLGTDEYRKINPLGA
FT                   VPALDIGEGIVRGELAAILRYVLHKYPEKDLGADESPEDKFQFDEIMAFMTGDFHPAFE
FT                   ALFVPAGLTTSTDEAEIDKIKQKSFETIDKMMTHLDRLIGDGDHVYKNKKTVLDAYVYV
FT                   LTRWSELTPKSWKEYPNINRVSEKIEKDKTVQEIMKKSQE"
FT   CDS_pept        86392..87912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0068"
FT                   /product="putative ATPase ComM with chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07486"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZR7"
FT                   /protein_id="BAG07486.1"
FT                   /translation="MYSKVKTCCLEGLNGYVVECECDLANGLRSFNIVGLPDTSIKESK
FT                   ERVRSAIENTGIRFPVKRITINLAPANLRKEGSQLDLAIAMAILQSMGVVEDFSEKWAF
FT                   IGELSLDGRLNPVNGSLCMVLSLKDLGYERVYIPKQNAQECSMVKGIEKVCVESLDEII
FT                   RILNGEEELKILDDIDIMQQEIHYDVDFSDIKGQKFLKRAMEISAAGFHNLLMIGPPGS
FT                   GKTMSAMRLSTILPDMSFDEIMETTKIYSVAGLLGEKNIVTTRPFRSPHHTASQVSLIG
FT                   GGRVPKPGEISLAHNGALFLDELPEFSKSTIEVLRQPLETKNITITRVNASLSYPANFL
FT                   FVAGMNPCPCGYFGDPNHECTCSQNQIANYLNKVSRPILDRIDIHVEVSPVKLDELTTD
FT                   EQCDTSEQIKKRVEAAREIQKQRFKNEKITTNSQMNTRQIRKYCKLNDELNSIIQLAFD
FT                   KYKFSARSFDKILKISRTIADLDGKENIEAKHLMEAIRYRTVDQKYWG"
FT   CDS_pept        88127..88177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0069"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07487"
FT                   /db_xref="GOA:B0RZM8"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM8"
FT                   /protein_id="BAG07487.1"
FT                   /translation="MVDGVVVGMVSQNWID"
FT   CDS_pept        88190..88474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0070"
FT                   /product="truncated conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07488"
FT                   /db_xref="GOA:B0RZM9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZM9"
FT                   /protein_id="BAG07488.1"
FT                   /translation="MEIGIVIYDENYWNKSIGTKALKLWTSEVFNDNPQIEHLGLTTFS
FT                   GNPRMMKAAEKIGFTQEARIRKVRYWNGTYYDSMKYGVTREEWEKLSQK"
FT   CDS_pept        complement(88558..89523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0071"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07489"
FT                   /db_xref="GOA:B0RZN0"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN0"
FT                   /protein_id="BAG07489.1"
FT                   /translation="MARKFEKACVIGGGVIGSSFTLLFAMGKMDVVLYNLDENEENKSK
FT                   KIIEKYVDELIEKNVVSEDKQTIMARIRYTTDEKEAIEFADIVEECIPENYDVKKEFVK
FT                   VFEKYAKPDCVLCSATSGLLITKIAEDAKHPERIFGAHPYNPPHLIPLIEISQGEKSDP
FT                   EIADALRELFVKLGKKPIVIRNEVPGFIANRLQAVVLREMMDLVDKGVVSMEDCETALT
FT                   FGPAIRWAIMGPGQIFELGGGEHGLQGLLDHIGPSMETWLEDAATWTKFTDDIKKKTVD
FT                   GVHEAIKNRPDEIGNTHETLAKYRDGMLVEILRLHKDFKI"
FT   CDS_pept        complement(89630..90685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07490"
FT                   /db_xref="GOA:B0RZN1"
FT                   /db_xref="InterPro:IPR021299"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN1"
FT                   /protein_id="BAG07490.1"
FT                   /translation="MKIVESLFDVCYLMIVVAFGVRLLLEKKNGAKLFGIMAMVLGLGD
FT                   GFHLIPRVISHLSPGGFEAHAAVLSWGQFVTSITMTIFYVLYYHYYRMQSNDTDNVKKW
FT                   LIYGLAISRIGLVLLPQNNWGTADGNYMFGIYRNIPFLIMGILLVVWSYKKKEILAFKH
FT                   MWILISLSFLFYVPVVLFSKTVPAIGALMMPKTVAYLLIVWMGFKYFVTDFGANNLFAN
FT                   SITILIIGFIGGVFYREFTKFYAFTDATHLGKVHVHTLVLGFVVSLLMYLLAKDMKDVK
FT                   SLKKPYEIYLTGLVFTIANMVVIGIYEVVREGLDVIVRAAIDGTSGIGHIVLAVGIVWM
FT                   FVRAYNLKISE"
FT   CDS_pept        complement(90672..91250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0073"
FT                   /product="transcriptional regulator TetR/AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07491"
FT                   /db_xref="GOA:B0RZN2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN2"
FT                   /protein_id="BAG07491.1"
FT                   /translation="MPKQTFYNLSEDKRNLIDEVLKDEFSTKPYKDCNVKNIVERLSIA
FT                   RGSFYQYFDDLMDSYFYILDKETKDVHLLFRSVLKKNNNDVSVALDAFGDEVCDVIFED
FT                   GEYNLYKFRYLYWNSELEDGWRATKNEYYDIFYDNSDCMKQELVYFMKAIVHSLIERNF
FT                   KEEWSRDVFIEKYRLHINWLKKGVGHEDC"
FT   CDS_pept        91446..93158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0074"
FT                   /product="putative type I restriction-modification system
FT                   methylation subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07492"
FT                   /db_xref="GOA:B0RZN3"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN3"
FT                   /protein_id="BAG07492.1"
FT                   /translation="MTLQKKEYLELKKWFDEEGKKVLWEMMSNWRGIIDKPLDAFYIFA
FT                   RAFYDDKLLNEKLGNNKSIKILFYRIDNEYHDFVEEVREKLSPNQIKSIILNFYNLDNI
FT                   RSIHMIPGFSIPTGISELSYKLLDIKKGDKLFQPNSQAGEFMIDFLINHPECDISAIEI
FT                   NTSYILTSQLKLPIIGHQNRASIRQEDYFNTDLSTLEYNKVFSMPPMGMLYRDFDKRVN
FT                   DKNLIELYKKNDFNTKNEWTDILKIISNTKFEKAIFIVHSGILFKERDEKIRKYLIDNG
FT                   YIESVIELAPRLFTGIGISTNILLISKNNKKVKMVDASEIYHSDKMVNKITKDDVEVIF
FT                   DAYKNESTISKEVSPEEFEDNNYSFIPRRYTNEEIDLKNYVYLKDITKIKRGYANLKKS
FT                   DLYKRISRENTNNKIIAAGDIDDNFNIADLTSLTEIEDKEETYCVKDGDIIFSRGGSYN
FT                   SLLIRNSGNYRILVNGTLYILNCDEQKIDPYYLQMYLASDHCLSQIESLNTGKSIQFMS
FT                   INQLGELKIPKVSKEKEKELSQKYKMILDKKEIIRIQKIKLEEDVSELVSEVI"
FT   CDS_pept        93161..93667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07493"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN4"
FT                   /protein_id="BAG07493.1"
FT                   /translation="MDRNPIIAEAISRITSELIKDQTDEQFCMLLEKYGLINLIPQTAP
FT                   YFYDTQKNGNIIMFGDSKIKTKEINGCLKSYGISKDRFEHVPYDEVTNYNFKNLEYNNN
FT                   YRLIMVGPVPHSAKGMGDNSSVIEWLTNNRNIAKTIILDNLKITKTSFKSAIEKEVESG
FT                   YLAQG"
FT   CDS_pept        93910..96396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0076"
FT                   /product="type I restriction-modification system
FT                   specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07494"
FT                   /db_xref="GOA:B0RZN5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN5"
FT                   /protein_id="BAG07494.1"
FT                   /translation="MAVKKSELYSLLWDAANKLRGGVEPSRYKDYVLLLLFFKYVTDKY
FT                   KGQRYGEFEIGEGASFDDIIMAKGKPDVGERVDKIIQKFLEINNLKGALPDVSFNNPEE
FT                   LGKGKELVDKVSGLIAIFQNPAIDFKKNRASGDDIIGDAYEYFMMKFAQESGKSKGQFY
FT                   TPSEVSRVISRLIGIGDIENSPNKKWTLHDPAAGSGSLLIRAADEAPVDSNGDSIVTIY
FT                   GQEKYSDTAGLAKMNFILHNKGTGEVHSDNTLSAPYYTDDFGELRKFDFIVMNPPFSDK
FT                   DWSDGIKADEDTYHRFDGYGIPPEKNGDYAWFLHVLKALNENGKAGIILPHGVLFRGNA
FT                   EETIRKEILKRKYIKGIVGLPSNLFYGTGIPACIIIIDKENADKREGLFMIDASDGFKK
FT                   DGDKNRLREQDIEKIVQVFTNKTEIKGYSRFIAYKEIIEDNNANLNVPRYISKINKNLP
FT                   QNINSHLNGGIPEKDIDSMERLWNISSELRNKIFEERENANVYDLKVEPDSIEDLIFED
FT                   EKIKKVIQEETIDIFNTWKQQSETILENIDSTIIPKKLIRELGFSILKAYEKSKLLDNY
FT                   DAYDFLLNYWNEKMQDDVYLIKASGYEAGAEIDRKYGKKKIKDEQGIEIEIEDKKKFKS
FT                   FDGLLIPKEIIETEYFNDELEEISAINSTISEIDEKMNEIFEENSGEDGLINDAINDKG
FT                   NITKKSLNDRIKQIDKIKDKEEYELLISYQNLLKRKDSQNKELKSKTKSLDERIEEQYS
FT                   KLTEKEIKNLLVDKKWMARINNDIKDAVDSEINNIAAKLVEISKRYETTLSQLEEKAEN
FT                   SRNDVRNALERMGYSW"
FT   CDS_pept        96390..97424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07495"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN6"
FT                   /protein_id="BAG07495.1"
FT                   /translation="MVDYPEKIEFLLYKNELSEAKIQVVVKDETIWLTQKAMSELFGVG
FT                   VPAISKHLSNIFKEGELDENVVVSILEITTKHGAIEGKTQEKKTKFYNLDAIISVGYRV
FT                   NSRQATNFRIWATNVLKEYIRKGFVLNDEMLSQGKSTFGTDYFRELLERVRSIRASERR
FT                   IWQQITDIFAECSFDYDKNSEITRNFYAMVQNKFHYAITGKTAAEIIYEKSDSTKNNMG
FT                   LTTWKNSPDGRILKTDVTVAKNYLSEKEIRKLERLVTGYFDYVEDLIEDEVLLGMEDFS
FT                   SSLNDFLNFRRYKILSGNGHISAKKAREKAIGEYMIFNKNQLINSDFDKFIKKNRLEGG
FT                   EKDE"
FT   CDS_pept        97417..98544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0078"
FT                   /product="type I restriction-modification enzyme
FT                   specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07496"
FT                   /db_xref="GOA:B0RZN7"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN7"
FT                   /protein_id="BAG07496.1"
FT                   /translation="MSDYPKDWEEVKLVDIPIQIKKGDLITKKEIANGKIPVIAGGKSP
FT                   AYYCNRYNREGTTITVSASGANAGYVNLFYGQIFASDCSTIEEDRSYCIEYIYYLMAKE
FT                   QENIYKLQTGGAQPHVHPKDIKKLEIIYSRNIEEQKSIAETLMTFDRHIENLEKLIEKK
FT                   KMIRDGAVEDLMTGKTRLDGFDGEWEKLLLGDIFKINMCKRVFSYQTVKNGKIPFFKIG
FT                   TFGKKADAYISEELFNQYKHLYPYPSKGDSLISASGSIGKIVVYNGENSYYQDSNIVWL
FT                   KTNLNIVDKSFLYFYLRTFPWKITEGTTIKRLYNNIILETEINLPTDIKEQQAIASILT
FT                   SMDEEIENLEKEKAKIEKIKAGAMDDLLTGRVRLI"
FT   CDS_pept        98554..101670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0079"
FT                   /product="type I restriction-modification enzyme
FT                   restriction subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07497"
FT                   /db_xref="GOA:B0RZN8"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN8"
FT                   /protein_id="BAG07497.1"
FT                   /translation="MSVDKEIKLQERVLEVMKEDLGYRYIGNLKNYDNKSIREYEFERN
FT                   LEKRGYSSRLIKLALNEVRKVAYNQTSGLYQNNKAFYSLLRYGAQGLQDENKNRVTVDL
FT                   IDWDNIENNDFAVAEEVSVLCLDNKRHKRPDVVIYVNGIALGVFELKRSSVSIGEGIRQ
FT                   NLTNQKDENIATFFNTVQFTFAGNEAEGLKYGTICTAEKYYLQWKEDDNAKDALSNKIK
FT                   ELQGDEPNKLRDGIISICQKERFLSLIYDFVIFDAGIKKLARHNQYFANIAARDFIKRK
FT                   EGGIIWNTQGSGKSLIMVWLTKWIIENIEDSRVVIITDRDELDDQIEGLFSDVDISIAR
FT                   ARSGKHLRDLLNTYDESIICSLIHKYGHNAGNQSDVDLYVKELEKSLGSDYEAKGNIVA
FT                   FIDECHRTNSGKLHKAVRTLMPNATIIGFTGTPLLKKDKQTSREVFGEFIHTYKFDEGV
FT                   EDGVVLDLRYEARDVDQNLTNQSRVDVWFETKTKGLTDYAKNKLKSSWASLNKLYSSRQ
FT                   RLEKIAADIIFDMETKPRLSCDRGTAMLVAGDILQACKYWEIFQSNGFKKCAVVTSYEP
FT                   NAASVRTATSDLNEQSESEYKKEIYERMLAGRSTSDYESEVKKKFKEEPANMKLLIVVD
FT                   KLLTGFDAPSATYLYIDKSMRDHDLFQAICRVNRPDGEDKDYGYIVDYKDLFKNVQLAI
FT                   TDYTSGAFEDYAAEDVDGLIKGRYEEAKAEMVGARASLNDLFSNIEDKSEDSKIIEYFC
FT                   GDKEDDETYLGRREVFYSISSSYTRAFANCCDKLVSDFGYNDKEVNKLRNEITNYNKIK
FT                   EMIKLASYDYIDLKPYESDMRYILDTYVMAEDSTIISELENMSLVELLLSSDTKSPIDQ
FT                   IVDGLPGDDNAKSEIIENNLTYEIVKRKSSNEVYYGKLSEMLEEVIEQRKIGVISYENY
FT                   LKEVTKIAQNIIHPEDSDNYPDYIKDSEAKRAIYDYLGDEGGDLAYKLDSAIKTSIQPD
FT                   WMTNRQKQNKIKGSIYDVLCEHGKDENLADDLTEKIFDIVKSQDEYREI"
FT   CDS_pept        101660..102370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0080"
FT                   /product="zinc-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07498"
FT                   /db_xref="GOA:B0RZN9"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZN9"
FT                   /protein_id="BAG07498.1"
FT                   /translation="MKYNEIIDGLGVEIHKKSNLKNLYIRIFPPDGDVKVSVPLKCTDE
FT                   EIKYFVLKNMTKIKNVKEKFRNQPRLSKREYVSGESCYLWGKTYILEVVYENKKPEVVV
FT                   TPKKIILRVREGSDVKKRESIINEWYRNELKRVLKIVSKKCEKNTGLIANEYRVKNMKT
FT                   KWGTCNINKKRVWINLQLAKKPIECLEYVVTHELVHLLERNHTNRFYELLGEYYPEWKV
FT                   ARKILSEQPLDYVE"
FT   CDS_pept        102466..103659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0081"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07499"
FT                   /db_xref="GOA:B0RZP0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZP0"
FT                   /protein_id="BAG07499.1"
FT                   /translation="MSKAKFERTKPHVNIGTIGHVDHGKTTLTAAITLVLNKRMGSGEF
FT                   VDYANIDKAPEERERGITINTSHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLARQVGVPKIAVFLNKEDQVDDPELIELVEMEVRELLNEYE
FT                   YEGDDTPIVVGSALKALEDPDGEWGDKIMKLMEEVDEWIPAPVRDVDHPFLMPVEDIFT
FT                   ITGRGTVATGRVERGKVKVGDNVEIVGLTTEKRTVVVTGVEMFRKQLDEAEAGDNIGAL
FT                   LRGVQREEIERGQVLAAPGTIHPHTKFEAEVYVLTKDEGGRHTPFFSGYRPQFYFRTTD
FT                   VTGNIELEEGVEMVMPGDNAKFIIELITPIAIEEGLRFAIREGGRTVGAGVVSKIIA"
FT   CDS_pept        103744..104127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07500"
FT                   /db_xref="GOA:B0RZP1"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZP1"
FT                   /protein_id="BAG07500.1"
FT                   /translation="MNDLTKILFDYFKDNDIDPNKVANIIEDAKINVLDEMFGEEGEWV
FT                   LKKLGSVESFDKEKIFHSIAQTSDSSGAKMNASDVNIIVEDVLKKMKSIKRNVYPTTEI
FT                   RGYVEEALKEEGYGKVLEAYKNI"
FT   CDS_pept        104140..106512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0083"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07501"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZP2"
FT                   /protein_id="BAG07501.1"
FT                   /translation="MNTKLLKKVLASTLALSMILPIGVVNADKQNTQQKEKSQQTTRIS
FT                   GKDRITTSVEISKSAYTTSENVVLASGFNFADALSAGQLASALDAPLLLSSQDKLDSQT
FT                   KNEIERLKAKKVFVVGGDNAISKTGIDTTLKSEKIDVTRLEGQDRYSTSQKVMEKTKEI
FT                   INPEYLLIASGKNFPDALAATGFFVNHKSVMVLSDGLTYPQSNLQEIAIGGKNQLPLKG
FT                   FKGKRVSGKDRYETALEIAKLSFDKNNNAILASGQVFADSLSAVSLTKKHNAPIILTQS
FT                   NSLTENAKKYLNGKNVFIVGGEKTVVNKIMTNITAEERAKIASFNLEEEIEKVLAKKKN
FT                   NDNINLEKEIERILAKNQAYQNLIIKQEVEKALSGKQIGQSVDLEKEIEKILDKKQSNQ
FT                   NIDLEKEINRVITKRRLKDSIDGGEKTIANAKKKIVQYNDELKKYKENPNYIKKQELKL
FT                   KKMQEETEQYEERYKSEKADAIKKLEEVNKNISLLDYRLKEGAFAFFKWAGEKYPEYKQ
FT                   DADKALSILNEYYKKGDVKKTSGDATSYENLLASFDLYNQLNKVKRDFNYHDVDTNLTI
FT                   MAKAMVSCNRNVYSSNKNTFSITEDLYSGEKNPIEYWYNDGKAVLDELKKIEGKYYNYP
FT                   EYIAKDLARKEYKRIHGKESVIGILVELLYSDDNFIAIARNTSKNSSYNTFCLNAESDE
FT                   VSEKPKSKHEKHDWNFDKYKRVTDEYYLLHDKEDAENWIKRVESDKKEREKEMEDLKNH
FT                   EDYETHRIRELIKITEDDIARWEKEIQKDKQTYEKLK"
FT   CDS_pept        106667..107980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0084"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07502"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZP3"
FT                   /protein_id="BAG07502.1"
FT                   /translation="MLKNQLKKLTVAALVAAMIVPAGVSNADNQQITRISGKDRIATSV
FT                   EISKSAYTTSENVVLASGFNFADALSAGQLASALDAPLLLSSQDKLDSQTKNEINRLKA
FT                   KKVFVVGGDNAISKTGIDKNLKSEKIDVTRLEGQDRYSTSQKVMEKTKEIINPEYLLIA
FT                   SGKNFPDALAATGFFVNHKSVMVLSDGVTYPQSNLQEIAIGGKNQLPLKGFTGKRVSGK
FT                   DRYETALEIAKLSFDKNNNAILASGQVFADSLSAVSLTKKHNAPIILTQSNSLTENAKK
FT                   YLNGKNVFIVGGEKTVVNDILTRKKPVVKKEDKNLHTKTGQYYSSLISKKLSKSEADAS
FT                   NQAYNVRIEGDQLVVSGYMLYYKKIDSFFGGDSIGHSVNHSFKITDKTVFRAVSGLATP
FT                   SYFNRTEFLNYYKLCKNTGLGLVVTVKNGVAVKVEIAS"
FT   CDS_pept        108083..108352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07503"
FT                   /db_xref="GOA:B0RZP4"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZP4"
FT                   /protein_id="BAG07503.1"
FT                   /translation="MNKTKNKSLWTLIIGVVCLVVAFILKDFEFGFLGNLRPIGFVTIY
FT                   ICPILGIIGIVLALIEKSVARALLNFLLLLSFPLLMIVGNLLIK"
FT   CDS_pept        108435..108977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07504"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZP5"
FT                   /protein_id="BAG07504.1"
FT                   /translation="MRIFYAIKNMEICINSVGAGIEYFRINGADAIDDLKICIPNYGVD
FT                   KTFRYPTDGLFVNEEYDVVSKSEDMCVLRLVREGIESFVVYQFTQDFVNVNVNVVNDSD
FT                   CTIKMNPAVVIGWKNNVESTNIMSEISGYKLESTSSFVDGKSSYYFSNLNTKSNHTKFG
FT                   LKSGEKCSISAKIRIVS"
FT   CDS_pept        109102..109947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07505"
FT                   /db_xref="GOA:B0RZP6"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZP6"
FT                   /protein_id="BAG07505.1"
FT                   /translation="MIYVVSLFVFPFGFIVLPSYFIKLGLEKDNRLALISFGIFFVLSM
FT                   VVSSPMIAIPIGLFTILVFYSILNLLSSGFDDTQAIAISFVGICAFVVLTNLLLKFNAD
FT                   MSIADVISHKLNDFMKVLSSVKMDDELMMSVKTMFEQSTKLIVRAVYAILGIVAFYTSV
FT                   LNVYIPQKSKEHKFHDFRIDKIFTSVVVGLVLISGVTYFVNRDLGNYLLYNLSIFGIYT
FT                   YLLGGIALMFSYLKSLSKPFKVLTVLVSVAIQPFIYILAVLGAVNSFKDLRKKENNARA
FT                   "
FT   CDS_pept        109934..111922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0088"
FT                   /product="exopolyphosphatase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07506"
FT                   /db_xref="GOA:B0RZP7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZP7"
FT                   /protein_id="BAG07506.1"
FT                   /translation="MQELKYSLKHLIVQAVLLVILSAILFYFQNIIGTLAFIASAFMIM
FT                   NQYTYINKKNQKVEDKIINLNNEFTDITKNAVFKVPFPLLILNDKNKISWFNTYFKDLC
FT                   DDEVEIFNNEIENILDLKTVNDDENNLDYYETQVDGKYYRFYPVTIKDSEDKDLTLLYG
FT                   VDNTAFMDVVTLLDEKRLGLVDIFIDNYDEARNSIKEEERTRVFSEVDKILQDFAREHN
FT                   AYIRKYESDKFVMVIEKHELENIMQQKFSVLDMIKDIKNTNNVPVTLSIGASIVGDNPY
FT                   EIHDKSRSCLDVALGRGGDQAVVDTGELKYFGGKNKAVEKRNKVKARVVSHALKKLIEQ
FT                   SSNVFIMGHKNPDMDSIGSCLGMLEACKINSKECYIVLNEVGPQIENIYNAVLEEKPDY
FT                   KKYFVKNAFAKENCNSNSLVIICDNHRRNSVECQEIMDITKNIVVIDHHRRSSDYIKDT
FT                   SLTYLEPYASSASEMVTEVLFYMTEKLEIPKIVAEALLAGITVDTKNFFYQTGVRTFEA
FT                   ASILKRQGADSVRVKQLFKDDERTIKLKSDVIASSKMYRNNIAIGRLEEEVDESILVAA
FT                   QSADDLLNILGVEASFVLAKLKDKIHVSARSLGKISVQLILEKVGGGGHLTSAGAQLDC
FT                   SMDEAEEKIKQAIDEYIKEDTDESYID"
FT   CDS_pept        111903..112349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0089"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07507"
FT                   /db_xref="GOA:B0RZP8"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZP8"
FT                   /protein_id="BAG07507.1"
FT                   /translation="MKVILTSDVDKLGKAGEMVNAKTGFARNFLLPNKLAVQATKENIK
FT                   IWEEKQAELRAIERENIKKANELKEKIENTKVKIIAKTGEGDRLFGSITSMDIEKALKE
FT                   QHGLDVDKKKIEMKDNIKSLGTFNVVVKVYPDINANLEVIVDKE"
FT   CDS_pept        112383..113720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0090"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07508"
FT                   /db_xref="GOA:B0RZP9"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZP9"
FT                   /protein_id="BAG07508.1"
FT                   /translation="MENQQNIMPCDLEAERSIIGAMIIDERAVDDAAEIVEPVDFYSTK
FT                   YQEIYKAILQVIDEKKPVDYITLEDQLKSNNMYEIIGGIDELISISEAVGSAVNVKYYS
FT                   EIVKSKAIIRNLMRVSQDVIDMSIANNSVGEVLEYAESNIFKISQNRNHQDLVKIQEML
FT                   EPTLARIGEMSMSQGQLTGVTTGLIDLDRQLSGLQNSDLILLAARPAMGKTSLALNIAY
FT                   KASVKHHVAIFSLEMSKMQLTQRLLSALSNINLSELVSGRVTEWTNLGQAAQLLAESNM
FT                   FVDDTSSISLNELRSKCRKLKARGELDLVIIDYLQLMTTNSRNENRQQEISTISRGLKG
FT                   LAKELNCPILALSQLSRAPDQRPNHRPVMSDLRESGAIEQDADVVLMLYRDDYYDPETD
FT                   KPNIAEIIVAKHRNGPTGTVDTLFDKEHTKFMDLDKQMPDVGAFDK"
FT   CDS_pept        113717..114280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0091"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07509"
FT                   /db_xref="GOA:B0RZQ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZQ0"
FT                   /protein_id="BAG07509.1"
FT                   /translation="MITTERLTLEGLTLNDAFEIEQWGKHTDERLIDYNLSDLDDFEIK
FT                   MWYRQKREMKTQKYFAIRDKSRKLVGYVGLKQYDKFTKTAFLGIVLDPNEMDKSYGEES
FT                   IKALINIAFNVYGLDRIFLNVNNFNIRAIKCYEKCGFRKFCSYEEVFENQRLDTHDEDF
FT                   DEFFTVKDGVIFSKNTTMAIDNKR"
FT   CDS_pept        114285..115043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0092"
FT                   /product="putative DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07510"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZQ1"
FT                   /protein_id="BAG07510.1"
FT                   /translation="MKYSVEKFKIDLGETPIENIFLNQYLQVATGNQLKVYLYCYKLAK
FT                   DTSANVDISDEEIAKALDLTESEVSECWNYWLDEGIIKRYTDAETQTNHTVFLSLRQLY
FT                   LGITNPEPDESQKTYIPQNSQEIKEMFRDIEDIRDMELSKSEMERILEHISTYHQTPEL
FT                   VVTAFHYCTTNPNTKNNTNYVLQVLRNWKLDGIMTLEQWQEENNKKQQRKTKKRTYYRP
FT                   KTNDIENKATNINSKFLNDFIKKSKEQKDK"
FT   CDS_pept        115046..116023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0093"
FT                   /product="putative DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07511"
FT                   /db_xref="GOA:B0RZQ2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZQ2"
FT                   /protein_id="BAG07511.1"
FT                   /translation="MSYAKEANRILEDYRNQSKRELDMRFDEVFRKVPEYENLLQHRNE
FT                   IGYEYLRKSIKADKEELKNLEDEIKSTEEKMHKLLILSGFPSDYLNLKHRCDKCEDTGV
FT                   YNGKMCSCKKTIMVNIAREKSSLNEQMKQQNFDRFDINVFDTKKDSSQGMSQRENMQAI
FT                   SENLKYYSKNYTKNAKSLLLYGQVGTGKTYLLSCMAKEIIENGFSVIYLSAMQLLKQLF
FT                   SIRYQNFNEAPQPEVEDIIYNCDVLMIDDLGTENSTETNISLLFDLLNYRIQNQKTTII
FT                   STNIDLDDLQSQYDQRISSRIKGEFIPIQFFGRDIREERFKNGL"
FT   CDS_pept        116020..116664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07512"
FT                   /db_xref="GOA:B0RZQ3"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR032976"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZQ3"
FT                   /protein_id="BAG07512.1"
FT                   /translation="MIYVTAEQMRQIDHYTIHEIGIPSIVLMENAKAQISKHILDKNFS
FT                   KAYVFASVGNNGGDGLAVARDIYNAKKYVKVYVIGKLEKASTDFKINYDILKKLDVEIE
FT                   FVDENTKFDITENDLIVDSIFGTGLKRDIEGIYKGVIDMINDSQAFVVSVDMPSGLDSD
FT                   ENKIHNVAVKADLLVTLQLPKKSLQDYEGEYVVEPIGIPEKSIKHVLNNAS"
FT   CDS_pept        117167..117709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07513"
FT                   /db_xref="GOA:B0RZQ4"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZQ4"
FT                   /protein_id="BAG07513.1"
FT                   /translation="MRKTNTKLLTTIAICIAINCLGAFIAVSTKVPLLLDHIGSLLVCM
FT                   LFGWKYGIVTAFLSSVMNQILFDPFALPFAPTGMLMVFMVGILYEKGYFKKLHTIPALL
FT                   LAVLPGAILGAIIQGYIFGGVTSSGSDVIVRFMINKGVNPAAASFINQYFMEFVDRLIS
FT                   FTVVMTAVKRIKIESIR"
FT   CDS_pept        117693..118379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07514"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZQ5"
FT                   /protein_id="BAG07514.1"
FT                   /translation="MNRYAKIEEKLKREIVLLKGRPCFWGKCTFCDYIEDNTMDMDDAV
FT                   RENREILENVTGEFGVLECINSGNVFELPEQTKIDIKNLIHDKNIHTLVFEAHYIFKHR
FT                   LHEIREFFGCEILFKTGIESFDYDFRENVLNKNAKFHDVKEVSDYFDSACLMVGIKGQT
FT                   KEMIERDIEIGLSNFKWITINIFINNSTPIKRDDELVKWFLENHYDLKDHPKVEMLVEN
FT                   TDLGVG"
FT   CDS_pept        118446..119150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07515"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZY4"
FT                   /protein_id="BAG07515.1"
FT                   /translation="MKNKLFKILLVMLGVVFVSSCSKKMPEITEENKAYVADYLNDGFK
FT                   NVDISKDGRLEKSDVEKIAANFNKPYNYNGKDVVNSIDTFFYGESFASPKDITLKNFVA
FT                   NFPSETLDPDKDKSKIDELKKQNPNAFKQTRADAKILKVDKNLVDAVLLKYANISSDDV
FT                   KNKENVVYLKDDNSYYVMENDEEWAFEPAVCKINSKEIVLEDDIKSELKLEQKSGKFFI
FT                   KSFELSPNACCE"
FT   CDS_pept        119208..119435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07516"
FT                   /db_xref="GOA:B0RZY5"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZY5"
FT                   /protein_id="BAG07516.1"
FT                   /translation="MITLAFVTLIVILSIVFAAILGAFGLVLGLAGAIVGILVAIGAVA
FT                   FSFLKVFIKIALVVLVIRFIYRRFFAKEEI"
FT   CDS_pept        119448..119630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07517"
FT                   /db_xref="GOA:B0RZY6"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZY6"
FT                   /protein_id="BAG07517.1"
FT                   /translation="MDNKYLKYILYIFLAILALNILTGIMGITISILKFLMKVFLVLVV
FT                   IGYVAKFFQNANKDM"
FT   CDS_pept        119766..120704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0100"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07518"
FT                   /db_xref="GOA:B0RZY7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZY7"
FT                   /protein_id="BAG07518.1"
FT                   /translation="MKKHKRKIFLIIGVILLVFCFVLLKLRGYRILQSRTFRKFYDRID
FT                   FKIDTKELKIPEDALSFSVYDIDKEEYLFYEGGGQLPTVASLSKLFAIDYALTKVKLED
FT                   RIEVNQELLDLVPQGSSMAHLKPGKYTAEQIMQAMLVPSGNDAAFALAYNIGKKDLGDG
FT                   YSAKKYVNYFVKNLSKYLADEGYNKTHLFDPSGFSTQADTNLKDINRVALKLIDYDFVK
FT                   KCMGKSYFTIQTPQGEMTWKNTNEFLDSKSAFYNKDVKGIKTGTMASSYNIVVLYEKDG
FT                   KKYLITCLASHTNEDRYKAVQAAINTIINKK"
FT   CDS_pept        121046..122311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0101"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07519"
FT                   /db_xref="GOA:B0RZY8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZY8"
FT                   /protein_id="BAG07519.1"
FT                   /translation="MLDIKRIRNNPEEIVEALKKRRGEYPIQKLLATDEKRREVIQKVE
FT                   SMKAEQNKLSKQVPQMKKNGEDTTELFKNLKKLSDDIKNLDDDLKDIDDEIREYLMEIP
FT                   NTPNKDVPVGLDDTENLEMRKWGEPRKFDFDIKAHWDLGVDLDILDFERATKISKSRFS
FT                   VFKGKGARLERALMNFMVDLHTDKQGYTEMNTPVLMSPSAMMGTGQIPKFKEDMFYCEK
FT                   DDMYLAPTAEVPVTNLLGGEILEQGSLPIYYTAFTQCFRREAGSAGRDTRGLIRNHQFE
FT                   KVEMVKFVEPSTSYDELEKLTNNAEEILQLLEIPYRVVRLCSGDLGFSSAMTYDIEVWM
FT                   PSYNRYVEISSCSNFEDFQARRANIRYRDENNKPQYVHTLNGSGLAIGRCFAAVIENYQ
FT                   QADGSIKIPEVLQKYTGFDIID"
FT   CDS_pept        122339..123475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0102"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07520"
FT                   /db_xref="GOA:B0RZY9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZY9"
FT                   /protein_id="BAG07520.1"
FT                   /translation="MKAYIIARGYPTDKYKMNGIFELDQAIALAKKGVEVVLIALDFRS
FT                   LRRFRKYKSEYFIKDNVKVYSFHFPIGRYIFKSLYDFSYLVLRHFYKKVEKIEGRPDVL
FT                   HTYFTDQGYYTSKLAKELNIPFVLTECNSVVNQDTIKPSYRRIAQETYDRTDGLITVSP
FT                   KFKEKIKEEFGKDSTEIAIIPNLTIFKNNENFKRGEIFNIVSTGNVITTKGPQELIEAF
FT                   NIAFSNDKNVKLTIYGDGFLRKPLIKMVEELNLTDQVFLPGLTKREKIVEGYNNADMFC
FT                   LYSYSETFGLAYLEALSAGLPVVASKCGGPEHLINEENGILVDRFNVEKLAEALRYMHD
FT                   NIEKYDRKKISHDIKEVYSEENITDDVIKVYEEVISKR"
FT   CDS_pept        123484..124668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0103"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07521"
FT                   /db_xref="GOA:B0RZZ0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ0"
FT                   /protein_id="BAG07521.1"
FT                   /translation="MKSIKKIIPLMLVLAIVFQPALSKADSKLGFEDKVKAYYTIEQDY
FT                   SQELLNYNENKPLAIASLTKIMTYVLVMEDINANKYKLDDKIKIQTQYAKPEASTMQLK
FT                   KGEELTVNDLIRGMMIVSGNDAADELAVKSEGSVGKFVERMNKKAAELELESAKFYSAS
FT                   GYPENDKENLMSAKDLAKLTTYTINNYPQVLNYTKTQKLVMPSRKYEAATTIPFLGKIE
FT                   GVDGFKTGTTEKAGYCLITTMSLKPNNPKNKVVSVLMGAPTKYDRNTYQKIMLEYVRNS
FT                   FEPMNILNSEKPIETKSVDSVVDKKVEIYPTEDVSILYNNKTGLQQKVDIKKDLKAPLK
FT                   KGQVVGKVIIDTGKGDKREVSLVVKKPYEKADTLTRIKRSAKYTYELLEALLAS"
FT   tRNA            124693..124768
FT                   /locus_tag="FMG_tRNA01"
FT                   /product="tRNA-Arg"
FT   CDS_pept        complement(124944..125969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07522"
FT                   /db_xref="InterPro:IPR022104"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ1"
FT                   /protein_id="BAG07522.1"
FT                   /translation="MKETEETNKKLVSQLIEKSIEAFILGIEIYNKPTIKYRIEGFSFF
FT                   ICNAWELMLKGELINREIPIYYRDSPERTITLSESIAKIYSDKNTRIRLNLEKIIDLRN
FT                   ISTHFITQDYEVKYAPLFQACVLNYINEINRFHSVDITKYIPQNFLTISAHYQPLSNEE
FT                   IKLKYPPEIAEKFIKEANEVDVLMDEYNSDKFSVKIKQVLYITKKRDDADFTVRIEKDS
FT                   KTPIEIVKELKDPADTHKYSFNSVVTAVQERLKRKNIVLSYEKGFTAYVLTQFINFYNI
FT                   KENDKYCYKHKIGNNNSYTYSQQFIEFIVDEISKDPLNIVESLKDGNKKLNSSREENKK
FT                   R"
FT   CDS_pept        complement(125991..126734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07523"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ2"
FT                   /protein_id="BAG07523.1"
FT                   /translation="MRYSYDNSLDGLFTVIFEQYKHIENSIIVVKTEQLDFLNDDIYIE
FT                   TDVDKSSRVRKSIIDNFGFNFYRSINYAFVSENPDKSTIIAKTIKNMYKYNYNFINSSD
FT                   KIAVQFNSLCKYSTRELHAYKGLLRFKEIQDNFLFAEFEPNNDILELLTYHFKNRLRNE
FT                   KFVIYDKKRNKCAIYVDKELAFYDVQEIFKQESDEEKMFEDCWIEFYNSVGIKERHNLK
FT                   LMQNNMPKKYWKYLPEKSKIYDNEK"
FT   CDS_pept        complement(126737..127972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0106"
FT                   /product="biotin synthase related domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07524"
FT                   /db_xref="GOA:B0RZZ3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ3"
FT                   /protein_id="BAG07524.1"
FT                   /translation="MELKRKLSILSDAAKYDVSCSSSGSNRKNTTNGIGQAHNSGICHS
FT                   WSEDGRCISLLKILLTNKCIYSCEYCINRKENNVERAEFTPEEVADLTINFYKRNYIEG
FT                   LFLSSGVVKSPDYTMIKLIRVAEILRNEKKFNGYIHMKAIPGASEELIERLGRLIDRMS
FT                   INIELPTKSSLKMLAPQKTYESIEKPMSFINESIMQYKIDRKTIRKTPLFLPAGQSTQM
FT                   IVGAAGESDLTIINKASSLYEDYKLKRVFYSGFVPVIKSKYTEKIKKVPMLREHRLYQA
FT                   DWLMRFYKFKSNEILNEKNPFFDLTLDPKAFWAVQNVANFPIEINRASYEELLRVPGFG
FT                   PTYAMRIINARKFANLSFDDLTSLKISLKKAKNFILVNGVYRGQKYNTQDDLLEILRMQ
FT                   EGKNITQLSFLE"
FT   CDS_pept        128113..129390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0107"
FT                   /product="branched-chain amino acid transport system
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07525"
FT                   /db_xref="GOA:B0RZZ4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ4"
FT                   /protein_id="BAG07525.1"
FT                   /translation="MKDKKLIIVSGFALFSMFFGAGNLIFPPYLGNKVGDQYLIAMIGF
FT                   LLSSVGLVFLGLLAATKCGGTIEKIGNTINPRFSLIFSTIIMLAIGPGLAIPRTAATTV
FT                   EVIQKGFFKGANSILLTAIFFVCVYLFVRKPNKIIDNLGKILTPLLIATLLAIIFKGIL
FT                   FPVATPVNTYQIQVFQSSFEEGYQTMDALASIVFAIVVTKGFMQNGIKDEDKIKDYTIK
FT                   SATISAIGLCFVYGGLLFIGATTSNLNLGNMERIELLLYICNQQLGVFGKILICIAMTL
FT                   ACLTTAIGLTTTVGEFFGDMLKDKTNGIMSYDLIIIISTVFSAFFAVVGVEKILKISAP
FT                   ILSAIYPVAIVLIFLNLFNKDTFEKNTKLGAIIGASIFGFLILLNSFKLDFGLLKLIES
FT                   VFPMQIKSFIWIIPAVIGGLIGKIKK"
FT   CDS_pept        129461..129814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07526"
FT                   /db_xref="GOA:B0RZZ5"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ5"
FT                   /protein_id="BAG07526.1"
FT                   /translation="MIKKIFGLKNEIPTLWYAFFNKQTPLFSKIILALSVIYVVSPVDF
FT                   VPDFLAGLGILDDLILAPSLMMVAKKFIPEEIIDTSEEKAEQLNSKLKIFAIVAGVGIL
FT                   LLISFLIYKNIGR"
FT   CDS_pept        129875..130414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07527"
FT                   /db_xref="GOA:B0RZZ6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ6"
FT                   /protein_id="BAG07527.1"
FT                   /translation="MEKFNVNKDDMIILLIDLQEKLVPVLHDNEYVINHTKAVLEMARI
FT                   YDIPVITTRQYPKGLGDTVECLKEYETKVFDKVDFTAKLDDVMNEIKKTGRKQIVVVGA
FT                   ETHICVYQTIRDLIDDYKMIVLEDCVTSRRVENKMNAIANFREMNCLVINSETLIFDIL
FT                   KRAGSAEFKTLSKLIK"
FT   CDS_pept        complement(130461..131609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07528"
FT                   /db_xref="GOA:B0RZZ7"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ7"
FT                   /protein_id="BAG07528.1"
FT                   /translation="MKKTKKQSEISLESFVTIAVVFGLFGYIARIMGLGNMFNTLMKTA
FT                   HDLLLNTVFFIMAIAVLTGALSKIFSEFGVIALINKIISPVMKPLYNLPGASALGILTT
FT                   FLSDNPAIIGLAKDKGFAKYFKNYQLPTLCNLGTSFGMGFIVWTFMSSLGNGTEFLKAA
FT                   SLGLLGAVVGSVVSVRIMMHFTKKFYGDSDENVELEEEQNDEEKEDLTLMERILNSMLE
FT                   GGKSGVQAGMDIIPGVVVICTLVMILTSTGTVENGTVVYTGAAYEGVGLIPKIGAVLNP
FT                   VLKPLFGFSSSECIAFPLTALGSVGAALGLVPKLLEKNLITGNDIAVFTALGMCWSGYL
FT                   STHVGMMDTLNARKLAPKAILSHTIGGIAAGISAHFLYLLLG"
FT   CDS_pept        complement(131667..132443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07529"
FT                   /db_xref="GOA:B0RZZ8"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ8"
FT                   /protein_id="BAG07529.1"
FT                   /translation="MQLLNETQRQKYLDIWHRDNGISSSGLKIIACISMLISHIVQCNM
FT                   LQKFNIYPTMTLISSDWRVTVGALMLFIGRIAFPIFAFLIVNGMFLTRSVEKYIVRLFS
FT                   FAIISEIPFDLAVSGQMFDFYNQNVFFTLALSASLIFVVEKIEKFDQSNLVKAILKIIS
FT                   VGIFCAIANYYHTDYSMLGILAVFLLYLGSTSRRNTYIAILFGYFFEAYMYLFVYLSIP
FT                   IIHFYNGKKGNINKWAFYIFYPAHLLVISFVRDFIL"
FT   CDS_pept        132526..132864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07530"
FT                   /db_xref="GOA:B0RZZ9"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZZ9"
FT                   /protein_id="BAG07530.1"
FT                   /translation="MKMMIFENKVDENNLFENEMDNRNSVMLSFFLQKLRTKKIVVDRF
FT                   KLNKNPEMFEQHGITQRIDDGMKLPITIVDGKIVLSGRYPKSYEILDFLHIDRNIFNQA
FT                   YVNDKRKF"
FT   CDS_pept        complement(132946..133635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0113"
FT                   /product="putative glutamine amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07531"
FT                   /db_xref="GOA:B0S000"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0S000"
FT                   /protein_id="BAG07531.1"
FT                   /translation="MKIIGLTPLYDVAENRLFMLRKYIKLIERNGAYAVILPFNSDRKF
FT                   LEEIVDRLDGIVFTGGLDVAPSYYGEDKILECGISSNVRDELEFNLMDICYKKDIPTLG
FT                   ICRGLQIMNVYLGGTLYQDLKKQKDISIIHSQDKPYNDLVHEVTNYGMFKEKFGDKFYV
FT                   NSLHHQAIKDVAEKLEVLQKSSDDIVEAAYVKDKKFFLGVQYHPEMALDTLKQGHEIVK
FT                   MFLDSIE"
FT   tRNA            133734..133823
FT                   /locus_tag="FMG_tRNA02"
FT                   /product="tRNA-Ser"
FT   CDS_pept        complement(133886..134797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0114"
FT                   /product="putative drug/metabolite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07532"
FT                   /db_xref="GOA:B0S001"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0S001"
FT                   /protein_id="BAG07532.1"
FT                   /translation="MDKKKANLFAKLALLIVAILWGSSLTVVKQSSKTFNPNFILAIRF
FT                   TLAAILLSIIFWKRLRQAKFDDLKSGLLIGIFLFMAYSSQTLGVKFADPGRSGFLSASY
FT                   CVIVPFLGWIVFKQRPDRYNLSAAALCITGIFFISLSGSSAHVDNPLAWLGDLLALLSG
FT                   LLFASHIIAVSALAKGRDPIVMTILQFIMAAVLSWITTIVIEDNSHIVVTSRSVMELLY
FT                   LAVMCTAVALLLQNIGQKYTNPSTAAIILGFESIFGILIPVLIGIESLTVYSVIGFVFI
FT                   FAAILVSETKLSFLKRNVVTAE"
FT   CDS_pept        complement(134926..135870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0115"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07533"
FT                   /db_xref="GOA:B0S002"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B0S002"
FT                   /protein_id="BAG07533.1"
FT                   /translation="MRFIEKSTIYLAGGCFWGVEAYFKKLQGVIDTDTGYANGEGTDTD
FT                   YKKIKQTHHAETVRIVYDKNRLDLAEILLHYFRIINPISVNKQGNDVGEQYRTGIFYED
FT                   EEDLEVINSVMKYIQSKYDEKLTVLVEKLQNFVLAEDYHQDYLDKNPGGYCHINLNAFD
FT                   ENLDTTEYKKMSEEEMKEKLSDVSYRVTQNEATERPHTSSFNDFDERGIYVDIVSGEPL
FT                   FSSKDKYDAGCGWPSFTKTITSSSVNYSDDHKLSRVRTEVRSKHADSHLGHVFDDGPLE
FT                   KGGLRYCINGASLRFVPLEKMEEEGYSKYIPFV"
FT   CDS_pept        complement(135970..137367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0116"
FT                   /product="Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07534"
FT                   /db_xref="GOA:B0S073"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0S073"
FT                   /protein_id="BAG07534.1"
FT                   /translation="MKILEAGKRYGFDKVFDYVAKDPQKRGVQLVEWAENLSHGDFAPQ
FT                   IEIIREVFEDENHPYHSFVMKIFQEVDKKQIKKVAYNFFMNASVLGWQTQQKYREEYNC
FT                   NIPWAILLDPTSACNLKCTGCWAAEYGYKQNLSYDEIDSIITQGKELGTYMYIYTGGEP
FT                   LVRKDDLIKLCEKHNDCVFLSFTNATLIDEDFVDEMQRVGNFIPAISLEGFEEATDGRR
FT                   GEGVYKKVIKAMKMLQERHLIYGISCCYTSQNFDSITSEEYYDYLIELGAYFVWYFHYM
FT                   PVGNAAVTDLLPTPEQRKQTIERLRKYRAEKPLFALDFQNDAEYVGGCIAGGRRYLHIN
FT                   ASGDVEPCVFIHYSDSNIREKSLLDCLRAPLFTKYHDGQPFNDNMLMPCPMLENPNELR
FT                   EMVHSTDAKSTDLESKQTVDSLCGNCDEYAKNWEIEAEEIWNKSPKKERFKGSYHTMNR
FT                   KETMKSK"
FT   CDS_pept        complement(137519..138076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0117"
FT                   /product="putative transcriptional regulator TetR/AcrR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07535"
FT                   /db_xref="GOA:B0S074"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:B0S074"
FT                   /protein_id="BAG07535.1"
FT                   /translation="MNADYTKKMIMENLINLLNRIPLNKITVGKLAEECGINRNTIYYH
FT                   FKDLNEIIDTIFEIRLKRVLNESDNISWEDSFIEEMQFAIDNKTAIYHIYNSISRKTLS
FT                   DYLYTKSGQIMRTYIENVDKEIHAKKDDKEIIIKFFQSAITDLVIRWLTSGMDEDIEKK
FT                   IKRIGFLLKDTVKSSLTRSKMN"
FT   CDS_pept        complement(138168..138494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07536"
FT                   /db_xref="GOA:B0RZH8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZH8"
FT                   /protein_id="BAG07536.1"
FT                   /translation="MDSKEVLAEQSKLFRENLPDVTKNFSDLCGTVFKDGKLSLKEKEL
FT                   IALAIAITVKCEGCVVHHTTGCVDAGCTMEEISEMIGVCVAMGGGPSKTFAGKALQLAE
FT                   ELLK"
FT   CDS_pept        138674..139606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0119"
FT                   /product="putative phosphate ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07537"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZH9"
FT                   /protein_id="BAG07537.1"
FT                   /translation="MKKLYKLLVLMMVMAIGFTGCANNSDKPKSNEKTESKEDSKAKEN
FT                   YEISFSGSSTLAPVISKISTTFIEKNVTWDKVDSSLPDKNITIYVSAGGSGAGVKAVLD
FT                   NVANFGMLAREVKDKEKEKVKDYKEYNLGLDALTLAVNPQNKVIAAKKGNLTKEEIVKI
FT                   FSGEYKKWSDVDPSLPQEDIVVVTRDLSGGAHEVFQKKVMKDVKVRQDAIQAPTMGALV
FT                   SKIIENPNAIGYASFGIANQNKGKLIPLKVDGVEPTEENILNKSYYISRPLIIMKSGDL
FT                   TKTEQLFIDYLNSKEGKQTIKDMGFIPNK"
FT   CDS_pept        139669..140535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0120"
FT                   /product="phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07538"
FT                   /db_xref="GOA:B0RZI0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI0"
FT                   /protein_id="BAG07538.1"
FT                   /translation="MRTKNNIFKTLVYIFAFFSIALLAILIGFMFKESLPFFKQYSVNK
FT                   FLFGKTWDSMDGSFGAFNIILASFYIALLACVFSFPISYGLSLMIVFYTNEKVKTLVSW
FT                   IIRILAGIPSIIYGFFGLFVIVKFFEKNFKMAAGESVFAGSVILSIMILPYFVEVLTET
FT                   FEKIKQKYKRQSDCFGISKEYFIRKIVLKQSLRSAFSGFVLAFSRAIGETMAVMMVIGN
FT                   APILPKFFSKAETIASLIALEVGMSEAGSLHYHALYASSFVLLVFVIILDVILFVTKKR
FT                   TDNYDEV"
FT   CDS_pept        140522..141373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0121"
FT                   /product="phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07539"
FT                   /db_xref="GOA:B0RZI1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI1"
FT                   /protein_id="BAG07539.1"
FT                   /translation="MTKFKDFLIKLWVYLSFAVVFFFVFKIFYFLISKGISSVNLEFLT
FT                   QNPQGLPLGTTGGIKSSIIGSFWLMIIAMGISTLLGVFCAIYRVFYCKSEILKSVISLI
FT                   IQCIASIPSIIIGMFVYGFFIVTLNISKSLLTAAIALSLIVFPFVEVNIEKSIAEINKN
FT                   TIKDSFSLGIDKTYMIRKLVMPMISRNIITISLLAGSYAIGATAPLLLTGAVFMNNSIS
FT                   LFKPVTALPFHLHMLLSQSIAIEKAYATALVLIMILIILHILAYVVLVFSGGKLVEHIT
FT                   NK"
FT   CDS_pept        141351..142028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0122"
FT                   /product="phosphate ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07540"
FT                   /db_xref="GOA:B0RZI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI2"
FT                   /protein_id="BAG07540.1"
FT                   /translation="MSILQINNLDISYKEKNILENVNLTVEKNEIISIMGNSGSGKSTL
FT                   LSCLNGFLSENGGQYSGEILFDGTDISQYKLIDLRRQISMLFQDSTVFDMSIEKNLTYT
FT                   LEYFLGKNYDKKTKIEQILKSVNLYEELKDNLKMNANKLSGGQKQRLCIARMLTTNPKI
FT                   LIFDEPCSSLDLQNTLAIENLLKNLSQNYTIIISTHNTDQAQRISDRILFIEDKKLVEQ
FT                   DEI"
FT   CDS_pept        142055..142756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0123"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07541"
FT                   /db_xref="GOA:B0RZK0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK0"
FT                   /protein_id="BAG07541.1"
FT                   /translation="MKIMVVEDDIDLSELIRMYLIPEGWEIETFHTGKKAVESFNRNHY
FT                   DLILLDLLLPDINGFEICKQIREKSTIPIIMLTALEDSIHKVQGLNMGADDYIIKPFEP
FT                   TELVARIKSNLRRSYEFSSVKPLDNEEHERDELVVGSLRLNRKTHKSFYNEIEIILTPK
FT                   EFDILWLLMEKPDDVHNMDEIHYKIWKDEVLSTEVNPVMVHIRRIRAKFEQCGISSIIK
FT                   TIWGVGYKINA"
FT   CDS_pept        142749..143831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0124"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07542"
FT                   /db_xref="GOA:B0RZK1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK1"
FT                   /protein_id="BAG07542.1"
FT                   /translation="MRKENSYIKRIILYQCLWIAVGIFITFAFHQLIDTLIIYNIDTEA
FT                   EMSSIYKIYFGYGHYFFIMLGAIVITIGCFYIQNKQFEKYRDYFVSGIKYIKGEIPEIR
FT                   EFHESLSNERLDFINIRKQILEMENNYELAYKEKTDLLTYLAHDIKTPLSNLLGYSTLL
FT                   YDEDNLTYEQQKKFIKVIYENVKSLNSLSEDFFSYLKFNLNEIPINIKKFDAELFLKQW
FT                   EEERKTLVNDNDLDIRFANTSCKEINTDAELLVRILDNLVSNATKYSKKGTTIIVEVEI
FT                   KDKSLNLTVKNEIENDLNVDWKLVKNKFYRGDMSRNRIKNNGSGVGLTIVNDIVAHLNG
FT                   KFDVYNKDNLVIANVIIPVY"
FT   CDS_pept        143951..146110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0125"
FT                   /product="conserved membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07543"
FT                   /db_xref="GOA:B0RZK2"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK2"
FT                   /protein_id="BAG07543.1"
FT                   /translation="MKKIIRLLTFLLIFAVGLGFFSYKDSRLMEFFIREFDTTVNITTK
FT                   PQNTEKNILEIQKIAKKNKISFIKEVYKPKNSLKEKQKINIFVYLDDAMWFKKSFKNID
FT                   IDENYNGINRFKNVTEHSILTSKEVDFIEYSKIENHTFNGDYHIKGTPSNIGKFIDELN
FT                   GRKELEIDATIDKSFSVASEITQKQAILYAMLILIIVFALAFSVVIYNSSLSKEISIIS
FT                   LLGHDKMSFCCKKAMNLLAITILISSMALFGVLFYLTHPGSMIGFAIAVKQIFISLVLM
FT                   GILLTILYFLMLYFRVKNVSTISWLKGYKKIYKTSPVIFKVISFSVVLYLLTVTVFGLN
FT                   DYLASTSFFDAWEKSKNYANVACAWPWTYVQNDEKFEEIVAPKLSSLWDELDSKGAILF
FT                   FAPNIQYENDDEYLNKQAFRGRYAYINKNYVETTNLIDSQNNPLTTHTPNSDEWIVFVP
FT                   ENITITEFDKQNIRKSHIFNCVNQKDDVSEKYIKIKKKQYVFTFDCQQNIISPDIFNYV
FT                   LVMVNGKELAPTREIKIPSLVNGKFHPYIPNPNKGYDYLKPAIQKTQSSDYILFVTSVY
FT                   DEVVEKIEMYKTETTIYFLGFLLSVLILFVTIKIDEESYFYNYGQKIYVSRLLGYDFKS
FT                   IHKTKILQIIVGFIVSVIICYMIILFTIYFRNFEFFEPKDGWSLRKLLICLLMYSASII
FT                   ICFIYEIINIKKNEKNLVTKLKEGN"
FT   CDS_pept        146111..146794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0126"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07544"
FT                   /db_xref="GOA:B0RZK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK3"
FT                   /protein_id="BAG07544.1"
FT                   /translation="MNIDKPQISLKNISKKYGNHKILENINLEIYEGDFICIFGKSGGG
FT                   KTTLLNIIGTLEEYDEGELICFSKHNPFRNEKESELLRRYKIAYLFQNFALVDNMTVQE
FT                   NLNLAVKYSRSTDKKSLIKKALMDMGIEDKLKSKIFELSGGEQQRVALARNMVKPYEIM
FT                   LADEPTGSLDSENKKIVIDTLVKLNKLGKTIIVVSHDKEFEKIAHKNFIIENGKLKKME
FT                   FAVDN"
FT   CDS_pept        147052..148194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0127"
FT                   /product="capsular polysaccharide synthesis related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07545"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK4"
FT                   /protein_id="BAG07545.1"
FT                   /translation="MEKSNQKKYTFLINTTPPPRLIKRMDLVKDKFDLYAICWDKGGDE
FT                   KYDFKRDFCKKEIINIDADNSNPMKRLIPTYKFSQKAYKILERIKPDLIHVQSYDMLEI
FT                   ATKYKKNNDNKVKIIYEVPDIHRYLTDDKKSFPMNIVSSILKKRENNMLAFVDLMIMTS
FT                   MKFWEHFDGKYSKDNLVFMPNIPNLELFKDYDKLRVKNQHDTFTVGYIGGLRYLNELKK
FT                   LVKAMEGLEMNLMMAGFESGTYFKELSETKDFIEYRGKFYYDDEIAELYSKCDCIFSVY
FT                   DASMKNVRIALPNKLYESIHAELPIIVARDTYLSEVVNEWNVGVAVDHESDEEMRNVLI
FT                   KLRDDQSFYHSLQENCRKMQSELNPQKNNERLLKRIENLF"
FT   CDS_pept        148208..149434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0128"
FT                   /product="UDP-N-acetyl-D-mannosaminuronic acid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07546"
FT                   /db_xref="GOA:B0RZK5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK5"
FT                   /protein_id="BAG07546.1"
FT                   /translation="MINVIGLGYIGLPTALMLATSGNKVVGTDIKEEVIDKLKHKKLTF
FT                   EEKGMDELFEKALNADITFSLKPVSTSFYIITAPTPYDPVSKKLDCSYVVKAVESVLEP
FT                   AEEDAIIVVESTISPGAIDTYVRPVVNEYMEKSGKKLNLVHAPERIIPGNMVYELEHNA
FT                   RTIGADDPKYGEKVKEVYSSFCKGEINLTNIKTAEMTKVVENTFRDINIAFANELAKIC
FT                   RQGGLDVNEVIRISNKHPRVNILSPGPGVGGHCISVDPWFLVGDYPLLTEIIYKARQIN
FT                   DSMPEYVLRRAYNIMQENNLKDFSRVGIYGLTYKENVDDVRESPTLQLLQHQKEHLGDG
FT                   LKVYDPMVKREVVENQYHDLNKFLNDVDFVIVMIGHDEIRQNMDVLKDKVVLDTRNIDA
FT                   ENKYNFYKL"
FT   CDS_pept        149489..150580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0129"
FT                   /product="UDP-N-acetyl-glucosamine-2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07547"
FT                   /db_xref="GOA:B0RZK6"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK6"
FT                   /protein_id="BAG07547.1"
FT                   /translation="MKKVMVVFGTRPEAIKMCPLVKELKKRDEFEVCVLVTGQHKEMLR
FT                   QVLDVFEIKEDYNLDIMKEKQSLFDVTTTILDKIKSILEEEKPDIVLVHGDTSTSFVAG
FT                   LAAFYLRIPVGHVEAGLRTYNKYSPYPEEFNRQAIGSLADFHFAPTTTARDNLLRENKD
FT                   ESKVFVTGNTVIDALQTTVVDNYQNENLIEGKKMILLTMHRRENLGESMKNSFRAIKRV
FT                   VNENEDIYVIYPIHLNPKVREIANEVFDNHPRIKLIEPLNVVDFHNFMKQSFFVMTDSG
FT                   GIQEEAPALGKPVLVMRDTTERPEGVEAGTLKLTGLCEEDIYNEMTKLLTDKNEYDKMS
FT                   EATNPYGDGHASERICDILSKNL"
FT   CDS_pept        complement(151755..152786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0130"
FT                   /product="endoglucanase and aminopeptidase M42 family
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07548"
FT                   /db_xref="GOA:B0RZK7"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK7"
FT                   /protein_id="BAG07548.1"
FT                   /translation="MENLDFLQEILMTSSPSGDTKVVMEKVRKKFEELGKVEINFTNKG
FT                   AMVVTLRGETDEKQSTFAAHVDTLGLMVKEIKPNGRLKTFLVGGYAYNSVENEYVTIST
FT                   MSGKKYTGTCLNDKQSVHVYGPEAKSNERTAKTMEIRIDEKVESAEDVKKLGINVGDFI
FT                   YLDSRTQLTESGFVKSRHLDDKACVYVLYETVRYFVENNITPKHTLNFFISNYEEVGHG
FT                   ACYGIPEETDEFIVVDMAAPGDGQTSSEFKTTICAADSSGPYDLELKERLVRICEENNI
FT                   PHAVDIYPFYSSDGSAALEAGYNLRVALIGPGVDASHAMERTHQEGLQASIDLCIKYIE
FT                   DKK"
FT   CDS_pept        complement(152887..154401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0131"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07549"
FT                   /db_xref="GOA:B0RZK8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK8"
FT                   /protein_id="BAG07549.1"
FT                   /translation="MKKPKLNISSKNFLYNIILTLLICTIIFSYMAFYMPNVYLEKKIE
FT                   SAENIASSVHDSFIKNKNYNNLNEIAKEGMYSYFIPKGKDKVVFSGLRFNLSMTIKNEN
FT                   IKNLLRSLETDEFKEINSKNSERLINPLIKEAKKELEKYVIIDSYSNINNVSKDTFSIK
FT                   RKNNSILIKAESKTKDSIATNLILISKHSEGTYVSIYPYIFNSISDIKSTVISAFPVIF
FT                   LLIVMIVFLLNKIYSKSITQPILKMNNFTKVSKNQKNAKYDLEIHTNDEIEELSNNLKL
FT                   LYETLTENYKILEKNTKKKEIFIKSTSHELKTPLQTAILLNDSMIEKIGKYEDTDKYLP
FT                   ELRKKLYQIQILIDDLLFMNKIDENPIMENLKLSEIMKESVKNHHDLIAEKNLKVTIKG
FT                   EKSDIVDYDHFRIIFDNLLKNAIEYTDFGGNICCDFNDVIEISNNPTTVDKNLLNKITH
FT                   PFVSSTKNKSKGIGMYIVENLLEDMNYKIKIVYSNETFTVKILKTN"
FT   CDS_pept        complement(154388..155056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0132"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07550"
FT                   /db_xref="GOA:B0RZK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZK9"
FT                   /protein_id="BAG07550.1"
FT                   /translation="MKKIFFLEDELQIREILTEYMKIAGFDVCQSSNGDEAIKILSSNS
FT                   FDAIILDIMVEGENSGIDVLRFIRNTPSISNSNVLMLTALDDLNTQISAFDLYCDDYIV
FT                   KPVQPILLIKKLEMIMKRRSFSQNTSQVGLSLDEEGFRVLYNGMDLKLTVTEFQIMSLF
FT                   LNNPTKVFSRENLINSLYNTDFYGSSRTIDSHIKNLRKKLPKDFIKTVIGAGYKLNEEA
FT                   "
FT   CDS_pept        complement(155108..155860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0133"
FT                   /product="putative antibiotic ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07551"
FT                   /db_xref="GOA:B0RZL0"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZL0"
FT                   /protein_id="BAG07551.1"
FT                   /translation="MNKYIFKFETKLLLQNFTSLFFGMVFPILMSFLIISGLKDVPAPL
FT                   IDEVKRSIVLSISIISPFSIFLVGLSALFAKDLEEGVYDRLDLFSINHLSMAKYKFIVY
FT                   YLFWTVCNIFYFVVMKYTLGVNIPLISIIKHTGFVTLIAVASFFIGYSICIFFKKFSIS
FT                   FSLSMGIYFLSMILGGMMGIQVEDMPKGIKKIAQLIPISHFSSIEYVNEVAKGAKLNYS
FT                   FFQSLIVLVLLSLVLFTISIYKNKRKSN"
FT   CDS_pept        complement(155860..156723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0134"
FT                   /product="putative antibiotic ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07552"
FT                   /db_xref="GOA:B0RZL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZL1"
FT                   /protein_id="BAG07552.1"
FT                   /translation="MIKLNNVKVQYKDKIAVDIKDEIVLEDAHKIGIIGSNGAGKSTLI
FT                   KAILGLVNYSGSISSDIPKEKIAVHMQFNNYSETVKTKDIIQMITNKKIESDENLMDLI
FT                   KYFDFEKLLHKSFKKLSGGEKQKLTLILVMWQNSPVTIFDEVTTGLDFVSRQSLMEKIV
FT                   EYYKDKSTTILMVSHYYQELEDICDKLLYLHEGKVLFYGKKREMFLKYCTSSVILTEKN
FT                   SITESLIPKDIRLEAMENKIAAGFHDINTEKRLISTLVDNDQQFERLNDSIELTVLNAL
FT                   KKEGAK"
FT   CDS_pept        156829..157326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07553"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZL2"
FT                   /protein_id="BAG07553.1"
FT                   /translation="MKGYFASHFFNDAMFRWTEDLARFIEKEVDIDLYVPQRNDSINNK
FT                   KDNDATITDIDIARNDMAKLREADILIACLDGLSIDDGVAGEIMAFSVMKDYEEEYKFT
FT                   DKKRIIIGFVTDMRYLGTGENKLYRNQMIVGQVKDKGYFIVGYPNTDDYKKEIVDIIKR
FT                   EY"
FT   CDS_pept        157935..159191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0136"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07554"
FT                   /db_xref="GOA:B0RZL3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZL3"
FT                   /protein_id="BAG07554.1"
FT                   /translation="MNKLAIIGAQWGDEGKGKVVNYFSQFNDIIVRSSGGANAGHTIYF
FT                   KDKKYVHHLLPSITFDTDSKGFLAKGMVIELEQMIEELKVLEADFPGISKRFMVDVETF
FT                   IVLPYHKEEDGLLESMRKNPIGTTKRGIGPAYQDKAARQNVRIIDLFDDELLRERVEEI
FT                   VYLKNNIYEGKMHIDVDETVNYLLDKFDQLLKLGVTFTSASEIEDEIKNKRVLFEGAQG
FT                   IMLDLDSGTYPYVTSSTTTAYSASCADVTLTDDDTIMGVVKAYTSRVGEGEFPTELFDE
FT                   EADKLRKLGNEFGATTGRNRRVGWIDLAQLRYAIKKSKINSIVMTKADVLNGYDKVKVC
FT                   VGYEIDGVEQKMPFISNDFKKAKPIYKEFDGWNDVFEVNFLKYMTFIEKELDTEISYVS
FT                   YGPKTEEIMEKRDFIMNIK"
FT   CDS_pept        159233..160114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07555"
FT                   /db_xref="InterPro:IPR041273"
FT                   /db_xref="InterPro:IPR041644"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZL4"
FT                   /protein_id="BAG07555.1"
FT                   /translation="MDTVNLFIEYVKLNINKTYELRSRIYQIIKDYDQTTEKYKSCDMD
FT                   YLIEKISPDILNEACKCIEKGYEADSYIQNLSDEQIAVVLVSMLDFLKKSYEREKIDEK
FT                   VFFQTISDLIFRISDYKLRNGKYGLEGFEGKWLLRMFYLNIFKLGSLQFETGRINLDEM
FT                   KMKQEDLKEFEDIVNKDVIMVHIMENEDISRKSCEKSFELADEFFSNEYKYYVCYSWLL
FT                   YENMRDVLKPSSKILQFQNLFEKIINIDDSSMAKERIYKNHDKNNETSLQKNMKLHPEC
FT                   MGVGFGIKGAHL"
FT   CDS_pept        160198..161217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0138"
FT                   /product="sugar ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07556"
FT                   /db_xref="GOA:B0RZI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI3"
FT                   /protein_id="BAG07556.1"
FT                   /translation="MATLKFSNICKTYENNFKAIENFNLELKDKEFVVFVGPSGCGKST
FT                   ILRIIAGLEDITSGQLFIDDVCVNDVSPKDRDIAMVFQNYALYPHKNVYDNLAFGMKIR
FT                   KVDKNTIDEKVKKVSEILDLQDLLNRKPGQLSGGQRQRVALGRAIVRNPKVFLMDEPLS
FT                   NLDAKLRVQMRAEIVKLQKDLQTTMIYVTHDQTEAMTMGDRIVIMKDGVIQQIGTPDEI
FT                   YKHPINIFVAEFIGSPTINILGAEDFYIASGKKIESNLCVGLRPENLRIVEGDDYVITV
FT                   IENLGSEKFVHVEREGIKLTIKYSGETEYSLGDKISLRIKNDAILNYFDKNTGESVSI"
FT   CDS_pept        161236..162516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0139"
FT                   /product="sugar ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07557"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI4"
FT                   /protein_id="BAG07557.1"
FT                   /translation="MKKLFKVTLFLMVTALLMSGCSKGNTNESSKGTTDDKNSAETKEV
FT                   SLMIPEWGVPTKEMLADFEKESGIKVNVMPTSWDDIRNKISTAAAGKNAAADVYEVDWS
FT                   WVGEFQKAGWLEPIEMDKADLEDMKTTSTFMIDNKLYAIPYSNDYRIGFYNKAMYEKAG
FT                   LTKEPQTWDDVINDAKVLKEKKVCEYPISNPMAADEKTTTTFLWLAYTRNGKVFNDDNT
FT                   LNEEATLDALTILDKINRPGLSDPANRTASGAFDKLKNGECAFMVGPSSNVMSVNDKEK
FT                   SKVVDQVMPIVLPGKDKKATATVPFAEAIGVSPYSKNKEAAMKFAKWYTSKETQYKLYN
FT                   ALSNLPTRTSVIEQLLNEGKIKNPGAMLELAKVIETPFPNGVPIYYTKMSTEIFNTINQ
FT                   MANEKLTPEQAAKQMVTNVNKIVEENK"
FT   CDS_pept        162582..163433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0140"
FT                   /product="sugar ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07558"
FT                   /db_xref="GOA:B0RZI5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI5"
FT                   /protein_id="BAG07558.1"
FT                   /translation="MKKSKKGYLLLLPALFIIITTVVYPVIRTFFFSLQNYNLTEPYNI
FT                   KWIGLKNYEKVLKSPDFYAALKNSLIILLLTVIIAFVCSVIVGLILNEKLRLSPILTAI
FT                   AIIPWALPPLVNGIIWKFIFYPGYGLMNKILINLHLIEKPVLWTVNLKTTLFVVSVVVA
FT                   WRVVPFCAILILSTLKNIPDDLYEAALVDGASKAQQFREITLPMLLPSMAIVLIQITMA
FT                   AINVFDEVVTITGYKLEAATLLIYNYMHTFSYLNFGYGSAITYIIMILSGIIGYFYIKD
FT                   AN"
FT   CDS_pept        163443..164288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0141"
FT                   /product="sugar ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07559"
FT                   /db_xref="GOA:B0RZI6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI6"
FT                   /protein_id="BAG07559.1"
FT                   /translation="MKDSLFEKIIKYLCIILFVLFTLGPLIWCFVITITPEYEMLKNTT
FT                   SFLPSEIYWGNYKEIFDATTKSHEVLFGGLMNSLKMAALTILIGIPTAVLAGYAFYRYK
FT                   FFAKNFIIKFLMITIVIPVFTTIIPIYATFARFGFLDKLFYVSIIYVSAFIPITTWIIM
FT                   NYFKTLPKELLEAAEVEGLNERQIFFYVILPISYPIILTCVLMVFIMSWNQFQIPLILL
FT                   SSPENKVVTLILSEFMGRNDISYGLIALCGLVSLVIPAIVAIIFRNKLISGLTQGSVKG
FT                   "
FT   CDS_pept        164620..165210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0142"
FT                   /product="transcriptional regulator TetR/AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07560"
FT                   /db_xref="GOA:B0RZI7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI7"
FT                   /protein_id="BAG07560.1"
FT                   /translation="MSYLDEKKKDNKLQIIQSAIKMFEKKGVEKTTIRDIMNNTDLGLG
FT                   TFYSYFKDKEDLKEQIVLSKVVDLVLEAEKKCTQEDHVERFISFTDFIIDYYIAHPFEF
FT                   ELVASNLNWALYAKVENEERFAEADTTLKYILNKYSQLFSKEYSDSQKLYILSLTIETV
FT                   ISTCKLAIRKDSILSIDEMKSVLVEVIKQILNR"
FT   CDS_pept        165222..167276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07561"
FT                   /db_xref="GOA:B0RZI8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI8"
FT                   /protein_id="BAG07561.1"
FT                   /translation="MKKFSEFIANHPKLVLLVMTLLLIPSIIGYKATNINYDILSYLPT
FT                   DLKSTQGQSILDKDFKNAATGMLILEGSDNDAEKLREQVQKIDGVEDVISKTSIIGPTV
FT                   PNEFLPDDIRDVFYAKDSTLMMVKFSESSSSMRTMKAIEQIKKIESKQKYLSGISALVK
FT                   DTKDLIDKETPIYVMLAVALGLVVLSLTNESTVIPFVFMLNIGYAVIYNFGTNIFLGQI
FT                   SYITKAIAAVLQLAVTMDYSIFLYHRYAAEKKKRDSHAKAMAKAIEATFSSLFSSSLTT
FT                   FAGFLVLILMRLSLGKDIGLVMSKGVFIGLLSTLIVLPPMLLLTEKAVDKYNHKVLLPE
FT                   FNKLPNFVVDKRKVLAMVFVVLFIPAIYGSVNTKLYYNLDRSLPQDLDSIVSLNKMKKD
FT                   YNMASTHFIVVKDNLSNTAMNSMIDELKHIDGINSVVGTSSITGVTIPATFLPDKLRDN
FT                   FVKNGYEMIMVNSKYQTASEEVNKQITQMRDVIAKHDKDGYLTGEAVLTDDLTDISDQD
FT                   FKMVNIASLIAVFIIIAISFKSFGIPVVLIAAIELAIQINMAIPFYFNQTIPFITSIVI
FT                   GVIQLGSTIDYSILMTDRFLYEYRKSKDLNGSLKTSVKETSKSIVTSALSFMAATIGVG
FT                   IYSKMEIVSTICTLLARGAIISMLVIIILLPAILSVTFPFIKKTTKNLA"
FT   CDS_pept        167289..169622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07562"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZI9"
FT                   /protein_id="BAG07562.1"
FT                   /translation="MKKNIEKILALSLISSMTFANLSFAEQQDLIKKSETVYVTVEGNE
FT                   IKDKSVSVWLNSDKNIKANDKSNLTNVKDLKTDKELKSENGYLKLDENKKDIYYKGDTD
FT                   KKLPVDVSVKYFLDGKEMKASELEGKSGHLKIVITSKNNRYEKKTIDGQSRNVYSPYVV
FT                   VAAMTFDDEKVNNVSSDDVKIVKDGKNEIVTTVMTPGMKQNLSGIVEDKELNKFKDEVS
FT                   VEMDIKDYKPVEIYSVITNEFFQEKKNIDSLDKLQNGVKELQDNSQKLVDASVKLSEGQ
FT                   DKLNSGISQMQTGVTKLRNGSQKLASSTQQMQGKFSGIQSKVGPIQGYVAQMNDGSLKL
FT                   YNGISDYTAAVGKIKENTAKIKEGSEKLAKGATDLDNGVGKLKDATSQLRAGTENMKQM
FT                   SAQKDQLLEKSTQLSNGLNGLAGSYGQLANTVEQISGKSQQLKDSSAQFNEKLQQVAQL
FT                   AGGADGSANAEKIALGLETSAEGLNNAIQQLQAKNGDGQLSDTIAYLQAQKNVMYVQAQ
FT                   SIRNAGSQNAGQQKLQAALNELAQSSSALSQGNADLSNALMRTSAAMNQSKSKLVDSSN
FT                   QLSQGLGQMGGALNGADGLSTLKDSIDKLDDATGQIKGGSQSLKEGTLQNEQAMAMLLN
FT                   GMEELDKNSSALVEGSKKLSGGLQEFNKQSALLSSLSQINEKAIIPMSNAINMLNDGLG
FT                   RLDSSTGQLKSGSDKLSSGQKEFSSKLKEYKEKGIDELSNKTKDLNKFKDIIDAMSDLA
FT                   VKDSSFTGTDNNFETKSRIIEKIK"
FT   CDS_pept        169888..171618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0145"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07563"
FT                   /db_xref="GOA:B0RZJ0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZJ0"
FT                   /protein_id="BAG07563.1"
FT                   /translation="MRMNKFYMPTLREDPQDAEIASHKLLLRAGMIRKTAAGLYSYLPL
FT                   GYRIVRKVENIVREEMDNYGSQEIHMPITQPREIWEESGRWKTFGPEMFKLKDRNNREF
FT                   CLGPTAEEYFTDLVKGEIKSYKQLPLNIYQIQTKYRDEKRPRFGINRSREFLMQDAYTF
FT                   DVNEEAMGEAYMNMWRAYEVVFNRLGLEYKIVAGDSGAMGGNSSHEFIALSDVGEGVIC
FT                   YSDDSDFAATDEKAYVYYQVNDENVEKLSSEKVLTPNCKTIEEVSDFLNVDAAHCLKAV
FT                   DLMVEGKPVIVFIPGDRELNMSKLVSYLKCPEHEIEMMEEQDILALNSSPGFTGPIGLD
FT                   CRIIIDSRVKQMKNFVVGANEENYHIKNVNYGDDFEGEIVEDLLMVQEGDIDPETKSPL
FT                   KFKRGIEVGNIFQLGQKYSKSMNATFLDENGKEQFFWMGSYGIGVTRSVSAIVEQNHDD
FT                   KGMIWPLVVAPYHVIITIVNTKDEEQNTLAEKLYEKLLLQGVEVLLDDRKERVGVKFND
FT                   RDLIGIPLRITVGKKAAEDIVEFSERRTLENVEMSSTEAYEKVMEIINSNLKSVGGLYR
FT                   "
FT   CDS_pept        171758..171958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0146"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07564"
FT                   /db_xref="GOA:B0RZJ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZJ1"
FT                   /protein_id="BAG07564.1"
FT                   /translation="MKNIISQLRKENKITQEELASEVGVTRQTITSIENGKYIASLPLA
FT                   FKIAKFFEMKIEDIFTMEGDD"
FT   CDS_pept        171959..172408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0147"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07565"
FT                   /db_xref="GOA:B0RZJ2"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZJ2"
FT                   /protein_id="BAG07565.1"
FT                   /translation="MKNLQNYRKEIARRISLLVVFCVIALLAIVLGADFLKDISPKTTD
FT                   RTDYVLGFFTGIELVCVFYMGCLIRAYRDEKYLKEMYTKETDEREILIRMKSGKNIVPI
FT                   LSLVIAVIACVMSYVNYEVFIALTAVAIAQIIITLILKIYWSQKL"
FT   CDS_pept        172539..173582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07566"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZJ3"
FT                   /protein_id="BAG07566.1"
FT                   /translation="MREFDYSKLLNLNIPANMYNLISKIYEYKGKQELYVANFSDVLEK
FT                   MVEVAKIQSTKSSNAIEGISTNDSRLEELMNKKSEPRNRNEEEIYGYREVLDIIHENYT
FT                   DIDLTKNNILTLHSRLYYYSSENHKGKFKTIDNSIVETNAFGEKKIRFQPVSAFETENY
FT                   IDKMISAYDEAVKLKVPPLLLIPVVVHDFLCIHPFYDGNGRMSRLLTLLLLYKNGFFVG
FT                   KYISLEMIIEDTKDKYYEQLQASSENWHSGENNELPFIKYMLSVIYKAYFECDERFRLI
FT                   GEKSLTSADRIMKVFEKTLKPLSKSDIVIICPDISQRTIERALKELKDTHLIKQIGSGR
FT                   ATKYIKA"
FT   CDS_pept        complement(173632..174696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0149"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07567"
FT                   /db_xref="GOA:B0RZJ4"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZJ4"
FT                   /protein_id="BAG07567.1"
FT                   /translation="MEDIRKQVSEYYSNITTEKEGQMETKICSCQDNMPDHLKEIRSMI
FT                   NPEIIKRFYGCGSPIPPALEGCTVLDLGCGTGLDVYIASKLVGENGKVIGVDMTDDQLN
FT                   FAKKYQDEMAEKFGYKKSNVEFKKGYIEDLKSIGIEDESIDVVISNCVINLSPFKEEVF
FT                   KEVWRVLKKGGELYFSDIFADRRVPDEIYQNPVLRGECLAGAMYVEDFRRLLRKIGWED
FT                   FRYTKTTVAPIENKEIEKLVGNVNFTSRTVRAIKLPGIIEDKCEQYGQFATYRGGMVGC
FT                   DNYFDLDDHHRFFVDLPMAVCGNSCAMVQDTRFGKYFDVVGDRSKHFGLFDGCGDSPAP
FT                   AADDCGCDGGSCCC"
FT   CDS_pept        complement(174723..175556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0150"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07568"
FT                   /db_xref="GOA:B0RZJ5"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZJ5"
FT                   /protein_id="BAG07568.1"
FT                   /translation="MSSEGDNCCCEVVTKESLIQGFTGEVIGTFLMCFLGIGAVATATL
FT                   YQAHTGPFQVGMVWGLAIAIAIYTTRNLSCAHFNPAVTFAMCISKRCSWKNFPVYVLGQ
FT                   FVGAILAASALWVFFQDSIKKSLDAANVTMDVATPASSIWCEVFPNTANGVISMPVAAF
FT                   AEALGVFVLVMIIFSMTEGCNVGRPSDDIFPLFIGLTVTALICTIGPMTDAGLNPARDF
FT                   APRIVAYFVGWKNVAFSMDAFIVYALAPLIGGGLSAILFTKFIEPMQNKKNCSCN"
FT   CDS_pept        175720..176682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0151"
FT                   /product="conserved hpothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07569"
FT                   /db_xref="GOA:B0RZJ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZJ6"
FT                   /protein_id="BAG07569.1"
FT                   /translation="MKTDKIILRKFTINDAEKMFENWSSDSRVTKFLTWKPHTSIKESE
FT                   KIIKQWINDDKNIYFAICNTNNENIGCISASLIKENPKTYAIGYCLAYDYWSQGIMTES
FT                   LKLMLKYLFEEKHAVRVEATHDRRNSASGKVMGNANMKYEGCLRKSATNNQGVADSCMY
FT                   SMIDEDYECDFVIPEFDEMNFRQELLADEKTMSFNEKYGGAIDFSEDKWRNWYDKWINS
FT                   DDRFYYYIMGHNKPVGECCIYKEDDRWICSLIVKDEYRNNGYGKKGLMFLIDLAKKLDI
FT                   DELYDNIGTCNPSLNLFLSLGFEVVYTNEEYSTVRIKTR"
FT   CDS_pept        176774..178114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0152"
FT                   /product="Na+driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07570"
FT                   /db_xref="GOA:B0RZJ7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZJ7"
FT                   /protein_id="BAG07570.1"
FT                   /translation="MKNKNFYKRAIQVAWPSVLESFFIALAGIIDTYMVSSIGSSAVAA
FT                   VGLTTQPKFIALSIFFAINIATSALVARRLGEEDKEGANRILVTAIIMGLVLTVVISTL
FT                   MVYFSDSILRLAGSNSDTHTDALNYFRIIMGGMLFSVVSMAINAAQRGSGNTRIAFTTN
FT                   LVSSIVNIFFNYCLIGGNFGFPKMEVSGAALATVLGTVVSSIMCIRSLFRKDGFVQIKY
FT                   IFKKKIKPTVEVFTSIVKLGTNLFVENIAMRIGFLTTALMAAGLGTDTFAAHNVGMNLL
FT                   SICFAFADGMQVAAVVLTGSSLGAGKKENAKIYGKVCQRIGLMISLVLSLILLLFGKGI
FT                   FHLFFDKLSIIETGEIIARFITVIVLLQISQIIYGGCLRSAGDVKYTLISSIISVTIIR
FT                   TVVTYILVSVFEMGIVGIWLGIFSDQFSRYMFNSIRFRQGKWVNIKI"
FT   CDS_pept        complement(178195..178728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07571"
FT                   /db_xref="GOA:B0RZJ8"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZJ8"
FT                   /protein_id="BAG07571.1"
FT                   /translation="MVEEKKSVDWFSLITGICFIIVSFIAFKNPYASLASLVIYFGIIA
FT                   IVKGVGGVLIYKKIKDFTRLNIKLFFWISIIDIILGLILVFNVESAVLIIPYVFSIWFI
FT                   IDSINDISFGRYLRFVPGGLYHLNIIINIITLILGIMMLYNPLRASFTVVFLIGMYLTI
FT                   SGVKYIAYAFKHEY"
FT   CDS_pept        179479..179787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0154"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07572"
FT                   /db_xref="GOA:B0RZJ9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZJ9"
FT                   /protein_id="BAG07572.1"
FT                   /translation="MANQKIRIRLRAYDHELIDQSAQKIVEAAKRTDVKVSGPIPLPTE
FT                   KEVITILRAVHKYKDSREQFEQRTHKRLIDIINPNAKTLEALKKLNLPAGVDIEIKL"
FT   CDS_pept        179862..180491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0155"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07573"
FT                   /db_xref="GOA:B0RZU0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZU0"
FT                   /protein_id="BAG07573.1"
FT                   /translation="MKSILGKKIGMTQIFNEDGSVVPVTVIEAGPMVVTQIKTKEKEGY
FT                   NAIQVGYIEKKEKHVNQPMRGHFGKAGVSFKKHLREFKINDDEQFNLGDEIKLDIFQDG
FT                   DVVDVIGISKGKGTQGAIVRHNYSRGPMGHGSKSHRVAGARSAGSYPARVFKGRKGSGK
FT                   MGHDRVTVQNLKIVKVDNERNLLLIKGAVPGNKGGVVTVREAIKSK"
FT   CDS_pept        180507..181130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0156"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07574"
FT                   /db_xref="GOA:B0RZU1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZU1"
FT                   /protein_id="BAG07574.1"
FT                   /translation="MPKVQILNQQGENVGELELNEAIFGVDVNEHVVYEVVKNQLANKR
FT                   QGTQSAKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFAPKPRDYSYAVPKK
FT                   VRRLAIKSVLTEKVNDNEMIVLDKLNLDAISTKKAVEVLKNIKADKKALVVIDKNDDTL
FT                   YRSFRNIENVAICEAKLINVYDCLKYNSLVITTDAVKILEEVFQ"
FT   CDS_pept        181130..181420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0157"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07575"
FT                   /db_xref="GOA:B0RZU2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZU2"
FT                   /protein_id="BAG07575.1"
FT                   /translation="MKSPYDIILKPIISEDSMEKMEDKKYVFKVDKNANKIEIRNAIEK
FT                   IFDVKVKSVNTMNVKGKVKRMGAHSGKRSDWKKAIVALTEDSKEIEFFEGM"
FT   CDS_pept        181437..182267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0158"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07576"
FT                   /db_xref="GOA:B0RZU3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZU3"
FT                   /protein_id="BAG07576.1"
FT                   /translation="MAIKKYKPTSAGVRGMSVLSFDEITKTTPEKSLTVSLNKSGGRNS
FT                   YGRVTIRHRGGGAKRKYRIIDFKRNKDGIKAVVKSIEYDPNRTANIALLQYEDGEKRYI
FT                   IQPVGLKVGDVVESGADVDIVPGNALPLRNIPVGTTVHNIEMKVGKGAQLVRTAGAEAQ
FT                   LMAKEGKFAQLRLPSGEFRLIHLDCKATVGQVGNISHELVTIGKAGRNRHLGKRPYVRG
FT                   SAMNPVDHPHGGGEGRAPIGRPAPSTPWGKPALGLKTRKKNKKSNKYIVRRRKK"
FT   CDS_pept        182280..182564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0159"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07577"
FT                   /db_xref="GOA:B0RZU4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZU4"
FT                   /protein_id="BAG07577.1"
FT                   /translation="MSRSLKKGPFCDEHLMKKVEELNKNDEKKIIKTWSRRSTIFPNFV
FT                   GHTIAVHDGRKHVPVYITDDMVGHKLGEFVPTRTYKGHIKNEKTSKVRN"
FT   CDS_pept        182582..182920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0160"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07578"
FT                   /db_xref="GOA:B0RZU5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZU5"
FT                   /protein_id="BAG07578.1"
FT                   /translation="MQAKAIAKYVRISPLKVNFICKEIRGKQVDEALAILKFTPKKGAR
FT                   ILEKVLNSAIANAEHNFGLNREDLFVSQAYANNAPVMKRWRPKAKGMAYPILKRSSHVG
FT                   VVVEEREL"
FT   CDS_pept        182932..183666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0161"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07579"
FT                   /db_xref="GOA:B0RZU6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZU6"
FT                   /protein_id="BAG07579.1"
FT                   /translation="MGQKVNPKGLRVGVIKDWDSRWFADKKDFGDYLVEDHKIRELIKK
FT                   ESFSAGISSVSIERASNKIKVTINTAKPGMVIGRQGAGVEELKNKLEKLTGKKLIINVE
FT                   EIKFQDLDAQLVAENIASQLERRISFRRAMKQTMQRSMRAGALGIKTMVSGRLGGADMA
FT                   RSEGYSEGTIPLQTLRAAIDYGFAEADTTYGKLGVKVWLYKGEMLPGMTEEDLPVYKNK
FT                   KNDKNKKRRNNNRKGKSQAAKN"
FT   CDS_pept        183688..184131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0162"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07580"
FT                   /db_xref="GOA:B0RZU7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZU7"
FT                   /protein_id="BAG07580.1"
FT                   /translation="MLMPKRVKYRRVHRGRMKGKALKGNTLTYGDYGIQALGSCWLTAN
FT                   QIEAARRAMTRYIKRGGNIWIKVFPDKPVSKKPIGIRMGSGKGAPEYWVAVIKPGRVLF
FT                   EMAGVPEDVAREAMRLAQHKLPIKTKFIAREEFGEKDGEADEN"
FT   CDS_pept        184121..184327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0163"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07581"
FT                   /db_xref="GOA:B0RZU8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZU8"
FT                   /protein_id="BAG07581.1"
FT                   /translation="MKTKEIRNLSDQDLQKQLEQSKSELFNLRFQLATGQLENPMMIGL
FT                   VKKDIARIKTIIRERELNIGKEA"
FT   CDS_pept        184345..184587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0164"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07582"
FT                   /db_xref="GOA:B0RZR8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZR8"
FT                   /protein_id="BAG07582.1"
FT                   /translation="MRKTIVGIVVSDKMDKSIVVEVKTLVKDPKYGKQLRKTTKFKAHD
FT                   EENIAGIGDKVKIMETRPLSKTKNWRLVEIIEKAK"
FT   CDS_pept        184612..184980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0165"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07583"
FT                   /db_xref="GOA:B0RZR9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZR9"
FT                   /protein_id="BAG07583.1"
FT                   /translation="MIQQESRLRVADNSGAKELLVIRVLGGTKRKYAAIGDIVVCSVKS
FT                   AQPGGMVKKGDVVKAVIVRTTKPLGRADGSYIRFDDNAAVIIKDDKNPVGTRIFGSVTR
FT                   ELRANNFMKIISLAPEVL"
FT   CDS_pept        184999..185307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0166"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07584"
FT                   /db_xref="GOA:B0RZS0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZS0"
FT                   /protein_id="BAG07584.1"
FT                   /translation="MKIKNGDTVIVISGKDKGKTGNVIEVLAKKNKVVVEGVNIVTKHQ
FT                   KANGRGVESGLIKKEAPIDVSNVMYYDAKNKKGTRLGYKFEDGKKVRFMKSNNETIK"
FT   CDS_pept        185326..185868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0167"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07585"
FT                   /db_xref="GOA:B0RZS1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZS1"
FT                   /protein_id="BAG07585.1"
FT                   /translation="MTSRLKEKYTNEVVPFLVERFKYENIMQVPRLEKIVLNMGLGSSK
FT                   ENPKAIESAVKELETITGQRPIVTKARKSIANFKLREGMNVGVKVTLRGEKMYDFLDKF
FT                   MNISLPRVRDFRGISSKSFDGRGNYAVGIKEQLIFPEIEYDMVDQIRGMDIVVVTTANT
FT                   DEEAKELLDKMGMPFKK"
FT   CDS_pept        185881..186066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0168"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07586"
FT                   /db_xref="GOA:B0RZS2"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZS2"
FT                   /protein_id="BAG07586.1"
FT                   /translation="MAKKSMIAKQKRPAKFSTREYNRCKICGRPHGYLKKYGICRICFR
FT                   ELAYKGEIPGVRKASW"
FT   CDS_pept        186088..186483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0169"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07587"
FT                   /db_xref="GOA:B0RZS3"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZS3"
FT                   /protein_id="BAG07587.1"
FT                   /translation="MMTDPIADMLTRIRNAVNAKHKVVEVPASNIKKSIAQILLDEGFI
FT                   DGFNVTEDGKQGIITIDLKYGPNEEKVISGIKRISKPGLRVYARANEVPKVLGGLGIAI
FT                   VSTSKGLVTDKVARKEGIGGEVICYVW"
FT   CDS_pept        186510..187049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0170"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07588"
FT                   /db_xref="GOA:B0RZS4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZS4"
FT                   /protein_id="BAG07588.1"
FT                   /translation="MSRIGLKPIEIPNGVEVKVTEDNLCTVKGPKGELVEQMPKEMIIK
FT                   VEDNTITVSRPSEIKRHKSLHGLTRTLVFNMIEGVTEGYKKTLIIEGTGYRAAKQGKKL
FT                   VLNLGYSHTIEKEDPEGISVEVPEQHTLIISGINKQQVGNYAAKIRDLRGPEPYKGKGI
FT                   RYEDEHIRRKVGKTGK"
FT   CDS_pept        187064..187426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0171"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07589"
FT                   /db_xref="GOA:B0RZS5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZS5"
FT                   /protein_id="BAG07589.1"
FT                   /translation="MFKKIDKNANRVKRHLRIRKNLTGTSEKPRLCVFKSNTNIYAQLI
FT                   DDVNHNTLVAASTLDKDFSGESKSNKEAAKLVGELIGKKAIDKGIEQCVFDRSGYLYHG
FT                   KVKELAEGARSAGLKF"
FT   CDS_pept        187447..187953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0172"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07590"
FT                   /db_xref="GOA:B0RZS6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZS6"
FT                   /protein_id="BAG07590.1"
FT                   /translation="MELLNKEIEGLELEERVVNINRVAKVVKGGRNFRFAALVVVGDKN
FT                   GHVGVGIGKAQEVPEAIRKASQDAKKHIFTVPIVNTTIPHQVTGIFGAGRVLLKPAGEG
FT                   TGVIAGGPVRAVCELAGIKDVRSKSLGTSNPQNIVNATVEGLKSLKTAEQVAKLRGKSV
FT                   EEILK"
FT   CDS_pept        187967..188149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0173"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07591"
FT                   /db_xref="GOA:B0RZS7"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZS7"
FT                   /protein_id="BAG07591.1"
FT                   /translation="MSKLKITLKKSKIGRIEKHIRTCEALGLHKIGQSVIKEDNDAIRG
FT                   MIRHIAFMVDVEEVK"
FT   CDS_pept        188161..188610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0174"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07592"
FT                   /db_xref="GOA:B0RZS8"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZS8"
FT                   /protein_id="BAG07592.1"
FT                   /translation="MKLHNLRPAKGGEVKARKRVGRGYGSGLGHNAGRGRDGQNSRSGG
FT                   GVRPGFEGGQMPLFRRLPKRGFKNHFAKQYAEINIRDLNCFEDGEEITPEILANAGFFK
FT                   PAKAKDGVKILGDGEITKKLTIKANKFTKSAEEKITKAGGKVEVI"
FT   CDS_pept        188612..189886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0175"
FT                   /product="preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07593"
FT                   /db_xref="GOA:B0RZS9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZS9"
FT                   /protein_id="BAG07593.1"
FT                   /translation="MLKTLKDSWKVLDIRKRIGFTLLMIVVFRLGNTIPVPFMDKAIIK
FT                   QIMSGQEGGIVSLLNLLSGGSLRQMSIFALSIYPYITASIILQLLTVAFPRLGELTREG
FT                   EEGKKRMGKYTKICSIILAFIQGYATVNGLFNRAIVDKSFLTGFVILISLVAGSMFLVW
FT                   LGEMITERGIGNGISILIFLGIISNMPRQIGTMIYQSRQGMLSWWKISLFVLIAIIILV
FT                   VVVLINQGERRIPVQYAKRVVGRKMYGGQSTHIPIKVNMGGVMPVIFASAILQLPQTIA
FT                   LLFGKDMPGWLAHIFTVQTTSGLVIFSIVNMLLIIIFAFFYSAIQFNTVEYAKNLQQYG
FT                   GFIMGIRPGKPTGMYLKKISDRVTFIGAIILAIVASAPMLISKAIGIQILFGGTSIIIV
FT                   VGVVLDTVKQMESMLTMKHYKGFLK"
FT   CDS_pept        189897..190544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0176"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07594"
FT                   /db_xref="GOA:B0RZT0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZT0"
FT                   /protein_id="BAG07594.1"
FT                   /translation="MRLILLGPPGAGKGTQAKRVIEEFDIPHISTGDIFRKNIKEKTEL
FT                   GQKVEGLLAQGKLVPDELTIEIVWDRLDQEDCKNGFLLDGFPRTIPQAEALDEGLAKRG
FT                   LKLDRVLNIDVDKDSLVKRLSGRRVCPSCGASYHIDNNPTKVDGICDACQTPVIQREDD
FT                   KEETVLDRIKVYDSQTKPLVDFYNKQDLVFTVDGTLPIDEITNKLVTELKKG"
FT   CDS_pept        190550..190834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0177"
FT                   /product="putative 50S ribosomal protein L14e"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07595"
FT                   /db_xref="GOA:B0RZT1"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZT1"
FT                   /protein_id="BAG07595.1"
FT                   /translation="MSQYNKLETGQVVLSTCGRDMGKLQMVLEILDDSYVLVVDGKQRK
FT                   IEKPKKKKIKHLQKYNKKLQLENLTDKKLRYMLNNLKKEDQDKDVQRSY"
FT   CDS_pept        190815..191030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0178"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07596"
FT                   /db_xref="GOA:B0RZT2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZT2"
FT                   /protein_id="BAG07596.1"
FT                   /translation="MSKEVIELEGTVVDALPNTVFKVELQNGHVITAHISGKLRMNYIR
FT                   ILPGDKVTVELSPYDLDRGRITWRKK"
FT   CDS_pept        191171..191521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0179"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07597"
FT                   /db_xref="GOA:B0RZT3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZT3"
FT                   /protein_id="BAG07597.1"
FT                   /translation="MARIQGVDLPNDKRVEIGLTAIYGIGRQSSNKILAKLGINPDTRV
FT                   KDLTESELSDIRNELDNYLTEGDLRRDVAMNIKRLKEINCYRGSRHKKGLPVRGQHTKN
FT                   NARTRKGPRKQA"
FT   CDS_pept        191537..191944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0180"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07598"
FT                   /db_xref="GOA:B0RZT4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZT4"
FT                   /protein_id="BAG07598.1"
FT                   /translation="MALKTKGAKRNVRGKKRVKKNIEKGQAHISSTFNNTMVCLTDLNG
FT                   NVLSWASAGQLGFRGSRKSTPYAAQQAAEEAAKKAMEHGLKTVEVYVKGPGSGRESAIR
FT                   SLQASGLEVSSIKDVTPIPHNGCRPPKKRRV"
FT   CDS_pept        192000..192953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0181"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07599"
FT                   /db_xref="GOA:B0RZT5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZT5"
FT                   /protein_id="BAG07599.1"
FT                   /translation="MTEQLDTKIKIVELDEQNNYGKFVIMPLERGYGTTLGNSLRRVLL
FT                   SSLPGAAISKINIQGVAHEMSTIKGVKEDVPEIILNLKGIAVKKYNEEPISLNVDIKGP
FT                   CVLTAKDILVDTDLEVKNPDHYIATLNEDASLEMQITVINGKGYKISEFNKTDEDIIGD
FT                   IAIDSLFSPVKKVNFTVDNARVGQVIDYDKLTIEVWTNGTIRPQDALSEGSNILINCLE
FT                   LFSELPNYECNTNSDDEDNQKDKETQMVINIEELDFSLRSFNCLKRANINTVGDIVSHT
FT                   KADMMKIKNFGKKSLDEVEEKLQEMGLAFKQEIKDE"
FT   CDS_pept        192967..193362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0182"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07600"
FT                   /db_xref="GOA:B0RZT6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZT6"
FT                   /protein_id="BAG07600.1"
FT                   /translation="MANLRKLGRRTDHRTAMLRNLVQSLFENGKIETTVTRAKEARREA
FT                   EKMITLGKKGDLSARREALKYIYKKDVVYTLFEEIAPVYADRQGGYTRILKLGPRRGDG
FT                   TEMCILELVDYTKKESSEEKETVKADK"
FT   CDS_pept        193495..195468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0183"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZT7"
FT                   /protein_id="BAG07601.1"
FT                   /translation="MNKKILAGVLLTSLLIGTNSFAANETKKIDTLEDFGLKLDSKLDK
FT                   TNLADEIKLENGVTLKFDKDGKLIGINALSSTEKLLSGKSDEKFEDYKNKTLDMLKKEG
FT                   YIPKEYKLVDKQDILDNGYKVVFEKENSYNIKNPYNIITVSFDKKTNELKTFNKIEKFE
FT                   VTKAPTAKLADAKKVAIEKLKSIKDFDETKIKSETSVINIDNLPTKFTKNKGLVVAYVF
FT                   EYEDTKVYVDANTKELLGADKLKTNENTQSTKPYVVSRIYGKDRIDTSIQIAKSYIKTS
FT                   EFAILANQNNFPDSLSATVLSKKFNAPILLTDANTADKGLIQEIKRLQTKYFVKIGGEK
FT                   SISNEVAKQLLPEKSKVRSFKGADRYATNAEIIKEFKDADTCIIASGENFADSLSIGAY
FT                   ATKNGYPIVLVQKNKINDVTKQALKDSKIKKCYIVGGENSISKSLEKELPQVIERIAGN
FT                   DRYETSLKIADKFYKDAEGAYLASGEVFADSLAINPIAAKFDVPLILTPKDKLPQKTLE
FT                   YLEKSKIIQVAIIGGEKTVSKQIQQELAKNNQEVATTVTFTYTKDGKKVTRELTNAEAN
FT                   ELAKLMNEHDKYVKDQRLKSIFNNYFTLVGANGRTKVAVSVNIEKDEVVIDDAINEKGA
FT                   TLNKDNELAKQYIKFIKNLKQN"
FT   CDS_pept        195563..196159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0184"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07602"
FT                   /db_xref="GOA:B0RZT8"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZT8"
FT                   /protein_id="BAG07602.1"
FT                   /translation="MARMMGPRFKQSRRLGLNVCGHPKANKRMGKGLGRNDKKLTEYGM
FT                   QLLEKQRLRAYYGVNEKQMHKYFEKALNNKEGLTTGDVMVRQLETRLDNLVLRASFASS
FT                   IRQARQMVSHGLIRVNGKKVDIPSFQVAEGSVIELKEKSRSNELFKENYETNFAQSLPY
FT                   IDKEENFKVTLTRLPERQEIPIEITDSLIVELYSR"
FT   CDS_pept        196263..197498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07603"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="InterPro:IPR038054"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZT9"
FT                   /protein_id="BAG07603.1"
FT                   /translation="MKKRVLITTILFLFLVYFSGTTFFTFYALPNTYVNGYNMSFVEKS
FT                   KIVDRNADIRTLTIGATDNRKLVIDAKEVDFNLKIPEDFKFEQNPFSWPLSFFDTKKYN
FT                   INFDYTIDEDKLNKKIYQAKLNKNAKKSYNAYISYLDDEYTIIPEEVGNEINTDKLKDT
FT                   IKKSLLEQKEEITLKNEYIKPTVYSNDWNIIRAKNKLNKLKDIEISFDFNDTIHKLKGA
FT                   KLRDMMDFDDRRGFVYKDSEIEQFVEELKKETDTYNKPHTIKTVENKTLTLNSTDYGWE
FT                   IDKPKTVELIKETLDNNESKTIEPVYSKQAKSRLKNDIQDEYIEIDQQNKTLYYINNYK
FT                   INKSIPIKIAQPLPKGIYNIDSKTKGYSNNYTLGFYRHTISSSQNSDIQVNSKLLESIY
FT                   YDVGDNIPVIVY"
FT   rRNA            197837..199361
FT                   /locus_tag="FMG_rrnD_16SrRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            199405..199480
FT                   /locus_tag="FMG_tRNA03"
FT                   /product="tRNA-Ala"
FT   rRNA            199618..202621
FT                   /locus_tag="FMG_rrnD_23SrRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            202662..202777
FT                   /locus_tag="FMG_rrnD_5SrRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            203096..203170
FT                   /locus_tag="FMG_tRNA04"
FT                   /product="tRNA-Asn"
FT   tRNA            203174..203262
FT                   /locus_tag="FMG_tRNA05"
FT                   /product="tRNA-Leu"
FT   tRNA            203267..203343
FT                   /locus_tag="FMG_tRNA06"
FT                   /product="tRNA-Met"
FT   tRNA            203370..203446
FT                   /locus_tag="FMG_tRNA07"
FT                   /product="tRNA-Met"
FT   tRNA            203548..203622
FT                   /locus_tag="FMG_tRNA08"
FT                   /product="tRNA-Glu"
FT   tRNA            203630..203705
FT                   /locus_tag="FMG_tRNA09"
FT                   /product="tRNA-Val"
FT   tRNA            203747..203823
FT                   /locus_tag="FMG_tRNA10"
FT                   /product="tRNA-Asp"
FT   tRNA            203829..203904
FT                   /locus_tag="FMG_tRNA11"
FT                   /product="tRNA-Thr"
FT   tRNA            203928..204012
FT                   /locus_tag="FMG_tRNA12"
FT                   /product="tRNA-Tyr"
FT   tRNA            204024..204098
FT                   /locus_tag="FMG_tRNA13"
FT                   /product="tRNA-Gly"
FT   tRNA            204138..204214
FT                   /locus_tag="FMG_tRNA14"
FT                   /product="tRNA-Arg"
FT   CDS_pept        205042..219801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07604"
FT                   /db_xref="GOA:B0S003"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR011266"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:B0S003"
FT                   /protein_id="BAG07604.1"
FT                   /translation="MRKIFDRLTSLVMVMLMVIQSCVPAITSFAKEEELDKRYVIQKFE
FT                   TLKQDTYANFSLNLATILDDKNLDTDTNVKFTLNATSNDSNIKLLVRKDFSLYDERTFD
FT                   KVEDAYKEFDRIDKSLKDQGLSLDVSVVQDGEKYRIKNNYVPQAGKEDYGSDYKVYSLK
FT                   VIDKFDFDKQGLYNKLPENDKLSAEHNLQIAEQRRLQQDGEVPEPDKHNVTYIFNFKVD
FT                   KSVDPALTTIALNKDANNPLEVKQNADLFAAILNDRTYSVYQTEQLPAEVTSSIEHKKE
FT                   VAKKKAEADAKAKAEADAKAKAEADAKAKKEADEKAKKEAEEKAKKDAKAKEEADAKAK
FT                   QEADKLKAEEAKKTEEQKALDEKAKQEADAKAKAEAEAKAKAEAGKIKAEAEAKQKAEA
FT                   EAKAKQEQLAKEQAEAEAKKAAEEKAKKDLENKKLLGLVKDVEEKQEEEPIIKKKEIKE
FT                   EVKSEPATPQERKQKAEEFDKALKERKEEIKKSEDKKDANNKEDNKKTTDKKEVSKETK
FT                   GLLEGIKEFFGFSNLQKADRELKAILSVKANGLKEVQALLSSFEDKYHLTQQEQAKLMD
FT                   DNKDAIKALIERDADKNFRPQMFFTQLTDKEKANLEGKKYNILTRFDTSTAVGPIKKGQ
FT                   SFNIHLDEKLKVNDPNSLQPIKHNGQVIATPQYDSQKNIITYTIDHDITENIQVPLDIP
FT                   VDFNTDKIKLDNDGTFTVTNKVSGLGVKAPKDLVPQKVDRNGNPAGSIIEPGRKDVTQI
FT                   IGADDSNYKIDMSAVANPVIKDGELKGYNWTVRVTSDTNLEELGFKANFTTVKGSGLGK
FT                   ISSNDNKVKLTPQLQKAFGIHDSEHHAPTGREITYNLYTPIQGMQEKYMMDLSVILTKK
FT                   SNKVGAKRIVIDEGWPHDKVKEATPIRSGINNRTTILGEFTSENSAKWTVTDGVSSGDT
FT                   DVKLPLEDRSLSTNQNGSLKQTAVYKIDPTSGQMVEDKTGATGAKPVGTIAVYEYESTF
FT                   DKSDTTPLELSGVAISKYENINVEQNWNLGQGLTMPKMKLKAVDGSGNKIGEEITVDKS
FT                   TDPNQAKRLITIPNVKVWNIQEGERKFTKNDVKIKQDFPTNDKDLNGKTISYYENNNWY
FT                   DYNKKDYFIHNRATVEKVPQYANFTLIKKGDDGKALEGATFKLLGQGEAEITTDKEGKI
FT                   HFNNIAPDSYRLIETKAPKGYKLNQETTFVNVDENGGISISGSSAKLKVGANPTVTIAH
FT                   NGYPGYMNAMHYARVNDDGSVTTYIYLKANSGTTNKDTRLNLRLNGSQDGRFNKTEDVK
FT                   VYDVNPYYRESLKTTMIQQRVDQNTINEIGNTNVLTTPNKKPIRANRYTRDPFTGQSGY
FT                   RITIPEERFVNDWGFLVVANSPAGTSVTYDWLTDGNKDFTQNNARLQDQTVIPTTAEQA
FT                   SQDTEITISNEKFQTRPVEIKKLDKKENPIVGANFELKDDKGKLISTATSQAADEKGEN
FT                   AGLASFGDQPEGKYTIEETSAPEGYIKSDVIFDVTVDESNQVTYKPRFKSGNGTPVNGE
FT                   DYLIEDEEQTQQSSDANVTKVSQTLKINESDEGDIGVRPQVWEAYRLESLIYNATIDLE
FT                   NTAPGQRFSIQFDRNLDFTQYFGEFPKVKVAGVEVADPYFDYTTNKLTYVYNEKSAGGK
FT                   GQAKIELKGIIPSKYFAQNDGTYPFSVIVAPGKTGIEGQRIDIKVPADYGQYDYDGNNK
FT                   EVPQSYYFRDVYKGDDGNWYVAALAYYNPDHIRTSPERELRFNWLSTNYQGAHKNFFTW
FT                   SGNGNKPAFSLKDVKVYRTSPNMFTINAGNFDKKVNKNMPLSFGVRPEQDPAKYNLIYS
FT                   KSIDPRYAVNNDRQGGVTLNYDPSQIQDFGLITQNSPLRIGMPAISNASKNGYIIEQTF
FT                   KIDDMHKFNNLWRVFLMQNNGFKSSFITRANYNKAIGDQAGGEIPKFFSQKVALFNKKY
FT                   TPGKFNIKKLNEADLSKTLPGASFKLEDENKNAIYRSSGQKGMVTFDNLKPGIYTLTEE
FT                   KAPDKYVKSDKTWRVNVGTDGQVTIIEIGLGSTGETLVGDNIELSVTNKPVATKLTVYK
FT                   KDNENMPLQGAKFKITTTDGKDVATGISDKNGVVTFDKDLEKGTYILEEESAPAGYNKL
FT                   DKKWVVEVGADNKAKVYNYIEGPKEGTNPEVNKSILGEKGTKWVDVAKRPLDGWILGDN
FT                   RQTGYYNNWPVPYRLGTRIVGKNTKDLNNKYVIQRYVINPEADSLTLNQASIHREKPNF
FT                   ENMDWYAGNETYKIFELDKAVDGEVEDIRLENYKLTDITNQVTVSKQTISGGPRLSMNF
FT                   NNRKITTPIVMDIKIPYKEEYGGVGTGMDLQTSKGLFWKSDYYDRASHIVEGDPVVTTG
FT                   EAGNIKGAYVSEGSVNVNNDRLVQKFSFKKVDETGNDAVTGATFSLKGPKKSDQDPGKE
FT                   VWKRSGKDGMVNFDDLIPGIYHLTETGAAQGYEKSNTDWTVTVTKDGKIYIRDNNPGST
FT                   VPDTSAKWQKVNTSATNPNRHLQASSSTGSPVKIATKITEVNKKGNKFRQVYIINGQPE
FT                   NLINPYFELHAQEETRGLTLDNTTIVSMNLVDRSSTPENLVNVGEKIDYTTKVYVKNNG
FT                   QNRIQINPKNLAGQEKTIALTIETEIPNSGTIGTGLDFINSGYNNHYWLAEWYDSFKDM
FT                   KLEPATTTGTDKNATVYVGTNRATNNPTAPFRIDSNSAPLRTAVTIRQRVATRSVMSDA
FT                   VVLGLYGLNKSIESDKLELGDNLVGTAVRADGWETVDPNRSRNVTTRSDGPNNQTKITK
FT                   INKTQGKYRQIFLVNKSGEALTDAKFDFHAEPKNTNVYGKKPRFGDINFKVVSIRPVLQ
FT                   SSTIDNIQYDGTGTIGTNSIADYKDGQWTRYTFKLNSTNKPFVIEVEYDYPKSGEIGLG
FT                   MDYYSNARWERTKIWAAQKYGSVNDINYKTQETTYSITKNTPANGSLTISKDKGIKENE
FT                   QVTITATPNDGYVLESLIVDKNTVSVDGNNNYFLTMPGHDVNVTATFKQKAAKKYKVDV
FT                   QGSTNGTFTVDKSEAAAGEVVTINPQPAQDYKVKEIYVGSSVGQITVTDNKFKMPSTNV
FT                   LVRVEFEPNNQQTDYKITSFNSEQGSVTAKATAKAGETVQLTVSPANGYQVGSINITDE
FT                   NGVGIQGLTVNQLDKTFKMPSQNVKIIATFKEIPKATYYVSRDGDTRGYITINGINTNR
FT                   LGAKAGDTVNFQITAGSNYKLTGARVTKAPYGGAVDNFKFDPATGLGSFTMPDSDVTVY
FT                   GDYTNKPYGERTASEDRTEVLKKETKVTVDESLAPGERKVDKPGSDGEVKTRYTATYNI
FT                   KKAGLKEAADPAGWPSEVISALKAKRASNEIITAYSKVKLSRTEPVAEEVRVGKSDDPI
FT                   DKFVPTEQDKLIKDGQTQELVKITNKKDGINPKIIKRNPGGDPLKDAEFTIEKMKDKDY
FT                   KEVDSSFGKITATSDEKGNVTFKDQAGNEVKLKKGYYLLKETKAPEGYKKFSSDWKIEV
FT                   KDDGGRMFAVYQGPEDTPSSLINNNEKSNAGYSADNANIKFKSRLTYIDPEKNTYVQRI
FT                   YIDTRPYYGNDTEENKGQLNVQITPKYKREEIDTPGALPQTIKDGVKTAYYSSYKLSNP
FT                   SDFNNMNDSAIDKILRTYDLSNKNLSMEKTARWRPFDWGFDEDQLNLGKGVYIVDVEGY
FT                   YDDVIITGKSDKKDKYDIREKDLGKIDLHVDFYKGARHFKQLKLDENGNATYEAFDRAS
FT                   YQGGASQVTEYVKRKEGTDAAKAWAGKKDDGAKYANFVGREVTYNGKTYKTGIIDPPLT
FT                   NEPTIHADTSVNLNPLYNSKVSEEIPKDGMVIENEEESYNITFSKHGRDNSKDDINSEK
FT                   VTKNRLEGAVFKLQVRGPGGQYEDVPGTTVASAFNGYFGFRGLKPGRYRLMEVRAPQGY
FT                   RPISDPILHFTIAYKKGDIKEETGEVTPGRGVITLEYNESNGIVQYAPEKNDADGNPIT
FT                   PDDGKLVDYVTAATAKNMGKIINEIPGKGKVTLEKYDDENHLLPGAEFKLTRISKEIKG
FT                   DDDSKKNDGVYTKTVGEDGKIVFDDLPIGQYELEETKPAPGYQNKGKKWRFTVGGVGLD
FT                   PYADQGNVGLRDISKSVEMTSEMSVVRPDGNDGTEKEGNSKIHPHKGHALSFKNTFKVK
FT                   EDTAIKPGDYFTIKLTDNIDLEGIMKEKSQNLDLFADGVGTIAKAKYDKEAGTLTYIFT
FT                   GYADQYNKTDFENTITAHINLMKVPNSSTQSVGMGVGTPTTNNIDVEYELNMAKRSEGG
FT                   NTPNMTSKIVSFDRETGEFVQYYYINRDKTLTKSAEFEYTPSEAVTNLKFDYYALRQNS
FT                   GNIYDYNKGQYVDPIVKDMPESFGVDENSYNLNWYYTDGYYNLGAGQTQKISLGTLGKD
FT                   NSLILKVTGKVKAENIASYDTYAKMYGYYTEKWTDYYGYSHSQTYMGPFVERTNGVRIF
FT                   ENKTEASAKLEIKAINPKNEIIFKKIDQKGKILPGAKFKLEKYYDNQKKWIEETGSEKT
FT                   SDKDGLVKYDTLKPGKYALIETEAPEGYAKIEGHIEEFTVGADGVITREVPKVKPVETP
FT                   RPVGVIANVSAAFKAVASAITGNDNTETVTEHVSKEPIDVVNYKEIEFEKVDGDNHKTK
FT                   LEGAVFEVHYKEKDTDKDYSPLKVKKTVEGKEQEVTMTATSEKDGKFKLPITKDGYYAL
FT                   KEIKAPAEYAKMPGYIKEFKLENGKVKILEKDPLKASNKTSTKGKITSEIISVDKDNKT
FT                   FKQRIVINPNHETMTVPSYESYIRIKENDWKITPKYKSSSGSGIGGEVNVAILKKDDKK
FT                   TLDKLTKDDYKKVDAISFTTAGNITGSRYGLKEMLGVTSTTDTPIETTDSIVMEFTGKL
FT                   DENNTTGTADQLFELVFNSGIDDSVSDKLDVKTIAEGKPAYADHDSKDPIQVENRKATY
FT                   PLTGAMGIIGFLVVGGIMMATAYYKYRRKRRESALS"
FT   CDS_pept        220115..222505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0187"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07605"
FT                   /db_xref="GOA:B0S004"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032332"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR032364"
FT                   /db_xref="UniProtKB/TrEMBL:B0S004"
FT                   /protein_id="BAG07605.1"
FT                   /translation="MKKRFLSLIIALAMMVGVFTPLIASAADETTKTVTLHKILMDKTT
FT                   FGKFTEGTTGKDGTEYDGNKITNVKDFFAGKEAKEGSAKEIAGVFFAWQVKGKEFVYKT
FT                   NSEGILVDKNNQVIEANIKDYDKLTTDELKAKAVVDHEQYIKGKLVDGVMTPDLDSNDA
FT                   IQFTNDLKEAFGAKTGDEGVKFNTDKLKGTFLIQEIHEKSTYVDKDGKTLTDTKAVPVE
FT                   ITLPLVNEKGTVQDAHVYPKNTEEKPETHKDFTKEFTTEQPNGRTEDAKENAAAEPHNV
FT                   GDVIDYTVTTKVPAKTKWKTAFWDDKMTEGLTFVTRKEAKNAIKETDKLYKKGLTVKYD
FT                   GKEMDTKWYELDETENGFTLKLTDKGLEEIAKATEVKEIRLDYHAVLNEKAVVAIPESN
FT                   DVTFHYGNNDNHGNTPVPNKPNDDGEMNVTKTWADGVPAAGEWAEFTLYNAQTGKKVGT
FT                   VKFTTDANGTTTTYTPNDDYKATGSEKPQGPSKKTDGTANDKTTWKFTWTGLDKDIQYK
FT                   VVEKNNMNETATYGKGANGEITITNNKWNNPEPINPNEPKVVTYGAKFVKTDTEGKRLQ
FT                   GAEFVVKNSENKFLTGTAVNRSDYKKAQDAFITAINAYNEKIKNGAISDKNKVTIDSKE
FT                   YSSDADAKAAIKALETRRDMLWSATLKDMNGFTATEKNANGVLKLTSNELGQFEIAGLA
FT                   PGKYTLVETKAPADFVDAEKATLEFEFEIKADGTISSTKMNPIDFGIKDDDTKNDNAKQ
FT                   VINKKVTIPQTGGIGTIIFTAIGLAIMASAVIAIKKRQATEAR"
FT   CDS_pept        222629..224020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0188"
FT                   /product="putative cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07606"
FT                   /db_xref="GOA:B0S005"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:B0S005"
FT                   /protein_id="BAG07606.1"
FT                   /translation="MKILRKILMVMIMVAMVATSSSFAAGDYSITVTVDKKYGDVTGKM
FT                   SLWKVSDKQIRDSEKSTVLGDLNKLSVENLNSKYENKADVEFSNNEAVFRNLDKGAYYV
FT                   RDTSGIKRNKEIASVLVNLPDDVENDSKNVTIHAKESSTNVRLVKVDESGNPLKGAKFK
FT                   LLVRRGSEYVELKNKATMKKDDKLELSPEVDDRSKVKSEENADESKDENSKSEKDEEKS
FT                   KEEKKEEKSSELSKKEEKSDEGLYISNESGEIIINDIKRGDYIFREVEAPAGYLIKNID
FT                   TRFTIADKSVELRVVNSKTTEKDKGRHDFMKTDEAKKPLGGAMFKVMTKNKDGKFEPVK
FT                   KDGKDYIVTSADNGKFSVEDMDYGKYYLVEIKAPEGFILLSEPVEFEIKKQADDKTISI
FT                   AFITNKSDTITRRRTTPGGDITRRRIPKTGDIRFFMSMIGGLIMFFIGKWIIAKDDKLI
FT                   GKNIR"
FT   CDS_pept        224195..225061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0189"
FT                   /product="sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07607"
FT                   /db_xref="GOA:B0S006"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:B0S006"
FT                   /protein_id="BAG07607.1"
FT                   /translation="MWKKIKHNFVFILIFLLGFGVMMYPVISRLYYRVDSANQVKEFDK
FT                   AVKGLSKEELAKRLALAKGYNDSLNNLVSKDPYDKKNQEEGRKAYARMLEVKEKIGHVE
FT                   IPKINQDLPMYAGTSEDVLQIGIGHLEGTSLPIGGNNTHAVLTAHSGLPTAKLFTDLKM
FT                   MKIGDKFYVHNIFGTLAYQVDQIKIVEPSNFNDLLIVKGHDYCTLLTCTPIMINSHRLL
FT                   VRGHRVPYVPAVDEALIADNKASYIYRYLFYVSLVIIAILLYLIYRQRKARKKLKELDV
FT                   EDKHEEV"
FT   CDS_pept        225048..225887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0190"
FT                   /product="sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07608"
FT                   /db_xref="GOA:B0S007"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:B0S007"
FT                   /protein_id="BAG07608.1"
FT                   /translation="MKKSKLKENLKYVLIFLVGFAVAMYPLISRLYYRIEANSEVHDFD
FT                   TNAKKMDKKEIDRRIRLAQIYNKTLDPSKLADPYSEKEKKNAISEYARMLEVKEKIGHV
FT                   EIPKINQDLPIYAGTSEEVLQKGVGHLEGTSLPVGGKSTHTVLTAHRGLPTAKLFTDLN
FT                   KMKKGDVFFIHNIKEVLAYKVIDIFVVEPSDFDKVLVVEGKDYCTLLTCTPYMINSHRL
FT                   LVRAERTEYNPAAVEKDLVSQVTGKYKIYLIISLIIIAILLWYYIRQRRRKKNNEIK"
FT   CDS_pept        225874..226728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0191"
FT                   /product="sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07609"
FT                   /db_xref="GOA:B0S008"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:B0S008"
FT                   /protein_id="BAG07609.1"
FT                   /translation="MRSSRKIGYVILFVGIGILTFCLSNLSYKIFSQDKKMDDFLRTQG
FT                   EMSTELSERIEKYNSNVNVDETGIVDPFNSEDIELEGSKVIDENGIFGYLEIPKINFKK
FT                   PIYLGASYNHLAKGVGQLDGTSIPVGGKGRRSVLAGHRGWYGDIMLLKVGQLYSNDVVY
FT                   VHHHGKTLTYKVVGRQYISPSDWDMLKPVEGKDMLTILSCDPMYPPFTRRILINCVRVD
FT                   ENSGKAGVDASSDKKNTTQLNTKGDSSSKTVDYVLLAFTILAWIVLIVNIRKFVLDIKR
FT                   HKD"
FT   CDS_pept        226831..227334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0192"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07610"
FT                   /db_xref="GOA:B0S009"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0S009"
FT                   /protein_id="BAG07610.1"
FT                   /translation="MRYRLYNANDYDRCCDLLRDSNMKYSFSEKSDVKLFTDIVKSESF
FT                   CEDCTFVLEDGDAICGIVMFTKCRVRKFDGLLLSIFYIDDEHMSDDNVDLLVGNAVDDV
FT                   MSRGVKFVCVMGEPDVFTRFGFTRARDYGILCPFYVEDDYFMARCEDGFKTRGELSYAK
FT                   EFFE"
FT   CDS_pept        227334..228068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07611"
FT                   /db_xref="GOA:B0S010"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B0S010"
FT                   /protein_id="BAG07611.1"
FT                   /translation="MKISLCAVEQRLNDKVFNMKQIEKYARQEAENGADMCVFGESFLQ
FT                   GFECLSFVYKDDVGVPVTQNSNEIAEIRSIARENEVAISFGYIENDHGAFYSSQMTVTK
FT                   RGEIINNYRRMSPGWKEPSACSDYREGSKLYLYKMDGVSFSTLICGDFWDENLYTYISM
FT                   IDSDILLWPVFVDFSVIDWYKNEFEDYKKQSQLVPMPVLFVNSFVDEDDRAKGGAYVFY
FT                   QGKVVEELEPGEEGVLRYEYRK"
FT   CDS_pept        229294..229869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0194"
FT                   /product="putative cell filamentation protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07612"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B0S011"
FT                   /protein_id="BAG07612.1"
FT                   /translation="MGRFIDEELLSKRRAIELWDKGLINNFEVGTYKGLQEIHAFLFQD
FT                   IFDFAGKTRDVNLSKGNFRFANLLYLESNLAIIERMPEGSFDEIIEKYVEMNVAHPFRE
FT                   GNGRATRIWLDLILKKNLNVCVDWAMVDRADYLSAMERSPVNSLEIKHLLKDALTDKVD
FT                   DRGVYLRGIQQSYVYEDLDRYDIEDIEE"
FT   CDS_pept        complement(230897..231475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07613"
FT                   /db_xref="UniProtKB/TrEMBL:B0S012"
FT                   /protein_id="BAG07613.1"
FT                   /translation="MKNIKKFALLLALIASVSLSSCSSEQSLNKPDTTTSTAEENKKDK
FT                   AAQTQEKENTDKKEDKKDDADKKDDKKDDQELTDDEKATLDEFVERLEKYENGTAGASL
FT                   KMDRLFTEMVNRCTSLETKPEKSQEYLMKKVAEVKDKENFKQSVKGLKDTIDYYKSNKQ
FT                   QYIQELKDSGATWDPQIKLESLENVLNKF"
FT   CDS_pept        complement(231558..232484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0196"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07614"
FT                   /db_xref="GOA:B0S013"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:B0S013"
FT                   /protein_id="BAG07614.1"
FT                   /translation="MYTLLLISAILLIIAATDNFISMFTATSIILFVVSAISLIFAPHS
FT                   NVILNIIIAINVITDIFVITIISYRLYQKAKVKANIALHLSASLLYIAMIIVNLFKIFD
FT                   LYKYIIGMNLYLSLMVLSHLLGNLIIKYQKFDTDFDYIVVLGGSMKGIELSELIKQRML
FT                   TSFAYYTTNKSIMIFSGGKSNGDIEESVAMKNFAIENHIQDTDILLEKLAMNTMQNIEY
FT                   VKKLIQQQDTDFVDKKICVITNNFHAFRTKLICNKMKVNWTVIPTQSNFNSKISTYLIE
FT                   LLAAIYLDIYLHIIMLILITIIIGLVA"
FT   CDS_pept        232561..233346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07615"
FT                   /db_xref="GOA:B0S014"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B0S014"
FT                   /protein_id="BAG07615.1"
FT                   /translation="MRGLVLEGGGAKGCYQIGAYKALVEMGITFDYVVGTSIGAINAAM
FT                   ICQGDWEIAYKLWENISYEDVISLKDNDINSIFEESLSLDNAKDKLGLAKDFIDNKGFS
FT                   VDPLNDLLSKYIDEKRVRESKMKFGLNTVDVENRKVLNLFIEDIPVGHLCDYLRASSNL
FT                   LVFKQEKLDGKKLIDGGYMENNPYKMIDDICDEIVIVSLKPYMLTNKLKKNPKYTIIKT
FT                   WDRDFPRVLEFEKEKMRYGLKLGYEDTLKVYADLKKENL"
FT   CDS_pept        233453..233947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07616"
FT                   /db_xref="UniProtKB/TrEMBL:B0S015"
FT                   /protein_id="BAG07616.1"
FT                   /translation="MSIKINNEVVEMMLYFWQSASEGQKVAESFIIDVANRDEMKLIYN
FT                   DKFDEEAVRRVLSSITNKELLNGGSPEEKRFWNNNMWMMEDMGVVDQMVQPIKHLNLDD
FT                   VETDKKELIFVPGHVDEYYDLGDKLVVNFFKVSVDIFGGTGAVTMDGEDFREHIIKLLQ
FT                   K"
FT   CDS_pept        234008..235756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0199"
FT                   /product="putative multidrug ABC transporter ATP-binding
FT                   protein"
FT                   /note="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07617"
FT                   /db_xref="GOA:B0S016"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0S016"
FT                   /protein_id="BAG07617.1"
FT                   /translation="MLKRYKWFIDYYKKSYIIAIIALIFDYAFKLILPYMIGNVADNIF
FT                   NKNVTAENLKINLGICLVASVLCYVVSVVWNLNVFRGDDTIRYLVTTKLYNKYLKQSPE
FT                   FFEKNSTGSLMGKATNDPYALGDFAGYGLMSLFDSTFYPILIVIIMIVTTDFRLTLLSV
FT                   LPLPILVVVSNKIGNKLNTTFEESQKSFDKMNDQTLETVSGVRVVRANNLKDFQRKKFQ
FT                   DRANDLYEKNMATAKLIAWYGPIQKPIEVMTYVLAISYGTYLIRTGSITVGRLMSFMFY
FT                   LNLLIWPMIGMGDFISVKKQADASMDRIQEVWDYKEDIVNKPDAVDLKESPTIDFRNLS
FT                   FKYPSSKENVLEKISFTIEPGKTLGVLGKTGSGKTTLLKQFLRFYDVEDGEILLNDKNL
FT                   TDYTVESVRERMGYVPQNHMIFSKTIGENIKLTNKDATDEELMEAIRMSDFEKDLEKLV
FT                   NGKDTLCGEKGISLSGGQKQRIALSRALIKNPDILIMDDCMSAVDGTTEKNILDNFRKI
FT                   RSGKTNIIATHRISQVKDADEIIVLENGKIVERGNHDSLMKQDGWYKEQYLRQTVESAY
FT                   EKECDE"
FT   CDS_pept        235734..237470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0200"
FT                   /product="putative multidrug ABC transporter ATP-binding
FT                   protein"
FT                   /note="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07618"
FT                   /db_xref="GOA:B0S017"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0S017"
FT                   /protein_id="BAG07618.1"
FT                   /translation="MRKSVTNRIIKYSLNEKKNLAIGMVFTVLMTIFEIIGPIILAYII
FT                   NNLLTGEKLVYNIRKLALVLCLYAAVFFVDSLWKYNSTVYLEKTANKIARRMQMDVYDH
FT                   IQKMPISFYDNLPAGKVVSRITNDTKTVKSFYQMVLAQLMVSIMVSIFMIAMVLITDTK
FT                   IGIIVCLFFPIMFYIFRKFLQKSRFAFTNMRKYISEENAKINETIGNIEIIKAFNLEDD
FT                   FSKDYETSAKNVYDYGYMVTKAYGTMSYNVSELLRNFANITILGLYAYNVLTGNTDVKL
FT                   GSMYLTMEYTTRTFSYISNCVQRMGSLEQSFSAAEHVFELLDTEVEEFPEREIGDIKGD
FT                   VKFENVDFSYIENEPVLKDLSLDIKSGESVAFVGFTGSGKTTIINLLLGFYKPQKGTIT
FT                   IDGKNFNDYSVDSIRENISLVPQDPVLFMGDVKSNIRLDKDFTDEEVEKALRDIGADRL
FT                   IDFRNGLDEEVKDNGESFSAGEKQLIAFARSYITNPKILILDEATANIDTQTEAVIQYA
FT                   IDKLKQNRTTFIIAHRLSTIKNVDCIYVLDKGVVVEKGTHEELLANGKIYTRMYREQNK
FT                   KG"
FT   CDS_pept        237472..238935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0201"
FT                   /product="4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07619"
FT                   /db_xref="GOA:B0S018"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B0S018"
FT                   /protein_id="BAG07619.1"
FT                   /translation="MNDNRKAGILCPVFSLSSKYGIGSFGESAYKFVRFLKKSNQTYWQ
FT                   ILPLVPISSDGNSPYLSPSTFAGNYMYIDIDKLVDDGLLSESDVHGYKFEDDFVDYDYV
FT                   AKSKNEILRKAFERNKDLKIIDTQNFSERELVRGFCLFQALKKHFNGKSWLDFPDDIKY
FT                   RKKKSVDYYENLLKDEIEYNVFVQCVFYKQYFELKNYANDLGIKIFGDLPIYVSKESSD
FT                   MWQNPDMFVVNEDLSPKLVAGVPPDRFSETGQYWGNPVYDWNYCEKTGFDWWLKRLNHN
FT                   LKMYDVIRLDHFRGFEAFWAIDASKSTAENGHWVKAKGDEFFEILKKKNLIDRVVAEDL
FT                   GLITDDVINLRDRFGFNGMKVMQFAFDVNEESDYLPHNVGENCVYYTGTHDNQTLRGFV
FT                   NSRSSDELEYIKNYVNSADVEMSLIKVAYMTNSCLCICQMQDFLGLDDDYRTNTPNTLG
FT                   NWTWRMKKDWLTDELAEKISEITKLYNRD"
FT   CDS_pept        238995..239798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0202"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07620"
FT                   /db_xref="GOA:B0S019"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0S019"
FT                   /protein_id="BAG07620.1"
FT                   /translation="MKKVLTIAGSDCSGGAGIQADIKTMSAHGVYAMSVIVSVVAENTF
FT                   EVVSIEDLPDKIIKDQIDCIYNDMGTDAVKIGMLSNKRIMSCVRDKLLENKPENVVLDP
FT                   VMYAKHGACLMQEDAIDLLIEDLIALCTCITPNIPEAERISGMKIDGVDDMKKAAVIIR
FT                   NMGAKYVLVKGGHHVGDAIDILYDGENFHEFVNEKIDTKNTHGTGCTLSSAIASNLALG
FT                   KSIYDAVKSSKEYITNAIKHDLHIGKGNGPTNHFYKFFEGELKNE"
FT   CDS_pept        239791..240429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0203"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07621"
FT                   /db_xref="GOA:B0S022"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B0S022"
FT                   /protein_id="BAG07621.1"
FT                   /translation="MNKQFNLGLNLVTNKQTLKGRDLTETIEIALKNGADSVRLREKNM
FT                   DTRSIMQEAFKIKEITQRMGKLLIVNDRVDIAKACDVDGVHLGQKDMPIKYAREMLGDD
FT                   KIIGISCHTLEQALEAQEAGADYIGVGAIFPTFTGDDFLMVTIDTLKEISEKIHVPITA
FT                   IGGINKNNIRMIFDSNVDSVSLTSAVFSTGDVAASTQELKQKFDMILKK"
FT   CDS_pept        241168..241608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0204"
FT                   /product="transcriptional regulator MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07622"
FT                   /db_xref="GOA:B0S023"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0S023"
FT                   /protein_id="BAG07622.1"
FT                   /translation="MNTKKSMAVYIYMSRVINTLRRENNKLILKHNLTLGQFAVMEALY
FT                   SKGRLSTGEVMEKILSTSGNIPVIVKNLEKDGFITRKQDEADKRRYILDLTDKGKDLMD
FT                   EIVPENLKFMDELISLWDDEDKKELIILMNKFRRKYEEENFE"
FT   CDS_pept        241586..242431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0205"
FT                   /product="putative pirin"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07623"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0S028"
FT                   /protein_id="BAG07623.1"
FT                   /translation="MKRKILNRTQGFRTKDGAGVSLVRVLSRNTTKEYDPILMLDSFDS
FT                   VDPDDYIKGFPMHPHRGIETITYLREGTMTHKDSMGNEDTITDNEVQWMTAGSGIMHEE
FT                   MPKPSKRMLGVQLWLNLLSKDKMVRPHYQSLRGDDLKIVEEDFAKIKVISGEYKGTKGY
FT                   APKYLPLDFYEIEIKKNEEFTIDTKDDQQVILFTLIGDIEVEGDVVSEKTAVTTTDGDK
FT                   LTIKAKDEDVIVLFLQSIPTNEPIAWEGPIVMNTNEDLRQASLDLRNGTFIKEKPEEDQ
FT                   "
FT   CDS_pept        242445..243017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0206"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07624"
FT                   /db_xref="GOA:B0S029"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:B0S029"
FT                   /protein_id="BAG07624.1"
FT                   /translation="MTNIEKSLQNRRTIYSLDKNIKSNEAEITKTIKNITELTPDAYGI
FT                   RSQRVVVVFKDDHDKLWDKIGEVFNGKVAEEKINMFKSGYGTVLYFSDEETLKKASEDT
FT                   GADVEKFEHWAAQSIGMLELNIWTALEELGLGANIQHYNPVIDDAVKEMFDIPKSWKLD
FT                   AQMVFGNKTADPDPKEKENINNRVIVK"
FT   CDS_pept        244145..245455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0207"
FT                   /product="Na+driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07625"
FT                   /db_xref="GOA:B0S030"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0S030"
FT                   /protein_id="BAG07625.1"
FT                   /translation="MGNDKSIREFGKYVFLNIFAQIAFSCYTLMDTYFVSWKLKADGLS
FT                   ALNIAFPMFCIINGMGLMIGIGGGIKYSIFKSKDMDDDANTIFTNAVVLGVSIACLFVI
FT                   SGMFFSDKLVRFLGADDSIFEMTNTYLRVMTLFAPAFFMNNILQCFVRNDRNPRLSMAA
FT                   MVIGSISNVILDYVFIFPMNMGIFGAIFATGLAPIISMMVIAPYIIARNNGFHLNKNIF
FT                   DFHSIREIVSKGMFALLTEATSASVMFTFNMIILGISGNVGVASFSIITVISLVVTAIY
FT                   TGLSQGIQPLISHYYGKNDVENVGKILKYAVVVQIMLSILIYGEIYFNADILAAFYNKA
FT                   NDVLLQDYAVSGMKIYFVACFFIGFNIVVSTYFTSTERSIKSQVISFARGFVIIIPTAL
FT                   ILSKIFAMTGVWAAYPVSEFIVCMMAIVLFFREKSVI"
FT   CDS_pept        245477..245977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07626"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B0S031"
FT                   /protein_id="BAG07626.1"
FT                   /translation="MKGNYETIVHPLSPLYDENSKILILGSFPSVKTREYGFFYGHPQN
FT                   RFWKLMEKLFDVDLNVSIDERKKFLLEHNIAVYDSIYQCDIIGSSDSSIKNVVPSNLKE
FT                   IVDCANIKHVFCNGTASYKCFEKYHKKNLRVDCTKLPSTSPANARYRLDDLVDEWKVIL
FT                   EYL"
FT   CDS_pept        246198..247451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07627"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S032"
FT                   /protein_id="BAG07627.1"
FT                   /translation="MKNYTELLKSELIMALGCTEPISIALAAAKAREVLGDIPTKIEVK
FT                   CSGNIIKNVKGVTVPNTNGMKGVEAATAIGTVAGDSSLGLEVLSKVTDEDIKAAKCMLD
FT                   NNIIKVSLKEGVENLDIEIVAEDDKENTVDVEIKNKHTNIVKVTKNDKVIHIDNCYTHT
FT                   PEYENYDELSVKDIFEYANNVDLDEVRDLLEDQITLNSKISDEGLTGKWGVAMGKILMD
FT                   EDDSIRSKAKARAAAGSDARMSGCSLPVVINAGSGNQGITCTMPLVVFANEKNYDRETL
FT                   YRGLLITNLVALHIKRFIGRLSAFCGVTSAGVAAGAGICYMETKNLDLIEKTIGNALMI
FT                   ASGMICDGAKPSCAAKIATAVDAGISGYYLAKNNRNFEAGDGLLKDDIEETIRSIGYVA
FT                   KEGMKETDIVVLHTMIEK"
FT   CDS_pept        247461..248186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0210"
FT                   /product="putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07628"
FT                   /db_xref="GOA:B0S033"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0S033"
FT                   /protein_id="BAG07628.1"
FT                   /translation="MKKPVIGISGSIIIDGSGNFPGYRRSYVNEDYVKSVIKNGGIPYI
FT                   IPMNSSEEVVREQIQNVDGLILSGGHDVTPRFYNQEPHKNLGGILPERDVFDFNLVKFA
FT                   IEKNIPILGICRGFQILNVYFGGTLYQDINLKEKTFIKHNQVNFPYLTTHSVDIIENTK
FT                   LKELFNEESIMVNSFHHQIIDKVAEEFVTSAISKDGVVEAIENPNYKYMLGVQWHPEML
FT                   HSTEEKMNLLFSELINSTY"
FT   CDS_pept        248198..249568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0211"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07629"
FT                   /db_xref="GOA:B0S034"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B0S034"
FT                   /protein_id="BAG07629.1"
FT                   /translation="MNNATKKLGFWSIVLLTINSIIGSGIFLSPGSVVKMSGKYAPFIY
FT                   LAAAAFAAVLAITFASSAKYVSKGGASYAYTKAAFGDNWGLYIGITRFFSAAIAWGVMA
FT                   TGVVKTMLNIFGADSTNFNYITAGFIILMTILFIINVCGTRILELVSNISTIGKLLALV
FT                   TAIVAGLILVITTGQNNFSQIETVTADVANNMDLGTIVMAVIAAFYAFTGFESVASGSE
FT                   DMEQPEKNLPKAIPLGIVIIAVIYFGIVLVSMMIDPVAMVNTKEVVALVAIFKNHIVRS
FT                   IILYGSLISMFGINVAASFHTPRIIESMANENQVPKIFAKRTDKGFPLFSMVITAVLAI
FT                   ILPIAFKYHMGSIMIISAIARFAQFIVVPLALIWFYYGKNKQEVVSGVKKNFFTDVIIP
FT                   VVALLLTIVLLAKFSWVKQFTVDNNGVLAPNYLAIVSMFIGYVLVPLFVYFYNNKHK"
FT   CDS_pept        250011..251222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07630"
FT                   /db_xref="GOA:B0S035"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:B0S035"
FT                   /protein_id="BAG07630.1"
FT                   /translation="MGSFISAESTWILWAVLASCAALAIYLEQKYTWASKVTGCILALT
FT                   FTLILSNLKIIPTEAPVYDAVWSYVVPLAVPMLLFNADIKKIGRDSGRVLIIYLLSGIG
FT                   TILGGFVAYFALKNAIPALNDIVPMFVGTYTGGSVNFVAMSQQYKVPGATVSAALVADN
FT                   LLMALYFFSLMALPTMAVIKKHYKMPLVNALEQQSESDMEANKTMAAKYWGAKEISLKD
FT                   IAFTVALSFVIVAVSDKLATLFGDLFKGEGAVSAILGGLLGNKYLLMTTITMIIASAFP
FT                   KQISSIRGSQEIGTFLIYLFFAVIGAPASIGLILRESPLLLVFALIVVLINLVVSLIFG
FT                   KLFKFNIEEIIIASNANVGGPTTAAAMAVSKGWTELIVPALLVGTLGYVIGNYYGILSG
FT                   ILLH"
FT   CDS_pept        251307..252722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0213"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07631"
FT                   /db_xref="GOA:B0S036"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="UniProtKB/TrEMBL:B0S036"
FT                   /protein_id="BAG07631.1"
FT                   /translation="MLENLKPERVFHYFEELTKIPRESGNEQAVSDFLYKTGKELGLET
FT                   IQDESNNVIIRKPAHPDYVDHPAVVIQGHMDMVAEKADGVDHDFLTDPIPLVVDGDWVK
FT                   TEGTTLGADDGIASAIGLAIMEDKNGKHPALELLVTTNEETTMVGARALKRENIKGRKL
FT                   LNIDAEVEGILLSGCSGGHNIIGTKKLNYVDNKMKNTFVMNINNMLGGHSGMEIHQQRG
FT                   NSIKFAREALKLIEEKSPVEIVSIEGGTKHNAIPRDAKVVFSSNEDDYDIDFSDLIAKY
FT                   PLDKDMRVKIEKCENADKVLDEKNKEDILSFIEEVPHGVYSMMQEYPDIVECSNNLAIF
FT                   EIKDDVLKVTISLRSSNPETFDAHTEDVSKVYEKYGFEVKKEDYYKPWAFAKDSELRNL
FT                   ALETYKDLFGKEMKVEVVHAALEPAVFIDTFPDMEMISIGPTMKDVHSPKERLSIESTQ
FT                   RTYEFVKSLLERL"
FT   CDS_pept        complement(253437..254600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0214"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07632"
FT                   /db_xref="GOA:B0S020"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0S020"
FT                   /protein_id="BAG07632.1"
FT                   /translation="MKNLSNRATSFTESVIRKMTLVANKYNSINLAQGFPEFDPPIEIL
FT                   NRLQEISLIGPHQYSITCGAKNLREAIAKKHEKLTGNTTNPDENVVVTCGGTEAMMASM
FT                   MAITNPGDKVIIFSPFYENYKADAILSGADPIFVKLNPPNFDFDIDELENAFKQNPKAI
FT                   ILCNPSNPSGKVFTREELQIIADFAEKYDTYVVTDEVYEHIVYKPYVHTYFASLPKMKD
FT                   RTITTTSLSKTYSITGWRLGYTIANKEITQAIKSVHDFLTVGAAAPLQEAAIVGLNFGD
FT                   EYYEKLQEKYTHKRDIFLGGLKEIGLDFYSPQGTYFVMVDISKFNRKSDYDFCVELSQK
FT                   IGVTPVPGSSFFKDDNNDYVRFHFAKNDDTLIEAINRLRKINDLLVD"
FT   CDS_pept        complement(254602..255957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0215"
FT                   /product="coenzyme F390 synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07633"
FT                   /db_xref="GOA:B0S021"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0S021"
FT                   /protein_id="BAG07633.1"
FT                   /translation="MIRNNIKEITKEKLESLRTSKYWEEELETLSREEIEKLQLHELKN
FT                   ILVHAYENSEYYRKSFDENLLDPYEFSSLEELANYPFINKKTERDTQHKGSFLGQMACT
FT                   SEDDVVFISASSGSTGVPTISPFTQQDLDEFQNVESRFFYQIGMRKSDRYVHALNFSLF
FT                   VGGPDVIGAQNVGALCIWAGTIPSEKLLNIIVNYKPTIIWTTPSYAWYLGETAKKHGYD
FT                   PKELSLKKIIVAGEPGGSINATREKIEELWDADLYDFYGLSDIFGACAAMCEQKDGLHI
FT                   AEDQILVEVIDPETGKVLPEGEVGELVFTSLRKQARPMIRFRTGDIGYVNKDRCKCGRT
FT                   STRIYIIGRLDDMFIVSGVNVFPSDVEHAIRQVEGITGEYRIRIFDKNLSTAYSVEVEK
FT                   NDNITDVEALRENIWKELKVRLGVKPHEIIIHEDGYLPRQTHKANRVIDERQ"
FT   CDS_pept        complement(255950..256843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0216"
FT                   /product="pyruvate/ferredoxin oxidoreductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07634"
FT                   /db_xref="GOA:B0S024"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B0S024"
FT                   /protein_id="BAG07634.1"
FT                   /translation="MSNINKRTITQDEYFYGHKACSGCGAALAVRIALKVLGERAISVL
FT                   PAGCMSAVGFNFPQLAFKNNSIISTFAGTGSMLSGIYEGAKSLGIEDLQIVGFAGDGAT
FT                   ADIGFQTLSAAIDRGDDVIYICYDNEAYMNTGIQKSSLTPFGSSTTTTPAGKNIHGNTR
FT                   NKKNIFDIIAAHDISYAATASIGYIQDYIDKVEKASKIRGTKYIHVLSPCPVGWGTNTD
FT                   DTIDLAKEIVDNCMFPLEEYENGKYSIKEIKNRKSVHDYIRKQRRYKHLTDEEIDLIEE
FT                   NTIKNYENKLKRSYHD"
FT   CDS_pept        complement(256836..257981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0217"
FT                   /product="pyruvate/ferredoxin oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07635"
FT                   /db_xref="GOA:B0S025"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B0S025"
FT                   /protein_id="BAG07635.1"
FT                   /translation="MRRFLSGNEAVAQGVRLSKPNVISAYPITPQTTVVEKLSEIVEQK
FT                   QLDARFVHVESEHSALSCAIGASAIGARTFTATSSQGLLYMAECLPYAAGGKFPIVMVN
FT                   ANRSTALPWNIFGDQRDSLSQLDSGWIQVYVEDAQEALDTVIEAYYIAEHKKVSTPVMI
FT                   NLDGFDLTHTYEPVDVPENCDVDKFLPKFETENKFDVNHPRNLGFSVGPSDNLEWKIRE
FT                   NKAVVDSLEIIEESREKFKQIFNRDHGGVIDSYKVEDADYVLISIGSISGLIRSVVDEL
FT                   REQGEKVGYLKLRYIRPFPTEKLRNELQNVKRIGVLEKDISFGHFGTVYTNVKSVTDID
FT                   SQNFVGGLGGRNITRDNIKEIFEKLKQKGEELNFIGAKCNE"
FT   CDS_pept        complement(258252..258788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0218"
FT                   /product="pyruvate/ferredoxin oxidoreductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07636"
FT                   /db_xref="GOA:B0S026"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B0S026"
FT                   /protein_id="BAG07636.1"
FT                   /translation="MIEITFRGRGGQGAFTASKIIGNACVKQANLYSLAFPTFGPERRG
FT                   APVSAFTKIDTKKIEDRTQVQNPDYLVILDESLFNVNELKNLTDCTVFINSSKKFEEKN
FT                   VISVDATKIALDILHKPITNTAMIAALFSKFDVIDKQSIVESFKDNLSPSVVDKNVELF
FT                   EEVLKEVNENEKARA"
FT   CDS_pept        complement(259151..259462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07637"
FT                   /db_xref="UniProtKB/TrEMBL:B0S027"
FT                   /protein_id="BAG07637.1"
FT                   /translation="MDTLHKNTFQFDYFSDNFIAFEKDFYKYANINIPLAFLTDDILEN
FT                   MISTKNNYFRVNAKNCKDNLDHYFMFRKNFVKENKSIILFQYVGHKSQMELENLEDNR"
FT   CDS_pept        complement(259465..259833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07638"
FT                   /db_xref="UniProtKB/TrEMBL:B0S075"
FT                   /protein_id="BAG07638.1"
FT                   /translation="MVVTVAEWTVLMIIRNYLPYKSAREYCDRKMAKWMGFFLSEHTTA
FT                   LHSMTENVSIQSLGSSSLLLLISQAYLNDFTVEIFVHNNKSYVGTIYDFFEDKIYFEID
FT                   NQMIEIKFNEILNINLME"
FT   CDS_pept        complement(259790..261208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0221"
FT                   /product="DNA-damage repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07639"
FT                   /db_xref="GOA:B0S076"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B0S076"
FT                   /protein_id="BAG07639.1"
FT                   /translation="MGLIDYSLEPKSDIAFVDIKSFYASVECVKRNLNPLTTSLCVMSN
FT                   SDNASGLILASSPTFKKVFGKKNVGRAFDLPFHVHDRKFNFQSALRQNLPITDSYVNYI
FT                   ETWAKNTVIVPPRMALYIEENLKIQKIFMNYAAKDEILPYSIDEGFIDLTTSLNYFVPD
FT                   TKISRKDKLDLISSRIQNEIRNKTGLYSTVGMSNSNPLLAKLALDNEAKKTVNMRANWS
FT                   YEDVEEKVWNIPDLTDFWGIGERTKRRLNKLCIFSVRDLANSNPDILKREFGIMGVQLW
FT                   FHANGVDESKVTQPYKGKSKGLGNSQVLPKDYSKKSEIEIVLKEIAEQVAIRIRRIKKK
FT                   ATVVSIYVGYSLKENKKSIHAQKTISPSQSTAQLTKHVMELFHQKYQGGSVRRLGVSYE
FT                   NLVDEACISFSLFEDIEKIEKQKNLESAIDEIRDKYGFTSIQKATSLMEGSRVIERSKL
FT                   IGGHCGGMDGTYDY"
FT   CDS_pept        complement(261219..261761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0222"
FT                   /product="putative phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07640"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B0S077"
FT                   /protein_id="BAG07640.1"
FT                   /translation="MYNRWIYDKVNNLVEKYHTRNPDELLDLLGIKLHYIDSPSKLLGV
FT                   YQVILRNRVILIANNIGSLKKIVLAHEIGHDQLHRQYCIDGHAFHENKVFNPTDVFENE
FT                   ANIFAAHLLISDEDLIKTMREYTDDKTMAYKLGVDINLLNLKISEMVKLNKFPTDICYI
FT                   ENPKSTFLEDYSPLDDE"
FT   CDS_pept        complement(261766..262170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0223"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07641"
FT                   /db_xref="GOA:B0S078"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0S078"
FT                   /protein_id="BAG07641.1"
FT                   /translation="MSFGSKLKQLREDRGLTQTELADKLGVTLKTISNYETKGTRPRTQ
FT                   DMYKKIAEFFNVDINFLLTVEDNFVLDSAKKFGYSGKKDAENLVDNLSGLFAGGSLPEE
FT                   DKDKLFNAIAEAYYEAKLENKKYGKNKNKR"
FT   CDS_pept        262839..263510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0224"
FT                   /product="putative zinc-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07642"
FT                   /db_xref="GOA:B0S0A7"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A7"
FT                   /protein_id="BAG07642.1"
FT                   /translation="MNKLKLMAIVGVMSAALLLNGCGAQKDAPKENTKQAEQKQEDKKE
FT                   DNNATEKTEDKKEEVSLSDWAGEWNNMGSYLEKPEVQGAFKTLAKKENIDEKKAKADYL
FT                   EKRKCEFNGLKIEGNKITFTSKIPSENGDKIAETEYKFVEKKAVKHGSHMLEWDVFEAV
FT                   DSNAKYKVLLMMPIHGEEELTHFHMRYGNDKDELFAKEGWFPTFVKPNTTDKQIIGEIE
FT                   E"
FT   CDS_pept        263578..264894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0225"
FT                   /product="zinc ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07643"
FT                   /db_xref="GOA:B0S0A8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A8"
FT                   /protein_id="BAG07643.1"
FT                   /translation="MKKRLLSFLLVLCMILFAGCSNHMKKSSGKPVIYTSFFPVHELVK
FT                   MIAGDTVEVRTFMPVDKEPHLWEPSAKDMKKLAEADLLVVNGANMEHWVDKVHENLPNL
FT                   DILKLSDSVELITYKGAASRGDFQYMARLDLTKGKRKIDFGHTHEDIMRVAFFKDNGED
FT                   KKELVKKAKEIMNQKGEIVHQKNTFDVEEGKVYGLEMGHESGEIFYNIKDDGKWIFVSD
FT                   RISEDLLPYYLQDTNGKLLQDEGKLKPVMEGSSSGFDKITYDPHSWLSVVNAKKYLNSI
FT                   QDKLIQKYPDNKKIYHKNKLKYVDKLTDIDAEYKEKFSKLDNKSFLVTHYAYAYIARDF
FT                   GLTQYPLEGLTSMESPSLKTIKKAVDFAKTKNITTVFYEYGKPPKEAKTLAEELGGDIK
FT                   PLASMEFITKEQQDNNQGYIELIEMNLKNLYESMKKAGV"
FT   CDS_pept        264895..265566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0226"
FT                   /product="zinc ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07644"
FT                   /db_xref="GOA:B0S0A9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A9"
FT                   /protein_id="BAG07644.1"
FT                   /translation="MNAVTINNLNFGYNEDLVLKDLNLEISQGEMALILGGNGSGKSTL
FT                   LKLMLGELKADDGEIKVLDKNIKDYKSYRDIGYVPQINIVNKIAFPITCLELVTLNLYE
FT                   DFGLIKIARKKHYDKARKIMEEMGMKEYINRPVNELSGGLQQRAMICRAMINEPKLLIL
FT                   DEPTAGVDKENKEKFIKTIAKLNKDYNITVIMVTHEIKEIEALDIERTQYEMIEGRLVK
FT                   C"
FT   CDS_pept        265560..266399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0227"
FT                   /product="zinc ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07645"
FT                   /db_xref="GOA:B0S0B0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B0"
FT                   /protein_id="BAG07645.1"
FT                   /translation="MLEFAFMRKALIAGLMLAIMIPMIGIIMVNRKTSMIGDALSHTAL
FT                   SGVGLGLILGFDPLLGSAIVCVVAAFLIELIRKKFPQYGDMATAVIMSTGLGIAAILSD
FT                   FAPGGNSFESYLFGSISSVTNMDVINISVIFVLILAVSISQYAGLLAISIDKNIARLAG
FT                   VKVNRINAIFTLLSAITIALAVKIVGALMVTSLIVLPVATALIIAKSYKKTYIITIILG
FT                   VLYMMLGIVQSYQFDIKPGGAIVVNAVIGMIVFVAYSKIKQPNRRNFSNSENNAKIK"
FT   CDS_pept        266428..266637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07646"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B1"
FT                   /protein_id="BAG07646.1"
FT                   /translation="MNFEIEKGNKITIPDILMRKYDLREKDVFELELENDRIILIPKKN
FT                   HDANYVEKLKGLTDDTIDALHEDK"
FT   CDS_pept        266838..272519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0229"
FT                   /product="putative surface protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07647"
FT                   /db_xref="GOA:B0S0B2"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR012706"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B2"
FT                   /protein_id="BAG07647.1"
FT                   /translation="MNNKIFGKVIAEKRAKCSSKKPRYALRKLSIGVVSCLIGYAFLIG
FT                   GNVSFAETNTNSSAQFVEFVEKVGKEENSTKETTKETPEKTPENSEDISDEKIDTKKVE
FT                   SVNKKELMATENVKEMEENPVHKEQFTVVFDANGGKFDTENNTLTVKAGENATFSETPT
FT                   LAGKVFVGWANSIDATEAQEDILQNITANKTVYAVWKNDDKDTLKKHDKPIVTATKPED
FT                   VSDYLSLNFNASSFMENDGTLHYGKILDKDNNEVENNNEIEGIKTRTYWVLKSATWKDV
FT                   KDFTDKDGKSVYQNLTANSGDEKHPFLGWSDNSSLDNIVDLKSKFEDKSVIGESTKDRL
FT                   NFYAKYKTNDYVYYGKTDNSKPAYDSDGYKLNLKKDYKKVTFKIKDEKIGKVYLKEKQK
FT                   KLIGKDVATKDDGSIKLEDATIGDKEITVFVERKKAKSTIYKGIKVETDSIDKDHQYWY
FT                   WYRGEVDPSTREDDGDYIIPPSLNGIKDPDEVCFVPLFVTNGQDVTDLCVNAAPPKMPT
FT                   KGSRDKFVRFGLVTLRKEEKINDILREDGKSYFGRTYVVFREYNADFIFEKHPPKNPGS
FT                   VLPTLKEEFKDSYANPNWYDNTKDQKRYYYDDVDLSKVVIYKNKFFTARATKIPVIHKI
FT                   DEIDESAKYIEGTAEGKGKVWIHIDGEYITETRSDSRGRWKFEVKNKIKIKAGNEVRIE
FT                   FAPDSRTLPASAKFIVKKAKYNVKFTPVYEGTVVNPGDIAVISAPKFINDLNKSENLDQ
FT                   PIVKKFELVDLATEEIVIDEKTGEITYNSKESDADKTIDLNIKVTYMDDTTENVSTTIK
FT                   INSLPEIINRKENPSAQTPEGYVRVTMKAGEGVQLKQETIYDIKKGLSLAADYYPEVEI
FT                   NPENKNNYKNPINWTVNPGEKIENSVEIIANATKTQASVNEPTGKEIKILEGETIEAKD
FT                   LVANSDDLPTDTTFEFKEKPETKTAGKFDATIIVKYSDGSFDEVKSTIIVQKQAAIITP
FT                   IPTVEAVDEIVEFGKTYDLTDNIKDLPNGAKVTDITEKDAINTRKSGNYIGKVKVTFEN
FT                   GATRIVNVKVVVNKSLAETNEPVGKEIKILEGESIEAKDLVENSEAMPADTTFEFKEKP
FT                   DTKTAGKKDTTIIVKYSDGSIDEVQSKIIVQKQAAVITQIPTVEAADEIVEFGKTYDLA
FT                   DNIKNLPNGAKVEDITEKDAINTNKSGNYIGKVKVTFENGATRVVTVKVVVNKSLAETN
FT                   NPVGKEIKILEEENVEASELIANKQDLPTDTTFEFKEKPDTKTAGKFDATIIVKYSDGS
FT                   IDEVQSKIIIQKQTAVITPIPTVEAIDEIVDYGKTYDLTDNIKNLPSGAKVTDITEKDA
FT                   INTNKSGNYIGKIKVTFENGATRVMTVKVVVNKSLAETNEPTGKEIKILEGETIEAKKL
FT                   VANSDDLPENTTFEFKEKPDTKTAVKFDTTIIVKYSDGSIDELQSKIIVQKQAAIITPI
FT                   PTVETTDEIVDYGKTYDLTDNITNLPNGAKVTDITEKDAINTRKSGNYIGKVKVTFENG
FT                   EERIVNVKVVVNKSLAEKFVPDVKTIEVEVGELSAEKLKSAISNLPQDSKLEIKSKEEG
FT                   EAVVTIKFADGSEKEVKISYKIKENKAEVNPETNDNDGNNEEDNKPEKEEKPEKEEDKK
FT                   TEKEEDNKPEKEEDNKPEKEKKQGKDLVEDSEDNENIKKPEEKIETKPEVNHQISRTSE
FT                   KSSTKPGKTTENIVKPNAEGIQIHFEKTNVKIGDKVLLKPIFTDKSGKVINVPMDVEFS
FT                   LEENSPSGVKINPKTGELSFDTTGYKAGDRIELVVVTKFRGKTTQTFALFADNSVIKLP
FT                   EKITSTTTPDFVIKTKVVINIVESENRKSKNIWENKSEFTKSNSKSQLPKAGTQAEIAN
FT                   LTLAIVSCATGAYFTRKKK"
FT   CDS_pept        272922..273800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0230"
FT                   /product="putative cobalamin synthesis related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07648"
FT                   /db_xref="GOA:B0S0B3"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B3"
FT                   /protein_id="BAG07648.1"
FT                   /translation="MGDNMKTIIVSGFLGSGKTTFINHILGFNKNTLVLENEFGDVSID
FT                   SMLIKNDDIIEINSGCICCGLKSDFKEIIHKIDKDQFEYIIIEPTGIAKLTDILEVLKD
FT                   EENLQIQKCVTIVDSDSYICFHEDFGEFFNDQIKNADIIYITNIENLEEEKIEEVKKSI
FT                   EQFNKTAIIHTEDFRNMNPDDIVAEFENKKEHKCCCHGHGHKCCGKHHHDHHDHPHEDS
FT                   KFKTNVQKNLKFASKEDLEKFLDSKSIVRAKGNVEIADKKVFVSKTLSGLEISDAISDS
FT                   EDFVIIEVNNE"
FT   CDS_pept        273793..274575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0231"
FT                   /product="putative methylcobalamin-coenzyme M
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07649"
FT                   /db_xref="GOA:B0S0B4"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B4"
FT                   /protein_id="BAG07649.1"
FT                   /translation="MSKVGTYDCIIMETTPITNPKLFEDADCLVEHFKDKDYASIPMSS
FT                   TLESEAMGAVAELGKVSKYKYDNVDDIVIDFDYNQKHVKALFEAIDKMKDEKRVIVEVS
FT                   GPLIILDNLASSEVVFRSFRKKHDRIVELYDEIRKVLVEYIEKLVDSGIKLISFSDSLA
FT                   GADIIGPKQMQMYVDEFLMKFLADIQNIDKSFNFHLCPKSTMALISLNKAEFRPIEKDE
FT                   EQRYVDFLFEGEHKTFGDRCMNLSNKKFKKINEIIIRS"
FT   CDS_pept        274577..275230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0232"
FT                   /product="putative dimethylamine corrinoid protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07650"
FT                   /db_xref="GOA:B0S0B5"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B5"
FT                   /protein_id="BAG07650.1"
FT                   /translation="MDTQQEYLDKMAEMVVEMEDEDIADVCQEYIDKGFDPKKGIFDGL
FT                   IRGMTEANKLYDEEEYFITDVLLCSDAMYAGLNVLEKYVEISDEDILGVAVIGVVEGDT
FT                   HDIGKNLVKLMMETAGFKMIDLGRDVKLQNFIDAAVENNADLICMSTLMTTTMENMGKV
FT                   IEMLKEQGLRDRFKVMIGGGPISQGFADKIGADSYTENAVEAVKAAKKLIGKDN"
FT   CDS_pept        275368..276945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07651"
FT                   /db_xref="GOA:B0S0B6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B6"
FT                   /protein_id="BAG07651.1"
FT                   /translation="MKITINNLNKTIELEDDKNYNLMNALLENDIYIDNSCNGKLTCGK
FT                   CKIKIVEGNVNEITDTEKRLLKKEEIENGIRLSCAVTMCGDVIVETLSENSSIDVLDSG
FT                   EMPEFEKNFRDGYGICVDIGTTTVCMNLVDLKTGEIIAKNSALNAQTKYGLDVLTRITF
FT                   EFENENAAKILQHSIVNSMNKLIDRMIVESKIDRKDIKEVDIAANTTMVHMLLGVDARS
FT                   LGKFPYKPVFTEAKSLMCKDIGLNLDAKLYTLPNVSAYIGADIVAGAYVTDMRNRENTL
FT                   FIDIGTNGEIVLKTNDKLYCCSCAAGPALEGMNIKCGMRAEQGAIEDVVIDGSNVILQT
FT                   IGDKPAKGICGSGILAVISEIVRNKIVNKRGRIIDPNSVDDFRKDLVRIVDDKREFMLT
FT                   DELVITQSDIRQVQLAKGAILSGFIKLLDEEGLDISDLNECIVAGQFGSHLKPSSIVGV
FT                   GILPYEIESKISYVGNSSLIGAYMCLMNDKIKEEMSALAEDMNYIELSMTKDYDKIFAK
FT                   AMEFPKER"
FT   CDS_pept        276942..277394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07652"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B7"
FT                   /protein_id="BAG07652.1"
FT                   /translation="MSMKKKLLVLMMLVFALTACNADKDKAQEPQKIEQTQEQAKTDEN
FT                   KSEEKASDSQATKVSIVLMDEVNNKEILKEDAEIKKDENLQSYLEKNHKAVFEKGMMTE
FT                   LEGVKQDPAKKQYWMYYVNGKMAEVGIGDYKVNENDKIEFKFQEMK"
FT   CDS_pept        277394..277903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07653"
FT                   /db_xref="GOA:B0S0B8"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B8"
FT                   /protein_id="BAG07653.1"
FT                   /translation="MKTSDLTRIAILSAVCILTRLYLNIIPNVKILSDVILILAIEKNL
FT                   KESLFVNAVTMVTTSFVLGFGIWVLFQVVDFFILAVFNYAIFNVFKLKKTLITKTIAVS
FT                   VSGFLYGLIITLMECMTVMGMNVFIARYMTSIPFDINHMIGNAVIYIFLIYKLEDYITG
FT                   KKKIMN"
FT   CDS_pept        277976..278707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07654"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0B9"
FT                   /protein_id="BAG07654.1"
FT                   /translation="MKLRRKLLAGFLCLAIVGLAGCSQKADDKKEANNTATTEQSKTEE
FT                   NKKEEKKADDEVNGVSLKNPIKVDKEAKKVTVLSSVNGKYFTENTRHASVNTDGSNGAK
FT                   SVLTAYGTPEDFYNALIEIGAKPGENMNPDNATKTHVEGSKIGATVTWEGAGKDYDINE
FT                   VIKDSNGKKIEFRFGGNLERAKTKKTGCLTCLDSCPVGIISNTTYTYGAVEKRNEVKFT
FT                   GNADVLPEDGTYVAVTYTLED"
FT   CDS_pept        278720..279904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07655"
FT                   /db_xref="GOA:B0S0C0"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C0"
FT                   /protein_id="BAG07655.1"
FT                   /translation="MKKLRAIFYYLTTGVAIGFLTCLLLLFNVNYEMMVSQQLVMFIFT
FT                   AFGLILGIAYTNINRYVFFALEAAIALIALIGGKTQSLIYIVKEFVMYHGPVKNIFIPT
FT                   IVVVVVINLINIYIVLTQKKYQKFYTREERKAMKEEEVKLSDLREEKTAEEIAEIKHTR
FT                   KIQRIIALIILGVLLGLYFFVPSIKAKTNEAFSTISKLDTDVVVAYLRSYGKQAAVVSF
FT                   VLMILQSIAAPIPAFLITLSNAAIFGWVKGAMLSWSSAMAGAALCFFLARALGRDAVEK
FT                   LTSKGAMESVDVFFERYGKYAILICRLLPFVSFDFVSYGAGLTNMGFWPFFIATGIGQL
FT                   PATIVYSYVGGTLTGGAQKLFLGLLTLFALSIMIGIAKKVYNDKQKKKGGKVVE"
FT   CDS_pept        280088..281383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0238"
FT                   /product="branched-chain amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07656"
FT                   /db_xref="GOA:B0S0C1"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C1"
FT                   /protein_id="BAG07656.1"
FT                   /translation="MNKKFKDIIIVGFALFAIFFGAGNLIFPPYLGVLAGTEYKKAMLG
FT                   FLLTDPVLPILGVIITAKLGGAAEDLGKRVGNNFSKILGTVTILTIGPLFAVPRTAATT
FT                   HEVFVSKVFPGTPLWVTSLIFFILTAIFVFNETGVIDKIGKYLTPGLVIILLVIIVKCI
FT                   VDPIGVMNVATENQIFLKGFAEGYQTMDALGAALMTGIVVSDLKRKGYLNEQERVKLVK
FT                   WVGLVAFLLLAIIYGGLIYVGATASKIYTVQYTRVDILLGTVQHILGSAGKFAIGIAVS
FT                   LACLTTSVGLSAVAGDFLSGITKNKLGYKPIVLATVFVSGLISLAGVEGLIKAAVPILS
FT                   TVYPIIMVLIFLGIFDKYIKYDMTFKGAVLATFVVSLVEVLNSKFKILEGFTDVIKTLP
FT                   LSSVGFEWLLPAIVTGAIFGLIAYIQDKRKIA"
FT   CDS_pept        281414..282460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0239"
FT                   /product="antibiotic ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07657"
FT                   /db_xref="GOA:B0S0C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C2"
FT                   /protein_id="BAG07657.1"
FT                   /translation="MDSNFTNNFAIYLQIFYALMIEKLYNINRNIIWEDFMENLIEVRG
FT                   LVKKYKELTAVDNLDLDVKKGEILGLLGPNGSGKSTTINCILSLLKKDSGSVKIFGKEM
FT                   SSDAYDIKKRIGVVFQDVAVYDELTVYENIDYFCGLYIQDKSERKELVKRALDLVSLND
FT                   FVKFKPKKLSGGLLRRLNIACGIAHKPEIIILDEPTVAVDPQSRNNILEGIKKLNEDGS
FT                   TIIYTSHYMDEVDFLCDNIVIIDKGKVIAKGTSEQLKDMIEMNEKISFTAKELNEDVIS
FT                   QIKSLPHLMNFENKDGNVKLNFSHGDGYLMKLIKLLDENNINYSSLNVEKPSLNDVFLE
FT                   LTGKDLRD"
FT   CDS_pept        282462..283559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0240"
FT                   /product="antibiotic ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07658"
FT                   /db_xref="GOA:B0S0C3"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C3"
FT                   /protein_id="BAG07658.1"
FT                   /translation="MFLHSFKNTFKLLLRQRAMLFWALLFPIILGIFFKLAFGNINENS
FT                   KFKTIDVAVNETLMQDDNFKNFMNEMENEKYFKVVESKNQDILNTNDNVKAYIESWDKI
FT                   YTKNSGISETIVETIMNSYSQKVSMITKIMQKNPTADIGKILNVDDHIKDISRKNMNPV
FT                   NVFFYTLLGMTTIYGYMWGLFVSFQYEANLSTNAKRNAVSPTKKSTMLSASVLVSWIIN
FT                   FAITVLFIAYLKYALGVEFGDRIGAIIGLASISSFCGVAFGILIGVSNKKSLDTKIGIG
FT                   IALTMLMSFLAGMMVPEMKVLIAEKLPIINKINPVAVVTDAVYSLYYYDSMARFNKDIV
FT                   NLVIITAVFIVASLFFMRGKEYESL"
FT   CDS_pept        283546..284658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0241"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07659"
FT                   /db_xref="GOA:B0S0C4"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C4"
FT                   /protein_id="BAG07659.1"
FT                   /translation="MRVFKNYFKITWAHKTPILLYTIIFFVLMSFATKNTNQTAYKSVD
FT                   VNIYVQDKSNTKLSKSLYDYLNKNAKIRKMDENIVDDKLFYEIINAAVIIPEDFDKTRE
FT                   VLYKVAPNNAYAMDIKEKINIYLSQVSSYEKSGFTEDEAIKNANEDLDKKIDVSIKEGS
FT                   VNPKKDKSKYYFNFLNYLLLAQVILVVSNIALVYKKQPILMRNNVSPCPRTRINMELML
FT                   GHIVTGLVFWLIYMILFCVMYKYDFTKTHVNLMMLNSFVFTISVVSMAVMISNVIKNSN
FT                   TVQGVMNIVSLGSSFLCGAFVPQELLGKTALTIGRIFPGFYYIRNNEILVENPEISKIL
FT                   PNIFIILGFSVVFIAISVLAKPKGNDNINK"
FT   CDS_pept        complement(284706..285971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0242"
FT                   /product="gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07660"
FT                   /db_xref="GOA:B0S0C5"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C5"
FT                   /protein_id="BAG07660.1"
FT                   /translation="MNNVTFSTIGALIGLALSIFLIIKNFHATYALIIGALVGGLIGGG
FT                   GLVGTVSAMVKGSESMMSSVLRIMTSGILAGCLVKTGAAEKIADTIIKKLGEQKALIAI
FT                   AISTMIICAVGVFIDISVITCAPIALAVGKKSNLSKSSILLAMIGGGKAGNVISPNPNT
FT                   IATAEGFKLNLTSLMYVNIIPAICALIVTIIIAMALAKRKTDVIDSSDLESSERTNLPS
FT                   FFASIIGPITVIVLLALRPIAKITIDPLIALPLGGFVCLLATKETKNTKEYVNYGFSKI
FT                   IGVCALLIGTGTIAGIIKNSTLQTDMINLITAFNLPAFILAPVAGILMGGATASTTAGS
FT                   TIASQTFAKSLIDANVTALNAGAMVHAGATVIDSLPHGSFFHATGGSVKMSIADRLKII
FT                   PYEAAVGLTTTIASVLVYLITK"
FT   CDS_pept        complement(285973..287103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0243"
FT                   /product="glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07661"
FT                   /db_xref="GOA:B0S0C6"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C6"
FT                   /protein_id="BAG07661.1"
FT                   /translation="MNILVLIDSFKGSLSSLEAGEIIKKACEQDPSNKVTVRPVADGGE
FT                   GTIDSLKDIKNAKIIEVDVHNPLMEHHTARYLIVDDKLAIMEMSESSGLTLIKDNLDPM
FT                   NATTFGVGDMIKDALDKNIREFIIGIGGSATTDGGMGMLRSLGVRFFDEDGIEISNGPI
FT                   GIIDLEKIDMENFDKRLKECTFQIACDVDNPLCGERGSARVFAPQKGATPEQVEELDKL
FT                   LGKYHQVTKKVISDANDTIEGAGAAGGLGYAFKNYLNAELKPGIEIIMEMLGADELIKN
FT                   SDLIITGEGKMDFQTSMGKTPVGIANAAKKYNKKVIAFCGVCDNDAVSVNDRGIDAFFP
FT                   ILNGCMSTDEAMDKKVSEENLYRSVDQVMKLINLWR"
FT   CDS_pept        287207..288289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07662"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C7"
FT                   /protein_id="BAG07662.1"
FT                   /translation="MRISDHTAKMIVEKLKDVIDYDLNFFDQEGYIIYSTNSKRIGTYH
FT                   EAAKECVVQNKTIFVDNEREYVGAKKGINIPVTIDGEIIAVIGITGNKDEVMKYGNIIK
FT                   KMTEILVKEQLVEKNRLKKKDMNKYLFESLINELDDYGLYRYLETEDEKFVIVGRNSDN
FT                   RFLLKDSDQIYKILENNLSNNFVYSVFYGEIVILANNVDKIIIKKKLEKIRNQIHDVID
FT                   SRVYFGISGSFKIINEFKKNYDNCLVALDWLDNLQRKDCVVDYSTLDMGILLGSIKKDR
FT                   IKKFKEVVLKDISDEDYNIYKDLIKIYATNNQSITKCAEDLFVHKNTVQYRLNKLRDIT
FT                   GLDPRNVEDFIRLYLAFILN"
FT   CDS_pept        complement(288550..289404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0245"
FT                   /product="putative ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07663"
FT                   /db_xref="GOA:B0S0C8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C8"
FT                   /protein_id="BAG07663.1"
FT                   /translation="MKKNKKEKKNLFFKKLLQSIKDDQIPLLSAQTTYHFIMSLVPFLI
FT                   VLLNIVLMVAASKIDLIFKSMEVLPDETRNILMTLVNTIINNRSSSVLSISLLVALWSS
FT                   SKALKSLITAMNKAFDVRSENGFLKTQLKSILFTVVLLLLLMVTLVFIAFGGLILNLIE
FT                   QYMKIRIPYFAQIFRYLIPIVSMIFGFTLLYKFAPDFDSTRSIKWKSAMLGGTIATIGW
FT                   LLITLLYSFYVSNISNMSLTYGPLVGVFALFVWINLSSQIILISAEITANYDQVKKGVI
FT                   YST"
FT   CDS_pept        complement(289408..291303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0246"
FT                   /product="putative dipeptidyl aminopeptidase"
FT                   /note="acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07664"
FT                   /db_xref="GOA:B0S0C9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0C9"
FT                   /protein_id="BAG07664.1"
FT                   /translation="MKYFDYDSFKDFTFISKLKALKNSDNIFCVTTTANIEDNKYDSNL
FT                   RKIGNNKNFTSSNKDSSFFELKDGDLLINRNLDNEKDSDISSFYRLPVNGGEAVKEFDI
FT                   DLKNAEILFELEDSFIVKYEFDRHNEMNKITEEEKNEDVEVLTELPYFENAVGFTDKKR
FT                   TRLARYFPSIDKMDILTDEFSNISSVDISDNKSKLVFSRNSYENVMKIEDELVEYDLKS
FT                   GDESVILQGFMIMSVKYFSGDIVILATDGKEHGLNQDCEIYKVVDNKAIKLNEDHYCLY
FT                   NSIGCDLKYSSGSQIEKTDDYIYFVILEGYGSAILRMDKNYNFDKIFSTNNSINMISVK
FT                   NDEVYYVLITENHGQEVYKLNGEQLTHLNSDDYHISKKDKFTFENDGHSFTGWVIYPKD
FT                   YDENKKYPGVLSVHGGPKTVFGEVLFHEMELLSAKGYFVFYTNPRGSDGYGNEFMDIRG
FT                   KYGEVDYSDLMKFTDIVMGKYPIDKLGYTGGSYGGFMANWMMTHTDRFDCFVSQRSISN
FT                   WISFSLISDIGYYFGTDQNHTLTVLDDYDKLWDKSPLKYAKNAHTPTLFIHSTKDYRCP
FT                   LSEGMQMFQALKLNNTQSRFVMFYGENHELSRSGKPKNRIRRLKEICDWFDIYLR"
FT   CDS_pept        291688..292287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07665"
FT                   /db_xref="GOA:B0S0D0"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0D0"
FT                   /protein_id="BAG07665.1"
FT                   /translation="MKLDEDFSDIKQRILINLKTRNLYFKTFSECEKLLDIDLMQLQKN
FT                   NAIPTEELYKSELRKVNNYIEDFSNVNIVNKLVELVYYFLLITSVGLVTNLIRNFLGLE
FT                   FKQISVSAVILYLTMFAAVIATPIIISRKEKRFHDNTFRYILIAISAIGIVLFSYFSIF
FT                   SGPVKQNLFALNILIYILILVGFFAITILMKKLSAK"
FT   CDS_pept        292393..294141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0248"
FT                   /product="multidrug ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07666"
FT                   /db_xref="GOA:B0S0D1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0D1"
FT                   /protein_id="BAG07666.1"
FT                   /translation="MKRNLNLIKRVMPYFKKYKFILMFDLFCAALTTLTDMVLPMILRR
FT                   LTNAGLGTYTLTREMIFRMAGLLLIMKIIDLFAGFYMTKTGHIMGAKIETDMRYDVFQH
FT                   LQKLSDSYFNETKVGQIMARITSDLFDITEFSHHCPEEYFIGLIKIIVSFAILVRLNTL
FT                   LTVILFLSIPLMIVFASKYNRRMRKGFKEQKRHIGVLNADIEDSLLGVKVVKSFANEDV
FT                   EIEKFQKGNKKFLDIKSETYSSMAGFNTITKAFDGIMYIIVVLFGGLFLVEGKMSSGDI
FT                   VAFILYVQTLLTTVRRIVEFTEQFQRGMTGIERFTEIMDQDIEIFDDEDAVDLENVKGK
FT                   IEIKNVSFKYNNNNENVLNNISFTINPGQKVALVGPSGGGKTTLCNLIPRFYDVEDGEI
FT                   LVEGIDVRKIKLQSLRSNIGMVQQDVYLFSGTVRENILYGKPDATEQEIIDASKAAGAY
FT                   DFIMNLENGFDTYVGERGVMLSGGQKQRISIARVFLKNPPILILDEATSALDNKSEFIV
FT                   QESLENLAKGRSSLTIAHRLTTVQNADLILVLTEDGIIERGTHRQLMEQKGYYYNLYTQ
FT                   GGRLLV"
FT   CDS_pept        complement(294179..294577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07667"
FT                   /db_xref="GOA:B0S079"
FT                   /db_xref="InterPro:IPR021486"
FT                   /db_xref="UniProtKB/TrEMBL:B0S079"
FT                   /protein_id="BAG07667.1"
FT                   /translation="MKNKKNLTFENIFNIILICCMIFIIVLWGKHFPLMKYRGYKKLYK
FT                   YMDIQKIPKKDIKDIKSYKDIKFDGYFYYVYLKDYPNYTLCYEYTRDGKFFLAVEKEIN
FT                   GINNMLDENELKNFKYKPLPDNWEDNKK"
FT   CDS_pept        294770..295930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0250"
FT                   /product="putative ATPases involved in pili biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07668"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S080"
FT                   /protein_id="BAG07668.1"
FT                   /translation="MEINDNILFVNSIIDDAIRKKSSDIHIEPFEENVRIRFRINGSLV
FT                   EYKTVDKSMHSKIITRIKIMSELDIAEKRLPQDGRITYTYENSKIDLRISIINTIHGQK
FT                   CVIRILNPESFKIGMQNLGISENEQKIIEGFTKFENGMVLICGPTGSGKTTTLYTMLEQ
FT                   ENTIDKNIITVENPVEYNIFGINQIQINEKIGLRFDNTLKFVLRQDPSVIMVGEIRDLE
FT                   TSKLAIRASITGHKVYSTIHTDDCYQSIIRLMDMGIEDYMIRASLKVVIAQRLVRKLCP
FT                   HCKKKVTPTSEQMEIFRSNGLNPTEIYEPGNCDECSLGYDGRMAVMQILKIDDDLRSLI
FT                   KKDMNLKSLKNYGEENNIDSLFKKALIQVALGNTSFDEAMRLYNED"
FT   CDS_pept        295920..297011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0251"
FT                   /product="putative pilin biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07669"
FT                   /db_xref="GOA:B0S081"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B0S081"
FT                   /protein_id="BAG07669.1"
FT                   /translation="MKIDSLLKEDSVLKKEINFKASKKKLFLFLRQFSILLNAKIPIIE
FT                   IINLLKEQKEFKQLKPSLDKVSENLNNGLSVSESFCGDKNFDMFFTSMMKLGEESGRLD
FT                   KVVYDLSKYYERTYDINKKIQNAMIYPIILTVTGIVMLIFMLKNVIPTFVDLFESSDMV
FT                   LPLSTRILISVSNTINEKGLLILIILVLIIAGLIIAYRKTKFGYYLDKFKTTNPIFGKQ
FT                   RQIVISSEIARSLSITHKNSMTILDGLIIIQKSMKNKYYKQELSDIFKEIESGEFTLEE
FT                   AFNKRKITPQVFNSMLKVAENTGELGDIFEKLSEFYDGEVEYAIKSFISILEPMLIIFM
FT                   AIIVGFIVISITIPMFDVINSFN"
FT   CDS_pept        complement(297268..298326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0252"
FT                   /product="sugar ABC transportor ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07670"
FT                   /db_xref="GOA:B0S082"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S082"
FT                   /protein_id="BAG07670.1"
FT                   /translation="MENNKIELKNVYKSYDGENYSVKDFNLTMNDGEFIVFVGPSGCGK
FT                   TTTLRMIAGLEDITKGDLIIDGKRMNDVSPQDRDLAMVFQNYALYPHMTIYENIAYPLK
FT                   LRKIDKQEIDKSVKDAAEILGITHLLEKKPSMLSGGEKQRVALGRCIVRQPHAFLMDEP
FT                   LSNLDFKLRLKMRTEISNLQSKLHKTFIYVTHDQAEALTMGDKIVVMKKGEILQVGNGD
FT                   EIYNNPNCKFVADFIGSAPTNFVKVNGDLTVGDNTYKFAHPKPFYMSFRPEKASPYEKD
FT                   GFKFDLTLTAIENLGSEQYLYGSLLENSIVIKDFENKDYKVGESYTFYVDKNDLLFFDF
FT                   ETEKRVENEMTM"
FT   CDS_pept        298482..299714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0253"
FT                   /product="sugar ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07671"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B0S083"
FT                   /protein_id="BAG07671.1"
FT                   /translation="MKKKFLAILLVFVLFLSACGNKAADNSKDAKKDENKKEDVVTIHM
FT                   LVPGYDQGYLKEQFTDAIGRFEKENPNIKVEVISAGWEELNSKVVQLYQAKKAPDIMLL
FT                   GSRSLRQFSENGILEDMSSMMTDEQKADYIENVLNTGKVSGKQFGIPMALSSRGLFYRS
FT                   DLIKEAPKNWEELLNVAKENTKGNMKGFAIPTDLTSGTDEILNFIYQNGGKIVDENGNF
FT                   VINSKENVETLEFFKKLAAYVPDPVSTTRNDQSKMFVNNDLAMYISGGWEKETMDKGKD
FT                   KTPYKVAMLPEGKQKGVTIVTDSYTMSSISEHKKEAFEFIKFMGKLENQKIITAAYGWF
FT                   PILHKEAEDPKYADDFNKPMRDIMEFGTPEPQVPNWDDFNKSFTIAVQKAMTGQLSPQE
FT                   ALDNCQKELAK"
FT   CDS_pept        299716..300582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0254"
FT                   /product="sugar ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07672"
FT                   /db_xref="GOA:B0S084"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0S084"
FT                   /protein_id="BAG07672.1"
FT                   /translation="MKKSKMLPYLLLLPCFLVVIILYGYPMVLTFINSFNKVNLLTGSS
FT                   DFIGLANYKSIFNDPQFYKSLSVTVKYTVITVFLKIFLGFLLAYLLSSNIFAKKQFRFL
FT                   VLIPWAIPQVAVSTLWKWILDGRYGYINYFFMKLGIIKSPILFLSDPNIALYCAAFVDA
FT                   WLGISFVSMMFLAALEQIPTSLYEASEIDGANKTRQFFDITLPGIRQTFVTILILVTIW
FT                   TFNSFNVIYVLTQGGPMRSTETLIIKIYQEAFSRFNIGASSALTMIVVVILSLMTFIYS
FT                   RSMLNEK"
FT   CDS_pept        300572..301396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0255"
FT                   /product="sugar ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07673"
FT                   /db_xref="GOA:B0S085"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0S085"
FT                   /protein_id="BAG07673.1"
FT                   /translation="MRNKKNVKSTIILTIIVILLLFPIVILVNSSLKTYNELITWPPKF
FT                   FDSFHFENYTNVLSGDKSILKEFFNSLQISVITMLICILIGSLAAYSVTRFDFKGKNAF
FT                   MNIILVTQMFSSVIVVNAMYIIFRNFNLLDTKLSLIIATTTSCLPMTVWLLHSYFSQIP
FT                   IDYEEASWMDGANRMRGIKDVLLPLCFPGIITAGLFAFIAAWGDLIYAKSFITSPELRT
FT                   ISLALTDFQDLYKTTWETQMAASVVATLPPFILFFMIQKYLIKSMVSQGVKG"
FT   CDS_pept        301396..303072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07674"
FT                   /db_xref="InterPro:IPR025150"
FT                   /db_xref="UniProtKB/TrEMBL:B0S086"
FT                   /protein_id="BAG07674.1"
FT                   /translation="MIRFIPSTVRQIGISKNNCDEINEKFALKNEETAVQVELELQQKT
FT                   WINLDKVMTLPWEGVVEMYRIEVNSDCDCKLSFEKDVLDDDLCYKKDAILNKRSGYLPK
FT                   GFNNLWLDLKSESSGSHEVNIRILKASSFNDEELVYEKSFKLEVSNVEMPQENIFYLDL
FT                   WQHLSSLARVYDVEYYSDEHFKIIENFMKPLAKAGQKVCDVIVSDYSWAGQTCRMIYDN
FT                   QSSLYEYNILGCFIENGKLKLDFTNFDRYIEICQKVGMCDEIDIFGLIGNWDRKDFSVI
FT                   LKDFCEPIKVRVYDKDSGKFTFIRNKEMYADYIEQIFNHLIEKNLWSITRVMADQPKNT
FT                   TDVCECEDLLREIREDVKIKYAIMDGEFYEDFTGDTENFSIILDQYIMVQNGDLKMATE
FT                   ANFQNMTWYVCWTPYNLNQFVRSPLMESRLVGYMTYLFDMKGFLRWNYCLFPDSDDFRY
FT                   RPDVWACGDMFFVYPGKAGVPEISLRLKQLMYGNYDYSFLRYCESKLGRDYVLDLVKDF
FT                   TGEISDLAYNEPTREISGGYKDDYVLMESIKKKLALKLENK"
FT   CDS_pept        complement(303177..306077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0257"
FT                   /product="zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07675"
FT                   /db_xref="GOA:B0S087"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:B0S087"
FT                   /protein_id="BAG07675.1"
FT                   /translation="MQDYKNFKLIDTRELSDINSTAFLFEHEKTKAKVLKLSNDDENKV
FT                   FSIAFKTIPQDSTGVAHIMEHSVLNGSKKYTTREPFMDLVKSSLQTFLNAITYPDKTCY
FT                   PVASRNAKDFKNLVDVYLDAVFNPIVYEKKNIFYQEGWHYEIKNVDDDIKYNGVVYNEM
FT                   KGSYSSIYTIIFDELFKYLYPDTTYAHSSGGNPYNIPDLTYEKFLEFHDKYYHPSNSFI
FT                   YFYGNGNIEEELDHLSEYLDEYDYKKIDSEIPYQKPFEKAKKVQVEYNISKDENPDGKD
FT                   VLVYAANVGHITNVKDAFVSTILSDVLFSNESAIIKEKLLQENICESVENVSSYGQEIT
FT                   MGVIAENSDVKNTEKFEALVKRELENIVKNGIDKDELTSTLNKLEYDLKEAGSFHTKGV
FT                   IYFLKSALSFMYSDSYYDQLQFSETLAECRKLIDTDYYEKFIEEKLLNNNFKLILSLKA
FT                   TPGLNLKKDNEVKEKLKQYKESLSDEELNELVDLNKNLEQFQSEEDTKEQKDTIPTLEL
FT                   SDIDAKLEDVERIEKKIDNYTFLNPNLFTSNIHYASFMFDLSKFSQKDYFYLSLLSDYI
FT                   GLSDTTNYDYKKLYTQTYLASGGIFTAIHLSNTKNSQDLKTNFVFSFKTIEKTEDECIK
FT                   ILEEYLFNVKFEDKNRFKNILQNLKQEYKTRILEAGNQFALTRSMASFSEKSVLEDECS
FT                   GISYYEKLCDVLNDFDEKADITLKKLKDYYEKIVNSNDMIVSIINEKDSASKFFAKLQK
FT                   SLIAKMNTEEIDIKSSPTKFFKLKEAYKTSSNVNYVVKSADLKKYGFEYNSKITVLTNI
FT                   LNTSFLYNEVRAKGGAYGVGMSVSLNGILYVYSYRDPNIKNTIDIYDQIDKFVENMSFD
FT                   EKEMKQFIIGTVNQFNPPMTTFTKGSRSINMYLSGRTIEDYENYLENMLHTSVDDLKQF
FT                   AQIIKKAMKENHLVVVGNDTKIDEDASLFDKIINVE"
FT   CDS_pept        306249..307010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0258"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07676"
FT                   /db_xref="GOA:B0S088"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B0S088"
FT                   /protein_id="BAG07676.1"
FT                   /translation="MKLISWNVNGYRAVMKKGFMDAFNSLNADIFCLQEIKMKENQMTD
FT                   EMNIEGYHRYSYSANKAGYSGTLVYTKVEPIGVSYGIGIDEHDTEGRVITCEYEDFFLV
FT                   NVYTPNSKQKLERLDYRMVWEDEFHNYLNILRDRKPVIVCGDLNVAHNEIDLKNPQSNR
FT                   RSAGFTDEERNKMSLLLNDGYIDTFRYFYPDKTDEYSYWSYFAKARERNAGWRIDYFLV
FT                   SDDLKDNLVDAKIHQSIMGSDHCPVELEINF"
FT   CDS_pept        307020..307865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0259"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07677"
FT                   /db_xref="GOA:B0S089"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0S089"
FT                   /protein_id="BAG07677.1"
FT                   /translation="MSRNRIWISGADGKIGKVLQKYLDPFEDEVLATDKYIVDIVNSDE
FT                   TSIFARRNRPNIIINCSALTDPVLCQENPDEAFRVNALGARNMAVAANTVDAKIIHMSA
FT                   DDVFSGQSRSAYREYDTPHPTTMYGKSKLMGENFVREFSVKHFILRTSWLFSPVNHRVE
FT                   DIIKEAIQTGKVYVPKAQYSSPTSAYQLAEFIVKLMATYDYGIYHASCEGVASRKEFAE
FT                   EILKIKGIDAEVIEDENLRIEGHRPDFTALENFLLNTSQIYKFTDWQTSLQKYIEKNNL
FT                   "
FT   CDS_pept        307901..309166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0260"
FT                   /product="proton/sodium-glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07678"
FT                   /db_xref="GOA:B0S090"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B0S090"
FT                   /protein_id="BAG07678.1"
FT                   /translation="MKQKKKMGLTTQIFIGLFLGLFVGIVFNLFVPSSYIKDTILVNGV
FT                   FDVLGQGFIRLMQMLVVPLVFFSLVTGAMSMGDTKKLGKIGVKTLVFYLFTTALAITLA
FT                   LLLASFIKPGVGIDLTKVSQAAEANPAQAVSLKDTVLNLIPTNPIRAMSEGNMLQIIFF
FT                   ALLVGIILANLGEKAHNVANICEEFNDIMMDMTMIVMKFAPIGVFALITKTFATLGLSA
FT                   IFSMLKYMLTVVLGLGLQLLLVYMVLLTIFAKVNPFKFLKKFFPVLGFAFSTSSSNATV
FT                   PMNINKLEELGVSRKISSFTIPLGATINMDGTAIMQGVAVVFAANAYGMQLTPQNFLTV
FT                   IAAATLASVGTAGIPSVGLITLSMVFNSIGLPISAIAMIMGIDRILDMIRTAINITGDA
FT                   VCTVIVANSSGEEYFDKEKFNS"
FT   CDS_pept        309253..309936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07679"
FT                   /db_xref="GOA:B0S091"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B0S091"
FT                   /protein_id="BAG07679.1"
FT                   /translation="MKLENKHIKKIVVILIVVLAFVFIKPLREGVTNMSKAFKDLESVK
FT                   AYIRSFGKTAVVISFLMMILQSIAAPIPAFFITFSNAAIWGWVRGSILSWTSAMAGAAL
FT                   CFGIARFLGRDIAEKFATKGALKEVEGFFDKYGKNAILVARLLPFVPFDPISYAAGLTP
FT                   MGFWEFFIATGIGQLPATLIYSYAASKSTNPSTWVKGLIILFGVFALGMLMKRIYNDKQ
FT                   AKKNI"
FT   CDS_pept        complement(310031..311395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0262"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07680"
FT                   /db_xref="GOA:B0S092"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0S092"
FT                   /protein_id="BAG07680.1"
FT                   /translation="MLTRNLKTITELTNTIINEKYHDVMVKGISTDTRTIQKDNMFIAL
FT                   RGDNFDGQNYIEMAFEKGASCCVVNRDYRNINDYPVIEVDNTKEFMMDLARGYISSLDC
FT                   KVIAITGSNGKTTTKDIMSSLLKEKYKVVKTQKNYNNEIGLSKTIFDIDDDTEVAVLEM
FT                   GTENFGEIRQLTNIAHPDIAMITNIGDSHLLNLKTKENIARAKFEILEGLKEDGIFILN
FT                   NDDPILREVKQEYKLPEKTITLGIKPDSDYRMEMIKADETGSTFSINDHVFNIELLGHH
FT                   QMYNATMSIIVAELMGLDYSDIAKGLKNIELTGMRNELILLDKFHILNDSYKSNPQSLT
FT                   SCLETAYGLHGYSRKIAVLGDMLELGDNEITLHKNIGKSINPEKIDYVLATGPLAENII
FT                   KGARTNFAEDKVFYFETKEELLEKLQELIVDNTLVLVKASHAMQFDKLVEQIKEI"
FT   CDS_pept        complement(311398..312450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0263"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07681"
FT                   /db_xref="GOA:B0S093"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S093"
FT                   /protein_id="BAG07681.1"
FT                   /translation="MQKNIYVLYGGPSTEHEVSITSARTLINNLSKEKYNVNAIFVRRN
FT                   KKFIMKENITEEIKSDEELILDTDLSVIESVSECIRKINPENTVIFPAIHGSYGEDGTI
FT                   QGFIKVLDLPFVGCNVLGSALCMDKGYTNDIFELNKIPQAKYVVLCKNDDYNLKEIFEK
FT                   TSKAVYVKPCNAGSSVGVMRAETEEELEKAIQNAFQYDRRILVEEEIIGPELQIAVMGN
FT                   DNPVASRPGVYQIHDVEFFDYDAKYNDSKTEMLTPFPMDEKLELKARHLAEKVYKLMSL
FT                   SGFSRVDMFVKDNELWVNEINTVPGLTPHSMFPVLWKCTNDMSVSEVFDNLIGLAVEEY
FT                   KKNKAYKLER"
FT   CDS_pept        312623..315001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0264"
FT                   /product="glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07682"
FT                   /db_xref="GOA:B0S094"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:B0S094"
FT                   /protein_id="BAG07682.1"
FT                   /translation="MEKEEFLLRFEKILFNMFGKDLHTSTKKEKYIAFSKIIMNELADD
FT                   WKKTSDKHKHIRNAYYFSAEFLIGRSLGNNLLNMGLDEKYSQILKELDIDINDLEIQEE
FT                   DAALGNGGLGRLAACFMESAASLDYPLTGYGVRYRQGLFKQYFHNGFQMEVGDNWTLDK
FT                   DPWSRRVESESKIIRYKNQVVKAVPYDMPVVGYKNHVVNTLRLWQAECDDGFDFQKFNN
FT                   FQYDDSVKEKNRAEDITRVLYPNDIQRPGKVLRLKQQYFFSSASIQDIIEKYEKNFPND
FT                   VNFEDFAKYNTIQLNDTHPVMAIPEMMRVLMDDKKLSWKQAWNVTSNVFNYTNHTILQE
FT                   AMEKWNVDVVEEVSPRIMDIITEIDRRFVSDLVGLYYSVDRIDNLRIVKDNTVNMAHLA
FT                   ILTAVKINGVAKIHTEILKNDTLKPWHDLYPDKFVNKTNGITPRRWLFYANPELTQYIT
FT                   ELLGEDWKTDLTKLKELEKFRDEDNVLDRLMEIKLHNKIRLKKYIKEHEQIDVDENSIF
FT                   DIQVKRLHEYKRQLLNAFHILNLYYKIKNNEITDIPKQTYIFGAKAAPGYFRAKAIIKF
FT                   INEVKNLVNNDDVVNKYIKVVFLENFNVSIGELVYPAADVSEQISTAGKEASGTGNMKF
FT                   MLNGALTVGTYDGANIEIFNHAGEDNNFPFGATVDVLNSIRDNYNPVEYYYKDENIKRV
FT                   VDTLLSDLINDSGSFMFLDIYNSLVNRDSSFKLDEYFVLKDFNDYEQIHEKILQTYADK
FT                   KKWAKMSLMNIANFGEFSSDRTIKEYAEEIWRIVPNEKI"
FT   CDS_pept        314988..315323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0265"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07683"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0S095"
FT                   /protein_id="BAG07683.1"
FT                   /translation="MKKFKKSDINSKIFNKGNKILFFEADGICPCIPAKNDLEDIEKSF
FT                   QGEIEFYEYTAKKVKEINKDEIITHFEALPLPTTLFIKDGKIIDRLVGDNSKSTYRNYA
FT                   NKLLDEK"
FT   CDS_pept        315333..316382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0266"
FT                   /product="magnesium/cobalt transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07684"
FT                   /db_xref="GOA:B0S096"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:B0S096"
FT                   /protein_id="BAG07684.1"
FT                   /translation="MANLLFEDRINEILETLRLENDLENTKITFCSFNEHHFDKHQTTD
FT                   IDDIELRDDRINWIYITGLSDSDNFIKMKEKFKIHPLIIEDMLDVEQRTKLEAYDDYLF
FT                   VVTDTVDYDMFNSVKELSFNQVSFVLKENLLVTVEQNKSTSFDRIVDKLEKIPVFRPKT
FT                   TDGLLLLLMDAVIDNYYQIFDILGEYIDDLEDTMMTNHDDDVLRELYTMKKNLIFLRKT
FT                   LWPLRTVINEMSKFRVNLVSHNTSIYMRDLYDHIIQMLEFIEVYRDMINSMIDAFDTNI
FT                   SNRTNEVMMVLTVWSTIFLPLTFLTGVYGMNFKYMPELQGKYGYILFWVTAIVITSVMI
FT                   YFFKKKKWM"
FT   CDS_pept        316398..316952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07685"
FT                   /db_xref="UniProtKB/TrEMBL:B0S097"
FT                   /protein_id="BAG07685.1"
FT                   /translation="MENSTFLASDYEKEQIDAIKKILRVYFSGDIEFSKNFSSLKPNID
FT                   NENLKKVLNVLDDKITRDDLIRYVNDINIMAYNDENKLCFMYDANRKFTIERKTALENY
FT                   PPEKNYGFCLDKWINKCDITLHNSSSDLQNAIYSSMLDICCEEMGILVVRICEDDFDWT
FT                   DDHAMEKLNEIVSNIRKGDFC"
FT   CDS_pept        316946..317440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0268"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07686"
FT                   /db_xref="GOA:B0S098"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B0S098"
FT                   /protein_id="BAG07686.1"
FT                   /translation="MLMKVILAVDKNFAIGKDGDMLFSIPEDMQRFKELTTGNIVIMGR
FT                   KTLESLPDSKPLPNRTNIIITSKDLDGMLCVKNEEELLRTLKEINPDHKMTEYLIGGAN
FT                   TIESLIHLVDEFVITYVDCEFEYDAKIRNLFEDQDFYVSEESDIKSYEDLDYRYMVFKR
FT                   K"
FT   CDS_pept        317742..318929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07687"
FT                   /db_xref="GOA:B0S099"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:B0S099"
FT                   /protein_id="BAG07687.1"
FT                   /translation="MRCPNCNEKVLDTVNFCHNCGFNLKEYRENLNQQKSESEVSQQKE
FT                   NTSTEKDYSYSDDVMNIFNIKTSEKSNEQQKCEEIINKNKTERKPKRIEDIFQVINKNK
FT                   SQYGKFNPDEEVEKKINHEEEKGPEENYENTIFITKGYDDVEEKNKRDESIRFTSDNEF
FT                   TIHKFEDEEDEDDMDKFMDNFDVKTKQVFDKINLFFTKILKKMMGGVQPYKFSMRLAVV
FT                   VLSALPLLFFYMNSTNHWTLTQKLKAIVVMVSVLILDLLQKVLSYSLGLKLADTKLYQP
FT                   IDKNLKKNISLLLTVVESLIFSLFGVLTAGGLVGFSSSVFTFTFLGAHAFIYLISLVVL
FT                   ILFATIILIDRFDYKNIWKIYGLNAAGIIITRLVVFMVVMTLLQKIFFGLAPGLM"
FT   CDS_pept        318938..319852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0270"
FT                   /product="fructose-1-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07688"
FT                   /db_xref="GOA:B0S0A0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A0"
FT                   /protein_id="BAG07688.1"
FT                   /translation="MIYTVTMNPALEFVSEVTDFKFDKNNISDFDLMLPAGKGINVSRI
FT                   LKQLGLPTVATGFAGGFTGEFVEDWLRREDIKSEFVRIDDNTRINIKITGTTKTVIESK
FT                   GPSISHQELQELLYYLSRVKEGDTVFLSTAFPRNITETVIERMIAICKANKAQFVLDID
FT                   EYYLEKFADEGSLLENISVKCLEHLFKTKINSESDLLKWKNEISNLNSKFVVVPFVENK
FT                   VYLFQKDSTYAFEIDEIANQKRDFVIDSIIAGFIATFIRTSDYEKSFKMANACAQASLK
FT                   TKDLPKKFQIDDCLKNINIVKID"
FT   CDS_pept        320400..321395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0271"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07689"
FT                   /db_xref="GOA:B0S0A1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A1"
FT                   /protein_id="BAG07689.1"
FT                   /translation="MSANKKILEVNNMHTAFRIKDDFYDAVDDVSFELYENEVLAMVGE
FT                   SGCGKSTLATTIMGLHNMNYTQISGEVIYNGENILNYTEAQFNDLRGGEIGMIFQDPLA
FT                   SLNPLMRIGEQIEEALFYHTDLDKKQRQEKAIDLLKKVGIENAEIIARQFPHQLSGGMR
FT                   QRVIIAIALSCKPRVLIADEPTTALDVTIQAQILDLLKELQNQMNSGIILITHDLGVVA
FT                   QTADRVCVMYAGQIVEIAPVDELFNNPLHPYTRSLLNSIPQADTESDQLHVIEGMVPSL
FT                   KDLPRKGCRFAPRIPWIDDHEHEENPVLHDVGNGHLVRCTCWKNFHFKDE"
FT   CDS_pept        321405..322343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0272"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07690"
FT                   /db_xref="GOA:B0S0A2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A2"
FT                   /protein_id="BAG07690.1"
FT                   /translation="MGFLEVKNLKVHYPIRGGFFNTVQDYIKAVDGVDMDIEEGKTYGL
FT                   IGESGSGKSTIGKAIVGLEKITDGQILYEGKDVTSRSYRKKINYNQDVQMIFQDSMSSL
FT                   DPKKRILDIIAEPIRNFERLTPKEEKEKVFKLLDIVGLNESAIYKYPFEFSGGQRQRIG
FT                   VARAVACNPRLIVADEPVSALDLSVQAQVLNYMKLIQQEFNLSYIFISHDLGVVRHMCD
FT                   YIYIMHNGKFVETGNRDELYSDPQHIYTKRLIAAIPQIDPSIRKELRDTRQAIEKKFDE
FT                   QKNVYYDENGSVYDLKKYKDSHYVAARKGEI"
FT   CDS_pept        322345..323313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0273"
FT                   /product="oligopeptide ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07691"
FT                   /db_xref="GOA:B0S0A3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A3"
FT                   /protein_id="BAG07691.1"
FT                   /translation="MTKTIIRRFLIMIPQLIVLSLFIFFVAQKMPGDPFTGKITPSTGN
FT                   SKVEEELKIKSGFYDPWYVKYKRWVGNAVKGDFGDSYTQKLPVKDVIGQRAKNTFFLSL
FT                   FSLLIMYAIAIPLGINAGRYDGSLFDQGVNLYNFLALATPGFVFYLIMLLIFGYKLGWF
FT                   PTSGIISLEASAKGGMAAVLSRIYHMLLPAISYALLTTIGTIQYLRNEVVDAKSQDYVR
FT                   TARAKGVPIKKVYSKHIFRNSLLPIAAFFGFQITGLLAGSIMIETIFGYQGMGSLFVDC
FT                   INQRDYSVMTALVMIYGFLTLCGSLLSDIIMSIVDPRIRIE"
FT   CDS_pept        323323..324243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0274"
FT                   /product="oligopeptide ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07692"
FT                   /db_xref="GOA:B0S0A4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A4"
FT                   /protein_id="BAG07692.1"
FT                   /translation="MKEVKVTEEKLEEYKDLAHDNPTGFKVIVNEFKKDKLAIISLVVL
FT                   AVLWIGIFVGAMLLDKKQVMMVDIMNSYVPPGEAGHILGTDQGGRDLFGQLIIGARNSI
FT                   VIGIAVTVLTSAIGIVVGLLIGYYGGWLDNIIMRIIDFIQILPTMMIIIVFVTIVPKYS
FT                   MFTFVMIFTVFYWTGMARLVRSKALAESKKDYVNASKTMGTSDLKTMFTGILPNISSIL
FT                   IVDMTLSFAGNIGIETGLSFLGFGLPPSDPSLGTLVSLARKPEVIQDKLYVWLPASLLI
FT                   LVMMLCINYIGQALRRASDAKQRKG"
FT   CDS_pept        324255..326108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0275"
FT                   /product="oligopeptide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07693"
FT                   /db_xref="GOA:B0S0A5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A5"
FT                   /protein_id="BAG07693.1"
FT                   /translation="MKKKFKSLLAIFLVLAFVLTGCGNSKKDSGKSSDSGSKQESSTGK
FT                   KVNEENKGNIVGEKMGGGVVVENEGEPIKGGTFRVGIPTDSPFKGIFNNTLYDDNYDWN
FT                   IIGPTMYTAANAGESLELRDSGAEKFEWDEKAKTATIKLSDSFKWNDGKPVTAKDIIIN
FT                   YLIIGHKDYPGVRYDDDMINIVGMEDYHAGKTKDISGVKEIDNKTVQIQFKEWVPSIKW
FT                   GAGIWAEPNSYDQLKDIPVKDIISSDPVRKNPKSAGPFYISNVVPGQSVEFSANEHFWG
FT                   GKPKIDKVVMERVPSSQILASLKAGKYDYIAGGAPSDTFKEISELKGYKVARFQDMAYT
FT                   YLGFKLGKWDKAKGEVVVDPNAKMADVNLRKAMGYAVDNNAVGEKFYLGYRSQATSVII
FT                   PIFKDYFNTDLKGYNYDPEKAKKLLDEAGYKDVNNDGFREDKNGKPLVIKFASMAGGDI
FT                   AEPLAKYYMQCWEQVGLKVELTGGRLIEFNAFYDKLKNDDPEIDVFQGAWSTGTNPDPS
FT                   GLFSKNASFNYYRYTNPEMQKALDKISDGKTSDEDRAQAYKDFAKVMEDNVPLIPTLYR
FT                   EALSPINKRVKKFDFRYVQDLNKDDFRWNQIELTAEEPLKE"
FT   CDS_pept        326245..327201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07694"
FT                   /db_xref="GOA:B0S0A6"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0A6"
FT                   /protein_id="BAG07694.1"
FT                   /translation="MKRKNIIAVVLLTVLIFVGAFVGLNILNSSKAEKLDKLAHQCIVD
FT                   GNYQKAVDYYSELYDRTNDGSYIDKKREAVELLSSKNNYDYGVNYLKEMKYIDAAKSFL
FT                   KVSNKDNVNYQKAQQRLQESTQAVIIASDSFAEDDNFDASLNMLNSYARVMPHETLVID
FT                   KIKEVKKAKNQYNEKKQEEEKQRALSEKKEKEAREKAEKLASESAEELKKEKENSKNQS
FT                   NKDYSYETDDNRRLIDLCIRLVGKTYLVTTDNAKIYEEPSNKSQMISSIPIGSEVYIYE
FT                   AKPDSGQRVWCHAIIKSADSLKSYDAWISSNNLEIND"
FT   CDS_pept        327244..328287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0277"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07695"
FT                   /db_xref="GOA:B0S0R3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0R3"
FT                   /protein_id="BAG07695.1"
FT                   /translation="MDLNFLHFDLDAFFASCEILDNPKLKHVPMVVGGRSQRGIITTAN
FT                   YEARKYGLHSAMPIFQAKKIVPNLVIVAPDFEKYRRNSEKVFKVLSSFSNKIQKMSIDE
FT                   GCMDISHIRMDRLELANLIQENVRIKTGLSISIGISYNMSLAKLASDWNKPHGIKIITQ
FT                   DDIPNILLDLKVGKIQGIGRKSEEKLNKIGIKKVSDLYDLSRNNLRELFGKFGEVIYDR
FT                   IRGIDERQLDLSRIRKSIGVEYTFERDLKNYNELLNKASEFSEELSDDLHKKNIKAKTI
FT                   RIKIKLNDFSVITKSMTLEEYISDSSDIFRIVKYLVVNTKIEKSVRLFGITAANLSDTT
FT                   FEQLKFL"
FT   CDS_pept        328356..328670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0278"
FT                   /product="transcriptional regulator PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07696"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0R4"
FT                   /protein_id="BAG07696.1"
FT                   /translation="MNTQLKKGILELCVLSVISKHDSYGYEIIDQIKDKIPMSEGTIYP
FT                   MLRRLKNDKYLEDYTEQSESGPSRKYYKITDEGKKYLHSQLEDYKKLVESVKVLLEEGF
FT                   "
FT   CDS_pept        328671..329705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07697"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0R5"
FT                   /protein_id="BAG07697.1"
FT                   /translation="MNKEQFMELLDYYFRNVDETTYKEIKNDYEEHFRIGVENGKTEEE
FT                   ISTELGNPREIFNECKEAGIIRENNFFGMFNLDSIGDFFNSKIFDQSKDKDYDLSQQTL
FT                   EFDNDFHRIEVKSNADIDVSTHELDKIIVTYTTTDESQKLDVDYMNHVLKLGKVKMEKF
FT                   FQKSFIKSISIKIPQDSDLGLNIATASGDVHVDVISNDVTCNTSSGDVDITTQSNNVNV
FT                   NTASGDVQVFKCKKEIYVNTVSGDVKIVSENPKITVNTVSGDIKIDVDENKDLNVRGVS
FT                   SDININIKEKKGSIELRTVSGEIKIDSYYKDSSKKISKSHDQSFTNDDVEISAATVSGN
FT                   ITVD"
FT   CDS_pept        329834..330955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0280"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07698"
FT                   /db_xref="GOA:B0S0R6"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0R6"
FT                   /protein_id="BAG07698.1"
FT                   /translation="MKIIVTCAFGLESLVKRQLLDMGYENLNVNDGRIILEGDEKDIAK
FT                   LNINLRCADRVLIELGNFKAVSFEQLFKGVEKINWLEILEADSNFIVEGRSYKSKLFSI
FT                   KDCQSITEKAIIKSLQKKYKVDWFSKSKGRFRIEVSLVKDICSITLDTSGDGLHKRGYR
FT                   EESVLAPIRENLAAGIIDLSFANSDRPLVDLFCGSGTFAIEAARKFRNIAPGIDRKFDF
FT                   INFNDKFNDAYKQERTKALESIDYDKKIDIFASDVDGSAIEKAIANAENAGVREDIRFV
FT                   TRDFRNVVLNDNYFVLISNPPYGKRLGERQEAEKIYKDLGIKMAKFKTASQYIITDCED
FT                   FEKFYGKKSSKNRKMYNGNMKCYLYQYFGPRPK"
FT   CDS_pept        330968..332074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0281"
FT                   /product="putative sigma factor SigB regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07699"
FT                   /db_xref="GOA:B0S0R7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0R7"
FT                   /protein_id="BAG07699.1"
FT                   /translation="MEKKSREGVSDFKGSDYQVLNSMKDLVRVIDKDGVIIFANKSMIN
FT                   SMPINPIGVNCYLDYSEDFPKCLADRKYRLNSTIKEKRKINGVDYSITSSPVRNKDGEV
FT                   VSTVEVFRDISKEVKTQIDLINANKDIKDEIIFAKHIQNKTLPSKGEHVGLDLDYRYIS
FT                   SRDLSGDIIDCIDIDERFVGIYIADVVGHGIAASILTMFIRQTMRYLVSRITDSRPKRV
FT                   LKDLNTTFTELNLSVDKYFTIFYGLYDRKLKIFSYANAGHNGIPFLISNEKLEELKVTG
FT                   HPISPMFEGIGFTQRDILLSSGDELIMYTDGITETRGFGNEFYGEERLKRDLMKVPDKR
FT                   IEYVLSEVNSFRFLEQDDDIVLVSLKVL"
FT   CDS_pept        332083..333360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0282"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07700"
FT                   /db_xref="GOA:B0S0R8"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0R8"
FT                   /protein_id="BAG07700.1"
FT                   /translation="MFKLDFSNTTSHNSVDTLKTESVNALEKLLNKTCEGKEFTGWIDL
FT                   PKNYDREEFERIKKCAKKIRETSDCLVVIGIGGSYLGAKAIDYAMSSYFEKSDIEIIYA
FT                   GFQLSSTYLSELLDYLKGKDFCVNVISKSGTTTEPAIAFRFIKELMEEKYTKEELKDRI
FT                   FATTDKHKGALKELSDINGYETFVVPDDIGGRFSVLTSVGLLPLCVKGLDIDKLMMGAE
FT                   NAMEEFTKLDYESNFALQYASFRNNMYRNGKDIEILVNYEMRLKYFSEWFKQLFAESEG
FT                   KNNKGLFPMICNFTTDLHSVGQMIQDGQKNVFETVISVENPQKDLFIKSDDDNLDNLNY
FT                   LSGKSVDYVNKMAMQGTLNAHLSSNVESIVVKIDTINEENLGYMIYFFEMSVAISALVL
FT                   GVNPFNQPGVEEYKKQMFKLLEKPGY"
FT   CDS_pept        333362..333871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07701"
FT                   /db_xref="GOA:B0S0R9"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0R9"
FT                   /protein_id="BAG07701.1"
FT                   /translation="MKENLKKIVLYEKSYEVSKIILVLLTSVLFLKCAKVDHVFVKSFF
FT                   ITILSFVPIIGAGVYFVPAIILNLLESNTLNLAIYVWLLLVVICIDRILYSVFYDLPFD
FT                   YSPISYVIMGMILYLIFGKYTLLVFALSVCAVTVYNNYNKYKKTKVFYKKATFNFIDLK
FT                   QIIQEK"
FT   CDS_pept        333888..335336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0S0"
FT                   /protein_id="BAG07702.1"
FT                   /translation="MEKLLIARGNEDIELLSNKVNQHGLIVGATGSGKTVTLKVLCEYF
FT                   SDLGVPTILSDVKGDLSNLASVGEMNDNLKSRLDEMNITDFNFKNYPVNLWDVYGEAGL
FT                   PLRVSVSEMGPILLSQILDLNDTQAGILNIAFRVSDEEGLLLLDIKDLRSMLNHLSDNR
FT                   DVYSKKYGNITTQSISAIMRKLLYIEDMGADKFLGEPSLDIKDLMKTDSDGRGFVNIIS
FT                   AAKLINDKNLYSMFLLWLLSELFESLPEVGNPEIPKLVFFFDEAHLLFDNANKMIMDKI
FT                   EQVVRLIRSKGVGIFFISQNPLDIPDSISSQLGNRIVHQLRAFSPKELKAVQKVSETFR
FT                   ANADMNVKDEIVNLRTGEALISFLDEKGAPSITKKGLVLPPHSSFTPLSQSDVDYIVKN
FT                   SDLNQKYSQSIDRESAYEILQNKLQNQIKEEPEKPQKAKKQEKSAIEDFATKSINSMLG
FT                   SFTRQIGRDIARGIFGSIKKSIKF"
FT   CDS_pept        complement(335380..336081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0285"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07703"
FT                   /db_xref="GOA:B0S0S1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0S1"
FT                   /protein_id="BAG07703.1"
FT                   /translation="MSKFYDSISDNYEDIFQPNDKQINFLKELAHGKILDVACATGKVA
FT                   KRLQDDGFDVIGIDLEEKFVDRAIRENKIDAKLMNMLDIDQLQDNFGLIYCIGNSLVHL
FT                   DSTEKIDEFLKKCYDKLDPNGNLVLQIINFYPFLQVDDDYLGSLPTIKNEKVEFVRKYF
FT                   RNGDFIRFNTVMTANDKSIENEVNLFPIISDELVKLVEQNGFKNVKIYGGFNKSEFDKE
FT                   NSRPLVLSAEK"
FT   CDS_pept        336194..337174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07704"
FT                   /db_xref="GOA:B0S0S2"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0S2"
FT                   /protein_id="BAG07704.1"
FT                   /translation="MIHNNHDRFLEEKRKRAVKRRLLVCVFLLIILFSIIKVKKDRQEY
FT                   AEEQKQAEIAHEKKASQQQSDSEEKPVEKEKTDEEVFEEIRKNENIFSNTFKRNELLHN
FT                   LEIYAKYNPNAKLVMKNADDIHPSLLKLAGNNYTAVNFVAKTIDPTVKNEYSYTEKANN
FT                   SNVPLYLQWDKRWGYEKYGYGIIGFTGCGPTSCAMAMSYLKNDPSITPAKIAEESDRNG
FT                   FSSSEGTSWGFYPYIARKYGLKAVQMDENYNVIKENVKKGNPILISVRPGDFTRTGHVM
FT                   VISGMDSNGNIILNDPNSFINSQKTWKYDRLRPQIKAMWVFSNGV"
FT   CDS_pept        337175..337879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0287"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07705"
FT                   /db_xref="GOA:B0S0S3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0S3"
FT                   /protein_id="BAG07705.1"
FT                   /translation="MKKYTKYKKDLEYSYTMGPFPTYELIENKADIVEEVLISEDFNDT
FT                   EKLINILKEKKIPYTISSKQINKISLKDKEYVIGVFRKEKSNFQEKNHIILDGIDNMGN
FT                   LGTIMRSMLAFGYKNLALISNTCDVYNPKVVRASMGAFFKLNIQKFDNLEDYKKNFPDN
FT                   KIYSFLLDENSNELGDVKFDEPFSLAFGNEGAGLPKEYYNENKIFINQSKDVDSLNLPI
FT                   ACSIAMYESKVI"
FT   CDS_pept        337879..338574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0288"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07706"
FT                   /db_xref="GOA:B0S0S4"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0S4"
FT                   /protein_id="BAG07706.1"
FT                   /translation="MKRVFVFDLDGTLIDSIEMINNCFNHTTQKFGLKPVEKDKFNYFL
FT                   GDGPKILVEKSLNYLIQRDSLDEAKIHSQFNEIYDSYIEYYNGYDDKKTQLYPHIRESL
FT                   DKLKEMGALVCVCTNKTLPAAEKILNNLFPQGYFDYVSALEDETKRKPNPYLLDKIVED
FT                   LNIKKEEIVYFGDTDTDIETCKNAKVTSVGVEWGFREREELVESGADFVISDQRRIVDF
FT                   YGELPKNIG"
FT   CDS_pept        338537..339166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07707"
FT                   /db_xref="GOA:B0S0S9"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0S9"
FT                   /protein_id="BAG07707.1"
FT                   /translation="MIFMENYQKILDKTIENLNGGETLLLHSCCGPCSSYVLEYLSQYF
FT                   KITILFYNPNISPQSEFDKRVVEQKKVIENTKAKYPIDIIVDKYDPDEFYKRVEPYKDL
FT                   GEKSRRCYECYDLRIDRTFDIADEMGFDFITTTLSVSPHKNSQWINEIGEKLEQTHKTK
FT                   FLHSDFKKKNGYKRSIELSKEFDLYRQDYCGCVYSKKEAEQRHNND"
FT   CDS_pept        339290..340045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0290"
FT                   /product="formate dehydrogenase associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07708"
FT                   /db_xref="GOA:B0S0T0"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T0"
FT                   /protein_id="BAG07708.1"
FT                   /translation="MNFEKRVMVKKYNDGVIEEVEDVILREFLLDININSKPIVKLLCI
FT                   EKDLQELVTGYLITENIVRPEDIQNIDIHIDGNICNVKLKDIDNTPSHVTTESGDYKNV
FT                   PYNFTNRDEKVIPIDWEEETLLKISNFNLSGSKLFKETGNVHSVVLAKDEEIICQCDDI
FT                   GRYNAFDKAVGTAVLNGEKLSDLIAFTSGRIPSSIVQKCINSGISVIVSRSAPTDVSLE
FT                   LAEKYNLSVIGFCKQSRLNIYRDFRKKDL"
FT   CDS_pept        340045..340680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0291"
FT                   /product="putative formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07709"
FT                   /db_xref="GOA:B0S0T1"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T1"
FT                   /protein_id="BAG07709.1"
FT                   /translation="MKKLADFLYAIMAGAFIAMGGVVFLSLNNKIVGAFMFSLGLFAVC
FT                   TLKYNLFTGKVGYLFNNDVKTYLPWCLMVWVGNLVGSIIVAELVRLTRVAPGIIEKSTK
FT                   LVQVKADDSLISLFVLGIFCNIMVVHAVDQYLNNPHEIGKYLGIIMSIMVFILCGFEHC
FT                   IADMFYIQMARMWNSQTIIALIVITLGNVLGGILIPTMRNINTKLKSE"
FT   CDS_pept        340691..341872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0292"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07710"
FT                   /db_xref="GOA:B0S0T2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T2"
FT                   /protein_id="BAG07710.1"
FT                   /translation="MLLQVEKAKEILKENIKKASEIEEIDIDDAYNRVLAEDVLAKFNN
FT                   PPYPKSAMDGYAVSSKDSDKLSKKKIIGTNFAGDCNDFDYEENTCVRIMTGAFVPKGYD
FT                   AIVKQEDCEVVDGFIEIKKPYEPFDYYIKEGEDVSEGDLLIPKNTRISSVHLSILASNG
FT                   YAKVKVYRKLKVALLSTGSELLYPGDDYKPGKIYSSTTFTLKSILKNSGVEVVEQKNCM
FT                   DDEQSIIREVKNLTQKSDVVITTGGVSVGDKDLMESCMKQIGEVLFHRIAMKPGTPVMA
FT                   SKVGDTIVLSCSGSPFAAFCNFEVLFWDLYNKYYGLNVKQFEEGKVVEGSMKPSKLQRY
FT                   VRCFVKDSEITIFDKHKNSMLQDLTNCNALLLQKQNESLDVNSSVDYIYLGEI"
FT   CDS_pept        341869..342876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0293"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07711"
FT                   /db_xref="GOA:B0S0T3"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T3"
FT                   /protein_id="BAG07711.1"
FT                   /translation="MRVSVGILAGGKSERMGQDKFDLNFYGHTFIEELIDRFKDYEVIV
FT                   SSNTADYYPIKTVKDTYVDAGPLSGILEILKNSTNEYVFVTSCDMINVKPDLVDFAASI
FT                   ASFSDEAVIFETDERCYPTCGIFSKKIIPVIEGMLQIGDYRVMNLVKKIDAKFVNLKYT
FT                   IFEDEFVNINYPEDLKQNATPLICICGKKNSGKTTFIKKLVGELKNRNKTCSVIKHDGH
FT                   DFELDFKDTDTFFYKEYGACQTLIFNDKYFKLDGRSKNIYELIQLLDDVDLIIIEGMKD
FT                   SDFIKYECTLTDDLVCSDVNKYAVISDRKFSGYDNFDINNPSEFADYIIRKFKI"
FT   CDS_pept        342886..343341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0294"
FT                   /product="mutator protein MutT/nudix family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07712"
FT                   /db_xref="GOA:B0S0T4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T4"
FT                   /protein_id="BAG07712.1"
FT                   /translation="MENILCNMIKINRGNDVLVLDKVKKYGWEGLTFPGGHVEKMESIT
FT                   DSVIREAKEETNLDVENIRYIGMISWYDMDNNDRIVGFLYETDDFSGELVKENIEGTLE
FT                   FIDYEELKNMDGHSDSMDEIFAIYDGKYSEIVLYYEDNKCVKKECYK"
FT   CDS_pept        343359..344249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0295"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07713"
FT                   /db_xref="GOA:B0S0T5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T5"
FT                   /protein_id="BAG07713.1"
FT                   /translation="MMFAIISALIFGFTPIMVRETLSNGSNVIMTSFLRGFFVIPFLAI
FT                   SLKSRNISLKVTKQELKKLILMCSIGGCITMTMLYASYQYISVGLATSIHFIFPTIVTV
FT                   YSVMFLNEKMTKYKFVSLIASIIGVILLANNVGGSNNFPLGMFLAVASGCTYSFYLIYM
FT                   DVSGLKNMDSVKVTFYNCTINSTMLFIFGLITGDFTLSLSRYAWIIAFVISILVSVFGT
FT                   LFIQLSIVNAGVSTYTIFSTLEPITSVILGIILFNETTDPRRLLGCFMIFLSVMILAVS
FT                   MRFQERKAREAINNE"
FT   CDS_pept        344242..344982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0296"
FT                   /product="transcriptional regulator Sir2 family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07714"
FT                   /db_xref="GOA:B0S0T6"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T6"
FT                   /protein_id="BAG07714.1"
FT                   /translation="MNDVERLKQIVEQSDKIVFFGGAGVSTASGIPDFRSATGLYNKKN
FT                   DSDFSPEYMLSHEFFVTHPDLFQDYVLENLIIDGVKPNNAHLSLRKLEKANKLLGVITQ
FT                   NIDSLDTMAGTKNIAEIHGNLRDYYCVNCGAKYDLDYYKQNRPCKCEKCGGVVRPDVTL
FT                   YGEVPPQSEFAKAINWINKADTMIVAGSSLVVYPASGLINYFRGDNLILINLDRTSYDN
FT                   MANIVIHDDIAKTLEYVTRDIDER"
FT   CDS_pept        344969..345370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07715"
FT                   /db_xref="GOA:B0S0T7"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T7"
FT                   /protein_id="BAG07715.1"
FT                   /translation="MMKDKIKNYLQKVYGVDFFSKTMIVFALILSFINLKFKNRVIEII
FT                   TMILIVYFGIFRVFSVNKYQRMIENQKFAKAVKPMTDFFEKYKIRAANSKDKKYIKCPN
FT                   CKKEMKIPRNKGKIKVTCPHCGHKFVKKS"
FT   CDS_pept        345583..346443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07716"
FT                   /db_xref="GOA:B0S0P9"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P9"
FT                   /protein_id="BAG07716.1"
FT                   /translation="MIKIISDSACDLKKAYTEQNNIGIVPFNIIINEDTSLKDKIDIQS
FT                   EELLEMMKNDSHFFAKTSQPSPDDYKIEFEKAAKQGCDIICFTITSELSGSYQSAEIAK
FT                   KIIQEEYDVDIRVIDSLSASLGQAILINKAIEMVHQDKSLDEIEDYINKIKLTSKVFLL
FT                   VDTLKYLEKGGRISKSKRLIGSALSLKPILKLENGKLDIVDKVIGKKRAIKNMMRLLNS
FT                   EKNKSDKSHEFFVVHADSEKESSEIYDELKTENNIPFDIEVLSPVLVCHSGYGSVAIGI
FT                   ISTEV"
FT   CDS_pept        346603..347757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07717"
FT                   /db_xref="GOA:B0S0Q0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q0"
FT                   /protein_id="BAG07717.1"
FT                   /translation="MRKNVLKGTTLLLALCFSVGAVGCQKSSGNTGKDSKVVSPKEAGM
FT                   KNDKKQENEKFKPADYSLQPKDEFVYEFLGLKFKLPEQVKKDMTNKKIAMLDEQSPIDK
FT                   ELKYAMLTFSKLTEEQKNAVVDKMGDGYEKWQKELERVGTIGMFDKKMSEADISKITKC
FT                   DNHKKIGESKDGKFTYYISSKGKMDEGFAKEFAQTQIDIIDKKPRPENGFVLSEKTDLE
FT                   NTEAFDKKSVKGLGNLSTKDINGKQFTSKDFEKYDLTMVNVFATWCSACVNEIPDLSEV
FT                   SKEMKSKGVNIVGVVTDTVDDNGTNNDALQKSKLIQEKTKASYPFLMPDKSNFNGRLNG
FT                   IQAMPETFFVDKKGNIVGETYSGAKSKEEWKQVIEKELANLKSK"
FT   CDS_pept        347911..348816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07718"
FT                   /db_xref="GOA:B0S0Q1"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q1"
FT                   /protein_id="BAG07718.1"
FT                   /translation="MELDKIKNLLKFGDKKNKYKVMDNFRHAFQSLWFLITNSYVEGFK
FT                   TGKIYGGNLKKICVPGMNCYSCPGAKGSCPIGSLQAVIGNSNFKFSYYIVGFLFFIGAL
FT                   MGRFVCGWLCPFGLIQDLLYKIPFFKKIKTFKYDKHLRKLKYFILLIFVIILPMFLVDI
FT                   LGQGSPYFCKLICPIGMLEGGIPLVLLNKSMRGAIGFLYYWKGSILIITILLSIIIYRP
FT                   FCKYICPLGAIYSFFNPISIFKYRLDKDKCISCGRCKKVCQMNIDPTKNCNHKECIRCA
FT                   RCKNACPVDAISCGIKDKNR"
FT   CDS_pept        348950..349699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07719"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q2"
FT                   /protein_id="BAG07719.1"
FT                   /translation="MKKLLLTLALVSALTVTGCSNNTEKPADNNAKTEQKTENKSEEKA
FT                   AIKEMKGADLEAIEQDKKKKETVLVVDVRSKDEYDQGHVKWAINMPIDTFEQEVSKLDA
FT                   YKDKAVITICNSGKKSQKAAEVLVNNGFKDVTNAEGVKKFEYKLVKFANILPADLVKAS
FT                   EDTNNVIVDVRDKKDYDKGHIKNAISMPLDEADARLSEIPTDKPVYTYCYSGNKSGQLA
FT                   QKLVERGNKDVFNSLDGTKEHDYELVK"
FT   CDS_pept        349754..351235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07720"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q3"
FT                   /protein_id="BAG07720.1"
FT                   /translation="MNAVILMTKIPNKNSKTRLSTILSENERIKFSGNLINKNVNIIKK
FT                   YKVFLSLTPDELFEDYTKNSPYDCIRQTGDDIGQRMKNSIKEVLSRGYSKVVLIGSDII
FT                   DFDGEIFDEAFDKLEDYDVVFSPTEDGGYSLIGMKKSHDVLFENKKYSNPNVENDLENS
FT                   LIEHDLSYYKLKETHDIDTDIDFVKYISKSNNVKLLGKGEYNSNYLIDDDYLIRIARGS
FT                   QMHLDNQIEYEYKALKFLEKSNVTAKAYDLKKDELSGISYLIEEYLIGRDLDYHTDLKI
FT                   AAYLLSQIHSLDVIGQDFIKADSPFEMMFDEFTQMFSHYQKWHKKNNNTEEKISDMLKY
FT                   IKNLGLTSSLQNPCLINTELNNKNFIIGDKSYVIDWEKPIIGEREQDLAHFLAPTTTFW
FT                   KTDVIFDNDTMDDFLDEYDKLSKTKVDREKFVKYLLFTCLRGITWCSMAYTQYVDENRD
FT                   NGFTFEKIKAYLSDEFLDNIWEFIKANDFSNSAGV"
FT   CDS_pept        351207..351869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07721"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q4"
FT                   /protein_id="BAG07721.1"
FT                   /translation="MISVIVPVYNESDNIDKFIDRLDVFDDEFEVIFSVSGDDDTFEKI
FT                   KKRGYNPIKSIKGRGNQIINGILNSNGEIILILHADTFFRENPKEEIKSILENYKMGCF
FT                   SISFVPKQFIMQIVAFNSSNRVRQRNIAFGDQGMFFTREFYDEMGGFKNIDLMEDYDFS
FT                   IRVKEKGYTIFLSKMKIYSSSRRFQKNGPFRTMWMMQKCQYMYRKGESVDDIKQKYK"
FT   CDS_pept        351844..352791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0304"
FT                   /product="iron-sulfur binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07722"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q5"
FT                   /protein_id="BAG07722.1"
FT                   /translation="MISNKSTNDYLQEVKDKCIDCGKCTKNCPFLTKYKINLKDFADRQ
FT                   DLAFSCFLCQKCKAVCPVDLDGKKISLILRKQNPKFESVKKQKENYFFKNKSKRKTKDL
FT                   LYLGCNFPAFYPDTTKYLMELFNKEGFDYSIDCCNLPSDFTGFENNYMERLEKELQDKE
FT                   VERIVCVCPNCFHKFYKNLSVEVITIFKWLEERDMIQDIDEEVNVFFPCSDRYNHIMFE
FT                   EIKRHIKGFNNKYISTNCCGAGGIAGKSEKDIATQMQNSIKNEKMYTYCATCSSKFVAN
FT                   NEVHHFVSKMVGIDEKCDPSFFKNALKGKFRGRK"
FT   CDS_pept        352788..353708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07723"
FT                   /db_xref="GOA:B0S0Q6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024521"
FT                   /db_xref="InterPro:IPR026351"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q6"
FT                   /protein_id="BAG07723.1"
FT                   /translation="MRFEDRISEKFKKTGDITTLQLNITEKCNLRCKHCHIMKNSENLE
FT                   MSKETMQDCLKFLDNHKMKTVDITGGEPTTHPEIVRFMKECLKRVDELIIRTNATDIEK
FT                   NKELMDLFDKEKIKIVVSLPCYTQDNVDSQRGDGVFDKVIANLKKLNEMGYGTEKELDL
FT                   VYNPLGGFLPPEQSNLQSDYERELKKKDVVFSNLFTITNMPIGYFRDFLIEKGEYEDYM
FT                   KLLEDNYNEETVENIMCRFQISVDSLGNLHDCDFHLAEKVPMKDYKNIKDLIDVDDLSR
FT                   EIVCKDYCYGCTAGSGSSCGGALDE"
FT   CDS_pept        353608..354141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07724"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q7"
FT                   /protein_id="BAG07724.1"
FT                   /translation="MMLMICPEKSCVKIIATDVLQEVVQVVEVHWMNKLTNEEIWQQFT
FT                   EGIDCAQVVLRYFADDLGVDKKLLTKVASPFTGGMYKGMTCGAVTGAYMVLGIKYGHSK
FT                   PNEGEKKVELIKKMFEFDTKFKEKQSTIICEEILGDNIAENLEKIEQENTMQKKCPQAV
FT                   NDAIDILEEIFEEK"
FT   CDS_pept        354268..355812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07725"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q8"
FT                   /protein_id="BAG07725.1"
FT                   /translation="MIIIRNIKLENDDENELKKKISNMIGMKNFDYEIYRKSIDARKGI
FT                   LFNYQVIVDVDLSDKKIKSIKNCEKYFEEDFRLEDVDNSKSVTVVGSGPAGLFCAYLLA
FT                   KNRAEVKVIERGSEVSKRVDDIEHFLETGELNTNSNVQFGEGGAGTFSDGKLTARSKDK
FT                   RVREVLKTFVDYGAPSEIMYDSKPHIGTDELQKVIVNMRKDLIKMGCEFEFDTLIDDVE
FT                   IENEKCVGIKSHDKKFQSDCYVLALGNSSRDTAVMLADKIKMTNKPFAVGFRIEHPQKM
FT                   IDFAQYKCDRNLPSATYQLSYSEENKRGVYTFCMCPGGYVINASSEENELCVNGMSFHK
FT                   RDGRNANSAIVCGIDENTYGHNLLDGIKFQQEIERKAFELGGSNYNAPVQLVKDFMNDK
FT                   KSEKIGEVVPTVKPGYVLSNLNDIYPKHVTDYIKTAIKMMDKKLHGFSMDEAVLTGVET
FT                   RTSCAVRMDRDDLLRSENIDNLYVIGEGSGYSGGIVSSAIDGLKAAEVILTSKLSK"
FT   CDS_pept        355881..356834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0308"
FT                   /product="tagatose-6-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07726"
FT                   /db_xref="GOA:B0S0Q9"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Q9"
FT                   /protein_id="BAG07726.1"
FT                   /translation="MILSITSNPAIDVIYEMDELDTNGVNVVDDVYKTPGGKGINVSKV
FT                   LDLLRADFMVTGFIGGSNGDYVIDKLDDVNIKHDFIFTNVDTRNCIRVIHGDKQFEIFE
FT                   KTNKIDSRFERTFMSLIQEIGKNYDISVISGSLMNGLSDNFVEETMEILQDNSKIILDT
FT                   SGQVTKKVLENNYKPYAIKPNFHEFKEIIGLSEDISSEDFINKDSDYLKGIFSNKLLDD
FT                   IEIVLVTNGKYGAILKYKDNLYKITVPQYKIQRTVGSGDATVAGIAKFLDDGESVMETV
FT                   LKAISLGVLNARVYEVEKLDVSKINEVAEQIDVELL"
FT   CDS_pept        357021..358472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0309"
FT                   /product="inositol-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07727"
FT                   /db_xref="GOA:B0S0R0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0R0"
FT                   /protein_id="BAG07727.1"
FT                   /translation="MQFIGEGLTFDDVLLVPGPSEVLPNETILKTRLTKKIELNIPMMS
FT                   AGMDTVTESKMAIAMARQGGIGIIHKNMTIEEQAREVDRVKRSENGIITDPFYLSADDK
FT                   IVDALKLMSHYRISGVPIVKEDMTLVGILTNRDVRFVKDEQLPIGDVMTKDNLITGHEN
FT                   ISMDEALEKMMNAKIEKLPIVDENFKLKGLITTKDVEKSIQYPNSARDSQGRLLVGAAV
FT                   GITTDMIERCQALVDAKVDVVTIDTAHGHSRGVLNAVTKLKKAFPDLQIIAGNVATADA
FT                   TRDLIKAGADCVKVGIGPGSICTTRVVTGIGVPQMTAIIECAKEADKYDIPIIADGGIK
FT                   YSGDITKALAAGASVIMAGSLFAGTEESPGELVVLEGRQYKEYRGMGSLGAMRAGSGDR
FT                   YFQNNTKKYVPEGVEGRVAYKGSVAEVVYQLVGGLRSGMGYVGSKDLIELKEKSKFVKI
FT                   SPASLVENHPHDITITRESPNYTKK"
FT   CDS_pept        358482..358955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0310"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07728"
FT                   /db_xref="GOA:B0S0R1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0R1"
FT                   /protein_id="BAG07728.1"
FT                   /translation="MDIRLIMGSSSDIEVAKKVTKMLKKFGLSYEVSVISAHRALDVLK
FT                   ETVEKDDCKVYITIAGKAAHLGGVTAGITTKPVIGIPVKGSALAGMDALYSIVQMPKGV
FT                   PVATVAIDGGENAAILAAQMIALSDEKLAQKLKDYKEEMKQAVIDSDKELEEI"
FT   CDS_pept        358955..359980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0311"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07729"
FT                   /db_xref="GOA:B0S0R2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0R2"
FT                   /protein_id="BAG07729.1"
FT                   /translation="MGLTYKDSGVDKEKGYEEVQIIKEIVKKTHGKEVLTGIGGFAGLF
FT                   KPELTDMKEPVLVSGTDGVGTKIKLAMELDKHDTVGIDLVAMCVNDVLCQGAKPLFFLD
FT                   YIATGSLKPAKMADLVRGVAEGCSQSECALIGGETAEMPGLYKENDYDLAGFAVGIVDR
FT                   DKIIDGSGIKEGDVAISLSSSGVHSNGFSLVRAALDMANVKLSDKFEDTTVGERLLVPT
FT                   RIYEKEISALLKEVEIKGIAHITGGGLYENVPRMLPENIGIEFDIKESEIDSVFKAIQK
FT                   WGNVETKEMFSTFNMGIGMVVVVDAKDVDKSLEILQKIDPKAKQCGVCKKTETSVKINL
FT                   K"
FT   CDS_pept        359996..361111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0312"
FT                   /product="putative metyhltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07730"
FT                   /db_xref="GOA:B0S0S5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0S5"
FT                   /protein_id="BAG07730.1"
FT                   /translation="MKKKYFSFVDEGLIKMTYTERLKSYLDGNVVDVVPFDLFDVETPL
FT                   ATNMGYTKIDLINDFSLYTDMVHLKKSLYGIDYMYIGMDQKGIGSILGSETRMTENGDF
FT                   LTSHYAIDEYESMANLGNIDVSNSETVCNFIEKAKKTKSSMDGITIFGAVTGPFTTASG
FT                   VRPVEKLLRDTRKNKENLHELLDLCTNYTIDFVRTFTDEIGGCFFKIADPVASMTVISK
FT                   KQFEEFAQPHLTKLTDAIYEITGIKPMVHICGKTDKVWENFKDTNFSRFSLDNIEDMGE
FT                   FKNILGNSMIIEGNIAPMDILLNSDPQTVRNEVKNILQKASDSPKGFILNSGCTVCDHT
FT                   PIENIESYIKAVCDFGKDASIGKLPKGLSDI"
FT   CDS_pept        361247..362842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0313"
FT                   /product="macrolide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07731"
FT                   /db_xref="GOA:B0S0S6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0S6"
FT                   /protein_id="BAG07731.1"
FT                   /translation="MLTVNNLSVIFPDKKLFEDVNLIFNPGNCYGVIGANGAGKSTFLK
FT                   ILSGEKEPTKGNVTIDKNTRLSKLNQDHYAFEENSVMETVLMGNKKLYDIQKEKDEIYM
FT                   KPDFSDEDGMRAAELEAEFQELGGYEAEAESSSLLQGLGITTEQHYMLMKDLKESDKVK
FT                   VLLAQALFGNPGILLLDEPTNGLDLKAILWLEGFLMDFPGIVIIVSHDRYFLNEVCTHM
FT                   VDVDYGKINMFVGNYDFWYESSQLALRMQKEQNKKKEDKIKELQEFIQRFSANKSKSKQ
FT                   ATSRKKLLDKITLDDIKPSSRRYPFVGFELSREVGNEILNVDNLTVEQNGSKLIDNLTF
FT                   RVNKGDKIGFIGNEIAITKFFEIINGNDDNYSGEYKWGQTITNTYFPKDNTKYFEDCDL
FT                   NLIDWLRQFSEEKSEIHIRGFLGKMLFSGDEALKKSNVLSGGEKVRMMFSKMMVTPANV
FT                   LVFDQPTNHLDLESIEAVNNGLIAFKSNILFTSLDHQFVSSVANRIIEIFDDGTYRDVS
FT                   MNYEDYIEKYLTNN"
FT   CDS_pept        362851..364383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0314"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07732"
FT                   /db_xref="GOA:B0S0S7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0S7"
FT                   /protein_id="BAG07732.1"
FT                   /translation="MKHQLVIVVDFGGQYNQLIARRVRDLNVYCEVVPYKKALDVIKEK
FT                   QPIGIIFTGGPNSVYEENSPQIEKEIFELNIPILGMCYGMQLISKDFGGVVEKAKNREF
FT                   GKTNAKISNQSSILKGMSDESIVWMSHTDFVSEKPEGFDIIQTTDSCPVAAIANEDKKI
FT                   FAVQYHPEVNHTVEGKTLIKNFLYEICKADGDWTMENFLEEQIQKIRKTVGDKKVLLAL
FT                   SGGVDSSVCAALLSRAIGKNLTCVFVDHGLMRKNEGDEVEAAFKNDELNFVRVNAKDRF
FT                   LNKLKGVSDPEQKRKIIGEEFIRVFEDEAKKIGSVDFLAQGTIYPDVIESGQGDASVIK
FT                   SHHNVGGLPDVVDFKDLIEPLRDLFKDEVRRLGLELEMPEYLVYRQPFPGPGLGIRVMG
FT                   EITEEKLEVLREADFIFRDEVAKAGIDKDINQYFAVITNNRTVGVMGDFRTYDYTLALR
FT                   AVTTTDFMTADWARIPYEVLDKTSVRIINEVDHINRIVYDITSKPPATIEWE"
FT   CDS_pept        365093..366928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0315"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07733"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0S8"
FT                   /protein_id="BAG07733.1"
FT                   /translation="MASEKTFCFITRNVIYGGYMSTSIEINKKSVKEFLDAGKKHRFVI
FT                   PEYQRPYAWGEEEVQTLFDDLVEYTQERIDSPYFLGTIVSYTNDEKEQEIIDGQQRITT
FT                   LCLLLRAIYTKIEKMDDTKERKNFISQIEPALWETDELSGEADKSKTLLESRVFESEYN
FT                   GILHNLLRTGVADKNARDNYSKNYLLCQNLIDEYAKDEPLTFYHMINNILNKAIVLPIK
FT                   ADSQDTALTIFSTLNDRGLPLSDADIFKAKIYNNIKEPEARDIFIQKWQEVSAGAEYAD
FT                   ESIQKLFYYYMFYLRAKGNDRKTTTPGLRKYYSSNNFLRLYDSELMDDLSAILNFWSVV
FT                   NNKEEIEGENWSCNFEILKVLDILTSYPNEFWKYPVITYYLRYKDSDSFEDKFLLFLRK
FT                   LFVNLCSRYIVTPTVNAVKQNILNLNSEIINSDEPKFEFKAVDQNIITEELKNPHRNVV
FT                   RMLLKLLAYDEDSQDELLPEKWEIEHILPRKWQDSYFPNSSEEEVNEIIEHLGNKIPFE
FT                   KRLNIVASNGYFEKKKALYKKSKIVMVQEFSQIHSNDWKLDQIRERDIRVSDRIMEIFD
FT                   SWTLDINNENETKLTEEDMKAIERVKSRGLEGYFK"
FT   CDS_pept        367882..369171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07734"
FT                   /db_xref="GOA:B0S3W0"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W0"
FT                   /protein_id="BAG07734.1"
FT                   /translation="MLSKIKLWFFNHKNFLRMSRFLILTVSLLLVTWIFDHQYISFKSY
FT                   IPKQLLLSVEVSVDFLSNISGIFLTISTFCFTIIVTVLNKYSSSISPRLLQSFIDRTGV
FT                   LGLYGIFVSGFFYSVISILLLQDIAPDQHVVAGSLGIAYSIIAMLSFIAFSRQVLDNLK
FT                   VSNIIENIFNDCEKLIDKEVELREKAKHYEESDESTKLSIVAESSGYLFEIKADEIFKD
FT                   LNGIKAELVINKRIGEYTTKGESVGELNIFQCELDDNDKKELIEKLSPLFLINAYNNRE
FT                   EDYHRGIVNLTEIANMALSPGTNDPNTAIMCINKMSSLLGKLLSAGNHFIIMKEDEDVK
FT                   IIYQSYSVEDELYLGFSQIISYSAGDPLVTKEILQGIFIIYTMADISAKKSIKKFFDDS
FT                   YEILIENFTHEIHLDSFKRIKNNMEEHVSL"
FT   CDS_pept        369724..371034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0317"
FT                   /product="aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07735"
FT                   /db_xref="GOA:B0S3W1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W1"
FT                   /protein_id="BAG07735.1"
FT                   /translation="MKVVKFGGSSLADANQLKKVKDIIMNDDARKFIVVSAPGKGVNNK
FT                   HKVTDLLAMCHELSAHDLNFNEVFEIIENIYKNIVDDLVLNIDIDKILSDVKKEITNGA
FT                   SYDFVVSRGEFMSAKVLAAYLDYDFVDAKDLIVFDDGELDIVKSHENIKNILTKHDRAV
FT                   VPGFYGVDEYNNVHTFSRGGSDVTGSVIAASLDCEMYENFTDVSGFLVADPRIVKNPKP
FT                   MGTITYHELRELSYMGAKVLHEEAIFPLRDKNIPINIKNTNAPDEAGTLILSKCDVKNK
FT                   NIVTGISGKKDFTVINLEKVNMNTEKDFFRKLTTVFESNDILIEHMPSSIDSVSVLVSD
FT                   SSITPKLNKVLEELKIYLDVDKISWERDISLIAVVGRGMINEKGVSSSTFTALAKEGVN
FT                   IKMISQGSSEINIIIGVETKDFEKAIRSIYKEFYKED"
FT   CDS_pept        371035..372009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0318"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07736"
FT                   /db_xref="GOA:B0S3W2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W2"
FT                   /protein_id="BAG07736.1"
FT                   /translation="MKVNVAVVGATGLVGSMMLKVLSEKNFPIDKLYLFSSKKSAGSEV
FT                   EYCGKKYTVEELNENSFEGKDIKIALFSAGGSVSEKYAPIAAKAGVTVIDNSSHFRMNP
FT                   DVPLVVPEINPEDIKTNKGIIANPNCSTIQSVLPLKPIHDKYKIKRVIYSTYQSVSGSG
FT                   VKGISDLEEGTQLAYKYPIRNNCIPQIDVFMDNGYTKEEMKMIDETKKILHDDIRVTAT
FT                   TVRVPVKTSHSVSINVETEKPFEIEDVKKIIADYPGMDLQDDIENEIYPMAITSAGKNE
FT                   VFVGRIRRDFTVDNGLNLWCCADNIRKGAATNAVQIALKVLEG"
FT   CDS_pept        372011..373192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0319"
FT                   /product="homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07737"
FT                   /db_xref="GOA:B0S3W3"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W3"
FT                   /protein_id="BAG07737.1"
FT                   /translation="MKIAIMGFGTVGCGVEEILYKKRKSLIKNNFDIQIDKILIKNTDK
FT                   QRFPHQKDLVFTDDFDEVLNSDVDTVIDVTSSLEETHERIVALMNAGKNIVTANKAVVS
FT                   KYFEELNELAVKNDVYFSYEASVAGAIPVIHPIMEEIFFSDMNKIYGILNGTSNYILSK
FT                   METEGLSYDEVLKKAQDLGYAEADPTADVGGLDAMRKIRIVSSLIYNSKINEEDIFTFG
FT                   ISNVTKTDFEFAKNLGYSIRLLAKCALEANNINISVIPTFVADDFFAKTFEGTNAIKVW
FT                   GENFNSYEFKGPGAGKLETADAIMRDLLRILAKREIKTFYDATNSFEVENNIKHKFYIR
FT                   TTEVTDGLKNIIDREKTSGENHMIVTKKVSLDELTSAIEKFDQVFISEIEEEK"
FT   CDS_pept        373189..375483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0320"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07738"
FT                   /db_xref="GOA:B0S3W4"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W4"
FT                   /protein_id="BAG07738.1"
FT                   /translation="MRYLSTRNSNLKVSSREAILKGISEDGGLYVPESFPKFDILDHLD
FT                   LSYTQLCHAILSLYLTDFVSDELLEIIEKSYASFEQDICKVAYHKDYYLELYHGRTSAF
FT                   KDFALCLLPNLMIYAKKSLGINEKTLILTATSGDTGKAALEGFYNTENIDILVLYPTEG
FT                   VSCIQKAQMDTTSSLNSKVISIDGNFDDAQTAAKKIFNDKDIKEELKNQNICLSSANSI
FT                   NIGRLLPQIVYYFYAYQDLVNNKKISAGDKISFCVPTGNFGDILAGYYAKEMGLPIEKL
FT                   VIASNDNNVLTDFFTTGTYDANRDLVKTISPSMDILVSSNLERLIYHKSSDEIVKQKMT
FT                   ELNESKIFTFEGDFHEFKCGYATENETRNTIKEVFEDEGYLIDTHTAVAKNITDKLGLD
FT                   KTVILSTASPYKFSSTVLSALGENISSDEFENIDLLYEKTGAKIPTEIKKLHSKKIIHK
FT                   TKITKDKIEDEVLKFAKRGKRISVPATSANIGPGFDALGVALDLANTCEFKLTDDENTF
FT                   EKNVESNLIYKSYKYTFDFYGEKIVPVEFDLDTNIPMSRGLGSSAACIVMGIMAAFSVM
FT                   GKNPDEKEILKIATQIEGHPDNVAPAIFADAVASILKDDEVFVEKFEISDKFKFLAIIS
FT                   DFELSTQKAREVLPENYTKNDAVFNISRVSMLVLSLISGNEDNLKIALEDKIHEPYRLQ
FT                   LIPEIEKIDEIIENSDAIGHYLSGAGSTIMIILKSDDTTSESEIRNKLNKLSNSYEVMQ
FT                   LDIDKKGAFII"
FT   CDS_pept        375620..378151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0321"
FT                   /product="magnesium-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07739"
FT                   /db_xref="GOA:B0S3W5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W5"
FT                   /protein_id="BAG07739.1"
FT                   /translation="MEKFWSYDVDEVLKTIETSKNGLSTEQANERIEKLGQNLFEEKKS
FT                   SSKLMVFINQFKNPITMILIFAAILSIFLKDYSDGIIILIIIMISAILSYNHESKANDA
FT                   VKKLLSTVSVTSAVLRDGKFQELDNSKLTIGDIISVKTGDMIPADCLLIEENSLSMDES
FT                   SLTGETFPVEKNEEKLEEKTALSQRKNSLWMGTHVISGSGKAVIVNLAKDSEFGKITES
FT                   LDETETDTDFERGIKDFGNLILQVTTILIGLIFLFNIILNKPFLESFMFALALSVGLTP
FT                   QMLPAIISVNLSQGAKRMSAQGVIVKKLNSIENFGSMTVMCSDKTGTITKGQVKLESAM
FT                   DNTGKKSETLVKLAAINSYFQEGYTNPIDQAILDENKNDFTKYEKLFEIPYSFENKLLS
FT                   VIVNTNNDLSDENIMITKGALTSVINVCSTYQDDSGNSGNIEEIKSEIMDLFEKYSSQG
FT                   YRILGLAYNHIDQTTDASKQKAEDMIFRGLLLFIDPLKDDIKDVIEQMNSLGVSLKMIT
FT                   GDNHLIAKNIGSKVGLNPDKILLGEDLNSYSLSQLNKKIMDIDIFAEISPNQKEKIILA
FT                   YKQAGEIVGYMGDGINDAPAIKQADVGISVDTAADTAKDAASIVLLENSLKVLVSGIKE
FT                   GRRTFINTLKYIFVATSANFGNMFSMAGASLFLKFLPLLPKQILLTNLFTDFPSLQIAS
FT                   DSVDEDWLQSPVTWDMKFIKRFMIIFGITSSVFDYITFVVLLLLFKANEQFFQTGWMLE
FT                   SVISAMVVMLIVRTKRPVIKSKPSKKLMVAIILVAVFLIAIIYSPINTYLGLIALPVQA
FT                   LLSMLAISLIYALTAEILKKQFYKHNSFSRK"
FT   CDS_pept        378380..378910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0322"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07740"
FT                   /db_xref="GOA:B0S3W6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W6"
FT                   /protein_id="BAG07740.1"
FT                   /translation="MKMLNENIKSLRKQNGLSQEQLANEMHVVRQTVSKWERGLSVPDS
FT                   DSLIKLSEILQTSVSVLLGENVEETEQSELDKISEKLEEINMQFFENKQKKIKVYRNIF
FT                   IVIDALIVVVFLALLFMKSSYLQWDTTDSNTAVMKFILQSFEWGFVRIAPLLLVICTIC
FT                   AYVFNKKLKSMVV"
FT   CDS_pept        378952..380241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0323"
FT                   /product="putative carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07741"
FT                   /db_xref="GOA:B0S3W7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W7"
FT                   /protein_id="BAG07741.1"
FT                   /translation="MLGFFTYFVFKIYILKMDNFSSKKGIYTTMKGELLMNYEKLFSLI
FT                   DSKKDDMFNDRRWLHEHPELSYEEKETSEYIYKHYENNKNVKVEKNIGGYGVKVTIDSG
FT                   KPGKTVALRADFDALPITEDTGLDYASKNKGVMHACGHDAHTAYMMTLADCLVEMKDDF
FT                   SGKIVIIHQPAEEMPPGGSSFMIKDGVLDGVDNIFGCHVMSQLDFGKVYYHKGPTQQAR
FT                   AKFVATVKGTGGHGAAPHEANDAIVIASNLVMSLQTIVSRRLNPMTPGVVTIGSFDGKG
FT                   QFNIIKDSVTLEGDVRCMSDDARVLIEKEVRNICEGLAKAYSCEIELDYKNDYPVLMND
FT                   DEMTQLVVDAVKEAKIPEVVGVEDCGPQAQSEDFSYYSQKIPASFFYIGAKPDGKAYPH
FT                   HHPKFTINEDSMIIAAKAMGAVALKYLNEK"
FT   CDS_pept        380257..381189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0324"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07742"
FT                   /db_xref="GOA:B0S3W8"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W8"
FT                   /protein_id="BAG07742.1"
FT                   /translation="MKIIKKIPGGTLLVPMMISALINTFFPNLFKIGGVTESFFGPSSL
FT                   GFILGATIFISGCTVKLSTIKSVVKIYGLLIIVRTAVAALFTILFFKFFGMKGILGISL
FT                   IGFICTITSLNPSLFLAIMEDCGDEVDMSAFGFISLFATPAIAMLIFGISQPTNVDYMS
FT                   IVSLIIPLVLGVAIGNLDKDLGKFISTGMPFMIFALGWSVGNSINLFEAVKAGFSGVIM
FT                   AVIYYILIFLPMLFVERKVLKRDGVSAGGLSTIAGLSASIPMIMAANDPSLTVYAPRAA
FT                   AIVTFGVIISSFVSPFLCNKLYTGEKKKK"
FT   CDS_pept        complement(381607..381849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07743"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3W9"
FT                   /protein_id="BAG07743.1"
FT                   /translation="MSKLNKSYFQTLKGKNVVFKEVKFGEDISVQIVKNFPDFKVQVLK
FT                   SRSFIKDTIKVKFVEHFPDVKIQVVDNFGDFSIYI"
FT   CDS_pept        complement(381920..383170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07744"
FT                   /db_xref="InterPro:IPR029470"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X0"
FT                   /protein_id="BAG07744.1"
FT                   /translation="MKKFFYELKLIYNKYKLLDEMKSDFNIFFQLLNPYDEVNLHSKLI
FT                   YSILNDCKFKKEFMLSFLKITGIISSDNINPSDLKIIDVEREKSFSNGRLDLFISCKIK
FT                   DKNYVIIIENKIFARDQYEQMDRYIEFANNRQADIKKVFYLTLLGNAPSEDSASNLDQI
FT                   NLISYDDEILTWIENCIKISAREPALKEVLIQYADLLEKITGKDVDYTMDVMNFLLESP
FT                   ENFNMANSIQPAIIDAKTDLQMRFWTKLEESLDEMFKNFPDLNYRKTDRDEDLGSLNPW
FT                   YSKTIIKNYYNNMRNSSCYGVMYYLYNKDDLGDLCFKIEYNKYDSLFYGLTFQAPGVNK
FT                   DKLKSAIELKKKLESYDYKSSTGWFTWKYLKVNEKYFNFMNMDPDIVYILMNNDELNDL
FT                   IKKITKEVETFIHIILD"
FT   CDS_pept        383478..383657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0327"
FT                   /product="putative type I site-specific deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07745"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X1"
FT                   /protein_id="BAG07745.1"
FT                   /translation="MQQGFRDLEQSDPAYENLFEDIYLYSKKIRPAPQRQNEIISKIML
FT                   TLAHLTLQKQMETS"
FT   CDS_pept        383675..383902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0328"
FT                   /product="putative type I site-specific deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07746"
FT                   /db_xref="GOA:B0S3X2"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X2"
FT                   /protein_id="BAG07746.1"
FT                   /translation="MISNYASNAGKSGGEFFTPQTVSKLLAKLVMDGKTSIKKVYDLTC
FT                   EERVIIVMGAVCANKSTVSGTLTKYISYIA"
FT   CDS_pept        384130..384657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0329"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07747"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X3"
FT                   /protein_id="BAG07747.1"
FT                   /translation="MKYKQIFNSGVTFQQFYDTAQDRYKNYANNAIRNYLNLERYLEKV
FT                   SSITSKFNILAIGENWCIDSIINIPVVHWLEKNNENIKLKVIDTDSYSKFMPNEKVITP
FT                   TFIIMNQEYQEIGKWVQYPKRIIDVVESKDQVRVIVEKRRYRQGEYIVDTLKEVLDILI
FT                   NYRNNIYLGRRK"
FT   CDS_pept        384722..385159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07748"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR040890"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X4"
FT                   /protein_id="BAG07748.1"
FT                   /translation="MKEKENCPKCYEIGEKVKNITVKHMVSENLRGKVVDEETYYLCMN
FT                   EDCDVVYYNLNNERVFYKEEVKVPIWFKKNANPKYICYCNQVTEQQIINAVLDDGAKNI
FT                   KDIIRLTGAMKNGKCEIKNPLGKCCGPLIQETINKALNSKE"
FT   CDS_pept        385249..386145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07749"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X5"
FT                   /protein_id="BAG07749.1"
FT                   /translation="MCFRDLEKATEDAIKTFGDENSVNIILEKSYEEYMEGFTDEETGK
FT                   VTRGYKDICNEIVAKFPDTTEIFLEADKKEFVQLFGELLKSENILKNFDEFESFDKIIS
FT                   DRLMQDMKSVYVDIRENIVNSRCSGDSEEQQVDFSDVEFQIDLLKTDEINLDYILALIL
FT                   EKSKEHEDVENLKAEVRRVIRSSLGTRAKEDLVMDFINKTRLSELKDNDDILETFYSFA
FT                   RKEKEKKVESLIEDEKLKEGAYHFINKSIAKGFVDYAGTGLDKILPPTSRRHGAREKKK
FT                   QNILEKIEKIVEVFVGI"
FT   CDS_pept        386306..386767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0332"
FT                   /product="transcriptional regulator CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07750"
FT                   /db_xref="GOA:B0S3X6"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X6"
FT                   /protein_id="BAG07750.1"
FT                   /translation="MAGLSNSIEAFLKELLSNTDDDFIEIGRNDLANQFNCAPSQINYV
FT                   LTTRFTPYKGYYIESRRGGSGYVKIIKLTIKDSNPIKEIVENVIGDRITKDKSNNIINM
FT                   LLDEDLITEREALVMVHALEDNTLSKVDFNDRNILRADLLKNMLLAFMR"
FT   CDS_pept        386778..387377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07751"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X7"
FT                   /protein_id="BAG07751.1"
FT                   /translation="MNCDNCGKPAFIQVKIVGPFGARDVNLCHDCYEEYMNNLKNEIIS
FT                   NSDFKFDSDKQLNDNNELFEEIAKQISDVVEHLPFEKVQQSSNKKDEDKSVCPVCNMPF
FT                   DELKNYSSIGCKYCYDHFRDFIMDKRNSKSYSKYYRGKFPKNFEKAKEILEKLDSLSDE
FT                   LFIAMDKEEFEKCHDIQMKIDDLELKLQEYREKCYE"
FT   CDS_pept        387370..388365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0334"
FT                   /product="guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07752"
FT                   /db_xref="GOA:B0S3X8"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X8"
FT                   /protein_id="BAG07752.1"
FT                   /translation="MNNSSVVMKSDVSLRRNLSDYNFMLVIDTDSCDDMKSDIKKELNN
FT                   LGYLKESSVYSFKDTKSTNRDYLRKQGYISSAYYEDVSPEVIINSDEKCVFTLADNDHI
FT                   CITAYDFGKNLRDIYEKCLNIEEKLNDKLNFAFDIDFGYLSDDFYDSGCMMNVSVCMNL
FT                   KALEYFKKIDDIQDVARYRGYMFERAFNSNTKSSIYRLTTNGHLTDPEYIINDMTLLID
FT                   SISRKEMENRRILFENNPEFKDDLLRSVSMLKYSRVLDEIEGMNKIGDLLIAMDFGMVD
FT                   GFDVDEILDLYDKTNKLKLEKFRENNNLNQNIGVLRSEIIKDTLERQVKN"
FT   CDS_pept        388362..390782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0335"
FT                   /product="ATP-dependent protease Clp ATP-binding subunit
FT                   ClpC"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07753"
FT                   /db_xref="GOA:B0S3X9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3X9"
FT                   /protein_id="BAG07753.1"
FT                   /translation="MRKSDIYNLRTEAVYEAISLKHADLGVEHVLLAMFKFDFKASQYL
FT                   KKHGGNYEKIRNLIIDELGYGDSDETNQRISPKLEEIITQAVQLSNTYGERTITPEHIM
FT                   AALCLDSSNYANHLMKRTGVDIMKLTAELRKYFFMKMKRERGDVNDNSANSSKPNEIEK
FT                   YTKNLNEMAKEGKIDPCIGREEEIERIIQVLLRRKKNNPVLIGNPGVGKTAIVEGLAVK
FT                   IVKGDVNDIFKDKEILSLDLAALLAGTKYRGDFEERIKKVIDTLSNSENKILFIDELHS
FT                   LMGAGGAEGALDASNILKPSLARGDLQIIGATTINEYRKTIEKDQAFERRLQTIMVDEP
FT                   SVSDSIQVIEGLKDKYESHHHVLISDEAIKASVELSHRYLNDRYLPDKAIDLIDEAQSM
FT                   VRVKNFTGGKNYAKILEELEEEKQEAIQNSDFLLAAEKRDAIKEVEAEMEEEDQDENKL
FT                   EIGFDEIANIVSRWAKVPVSKLTESESQKYLFLADNLKKVVIGQDKAIDSISNAIKRAR
FT                   VGLKNPNKPIGSFVFVGPTGVGKTYLAKKLAKELFNDENAMIRIDMTEYMEKHSVSKLI
FT                   GSPPGYVGHDDGGQLTDMVRTKPYSVILFDEIEKAHPDVFNTLLQVLDDGRLTDSKGRV
FT                   VNFKDTVIIMTSNIGASELESKNVIGFNTAEDVEVDEYNRNKETINNAMKSMFKPEFMN
FT                   RLDDVIVFSNLNKENVKEIAGLMMDELVDRMAKNDLIISYDEKILDYLVDKGYDKKFGA
FT                   RPLERLIRTDIENELADKILNGDIDNNRKTTITVVNDKVSFRRYVRRKKTVKQ"
FT   CDS_pept        390784..392145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0336"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07754"
FT                   /db_xref="GOA:B0S3Y0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Y0"
FT                   /protein_id="BAG07754.1"
FT                   /translation="MKKKTKYVCKNCGYEQAMWIGKCPSCNSWGSMQEQEIVDEKSNTT
FT                   TTSSTKSSKAVKLVDVKIDSSERIQSSITELNRVFGGGLVRDSVSILTARPGAGKSTLL
FT                   LELANDLASKNIKVLYISGEESTSQIKQRAMRTMEKIPENIWLISTTSMDNALDSIDKI
FT                   KPDVIFLDSIQTFQLREYTSRPGSPVQTDECANKIVEICKNPEKPTLAIMVGHMTKSDE
FT                   MAGLRTLEHLVDTVLYLEGESDDPLRLLTTTKNRFGRTGEIGLFNMQEDGIKEITDASD
FT                   YFVTKRKKDVNGAALSVIKEGSRILVVEVEALVSKSFTPYPQRIGDSLRKDQLNTLISI
FT                   LEERAGMNMYDKNVIIKTTGGIKIQEQSVNLSIIMAIASSLMNKPIPSDVVFIGEVGLT
FT                   GEIKRVPQIETRLKEIERLGYKKVYISQNTKLTQKYDLEIKQFDSIRSVISDIF"
FT   CDS_pept        complement(392174..392479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07755"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Y1"
FT                   /protein_id="BAG07755.1"
FT                   /translation="MKRNKLLVILLCTVMMFSFTMCKNQSMNTYNSYSERYGIGSDDDL
FT                   KKAMQSMKENEDYPIYKDGKEESKIHRQYLLDLYEKNDLSAIKAYIDNNKLLLGKN"
FT   CDS_pept        complement(392580..394265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0338"
FT                   /product="oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07756"
FT                   /db_xref="InterPro:IPR011976"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Z9"
FT                   /protein_id="BAG07756.1"
FT                   /translation="MKFTEYKYTRPNFEEDKKKVEDLIKRFNDSTTSDEQIKIMEEMDK
FT                   YKKTLSTNSNLAYIRHTIDTNDEFYKEEQDFLDEYMPHYSVLDTKMYEAINNSKFKDEL
FT                   VKHFGQHLFDLISCQLIFNEKAVPFKQKENQLTTKYNKLIASAQIEFDNKTLTLSQMAP
FT                   YTQSKDRDERKAATRKISEFFAEHEKEIDDIYDEMVHVRTDMAKALGFDSYIEYQYKSL
FT                   MRTDYDKNDVAKYREFVKKYVTPVYLELRKKQSKRIGIEDMKAYDNNVMFTDGNAKPHG
FT                   GKDFLVDNAKKMYSELSSETKKFFDFMYERELFDLESKKGKEGGGYCTTIEDYESPFIF
FT                   ANFNGTTHDVEVMTHEAGHAFQAYTSMDGRIFEYIWPTFEACEIHSMSMEFLTWPWMEL
FT                   FFEEETNKFKFSHLDGAISFIPYGVTIDHFQHFVYENPDATAEERKAKYHEIELMYRPN
FT                   LDYDDEFLEKGTWWYRQGHIFNNPFYYIDYTLAQVCAFQFLLKSRKNREEAFKDYLEIC
FT                   KVGGSQSFFGIMKSGNIKNPMNDGVLEEILPQLLEILDEIEKEL"
FT   CDS_pept        394380..395192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0339"
FT                   /product="dinitrogenase reductase activating
FT                   glycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07757"
FT                   /db_xref="GOA:B0S400"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B0S400"
FT                   /protein_id="BAG07757.1"
FT                   /translation="MNSDYKDRIKGALYAFAIGDSMGATTEFMTDVEISQKYDKITDIV
FT                   GGGWLDLKAGECTDDTDMSICVMNCLMKNDNDNFEKNTMKLFVEWYNTHPRDIGNQCRR
FT                   AIEHYIQYEIFIEEDDTALGNGSLMRALPCALLDNENSEELNIKQGKLTHNNDMCAEII
FT                   REYTQIIRDNINGKNHELKDTQLLKPSGYIVNTFNNAIHWAKENFVEDCIINAVNHGGD
FT                   SDTIAAIAGSISGSIHGYSTIPKRWIEKLDENVKEEIEKFVEYLENQI"
FT   CDS_pept        complement(395235..396395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0340"
FT                   /product="NADPH-dependent butanol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07758"
FT                   /db_xref="GOA:B0S401"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B0S401"
FT                   /protein_id="BAG07758.1"
FT                   /translation="MANGVLHIPGFIYFGEGTFSKLSELKGKKAIIVTGGNSMKKNGFV
FT                   DRACEELKNANMEVCVFDGVEENPSVKTVEEGAKKMQEFQPDWIIALGGGSAMDAAKCM
FT                   WAFYEHPELKFEDIIEPGSLPELRKKAKFVGIPSTSGTASEITAFSVITDTEKHIKYPL
FT                   VSDHIVPDIAIVDPVLPSKMPKSVTANTGMDVVAHATEALVSNIANDYTDALAIHALKL
FT                   VFEYLPKACENPDDMEAREKMHNASTMAGIAFTSASLGLVHSLAHKIGGEFGITHGLAN
FT                   AILLPYITQFNRKATNKVDWIEKELNVKDYPIAVRELAKKVGIPPTLKEVEEKFGFNKE
FT                   KFDAVLDEMSKNAYEDPCTLTNPRESNPEIVKMIYTHAYNGEDITE"
FT   CDS_pept        396624..396956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07759"
FT                   /db_xref="GOA:B0S402"
FT                   /db_xref="UniProtKB/TrEMBL:B0S402"
FT                   /protein_id="BAG07759.1"
FT                   /translation="MSEENKTKNVKKKIWIILIVVLIFLASCSALVFKSAGFQRFKKNV
FT                   KSEYSGGIKREIIIYNAEGKEIFKKEGKFDFTYDDKCIEYIDTQTNLKHNVFAGDNSTV
FT                   IINELK"
FT   CDS_pept        397466..397918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0342"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07760"
FT                   /db_xref="GOA:B0S403"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B0S403"
FT                   /protein_id="BAG07760.1"
FT                   /translation="MKIAIAADHGGFELKDSMVEYIKSLGNEVVDLGTNSADSVDYPDY
FT                   AKKVCEEIQKGNSDLGILICGTGIGMSLAANKFEGIRAACVSDVYSAKMSRNHNNANVL
FT                   CIGARVIGDEVAKLIIKTFLENEFEAGRHQRRVDKIMAFEKENKGL"
FT   CDS_pept        397920..400547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0343"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07761"
FT                   /db_xref="GOA:B0S404"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0S404"
FT                   /protein_id="BAG07761.1"
FT                   /translation="MSKKALIIDGSSLLFRGFYAIRDLTTKDGIHTNGVFGFMNMYYSV
FT                   MGKINPDLVVVCFDRKEPTFRHEKYSEYKGNRQETPEELIGQFDMLKELLKAMGVSYID
FT                   LKGYEADDIAGTLAKQASSKDYDVYLLTGDKDYLQLIDDNTKVVLTKRGITETKIYDVD
FT                   VLKEEYGITPKQMIDLKGLMGDKSDNIPGIDGVGEKTALKYIQKYGSIEGLYEHVDEIS
FT                   GKKTKQKVIDGEDIAYLSRELGTINTDVPEDLMGFGIEDCTIKEADNDHLIEVLTKLEF
FT                   NSFIKKLPNEESNEKFEYENLDEKVDEIKAYIKENKKFTFALFNDDYYVDNEPVIFAIY
FT                   TDKVYITRNVELVESFKEEFESKDINKLSFDIKPCIYHLMRYGIDISYNYDDVVIIEYL
FT                   LDPSKTSYSMERSDPKVIGYDFKPLEDITGKGKSKKTILESDEKEIDNYVVKYMMFTNK
FT                   LYEKISEIEEEDMMHLYRDVEIPLIKVLCDMEFTGVCVKKETLVEMGELFEDEIKSIEK
FT                   SVEELIGKKININSSKQLAEVLFEDLELPVIKKNKTGPSTDQEVLEALSGRHEIIDYIL
FT                   RYRTITKLKTTYIDGMVDLIKKDGKIHTTFQQTIAQTGRISSTNPNLQNIPIRTEEGRL
FT                   IRKAFVPSEGNMLLDADYSQIELRVLADLANDEVMLDAFKHGADIHRKTASEVFKVDFD
FT                   KVTSLQRSNAKAVNFGIVYGIGDYSLSKDLHITRKEAKEYIENYLDTYKGIKQYMEDIV
FT                   AIGKEKGYVETIMNRRRYIPELKSKNYNVRSFGERVALNTPIQGSAADIIKVAMVKFYN
FT                   RLNEEKLKAKLILQVHDELIVDCPKDEREKVLEIMKDVMTHAVDLKVDMKIDVNSADNW
FT                   YDAK"
FT   CDS_pept        400519..401142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0344"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07762"
FT                   /db_xref="GOA:B0S405"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S405"
FT                   /protein_id="BAG07762.1"
FT                   /translation="MQIIGMMQNKKIIVVCGNIASGKSTVCRRIREKGFVVIDLDEITH
FT                   QIYEQGTDLYYKLIDEFGKEILDENSDIDRKKLSKLVFNSKTLLKKLEELTHTDIILRV
FT                   VKRIKKEKSDLIFLEISMYLESKNLVDKYINVDEDWVVVADRDIRIQRIIDRNNFDYDT
FT                   AVTRINSQLDYEKKISEFDEVIVNNTTESDLILKVDELIDREKL"
FT   CDS_pept        401139..401780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0345"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07763"
FT                   /db_xref="GOA:B0S406"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B0S406"
FT                   /protein_id="BAG07763.1"
FT                   /translation="MKFIKRFLITIISIIVIVFLVGFGVSAYSTMTRPVKYVDLVNTYS
FT                   KEYNVDPLLVMSVIKVESNFDPSVKSKAGALGLMQLMPDTAESINNMRNTHFTVDDLKK
FT                   PDKNIEMGTAYLSYLLHHFKNHDLAIAAYNGGIGNVKEWLSNESFSKDGQTLDDIPSSE
FT                   TKYYVVKVENQYNIYKIFYEDTKLEENMHKSFKVWAKNYIKLIKNIINKY"
FT   tRNA            401809..401894
FT                   /locus_tag="FMG_tRNA15"
FT                   /product="tRNA-Leu"
FT   CDS_pept        401923..403251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0346"
FT                   /product="electron transport complex protein"
FT                   /note="RnfC/NqrF"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07764"
FT                   /db_xref="GOA:B0S407"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B0S407"
FT                   /protein_id="BAG07764.1"
FT                   /translation="MSLENLTFKGGFHMDDHKSYTQNCPLDTNFEPKMVYIPLHQHIGA
FT                   PCTPIVKVGDEVKVGQKIGESKATISAPVHSSVSGKVMKIEQMVLSNGQKGEVVVIESD
FT                   GLNELGYTETNDDFTQLSKEVILERIKEAGIVGLGGAGFPTHLKMNKKPDVKIEQVILN
FT                   GAECEPYLTSDQLNMELYPQKAIGGLKIIMKLMDCDKGYIGVEDNKQKAIGILKNAAKD
FT                   EKNISICSVKTKYPQGDERRLINAITGKKISKAQRSNERGVQGLNISSAMAIYDAVVHS
FT                   IPLTHRIVTMTGSAIKEPKNIYVPVGTKFKDLVDYCDGFKETPYKIVVGGPMMGACQYN
FT                   LEAPTVKTTGGIICMNEKDATLASPEPCIKCAKCVDVCPIGLLPLFLQLKSLNGDFEGA
FT                   EKMHLNDCIECGTCSYICPSNRPLVEAIVHAKTQLKAQQRKRG"
FT   CDS_pept        403255..404226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0347"
FT                   /product="electron transport complex protein"
FT                   /note="RnfD/NqrB"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07765"
FT                   /db_xref="GOA:B0S408"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:B0S408"
FT                   /protein_id="BAG07765.1"
FT                   /translation="MENKEIIQKEYDLSHLIVEAAPHQRSAVSIQRIMLDVIIALIPAL
FT                   IVSVYEFGMRSLVLVLSAVIACVLSEYCYQKIMKQPSTISDLSAVVTGMLLAYNVPVTL
FT                   PIPMIVIGSVFSIIIVKQLFGGIGSNFMNPALAGRAFLMASWAQAMSNYTAPLTQKAVD
FT                   AESYATVLSGGQPVGFMNAIIGHMGGTIGEVSAIALLIGVAYLLYRRVINLRIPLVYIA
FT                   TTFVTLLICGVGIQDAFMNIFIGGLILGAFYMATDYSTSPVTPKGQIIFAIGCGFFTAI
FT                   IRQFGNLPEGVSYAIIFMNCAVPFIDQYTVPTPIGRGGKQGI"
FT   CDS_pept        404223..404795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0348"
FT                   /product="electron transport complex protein"
FT                   /note="RnfG/NqrC"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07766"
FT                   /db_xref="GOA:B0S409"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:B0S409"
FT                   /protein_id="BAG07766.1"
FT                   /translation="MRSSINLAIRLFIITAISALVLAFANQVTEPIIEAKRLENYKKSL
FT                   KVAFPEAESFKPLDEAKIKDLKAKDENLDDVQEAIKGGKPVGHVYKAIGAGGYSGNVVF
FT                   VFGVNNENKIVGYSILESQETPGIGSRIGDPEFVNSVIGKSMEKEISAVKKPQADNEIQ
FT                   ALSGATYSTTAAKNALNVAQKANAGLK"
FT   CDS_pept        404806..405435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0349"
FT                   /product="electron transport complex protein"
FT                   /note="RnfE/NqrD"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07767"
FT                   /db_xref="GOA:B0S410"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:B0S410"
FT                   /protein_id="BAG07767.1"
FT                   /translation="MEKGKAAKVFKSSILKNNPVLIQLVGLCSVLGVSTSVENAIGMTA
FT                   AFAFVLICSNIVISLLRNFIPDKVRIPAYIVVIATFVTLVSMMLQAFVPALYSSLGAFV
FT                   PLIVVNCIILARAESFASKNGVFLSLLDGISNALGYGIVIVLVAFIRELLGSGKILGKL
FT                   VIGDIPPIGIMSAAPGAFIVLGILLATYNSFLSRQERKKNNMRGED"
FT   CDS_pept        405435..406016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0350"
FT                   /product="electron transport complex protein"
FT                   /note="RnfA/NqrE"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07768"
FT                   /db_xref="GOA:B0S411"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:B0S411"
FT                   /protein_id="BAG07768.1"
FT                   /translation="MLANVFKIIVLYLLVNNYVFGQFLGLCPLIGVSSKTETAIGMGMA
FT                   VFFVITIASVVTYVLQIQILERFHIEYLQTIVFILVIATLVQFVEMALKKMSPNLYSAL
FT                   GVFLPLITTNCIVLGVALANVKEKYNLIETLASAIGASLGFILAITLLAAIRERIAMNK
FT                   NIPESFKGVPIAFITIGLMAMTFFGFGGLV"
FT   CDS_pept        406027..406878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0351"
FT                   /product="electron transport complex protein"
FT                   /note="RnfB/polyferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07769"
FT                   /db_xref="GOA:B0S412"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0S412"
FT                   /protein_id="BAG07769.1"
FT                   /translation="MTILTPFIILGALGILFALLLGFASKKFEVQVDRRVLKVREMLPG
FT                   ANCGACGFPGCDGLADAIVNKGAPCNSCPVGGKETAEKLAAFMGADAVDSAKQVACVMC
FT                   QGTPEYATEKFKYKGIMDCRVNHNLQGGSKTCPDGCLGCGTCVDVCDFDAIHIVNGIAL
FT                   VDKEKCTSCKKCIEICPRNIIKLVDYDQDVYVRCNSHDKGKDVRQYCKVGCIACGICAK
FT                   MCPDGFSVEDNLAHFNNAEGLDPEQVQKAVDKCPTKAIYPGLKIKEEQAKAKAQEAAVK
FT                   EA"
FT   CDS_pept        407037..407738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07770"
FT                   /db_xref="GOA:B0S413"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:B0S413"
FT                   /protein_id="BAG07770.1"
FT                   /translation="MANKIKEQSMGEYLVFIGILIIVVGFALKLDVLGIVLLAGLVTGL
FT                   AGGLGLAGTLKIMGEGFVNNRLMSLFLISFPVIAIMERYGLKEKARDFISKFKMASAAS
FT                   VLWIYLFIRWIAAAFSLRLGGHVQFIRPLILPMAEGAARKKVDLTEVRLDELKGLAAAV
FT                   ENYGNFYGQNIFPLASGVLLMQTTLKDAGFPLDTAEIAKWSIFAGVSMLIIALIQCAVF
FT                   EMKLRKDMKNA"
FT   CDS_pept        407731..408717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07771"
FT                   /db_xref="GOA:B0S414"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:B0S414"
FT                   /protein_id="BAG07771.1"
FT                   /translation="MLDFFVDNKIALDEIAYILCGIICIMTGIRARLNKEAKIGTMIFW
FT                   ILLGILFAGGGFLVRHVESGGIIVGVILLLLGVLSIANQIKPGEFKELTEEEREKNAEK
FT                   VGGKIFIPALVMGISAMLLSQLKSFKIPLKNSDAVFSLSAAQVLTISSLLALIIAIIIA
FT                   KPKAKETAEDTTKMLMQVGSSSLLPQLLGGLGVIFASAGVGKLIGSLASGIVGDAGVFA
FT                   AAVAYIVGMVIFTMIMGNAFAAFTVITLGIGVPLLMAKGANPAIVASLGMTAGYCGTLM
FT                   TPMAANFNIVPAAILEMKDKNGVIKAQLPVALALIVVHVVLLMILAF"
FT   CDS_pept        408729..409370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0354"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07772"
FT                   /db_xref="GOA:B0S415"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S415"
FT                   /protein_id="BAG07772.1"
FT                   /translation="MKILVSGFDPFGGEKINPAIESVKLLPDSIKGNEIIKIEIPTVIG
FT                   KSVDKLKEKIKEVKPDVVISVGQAGGREDITVERVAINVDDCRIKDNEGNQPIDEKIAE
FT                   DGPDAYLLTLPIKAMVENIKSANIPASVSNTAGTFICNHVAYGMAHVRATEYPNMRTGF
FT                   IHIPFLPEQVLNKPHTASMNLDTIAKALEKAIEAVIDNDEDIKVTGGKTH"
FT   CDS_pept        409530..409907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07773"
FT                   /db_xref="GOA:B0S3Y2"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Y2"
FT                   /protein_id="BAG07773.1"
FT                   /translation="MTKYDKILIGFLLCFSAVLFVILNYNNVNSQDKYVSIQVNGKEIK
FT                   QITLPIDHYDYKIDNKYGHNIVHIHGYSVSITESDCPDKLCMLKGKIDKPGDVIVCLPN
FT                   KLVVEIKANKQNKDDIDVVNY"
FT   CDS_pept        409904..410419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07774"
FT                   /db_xref="GOA:B0S3Y3"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Y3"
FT                   /protein_id="BAG07774.1"
FT                   /translation="MMKRLHIPILTAVALVVSLIESMIPLPIVMPGAKLGLSNIVILTC
FT                   LIVFGFRDSLVIGILKSFLLMLITGAVISFFYSLAGAVSSLVVMYLVNKYLRKYFSLIG
FT                   VSLFGAFIHNLSQVLVCAVMLNNLRILVYLPILVFLSIFTGVFVGLTSNYLTNALSKQK
FT                   NYLFNNRR"
FT   CDS_pept        410422..411093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0357"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07775"
FT                   /db_xref="GOA:B0S3Y4"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S3Y4"
FT                   /protein_id="BAG07775.1"
FT                   /translation="MRVKEMNESLRPREKMKINGISSMSDEELMQIILKTGIKEEGVEI
FT                   LSKRVIDYINENDYKDLCVEELMKIKGIGMAKATSILAGIEIGRRLSLRKAMDSFSLND
FT                   PDSVAEIFCNEIGSCDVENFYALLLDTKNRIISKELISKGTINQSIVHPREVFKSAIKK
FT                   GANSIILVHNHPSGSLIPSNADIEVTKRLDKVGDLVGIQVLDHIIVSSNDSLSMRKGMY
FT                   F"
FT   CDS_pept        411094..412089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0358"
FT                   /product="cell-shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07776"
FT                   /db_xref="GOA:B0S3Y5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Y5"
FT                   /protein_id="BAG07776.1"
FT                   /translation="MKLFKFQQEGLGIDLGTSNSIISDENGKIIINEPSVVAIDINNYD
FT                   IVAVGTEAKSMIGKTPDNIVAISPIENGVIADFESTVSMLSYFIKKARPNFSVFQPEVC
FT                   VSVSASLTDVERRSVEDLALNAGARSVKLVEENIASLKGLGVDVDEPTGHIILNIGAGT
FT                   IEASVISLGGIVTSYCIKSGGEDIDQEIKQILKKKFGVNIGISTAEAIKFKIATLNSDR
FT                   ENNTMIVGGTDVISTMPKSVEIRAKDITPAIVPIADMCIEALRKVLEKTPPDIANDIIA
FT                   EGIYIVGGVSLVDYIHEYITNVLGIKVLKVDSPMDCTGIGIGKFLKKGDK"
FT   CDS_pept        412090..412944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0359"
FT                   /product="cell-shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07777"
FT                   /db_xref="GOA:B0S3Y6"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Y6"
FT                   /protein_id="BAG07777.1"
FT                   /translation="MAKFGYNKKLRKQVFFFVVTLFLVLTITISNHNKSYMSIGENAIG
FT                   TVITPVNKVFYVIGSKFKESVHYVFGTKKMREDNKRLTVENAKLRKNVDNLNKVISDKR
FT                   YLQEEYELLSKDRTIKTKAFITGKDPGNIFTRFSIDKGSMDKIKKGDIVIEAVSSNDGI
FT                   EKGLVGVVTEVGLNHSKVDTIMNSGNNVGFRLAKSEDVGILNEKEKDILKGYMYDSNAD
FT                   VKVGDVLTTSGLGGVYPRDIKIGEVTEVIKTKDNFTKIVKCKSQINFNNMYRVLIVDGQ
FT                   GVN"
FT   CDS_pept        412945..413436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0360"
FT                   /product="putative cell-shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07778"
FT                   /db_xref="GOA:B0S3Y7"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Y7"
FT                   /protein_id="BAG07778.1"
FT                   /translation="MNKLKIFLIVLLDIIIQATLLSRISVFNVYTNISIPIVVLLSIGF
FT                   GAYTGSLNGMIIGLIEDAIFSPVIGVRALIYFTSGFLIGNSEAGINKEDPRSGMILTFF
FT                   VTLYYTLVHYFVLYITGNGFNKAYLKGPILIEMILNVLLYYVLFRLFKKIFKFPKFKFI
FT                   "
FT   CDS_pept        413445..416771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0361"
FT                   /product="putative penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07779"
FT                   /db_xref="GOA:B0S3Y8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Y8"
FT                   /protein_id="BAG07779.1"
FT                   /translation="MKKFDNKFLKKLEKYDRFTIIIVILAIMMAVLCLKLMHLTLVKGS
FT                   YYRDIAKNNRLREIKIPAPRGNIYDRNGELLATTKNVYVANLYKDQIKQMKIDDSNDAL
FT                   LNLSRILEKDGSMNTEDFPIALNAFTYRNTDDYLKEDKSPLDKVASIVMDKNIMANLID
FT                   KSYTQETNQGIYKKTVLDYCLNALRSKGLTLKLNRKDNTKFDTNDKETVKLLKKHGLKE
FT                   TSDVKSAISTIIQKDKSIIRKLLNDSVIRSMVYNELEKENLQDNIVLKDMELKDNQKLL
FT                   EKKVEMMKLSNKIDFKTEAADDFVNIVKDNTMVELLKKVDVEDDKKTIVLEKALNLLKK
FT                   NGIQTNVEYSLDEKDKKNPQVKAKFVTESKKSTDPYKHVADLLNSNNLAYKFITDDDIK
FT                   LIAQSVNTENNINPSISVNDWKYIYQKNMEDFYKSYDKEMNSDVKLLYEEILKKNKCEK
FT                   FSKYDAYNIVSIYNQLKNKGQKGYEPIALSYNLTEESVSSIEEKFGKNQGIEVATRPVR
FT                   YYPNGEELSHVLGYIGKISTEKEIEEYVKQKGYSKDSLIGKTGIEESKEDALKGQDGSL
FT                   RVMVDSKGNRTETLSEKKAIPGDNVYLSIDTNVQRVAEESLKKSIKAVSTGGTYVSEWG
FT                   DKTLAGYKNAKSGAAVAVDVETGEILAMASFPSYNPNLFSTGISQTDWESLQAEDPKDP
FT                   ISPRPLYNIPMQAAMQPGSIFKLNTSLAALEGGFDPYHEIKCGGYVDVGGSIFGCWIWN
FT                   EHKGTHGSDNVMKALRDSCNYYFYSLALGKDQRRSKDLGYQLSIDELVSTARKLGLGSK
FT                   TGIDINIPAENSGTVPDPQIKENNFKAIFRRFLEKNAEKYVKEGEVFTPKEMKSKIDKI
FT                   VLLADDKNLQTRTNIIKTLDSLGFDPEKKLDGERNSFSDKIKFDYLNQSKWNIGDMLNV
FT                   VIGQGQNAYTPLQMARYISAFANNGYLNKLSLVNEIKSNDNSTSLFKNAKKSERIKLKN
FT                   YENLEYIRKGLHLATTEGYEKNTFRNFPVSAGVKTGTAQVGVNPVTGETYDNHAWMIGF
FT                   APVENPKVAVVTVIMQGGTSTNNGPMTRDIMAEALKLKHDKDKKQENTESENDMYENST
FT                   R"
FT   CDS_pept        416743..417348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0362"
FT                   /product="putative cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07780"
FT                   /db_xref="GOA:B0S3Y9"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Y9"
FT                   /protein_id="BAG07780.1"
FT                   /translation="MICMKTVLVNSQLQKKALLIQSLCNLLDGKILIVNSENSRQIEYA
FT                   LGVEDYCVYDTLDVLSQVVDYKKSMIKIKEDKYIIPSTIKPEKYSATKEDYKNLLDNLC
FT                   EFDIVIFTENIGIEFDEEIMWGNEEKSHAKKLFQISDSSSKRKSDYKYIGKLEFTKEYE
FT                   KKINSYSEDVDEKLTEIIQNYKQDKEAKIGFFDRIFKR"
FT   CDS_pept        417345..418349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0363"
FT                   /product="ribonucleases G"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07781"
FT                   /db_xref="GOA:B0S3Z0"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Z0"
FT                   /protein_id="BAG07781.1"
FT                   /translation="MKYLFIDKNTWGYYDDELKLLGDYDSELGNIYVAKITKYDKKLDA
FT                   FFIEYDKKKTGFLNNTSFTQDLKPSDEILVQMTKESIGDKYPKFTTKITIETENLKYTN
FT                   GDKLTFEGKQKYKDIDDFKQKYTFTGIVGENFFKQEKAQQEKEMNFILNNLHYIETEKK
FT                   FLPIPKLLYKKNPVDKIIQEENVDYLITNDKIVYRQYKEILNVKFDENYNYNYDNLISR
FT                   DIIDKNSEIIKLDNNAEIVIQKTEAMWVVDVNSSQMIVGENYFHELNTKALKKIHQMMY
FT                   LKKMVGMVIVDCVREGDNKKLSDFIKYEFCEPNINFHGFSNLNLLEFTVKLDK"
FT   CDS_pept        418455..418763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0364"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07782"
FT                   /db_xref="GOA:B0S3Z1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S3Z1"
FT                   /protein_id="BAG07782.1"
FT                   /translation="MFAIIKTGGKQYKVSEGDIIKVEKIEAEAGDKIEFDQVLMVAGDD
FT                   VKVGSPVVEGAKVSAEVLDQKKDKKIVIFKFKAKKNYRKKKGHRQPYTLVKIEKIDA"
FT   CDS_pept        418856..419104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07783"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="InterPro:IPR036764"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Z2"
FT                   /protein_id="BAG07783.1"
FT                   /translation="MCSAISVYLINTVNTFTEILKLGCDKLKFHFESGDASFEINYDLL
FT                   NETEMIQVDILMKSLLFALESIRNENIKHLKINYREV"
FT   CDS_pept        419104..419391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0366"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07784"
FT                   /db_xref="GOA:B0S3Z3"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Z3"
FT                   /protein_id="BAG07784.1"
FT                   /translation="MMIKLDLQLFSSKKGVSSTKNGRDSESKRLGTKKGDGQYVLAGNI
FT                   LVRQRGTKIHPGNNVGKGGDDTLFTKIDGVVKFERIGKNRKQVSVYPKEA"
FT   CDS_pept        419518..420783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0367"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07785"
FT                   /db_xref="GOA:B0S3Z4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S3Z4"
FT                   /protein_id="BAG07785.1"
FT                   /translation="MFIDVAKIELKAGKGGDGSVAFRREKYEPSGGPAGGDGGDGGSII
FT                   IVGDKDIKTLMDYSYRSIYKAESGGDGRNKKQFGKKGEDLILKVPVGTLVKDYDTDTVI
FT                   YDVKHDKEEFVICKGGKGGKGNVHFKSSIRQAPRFAEPGEKGEEKTIKLELKLLADVGL
FT                   IGLPNVGKSTLLSIMSNARPKIANYHFTTLEPNLGVCKVGEKSFVLADIPGLIEGASEG
FT                   LGLGHDFLKHIERTKILVHVLDISGSEGRNPIEDFELINSELSSYNIKLNDKKMLVVLN
FT                   KTDLGAEDNIKEFREKYSDKVDEIVEISAATTENVDKLMYLIADTLDSIEDDYSTLDEQ
FT                   YVYFEEEKEPDFKVRRENENYIVEGPLIENLIYRTNFEVYESVNHLQKVLEDKGVIQQL
FT                   KDLGIQDGDNVVIGDVEFDFYE"
FT   CDS_pept        420792..421082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07786"
FT                   /db_xref="GOA:B0S3Z5"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Z5"
FT                   /protein_id="BAG07786.1"
FT                   /translation="MITPKQRAKLKKISHGYKPLVNIGKGGISENTLKQIDDTLNKREV
FT                   MKIKILNNNLDDRDMLIDEILTKLDCEFVRYMGNILTIYRESENKVIDLDD"
FT   CDS_pept        421075..421674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0369"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07787"
FT                   /db_xref="GOA:B0S3Z6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Z6"
FT                   /protein_id="BAG07787.1"
FT                   /translation="MIKVGIMGGTFDPIHIGHLILAMEAINYKNLDEVWFIPTGNPNFK
FT                   QDKNVTDKKKRFEMVKIATQDNDKFKVCDYEINKNDVTYSWETMKYLRENYDHDFYFIM
FT                   GEDSLMSVETWENAEDFLKNTKILACIRRQEEMSKLDVKIDDLKSKGYFVEKIPSSFID
FT                   ISSTKIREKVQSNQDFRYFVPNQVFEYIVRNKLYES"
FT   CDS_pept        421664..422239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07788"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Z7"
FT                   /protein_id="BAG07788.1"
FT                   /translation="MKVKEIENNLSKMLKKTRYEHVLRVRDKAIELAKLHNQDVIKIEL
FT                   AALLHDCAKNNENMYLDKYKKEFEELRNLRQNDPDMENPKLLHCYLGRIVANKEYGVND
FT                   QEILDAIEFHTTGRINMTDFEKIIYLADKTEDKRDYDGVDEIRKLSKINLNKAIVKSLD
FT                   DTIKYLIEGEREISVTSVNVRNYLLKGV"
FT   CDS_pept        422552..422920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07789"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B0S3Z8"
FT                   /protein_id="BAG07789.1"
FT                   /translation="MKFLHSDKAPAAIGPYSQATSANKTIYVSGQLPIVDGELQTDIRK
FT                   ATKASLDNILHIIESEGGKVENIARVGVFMQDLSQFSDMNEVYAEFFGDHKPARSAVQV
FT                   AALPKGAIIEIEAIAELD"
FT   CDS_pept        423104..425446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0372"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07790"
FT                   /db_xref="GOA:B0S0L1"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0L1"
FT                   /protein_id="BAG07790.1"
FT                   /translation="MKNLKDIAKVSFVALSVSLMISTGSMAQTENDKKDVENELSSRYT
FT                   SISTHNQSKLTKKAKLGYANINDLQNQKKENDSNLNLTDTKDSNYEIENKEEKENSSSE
FT                   KDNEVEAEKDAEGGLEVSPIKADESVSKENSEQQVSEEADGKEAQDEEVKALNSSGQIV
FT                   PTRIAGKNRYESAAQISREQFTNAKKVIVVNSQKYADALSATTLSDGRYSILYTEKDSL
FT                   PTATRNEIQRLNPIEVYLLGGKQSISDGIENILKKYANKVTRIAGKDRYETSAKVAAMS
FT                   NKKNIVIASGENFSDPLYASSYAYSNNAKILLSSGKTLSRETRDYLLRNKSKIGNVTVV
FT                   GGGKSISSSTVRYIQSVTGKNVGRISGRNRYEGSVKVANSMNKSKVFIASGEDFADALA
FT                   ISPLAQKLNAPILLSAKGKLDTSVIAFLNNFKNSIKDVFIVGGYRTIDNNVYGTVQNVL
FT                   KKQIAKPKPQPKPQVKPQAKPKPKPPVVKDEVSDIIEEDKAIGLHDFVVAKRSTTLYDA
FT                   ADSSAKSVRNINTSTVMQVINILDNGWMQLDINGFKGYAKVSDFGMFNPNKYRLVFQQG
FT                   ADLSKFNRYVDMRLAKKNGMDFVILKAGSGYSGEDPKFQQNYNNAKAAGLNVGAYWYSY
FT                   AVNVEEAKEEAVRYMKILGKKQFEYPVYLDFEDPSQRKIPKETKTDMAIAFMSILEKNG
FT                   FYTGLYSSGSWINNQFERERLKDYDIWIAHWHVTNPNCYTPDYGMWQFTNKSKIKGVPD
FT                   TGEGGVDMNYSYKNYPKIIKDAKLNNF"
FT   CDS_pept        425542..426639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0373"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07791"
FT                   /db_xref="GOA:B0S0L2"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0L2"
FT                   /protein_id="BAG07791.1"
FT                   /translation="MKLGIVGLPNVGKSTLFNAITKAGAEMANYPFCTIDPNIGLVNVP
FT                   DERVYKLAELFNSKKIIPATIEFYDIAGLVKGASKGEGLGNKFLENIRESDAIVEVLRC
FT                   FEDENIVHVDGSVDPIRDIETINYELILSDLEMVERRLEKSRKALKGNKDLKEEVDLLE
FT                   KIYEVLSEGKSIRILDLDEDEMKLMRSFNLLSVKPIIYVCNVSEDEVADAYENNEMVQK
FT                   VKEFAKSEDAKVVVISAQIESEISALDSEEDKKEFLEAIGLEKSGIDDLITQSYDLLGL
FT                   MSFLTTGEDETRAWTIKKNTPAVQAAGKIHTDIQRGFIRAEIVNYDDLIELKSMAAVRE
FT                   KGLMRLEGKEYLMQDGDVVHFRFNV"
FT   CDS_pept        426797..428566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0374"
FT                   /product="putative X-prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07792"
FT                   /db_xref="GOA:B0S0L3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0L3"
FT                   /protein_id="BAG07792.1"
FT                   /translation="MIKERLEKLRKKMSERNIDAYVVLSSDPHTSEYLADYYKTRKYIT
FT                   GFSGSAGTAVILKKKAALFTDGRYFIQAAKELEGSTVDLMKMGEPGVPTLIEYLKENVG
FT                   ECGKIGVDGLTLDYNDYYRWLENLGDRMIITDVDFIGDIWEDRPEKPNSKAYAFDVKYC
FT                   GKDTKTKLKELRYFMDCNECDYNFIGSLDDICYLYNIRGNDVLYSPVIISYALVGKDFA
FT                   NLYIEDEKIDDDLIELLKEQGVTVKSYEKVFEDLSELPGKSVLFLDPSKTNVRIYNSIN
FT                   SNIRISKGIQPTTLMKAHKNETEIKNQKNAYIKDGVALVKFFNWVETGTPTGNVTEMSA
FT                   ADKLRYFREQGDLFMDLSFGTISAYGENAALPHYSPSVDHPVTLQPKGLYLVDSGAQYL
FT                   DGTTDITRTVALGELTDDEKLHYTLTLKSHINLMTTIFPKGTKSSSLDPIARRPIWQEL
FT                   LDFRHGTGHGVGFYLGVHEGPQRIASVNNDIDMDEGMVTSDEPGIYIEGSHGIRIENIM
FT                   HCIKVGESEFGEFLGFESLSICPIDTRPVIKEKLLPFELEWLNNYNKECYDKLSPYLEG
FT                   SDLEYLEQQTKAI"
FT   CDS_pept        428569..430395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0375"
FT                   /product="excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07793"
FT                   /db_xref="GOA:B0S0L4"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0L4"
FT                   /protein_id="BAG07793.1"
FT                   /translation="MFDIKKELQKVPHKPGVYIMHDKNDEIIYVGKAIDLRRRVGQYFD
FT                   SSKKLAKVAAMVSHVEYFEYIIVNNECEALVLESNLIKKNSPKYNIVLRDDKQYPYIKI
FT                   TNEKFPRVLKTRRVLKDKAKYFGPFPNAYAVNDIIDLIHETYKIRTCNLNFDKGQKLKR
FT                   PCLNYYINRCDGMCVYDVNEEDYNKELLEVENFLNGREDELTKKLTDKMMAASKNLNFE
FT                   LAAKLRDSITNIQVILEKQNITNTKGLDLDMISMAREAETVCVQVFFMRNGKIIERQHF
FT                   IIDNKYEESNEHIVGEFFKQFYIDLTYVPKQILTDIEIEDRDLIEEMLTEKKGSKVEIK
FT                   IPKRGNKTDLLEMVRVNAKEGLDKYISRHLKRERNRENAILDLQDITGVKPIDRIECYD
FT                   ISNTSGVDSVGSMIVFKNGAKSSKDYRKFKIKTVEGADDYASHREVLTRRFRRLLDSDK
FT                   KDNSFDEMPSIILMDGGKGQVNIAKEVLNEFNLDIPILGLVKDDKHRTRGIIYENEEIR
FT                   LKVNTPLYRLLFAIQEETHRFAINYHRKLHEKNFKKSELDNIALIGEKRKKALMKHFKT
FT                   LDRIKKASVEELCEVDGMNEKAAENIVNYFKQ"
FT   CDS_pept        430432..430977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07794"
FT                   /db_xref="GOA:B0S0L5"
FT                   /db_xref="InterPro:IPR012652"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0L5"
FT                   /protein_id="BAG07794.1"
FT                   /translation="MVRYKVVNNGGFMNRNNSTLVKMIMLSIFVAIGVVISPILRVVGF
FT                   CPTQHFVNIVCAVFLGPWYALLCATLIGIIRMSLMAIPPLALTGAVFGAFLSGVLYKRT
FT                   NKLIMACIGEVIGTGIIGSIVSVPVMKFFFGKSNLTLFFYTPSFVLATLMGATVAFLFL
FT                   KAMQKNKMLDKLKESING"
FT   CDS_pept        430970..431776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0377"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07795"
FT                   /db_xref="GOA:B0S0L6"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0L6"
FT                   /protein_id="BAG07795.1"
FT                   /translation="MDNLIQKMSEIYSDLHNSNNLIHCLTNAISINDMANAVLSIGQSP
FT                   FMADNPREVEDVTRKSDSLLVNLGNITDYRIESIKKSVRIANENNIPITLDLVGVSASK
FT                   LRLDLTLDILKNHTITCIKGNYSEIKSLFIKDLSTKGVDSQKLEVDDVINCCKNLHEKY
FT                   DSIIVATGQTDIVCANEIYLLNNGDDRLSKITATGCVVGSLIACTLSVSQSIKACVLAI
FT                   SMMNISCEMVDKSVGLSSFKLGLYDNLSRIKWEQIKENIDAKKVES"
FT   CDS_pept        431754..432398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0378"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07796"
FT                   /db_xref="GOA:B0S0L7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0L7"
FT                   /protein_id="BAG07796.1"
FT                   /translation="MRKKLNLSLYLVTDRTNVACEEKFLTKIEESLKGGVTLVQLREKN
FT                   ISTREYIDLAKKVKIICDKFDVPLLIDDRIDVCLASECAGVHLGDEDMEIKDARKILGD
FT                   NYIIGATAKSVERAVQCEKEGADYLGVGAIYPTKTHVKTKITSVDTLRDINNSINIKTV
FT                   AIGGLNEDNMDVLKNSGASGIAVVRALMNDDNPQEKAHRLLEKSKQILELR"
FT   CDS_pept        432401..432811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07797"
FT                   /db_xref="InterPro:IPR033782"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0L8"
FT                   /protein_id="BAG07797.1"
FT                   /translation="MKKKFKLVLLVFVLMLVMVSCKKADPITLPNANDSQVITVTKIEE
FT                   NKEGPTASITSKKDIVDTIKLIQEKAKPTRKQSNNDTPANTKDFRKMEIFYGKDEKMTL
FT                   YLYQNKKFYIEKPYEGVWEIDNDTFNKLIGAM"
FT   CDS_pept        432932..433282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0380"
FT                   /product="transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07798"
FT                   /db_xref="GOA:B0S0L9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0L9"
FT                   /protein_id="BAG07798.1"
FT                   /translation="MININTTSDVPIYTQIRNEIIREIANGNLQNGDELPSVRQFANDL
FT                   GINPMTISKAYNILKDEKIIVIDRRVGAKICVDEDYSRNSFEDELKLLLMEAKIRGKSQ
FT                   KDIKNIVEEIIK"
FT   CDS_pept        433279..434613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0381"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07799"
FT                   /db_xref="GOA:B0S0M0"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0M0"
FT                   /protein_id="BAG07799.1"
FT                   /translation="MIWQFILFFSLVFILFIIRRVNIYTLKINDTFMLYTNFPKGYEDD
FT                   EFIVDLLGKTKKKLNILFAVSIVLSFLVLLDYDWIMLVYYNLIVVYLVSANIIEYNAMK
FT                   VIRQYKKDNNISTESSILTYDLKTSRDIEKKKIKLKAWIIPLVVQIVLLVAFFKNKEMF
FT                   FGYILLLVTMSVSTILTGWFLGRKNTKVYSTNSDENLKLNEESIIKVQQTMYAIYIMFI
FT                   VLGFVVAYYSSKDIYRIFPILSYIVLYTLAIILALFKYQTIAKNLTAINSDLYNGDFFD
FT                   PWGYYNPKDDRLMVEDVSVRKGNMTFNRAKLSGKILYALTAVLLISVEFLMISMSLPKT
FT                   YTVDNTPSTLTISESVYTTVIDKKSIEKVELIEDINKTDGVRLNGTSLKHNSYGKFSIK
FT                   GIGNCDVYIHNDNPRAIWIKTKDNKNLVFNFPTVKETENFYKNLR"
FT   CDS_pept        complement(434707..436362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0382"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07800"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0N6"
FT                   /protein_id="BAG07800.1"
FT                   /translation="MNNFKKPLLVMTLAVSLSLGANVSFADNENNKSETNVKAILDNSS
FT                   KTETTKIQVKLDENNKVISNKNQNNKEEKKEAEVKSQKSAKTERIDAQNRFETAKKIKE
FT                   KEFKNADTAVIVNSNEFSDSISATNISNGKSPILYTDSNKLDNLTKEALNGIKKVYITG
FT                   GEKTISSKVVKELNGLGIEVIRVKGKDRYDVNAKSATTSHPVSNKKQNVVIASGENFAD
FT                   SISSTSLAKKKNAPVLLVKKNEVPKSIKEYLNSFRKKGLLGDITIVGGENSVSKIVENE
FT                   LSKLAKVTRIAGDDRYQTSVKVAKHVGVNSERTIVASGEKFVDVLAASPVAQKYNAPIV
FT                   LVKKMDVPRNEDYKTQEQKSNSVESFFKQNKSNIMYTMVFGGKNTIDNFVVNGIKDLLA
FT                   GKSLQAKPKVDALVNLPKKQEQQVQEETNKLDKIVELAYKQLGKPYVWGTHGPRSFDCS
FT                   GLTSFLYKQAYGIGISTSSRAQASYGYKVSKSNLKKGDLMFFATGGGGISHVGIYVGNN
FT                   KLIHASTPSTGVILSDINSSYYQRTFVTARRLLG"
FT   CDS_pept        complement(436796..438511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0383"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07801"
FT                   /db_xref="GOA:B0S0N7"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0N7"
FT                   /protein_id="BAG07801.1"
FT                   /translation="MNNLKKPLLVMGLMFTFSALNATSSFADVDNTKLVEEVKHDALNH
FT                   TTNLQTIIKDQENVNAEDSIKSNDAQNTEKNNEKGNKKETTKEDLTEGFEDSKELLKKP
FT                   AEVKAAKKADVKKITSSSKFETATNIRDEYFSESNTVILTNSSTFVDSLSAVSLSRGNT
FT                   PILFTKSNSLDSTTLKNLKSNKPRKVYILGGEKSINSSVVNQLKNLGIIVERISGHDRY
FT                   EVNAKVAEKTHNPNTKQKTNILITSGEKHSDAINSATLAQNKKAPILFVTKNEVTSPIK
FT                   NYLYSLKKKNAIGSITIVGGENSVSRKVEAFLRSLSNNVDRIAGSDRYSTNVKVAKQVN
FT                   PNAKRAIVVEGNGYNDALLMSPVAAKLNASLILTKPNDVTRTSDYASVDKHSSMESFFK
FT                   NNKSLDQVIVCEGNHSISDFVSSSISDLLQGRSLKTAPKADALYKQEKAELRKSNTQNT
FT                   KATKKVEKPVDSLQAQLAKAKRVFIVRSTAYTSDPRENGGWNVTAIGTKIRRGVIAVDP
FT                   RVIPLRTRVYVEGYGFATAEDTGGAIKGNKIDVVMDTNAQSRNWGVRNVKIYIL"
FT   CDS_pept        438733..439692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0384"
FT                   /product="HPr(Ser) kinase"
FT                   /note="phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07802"
FT                   /db_xref="GOA:B0S0N8"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0N8"
FT                   /protein_id="BAG07802.1"
FT                   /translation="MKTVKLSAVVKKLDLHVVRTSSDYETIEINNSEINRPGLQLSGFL
FT                   EEFPYRRIQLFGKAELAYYKAMDMELRIERVRAMMEYDIPCIVFSHYAQIPEEVRKLAD
FT                   EYDKTLLISDRTTTRLISALDEVLEYFLSEEDTIHASLLDVFGMGVLLMGDSSVGKSET
FT                   ALDLVTRGHRLIADDVVEIRKIEKGLLAQAPLNIRHYLEVRGLGILDIQRLYGTGSVRL
FT                   TTFIDLVIRLEKWQDDKEYDRIGLDDHTTELLGVELPYLEVPVKPGRNIAMIVEVAVRN
FT                   QRQKLLGYNAAQELNNKLIANMKKDTEEHRKQLKNNKK"
FT   CDS_pept        439828..443508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0385"
FT                   /product="pyruvate/ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07803"
FT                   /db_xref="GOA:B0S0N9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0N9"
FT                   /protein_id="BAG07803.1"
FT                   /translation="MAKHMKTMDGNTAAAHVAYAFSDVATIYPITPSSPMPEAIDVWAA
FT                   DGRKNLFGETVQVTELQSEGGAAGSVHGALVAGALASTFTASQGLLLMVPNMYKIAGEN
FT                   LPGVFHVSARALASHALSIFGDHQDVMAARQTGFALLCSGSVQEVMDLAAVAHLSAIKG
FT                   KVPFLHFFDGFRTSHEIQKIEVMDYEDLAKIVDWKAIDEFRRNALNPENPKTMGTAENP
FT                   DVYFQGMEASNTYYEDIVGITEDYINEINKITGRNYGLFNYYGAEDAENIIVAMGSVTE
FT                   TIEETVDYLVSKGEKVGVLKVHLYRPFSKEHFLNAIPKTVKKIAVLDRTKEKGSLGEPL
FT                   YLDVRDCFYDHENKPVIVGGIYGLGSKDTTPTHINTVYENLKQDKPRTQFTIGIVDDVT
FT                   HRSLEVKDVINTSPEGTIRCKFWGFGSDGTVGANKSAIKIIGDGTDMYAQGYFDYDSKK
FT                   SGGVTMSHLRFGNNPIHSTYLLDESDFISCSKQAYVYQYDLLRGLRKGGTFLLNCIWDE
FT                   KELDTHLPGKLKKYIAENDIKFYTINASKIAAEVGLGGRTNMIMQAAFFKLSKVLPIDE
FT                   AIKKLKESIVHNYGRKGEDIVNMNYAAVDQGIDQLVEIKVPAEWKNAEEDVEKDANLPE
FT                   FVKEVASVMNAQQGNDLPVSAFKDRANGEFPMGTSAYEKRCIALNVPEWQMDKCIQCNQ
FT                   CAYVCPHAVIRPFLLNEEDRKNAPETFESKKAVGKGFEDLTFRIQVSPADCTGCGNCAD
FT                   VCPAKEKALIMKPFEEQHIAQKDNWTYAVEKVGYKEDLMPAEKTVKGSQFQQPLFEFSG
FT                   ACAGCGETPYAKLITQLYGDRMLIANATGCSSIWGASAPSTPYCTNAEGKGPAWANSLF
FT                   EDNAEYGYGMHLAIKKIRLQLKEKMQAFLDLNIESPLNAPFKKFIENMDDVATSKACAA
FT                   EILQHLDDNTNNEEAEELLKYIRTDRDFLIKKSVWIFGGDGWAYDIGYGGLDHVLASGE
FT                   NINVMVFDTEVYSNTGGQASKSTPTAAVAQFAASGKKVRKKDLGLMASTYGYVYVAQIA
FT                   MGANQNQTLKAIREAEEYNGPSLIIAYSPCINHGIKAGMGKSQRQEKLAVEAGYWHLYR
FT                   FDPTLAEEGKNPFQLDSKEPTGSFQDFIRGEVRYLSLQKSFPEQAEELFQEAERDAKER
FT                   YNTYKRMAEMDYSNSVENTESAEKEENLEKEGKKVESVEKAKEEEGAKKKDVVNPNSTN
FT                   R"
FT   CDS_pept        443804..444931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0386"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07804"
FT                   /db_xref="GOA:B0S0P0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P0"
FT                   /protein_id="BAG07804.1"
FT                   /translation="MNFYEESRKFALEHVEPYAKRSDEEGRFPVESFEEMGKAGYFKLL
FT                   IPEEMGGLGKTAVEHQQAVLAFAESNPTAGLCYMMHNVALMTVLTNGNEELKKKVVKDI
FT                   VENNKFMALAYSEFGTGTHFYIPEIKVTKDGGKFVFNGTKSMVTSATHASYYLILTPST
FT                   EKEGDINNWLIPLESEGLEFKMSHWKGIGMKGNVSCPMTMTDVKLDEVNRIGEEGSGVD
FT                   QVFNVVAPYFILGLASVYTGLNLRLSKITNDYALKRKYPSGQCLANIETVQVHLAKIYA
FT                   NGMSAKALTELAARSLVDGEADAVCKIIAARVCAIENAIESSTLAMRVGGGKTYNCASE
FT                   IQRLMRDAYAGQIMAPSLDVLNVWLGKAITGQPLL"
FT   CDS_pept        445076..445903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0387"
FT                   /product="putative phosphonate ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07805"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P1"
FT                   /protein_id="BAG07805.1"
FT                   /translation="MKKLKVGAVIYAPRVTVIWDLITKFYEENGAEIEAVFFKDYKLQV
FT                   DALMNGEIDAAWNSPLAQLDAHLRSEGKEKIGCMRDTDRDRKTYLVVKKGKFENISDLK
FT                   GKTIGFGAIDSPQARLIPINFLHNNGLEFGKDYTDKRFDIGVGLHGDHVGGEKDSMMAM
FT                   VNGEVDATFCLDLNYDAWISDGTIDKNEVEVLAKTDYFDHCVFTFTPETSDEDIKAFDD
FT                   IMFKMDYNNERDKEIMDLEGLKQWVPGRRDGFKQITEANEYLGNFIKEYNSEQ"
FT   CDS_pept        445893..447068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0388"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07806"
FT                   /db_xref="GOA:B0S0P2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P2"
FT                   /protein_id="BAG07806.1"
FT                   /translation="MNNKLFKTSLIGSMPRGNEILKARRMLKANMISLSDYEQMVYDKT
FT                   KEVVKLQEDLDIDVITSGEIERDNYVSFISEKLGGVTQMSMAEMLDYVDDKREFENILT
FT                   TLDVPATSIKNAICTGKLEYKGDIVSEELKLLKSLTDKPVKITMPGPYLVTRSMWLANV
FT                   SSKYYDSKEALGEDVIDIYKKEIKNLQEIGVDVIQFDEPVLTEIVFTEGKPRTFMCASL
FT                   STRKDPTEELKFATHLIKSVMDSVDRDKSICSLHVCRGNWSKNESILLTGPYTPLLDLF
FT                   ADINADLLALEFSTPRAGELKALLADERINNKVILGLGVLNPRLDDKEDTDGIYKRAKE
FT                   ALTFIDKDKLWLNPDCGFATFSNRPVNEYDHIREKLQSMIDARNKLRKEYE"
FT   CDS_pept        447061..447513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07807"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P3"
FT                   /protein_id="BAG07807.1"
FT                   /translation="MNDDINSFQKNFRAIVSDDLVKVYNEKSCIPVDSSISFDSEKEEF
FT                   TSIDFFVSSIVSELILTMMRVAKKRNTILQDIEAKVNLDIDNPMYLLNVIGFEDKSIIN
FT                   KIDIDIYFFSFYEGEELQEFLDEVLNRTLIYNSIKNLVNVNFKTVL"
FT   CDS_pept        447905..448420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0390"
FT                   /product="putative tryptophan transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07808"
FT                   /db_xref="GOA:B0S0P4"
FT                   /db_xref="InterPro:IPR031360"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P4"
FT                   /protein_id="BAG07808.1"
FT                   /translation="MDSKKLTVSSIFLSVGLLLHYVTPALFMGVKPDFLLVMMFLGILF
FT                   MDDVKEAFALSLFAGGLAAFTTSFPMGQLPNIIDKLISGIIAFYLFKLMGKNSRKSNLI
FT                   FAIGTLISGFVFLSLAIPMGMGTENFLNLLPSMFVAVCLPTSILNTIVGIFFKKLIYRT
FT                   NYVKIHAE"
FT   CDS_pept        448478..449251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0391"
FT                   /product="uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07809"
FT                   /db_xref="GOA:B0S0P5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P5"
FT                   /protein_id="BAG07809.1"
FT                   /translation="MKYAEEGVQYHLNIKSGDVGKYVILPGDPKRCEKIAKYFDDAKLI
FT                   ADHREYVTYTGTLNGEKVSVTSTGIGGPSAAIAMEELVKAGADTFIRVGTCGGIQEDVK
FT                   SSDVVIANSAIRAEGTTKEYAPIEFPAVANLDVTNSLVKASKNLGHNYHVGVVQCKDSF
FT                   YGQHEPEKMPVSYDLLNKWEAWKRLGTLASEMESAALFVVASYLHVRCGSCFLVVANQE
FT                   REKKHLDNPVCHDTDVAIKVAIEAIKNLIEEDKRK"
FT   CDS_pept        complement(449389..449922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07810"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P6"
FT                   /protein_id="BAG07810.1"
FT                   /translation="MKNKQIYLYVDGYNIINAWPNLYKLSNDVDLDSAREELIDIMKEY
FT                   QNLSGEQVYVVFDAYLVKGGMSIEEKRDNLTVIYTKEHESADRYIERKVNDMKKHDKMY
FT                   VASNDGMIQRIILSRGGIRISANELWKNYLTLKENLRRSKLKRRKQSSENIVTIDNEVY
FT                   EQLEKLQDELKKQN"
FT   CDS_pept        complement(449912..450646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0393"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07811"
FT                   /db_xref="GOA:B0S0P7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P7"
FT                   /protein_id="BAG07811.1"
FT                   /translation="MQYLVGRNPVMEALEMDMGVTNLYIQKGELKGFIKKIEKKAYDMG
FT                   IKVEYVDKKYIEKFAENTAHQGVMAKMPSFGYSNVDEMIIYAKKRNEDPFLIILDEITD
FT                   PHNLGSIIRTAEVAGCHGVIIPKHRACEVNATAIKTSAGAVFNIKIARVTNITTTINYL
FT                   KEHNIWIYGACGEASQTHTQANLKGPIGLVIGNEGKGISRLVRENCDQLIKIPMYGKTE
FT                   SLNASNAASILIYEIIRQRYEK"
FT   CDS_pept        450736..452181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0394"
FT                   /product="alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07812"
FT                   /db_xref="GOA:B0S0P8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013776"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0P8"
FT                   /protein_id="BAG07812.1"
FT                   /translation="MGNEIMMQAFEWYLPDDGNYYKNLAKEAKNLKEKGIDALWIAPMF
FT                   KATGTNDVGYGVYDLYDLGEFDQKGSVSTKYGTVEELKKLIEVLHENEIKVYADVILNH
FT                   KAGADFSETFKAYEVDPNDRTKRISDAYDIEGWTGFDFKGRNGKYSDFVWHFQHFNGVD
FT                   FDNKQNKKAIFEIAGENKGFSNSVSNEKGNFDYLMFADIDHKNPDVRDELFRWGEWFVN
FT                   YLNVDGFRYDALKHIDDQFIIDFTKHIQNVVNRDFYFFGEYWLQDKDNTNHYLYDTKYN
FT                   LDLFDVALHFNMYSASKNGNQFDMRKIFDNTLVQEHPTIAVTFVDNHDSEPGQSLESFV
FT                   EPWFKKIAYGLILLRKDGYPCVFYGDYCKIGGEYNIEGQKDIIDNLMYIRKHYAFGDQT
FT                   DYMESENLIGWIRHGDDFHNPMAVVISTGDINTLRMDVGKENAGKKYTEITGTNSNEIV
FT                   IDDDGFGDFEVGAGTLSLWVCNE"
FT   CDS_pept        452174..452782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0395"
FT                   /product="ribonuclease H-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07813"
FT                   /db_xref="GOA:B0S0M1"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017290"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0M1"
FT                   /protein_id="BAG07813.1"
FT                   /translation="MSKFYAVKIGRNPGIYNSWAECQEQVNGFKGAIYKSFKTKEEADN
FT                   FINGDDNKKVASIDNLSENECVAYVDGSFKKDTGEYSFGCVLFHNGKIDKFNKKYPQSE
FT                   YSTHRNVSGEVSGSVFAIKKAVELKMNKITIFYDYQGIESWANGDWKTNNNLTRNYKKF
FT                   IDEIKSKIDINFVKVKGHSNDTYNDMADELAKQALGIGK"
FT   CDS_pept        complement(452896..454140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0396"
FT                   /product="putative hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07814"
FT                   /db_xref="GOA:B0S0M2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0M2"
FT                   /protein_id="BAG07814.1"
FT                   /translation="MDSSSTSQIIALVFLVAMSAVFSSSETAITSVSKIKVRQLDQKDN
FT                   KNAHLLKKLHDNMQATISTILIGNNIVNIAASSIATILFTNIFHQNGALVSTVVMTVFV
FT                   LIFGEVLPKTIAQYKNKSVALKFSRFIYLLTIIFKPIVKVLNLLTRLVIKIFIGDNGDS
FT                   STLTEEELKTLVEVSEEEGVLKDQETEIMINALELKETLAVDIMTPRTSMASVDIEDAE
FT                   NDLREIIKNITYSRIPVYEDNIDDIIGVLHIKELAHKIIEDDHDFKIRDILKPAFYAYE
FT                   YIPVVDLFKQMRAKNISISIIIDEYGGTSGLVTMEDILEELVGEIDDEYDNEKEVTKIN
FT                   DNEYLVDPEMRIDEVNERFDLNLQSEKFDSIGGFVIELLDRMPKSKDEVEFENLKFVVV
FT                   NVDKRKITQLMIIFK"
FT   CDS_pept        454325..454843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0397"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07815"
FT                   /db_xref="GOA:B0S0M3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0M3"
FT                   /protein_id="BAG07815.1"
FT                   /translation="MELKEKIRVIDGFPKEGISFKDITTLLNDKDAYKYAVDLMVDDLK
FT                   DKGITAIAAPEARGFLFGSAVAYALGVRFIPVRKPGKLPGEVSEYSYDLEYGTDKLEVH
FT                   RDAIKKGDKVAIVDDLLATGGTVNAVAKLIEKNGGEITAMEFLIELTELGGRDINKNYY
FT                   INTLVQYES"
FT   CDS_pept        complement(454923..456371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0398"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07816"
FT                   /db_xref="GOA:B0S0M4"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0M4"
FT                   /protein_id="BAG07816.1"
FT                   /translation="MDWKNYENLSMLSDFYEFTMMNGYLENNMENEYAYFDLYFRRIPD
FT                   NGGFVIVAGLEEVVKYIQNLKFDEKDIEYFKSKNMFSEKFLDYLRNFKFECDVWAMPEG
FT                   SVAFPNEPLMIVRGPAPQAQLIETFALLSINHQSLIATKTNRIVHAAEGRVVMEFGARR
FT                   AQGVDATVLGARAAFIGGATATSNTLTDITYDVPAFGTMAHSWIMMFDSEYEAFKKYAE
FT                   TFPNSCSLLVDTYNVLKSGVPNAIKVFDEVLKPRGIKNMSIRIDSGDLAYLSKQARKML
FT                   DAAGYENCKIMASNSLDEYTISDLIEQGAKLDGFGVGERLITAKSDPVLGGVYKLCAVE
FT                   KPNGEIIPKIKISENIEKITTPAFKTVYRIYDKNSGKAEADLITLHDEKIDESKELEIF
FT                   HPVHTWKRKTLTNFTTKELLVRIFDKGELVYDLPKLDKIIERKNEQINEQWEEVKRFEH
FT                   PHLFHVDLSQKLWDIKYNLLMQSK"
FT   CDS_pept        456487..458829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0399"
FT                   /product="copper-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07817"
FT                   /db_xref="GOA:B0S0M5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0M5"
FT                   /protein_id="BAG07817.1"
FT                   /translation="MEEIKLKIQGMSCESCAARIEKVLSKYEYIDTVNVNLLQEYAYLK
FT                   LKEGYDIETIVDKIKKAGYEVPMKTSKFDIEGMSCQSCASRIEKVLNKNNFKDVNVNLL
FT                   QNSLTVSFYEGYKTNSDVKRLVDKAGFSAEIKTDNKIANEKNITEYEKLKRDFIISAIF
FT                   SIPLFSAMFFHMAGVHTILSNGYFQWALATVVQFYIGRRYYVNAYKSLRGGGANMDVLI
FT                   ALGTSAAYFYSIYHVLIGSDQLYFESSAVVITLILLGKLFEKRAKTRTTDAISKLMGLQ
FT                   AKKANVIKNGQTIETDIEDVMVGDKILVKPGEKIAVDGIIVEGSSSVDESMITGESMPV
FT                   KKQVGDECIGSTINKNGSFVFEAKKIGEDTVLSQIVKLVEDAQSNKAPIQRLADKISSV
FT                   FVPIVIAIAALTFVITYFVTKQFDRALLNSVSVLVIACPCSLGLATPTAIMVGSGKGAE
FT                   LGILIKSAEVLETANKIDAVILDKTGTITNGKPEVVDYKSEDADFLKVVSSIEKSSEHP
FT                   LADAVVKEYEKNSSDFYKVEDFHSITGKGLSARINDDEYFIGNEKLMKENNIDVNVDIQ
FT                   KYQSQGNTVVLVGKNDKFYGYILIADKIKESSPKAVAKLKDDNIDVYMITGDSENTAKH
FT                   IAEKANIDHVIAECLPKDKSDKLLDLKNQGKKVGMVGDGINDAPALAASDVGFSIGTGT
FT                   DVAIEASDITIINGDLNKVHTAIRLSHRVIKTIKQNLFWAFFYNVIGIPIAAFGFLNPM
FT                   IAGAAMAFSSVTVVTNSLRIKNFKEEK"
FT   CDS_pept        458829..459029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0400"
FT                   /product="putative copper homeostasis operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07818"
FT                   /db_xref="GOA:B0S0M6"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0M6"
FT                   /protein_id="BAG07818.1"
FT                   /translation="MKKEFEVLDMVCNHCVESVTKACKSVDGVTDVNVILEEKKAVVEG
FT                   DFNEADIIKAIDEIGFEATLK"
FT   CDS_pept        459029..459292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07819"
FT                   /db_xref="GOA:B0S0M7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0M7"
FT                   /protein_id="BAG07819.1"
FT                   /translation="MTEHKQKALKKIKTVRGQLDAIVNMIEEDRYCVDISTQILSCIGQ
FT                   LKKANIDILNGHLRTCVKHAIENDNADEKIEEVINIIDKYIK"
FT   CDS_pept        459443..459982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0402"
FT                   /product="30S ribosomal protein S30AE family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07820"
FT                   /db_xref="GOA:B0S0M8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0M8"
FT                   /protein_id="BAG07820.1"
FT                   /translation="MKLNYVTKDIKLTDDLKQMAESKLHKLDKYFHDEQQARVVFKKEK
FT                   DKARVEVTMILDKGVVLRAEESNEDIKTAIDKVEDALARQVRKHKTKLQKRFTESNSIR
FT                   FEAVEENSAKEIPTGSIVKTKEFGIKPMDKEEAIMQMELIDHDFFVFLDSKTNNVNVVY
FT                   KRNDGNYGLLVPGFEK"
FT   CDS_pept        460052..460315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07821"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0M9"
FT                   /protein_id="BAG07821.1"
FT                   /translation="MKIELSEKLKAYCNQKSKHKILLYMGQSPCCTIAEAKYYAKFISK
FT                   SPHLKEMNIDGISVYYEAYIEKYLDDCQLDLVKFLNMIIVNY"
FT   CDS_pept        460325..461029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0404"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07822"
FT                   /db_xref="GOA:B0S0N0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0N0"
FT                   /protein_id="BAG07822.1"
FT                   /translation="MSTPHIEAKKGDIAKTVLLPGDPLRAKFIADNFLEDVKQFNAVRN
FT                   MFGYTGKYKGKEISVMGTGMGIPSIGIYSYELINEYGVENLIRIGSAGAYSKDLDLYDV
FT                   VIAMGSCSDSNFAHQFDLEGTFSAICDYDLLRKAVNVAESKNIDVHVGNVFSADIFYNQ
FT                   KSEEWKKWEKMGVLAVEMESYGLYLTAKANNARALTILTISDSFHSDKQTTPEERQTSF
FT                   TKMMEIALELGE"
FT   CDS_pept        461031..461672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0405"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07823"
FT                   /db_xref="GOA:B0S0N1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0N1"
FT                   /protein_id="BAG07823.1"
FT                   /translation="MELNKYIDHTLLKADATSADIKKICDEAIKYDFKSVCVNSCYTSL
FT                   VKKSLENSSALVCTVVGFPLGAMSTKSKAFEAKTAIEDGADEIDMVINIGKLKEKDYDY
FT                   VEKDIQAVRDATKGKVLKVIIETCLLTDEEKKKACEISVKCGADFVKTSTGFSTGGAKV
FT                   EDVKLMKDTVADKAMVKASGGIHSREEALAMIENGADRIGASSGIKIVEG"
FT   CDS_pept        461721..462512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0406"
FT                   /product="putative histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07824"
FT                   /db_xref="GOA:B0S0N2"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0N2"
FT                   /protein_id="BAG07824.1"
FT                   /translation="MYYRDQHCHTEFSFDSKEKFENYLKLVKGDIVTTEHLDYGFTYND
FT                   GRVEDVDIDYDKYVKVIAEHNEKSSQKILKGIEIGYTAPNLDKIIKKVSSRDYDIQLLS
FT                   VHQYDGKDFMNPKPEDYSQREFLVKYYEKMVEAMKNFKDFDVLTHIDYALRLNRLDPKN
FT                   MDIVDEYLTKVFAELINDEKALELNTRSVYQYNNLDYYTFAIKKYIKMKGKLFSVGSDA
FT                   HFESYYRYHFDDAFKLLKSVDAKYLAMFENRKMTTIKLEDM"
FT   CDS_pept        462512..463453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0407"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07825"
FT                   /db_xref="GOA:B0S0N3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0N3"
FT                   /protein_id="BAG07825.1"
FT                   /translation="MKVLITNRIPNEIIKKYKKNFEVDYNDSLEFLSKEELKTRIKDSE
FT                   ALVCPLSEKIDSEIIDAANNLKIIANYGAGFDNVDINYAKEKGIIVTNAPASASTKSTA
FT                   ELTFGLIIDLLRNITKMNSDCYDDSFEGWKPVYGLGETLQGKTLGIIGLGRIGTEVMRK
FT                   AKAFDMDVIFYNRSKKEVEGAKQVDLDFLLENSDIITLHTAYSDELHHLIDAKALSKMK
FT                   KTAFLINASRGKVISEEDLIDALNDGEISGCALDVYEFEPKISDELRNAKNILLAPHLG
FT                   NATKLARVQMGEFTFDNIMQFKNGEIPKNKVN"
FT   CDS_pept        463513..464805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07826"
FT                   /db_xref="GOA:B0S0N4"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0N4"
FT                   /protein_id="BAG07826.1"
FT                   /translation="MTDDIKALFQSKGFFVFLSLMFKLFLDLSYSYAISPLFSYMGLVN
FT                   NLNIYKLIESYALVVIMCYTIRHKVERVSDFYLMLFYVLIIIPCLNIYPYKDFSRLYMY
FT                   MLIASFYTMQIFANSPKLRLSFSDKKINESFIVYAFALVGILMFAWIILRGGLKYLNFD
FT                   FRKVYDTRREIAEVIFPGPFAYFMNWYGKIINPTLLVFCLWDRKKLGTVITLICQVFFF
FT                   GFTSHKSMLFYPVLVIFIAIVKGNKYTGNLMTMGLAGLTFLCLAFYLITDNWQPISVIV
FT                   RRVFMVTADNHFRYYDAFKNIDFVYLTDKSWVFGGKLYPYNYPIQALISMIYYGHPNTW
FT                   VNTGFIANGYANFGFYGMLIYSAITGWLIGIMDEISYKKMPLWVAIAITIVPVFNLISV
FT                   DLLTGLLYHGLIMSIFLMWLLSKRDKKVKEI"
FT   CDS_pept        464808..465827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0409"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07827"
FT                   /db_xref="GOA:B0S0N5"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0N5"
FT                   /protein_id="BAG07827.1"
FT                   /translation="MEELNLKEAWQAVIRKLPHIIIIMLVCALLANVFNNVLGEDSYSS
FT                   KVSIMVGSPEDFEKEGAVVSKVDAMINQQLVSNVEQLLKSNAVLDTVAEKVGNGVSSSD
FT                   LKKDLKVKSVPSTSIIEMEYSSEREDVTNKVLDESLKAITELTKKTMKKDNIQVVDAPN
FT                   AKKKMKQLVNKIDTAIGLFLGMLIGLAYAFASYYKDPNIFSKEQLQNKLGIETVSVLSN
FT                   DYDENSSSALSLLNRRIDKFDNIGVFSFNQNTANLAKAYNSNFDKKITAVSPISEKVDL
FT                   TDLTTDIKNAIVLYKNGDSRLGEIKNTLEAIKSLGINPIAAVEISKYNSDDKKYLPYA"
FT   CDS_pept        465911..466564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0410"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07828"
FT                   /db_xref="GOA:B0S0V8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V8"
FT                   /protein_id="BAG07828.1"
FT                   /translation="MINSKLFKNFTEEEFEQFLIESNSIINKYNKNSFVFSLGDICDKI
FT                   YVLKSGKLSLEKTDINGKNTVVNIFKNHGEVMAEVYSYLNKISDFTLVCNTDCEILEIP
FT                   VRFFDISKSSTPIKNKIMTNLITILAEKAFFLNSKVRMLSSFSLRQKIATFLIQTEKEN
FT                   VSNTGMTRQQMADFLATTRPSLSRELLSMEDSGLIELNGSEIKIKNREELENLL"
FT   CDS_pept        466653..468314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0411"
FT                   /product="prismane protein"
FT                   /note="hybrid-cluster protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07829"
FT                   /db_xref="GOA:B0S0V9"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V9"
FT                   /protein_id="BAG07829.1"
FT                   /translation="MEKTIEKNQEMFCYQCQETAKNIACTKKGVCGKTSDVANIEDLLV
FT                   WVTKGLGEILTRMRKENKDIKNLHSFVNNNLFTTITNANFHYEDLLEKVKETIDLNQKL
FT                   IEGLDDKENLSKAALYNEKDDDELKLKSQIIGVLNTLDDDKRSLRELITYGLKGMAAYN
FT                   RHANVLGKFDDNVDEFMESTLAKLMDDSLSVEDLIALTLETGSNGAAAMALLDSANTSA
FT                   YGNPEISEVNIGVRNNPAILISGHDLKDMEMLLEQTQNTGVDVYTHSEMLPANYYPAFK
FT                   KYDNFVGNYGNAWWLQDKEFESFNGPILMTTNCIIPPKDSYKDRVFTTGVAAYPGMKHI
FT                   AADENGYKDFSEIIELAKKCESPKEIEHGKIVGGFAHNQVLALADKVVEAVKNGDIQQF
FT                   VVMAGCDGRQRGRNYYEDFAKALPEDTIILTAGCAKYRYNKLNLGDINGIPRVLDAGQC
FT                   NDSYSLVVIAQALQKAFGLDDINDLPISYNIAWYEQKAVIVLLALLSLGVKNIHLGPTL
FT                   PAFLSPNVANVLVENFGIAPIGEVDEDMEKFGIKTK"
FT   CDS_pept        468447..468992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0412"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07830"
FT                   /db_xref="GOA:B0S0W0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0W0"
FT                   /protein_id="BAG07830.1"
FT                   /translation="MKYEDFVLKCEDIEIKALEMKYLDDFHEYAIQKEVGPSAGWKPHE
FT                   SIRQSKKILKEFINSKLEYGIFLEDTLIGIVGIYEDDYLFEQPEFEEKTGVEIGYSLNK
FT                   NYWNRGIMTKVVTCFTNHLLNDLEYDYISCSCFVENNISARVIEKCGFKFYSKHLYQNF
FT                   DGTNKLCNYYYIENLKEG"
FT   CDS_pept        468994..470391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07831"
FT                   /db_xref="GOA:B0S0W1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0W1"
FT                   /protein_id="BAG07831.1"
FT                   /translation="MNLALKKSKFFGDKNFYKGVLVLAIPIIIQQLITSFVNMLDNIMV
FT                   GQTGTFAMSGVSVANQLITVFNLAIFGLVSAASIFAAQFAGKKDYKNVQNCLYFDVVLS
FT                   FIVSVISVLIFWVFGEKLLYLFMNPDTDTAKNIATTMEFALDYTKIMTIGFIPFAFSQS
FT                   ISSSMRVNGETRLPMITSVITVLVNFVFNLVLIFGLLGFPTLGPKGAAIATVISRFVEL
FT                   SLFIYFANKNKFRFTFYSDFFKNFHIDTHLFKNITVAGIPLIINEVLYSLGIAAITQSY
FT                   STRGIEALAAYNISQTIIGLFIVFNLAMGDCISIMVGRLLGSGNIDEAVDTDRKLVVFS
FT                   FMLAVVVGIVLIILAPLFPEFYNTTNDVKLMATNMLRVGGAFLWISALYNASYFTLRSG
FT                   GKTILTLLFDSVGIVLISYPFSFLLAKFTDLNVVLMYLIISVIDLYKVILGLILVGKKI
FT                   WVKNLAK"
FT   CDS_pept        470477..471946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0414"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07832"
FT                   /db_xref="GOA:B0S0W2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0W2"
FT                   /protein_id="BAG07832.1"
FT                   /translation="MSEVRVRFAPSPTGFLHIGGLRTALYNYLYAKRNNGKFLLRIEDT
FT                   DRTRYVEGAIENLLEQLKWAGLDPDEGVVLDDEGNVTEVGECGPYIQSDRVKQGLYQKY
FT                   IDELIEKGYAYYCFCSKERLDQVKAQQKADGLMPKYDGLCRGISIEDAKKRIANGEEYV
FT                   IRLKLPENKEITFNDAIKGKITFNTNDMDDQVLIKSDGFPTYHFAVVVDDHLMGITHIV
FT                   RGDEWISSTAKHVYLYQCFGWDVPEFVHLPVVLNKSGKKLSKRNDDVAVKDFRKKGYLP
FT                   EAIDNYLALVGWSSEDNQEIMSMEELKHKFDFNRVSKSGGVFDTEKLNWINRHYIKEIE
FT                   NEKLASMLKPYLVEDGVISEDYPEYKLIEIASLFKEELDYMAEITEKVEFLFKDYEMDD
FT                   DAKEFLNYEKLDELMNALKEEIESVDEIEKEFASGVMKKVQKKTGIKGKDLWMTTRAVV
FT                   TGNVHGPDLDSIMVVLGKQEVLDRINKALNR"
FT   CDS_pept        471955..473343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0415"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07833"
FT                   /db_xref="GOA:B0S0W3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0W3"
FT                   /protein_id="BAG07833.1"
FT                   /translation="MKLYNTLTRKKEEFKPIKEKNVGIYVCGPTVYNYIHVGNARPIVV
FT                   FDTLRRYFIYKGYNVKFVSNFTDIDDKIINKAKDENIDFREITKKYIQAYLDNVSGLNF
FT                   DEDDTIHPKATEYIDEMIKFVKTLEDKGAAYNVDGNVYFDITKAKDYGKLSKKNIDDLR
FT                   AGARIDVNSEKKNPMDFALWKKRKEESEPAWESPWGMGRPGWHLECSVMSKTILGDTID
FT                   IHAGGEDLQFPHHENEIAQSETCTGAHFANYWLHNSMITVDKEKMSKSKNNFFLLKDIE
FT                   KEFDLEVIRLWLLSVHYRNPIDFSHDTLVATKNSLDRLYTAKKFLNRILENSSEKEEKD
FT                   DNIKTFREKFEQAMDDDINTADAISVLFDFIKYINKNYDENTSKNILLDAKKLMDDISY
FT                   VLGILFKEDDDDLDSEIEELIEQRNAARKEKDFKKADEIRDKLLSMGIVLKDTRDGVIW
FT                   ERSN"
FT   CDS_pept        473343..474104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0416"
FT                   /product="thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07834"
FT                   /db_xref="GOA:B0S0W4"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0W4"
FT                   /protein_id="BAG07834.1"
FT                   /translation="MKVNLIRYTPDAQKLVASSAKLCYSDSSVMEIEEGLTDENVENFI
FT                   DKLMGLGHMSPVEHISFTFAIEGVSRTLTHQLVRHRLASYSQKSQRYVRANNYEYIIPP
FT                   KIKNNPKALEIYERHMKHTIDAYNELTEILIQEEYDKLIANGIDEKKAKAMSEKSSIED
FT                   ARYVFSNATETKIVMTMNARELLHFFEARCCQRAQWEIREMATLMLIEAKKVCPQIFKK
FT                   AGPGCVKGSCPEGKMTCGKIKQVREYFNSLD"
FT   CDS_pept        474117..474962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07835"
FT                   /db_xref="GOA:B0S0W5"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0W5"
FT                   /protein_id="BAG07835.1"
FT                   /translation="MGKIAILTDSGSEITPKIAEEYGIELMPLQINYSDASYNDYTIEP
FT                   KYIYENIDREVPKTSIPSLGDIVNKLNEIKNKGFDKIICISISSKLSGMYNAFMLAKEQ
FT                   VEDVQVEVFDSKNISIGTGFFAIFARKLIDEGFSLESIIETMKSKIKDSVPVITLDTLK
FT                   YLSLGGRIGKITGIVGNLLNLKLIISCNEDGEYYTVEKNRGTMKNINRAIDIVKKELSG
FT                   IKDYYLVLLNGDNQSAMEKAKESMNDLIEGAKFYYEGQIAPTLSIHTGPGLFGIGYFKL
FT                   "
FT   CDS_pept        474982..476349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0418"
FT                   /product="putative DNA damage-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07836"
FT                   /db_xref="GOA:B0S0W6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0W6"
FT                   /protein_id="BAG07836.1"
FT                   /translation="MGNKKSNIEFITNGNITDVIFKLSIPLMISNLIKTLYGITDGIYV
FT                   ARISSEDYAATSFTWPVLYLFIAVGLGVSVAATSLMSQRLGARKLKDCSIYAVHTLILT
FT                   TVLGVIFSILGLITAPFIVRWMGAKGSFEYKSYIFLAINSLGLLFDMIFFGYQSILNSQ
FT                   GRTKSMTIISTISSVTNVVIDPFFIFDNVLGIPGLNMGLAGAAWATVLSKVLLVVFAVR
FT                   VVKKESEIEVNFKNFKLDMGIIKHIFSIAIPASLGSSGEAIGFTVLNGFIQSYGTTTLA
FT                   AFSMGNRLSDIFNQGAIGIGMALTSITGQNIGAGKKERSKSIFKRANIIITFFSLASAI
FT                   IILLFKDQLLSVFIKDRSDIELWRQASEYMYFSAIITFFMGYFSAINGFFQGVGKTKLT
FT                   MYLSLARLWALRLPLIMILKSLTNLGSTGIWISMLVSNGLTVLIGFIIYKQGQWER"
FT   CDS_pept        476685..477965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0419"
FT                   /product="proton/sodium-glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07837"
FT                   /db_xref="GOA:B0S0W7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0W7"
FT                   /protein_id="BAG07837.1"
FT                   /translation="MIKSLIALVVAFALCVVIDRLKKKGTSFMIRILLATAMGAIVGLI
FT                   FKGATDYVAIFGRVFISLLQAFVIPLLLFSIITTVASLESTEKLRSTGGKTIGILALHN
FT                   VLASVAALILGKLVNLGVNANIKMDVTDKVKEVPPFSDVFVSFFPKNIVDSMLHTKVVP
FT                   IVIFAVIIGVTALKYSNKDEIKPFMDFTAAANKVMNKVIGEIIEFTPYAVLSLLAHQVA
FT                   TLDLSFVASLLFLLLMVYVCCFFHTFITTTVMLKFMAHVNPFKFQRKFFPAWLLGFTTQ
FT                   SSLGTLPENIREQEKMGVPTETASFAGSIGTTFGMPGCAAVWNILLAVFTINALNIPFT
FT                   ITQYVIMVFTALLASAGTVGVPGTGTMLNVALFTAMGLPLEMILVLSPIQGVADMARTS
FT                   TNVHAGGSTGIIVAAMQHDLDLEKYNS"
FT   CDS_pept        complement(478067..479005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0420"
FT                   /product="choloylglycine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07838"
FT                   /db_xref="GOA:B0S0T8"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T8"
FT                   /protein_id="BAG07838.1"
FT                   /translation="MCTTIIVDYPQGSVMARTLDFEVPLEYNMIYIPRGFHYADDLYHK
FT                   PMRSKFKMMGMCFRNLYPIKDGVNEHGLCGCTNMFIANNLFSNHPIEGKINTNSLDFMN
FT                   FALGNYKTVEELLDDLDNIHLANKDVDGNSVICPDFHFMFVDRTGDSIILEYKDHKLVP
FT                   CGDNPKVMTNSPKYSSHVKRYEKSIGDLSKFNQIKDLTGAYDPVSRFIRAKYILSTHKK
FT                   SNNVNEAYSSAFSILEPLKITEGFFKNDSHDYYTFTRYISAFDTQTASMAVRTHSNTQT
FT                   YLIDFDDIPDENKIFSYYFENKLEFKRINKG"
FT   CDS_pept        complement(479007..480392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0421"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07839"
FT                   /db_xref="GOA:B0S0T9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0T9"
FT                   /protein_id="BAG07839.1"
FT                   /translation="MFNFNIEEHKFKYIHFIGIGGISMSGIAELLNHYGYKISGSDREE
FT                   SDETNRLKSLGVEIFIGQKRENIKNPDLIVYTDAILDDNEELIAARELGVDVVSRGVFL
FT                   GALMRNYKYSIGVSGSHGKSTTTSMIAKILIDAKVDPSILLGGKLDEIQGNVHCGNSEY
FT                   MLTEACEYKANILNYYPSMAIILNIDEDHLDFYKDLNHIVATFIGYMKNLDENSKAIIN
FT                   IDDKNCEPLLSHIKGEIITFGIENEKADYNVHDITFNENGNPSFVVSSEKFDKDEEFSL
FT                   SIIGRHNIYDAVAAIIACYEFHIDIDTIRKNMKEYHNLHRRMETIGFYKGCEVKTDYGH
FT                   HPTEIKNTLKALDEHKKGKFYCVFQPHTYSRTKMLLDDFANAFYDCDEVVVTEIYAARE
FT                   KFDSSIHSTDLVEKLVKNGVNAKYYKTFEEARDYIRSKVCDNDLVLTTGCGNPDVLAKM
FT                   IVE"
FT   CDS_pept        480538..481323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0422"
FT                   /product="pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07840"
FT                   /db_xref="GOA:B0S0U0"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U0"
FT                   /protein_id="BAG07840.1"
FT                   /translation="MKDILLINDMPGYGRVALSCMIPVLSNKGKSVFNLPTAVVSNTLD
FT                   YGKFAILDTTEYMKQATKVWEELDFSFDLIATGFLNSLEQVDIIKDFIAKQKNSPEVVV
FT                   DPIMADNGKLYNGLNEDNIENFRRLIDVATVIIPNETEARMIANMMNEPINDVAKKLIE
FT                   MGAKYVVITSAEENNEHFVFCMDENFVSDKIYYEYINTSYAGTGDLFSALFISQYSENK
FT                   SIFDSAKYASLKTTELLKLSLDIKDKARGLPIERFIDIL"
FT   CDS_pept        481425..482297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07841"
FT                   /db_xref="GOA:B0S0U1"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U1"
FT                   /protein_id="BAG07841.1"
FT                   /translation="MIDLDALERRNKRKSVIMMAVGVILIALGIHFFLAPNKLSLGGAA
FT                   GMAIVIGNFVPISTGPILIIINTILFIVGFIMLGKAFGLKTIICSLGLSLLVWILDIVF
FT                   PMEKPLFDGKMIQLIAAVMIYGSGVGIVLNNYASTGGSDIFAKILNKYLGIELGKGCLI
FT                   VDFLITLSAWYAYGTEIAIYSLVGTVLNGLIIDFTINGMNTSKLCTITTSKPDEVCKFL
FT                   VDKLTRSANIYTAKGAYSGLEKEIVQTVVSNRDFIMLKKYIQEIDPLAFVIVCNASETY
FT                   GWRWRNIIE"
FT   CDS_pept        complement(482425..483570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0424"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07842"
FT                   /db_xref="GOA:B0S0U2"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012116"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U2"
FT                   /protein_id="BAG07842.1"
FT                   /translation="MDNKKISEVFLEISEAIESGKFGKKVKIGLTTLGSEHGVENMKKA
FT                   IELAKSDLFEVVVIGERVDDEHETYEVDNDEDMYKKMEELLDSGEIQACVTLHYNFPIG
FT                   VSTVGRVYTPGHGKEMFLATTTGTSDTERTKAMVRNAVAGIIAAKSCGIAKPTVGILNI
FT                   DGARQVEKALKHFKDNGFDIEFAESQRADGGIVMRGNDLLMGSCDVMVTDSLTGNLLMK
FT                   MFGSFTSGGNYETTGFGYGPGIGEGYERNIFIVSRASGAPVVANALKYAYQTVAGGIDN
FT                   NKKSIYKQAHKADFNGILESLSKKEAPKASSEEVKMPDKEVVSATISGIDILEIEDAVQ
FT                   ALWKENIYAESGMGCTGPIVQVSDANLDKASQILKQNGYIE"
FT   CDS_pept        complement(483581..485128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0425"
FT                   /product="glycine reductase complex selenoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07843"
FT                   /db_xref="GOA:B0S0U3"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U3"
FT                   /protein_id="BAG07843.1"
FT                   /translation="MNFPVLKGAGYVLVNTPDMIIQNGSTCQTERVVNPDSEFLKEVGK
FT                   HIRSFDEVVKYLPNQVYIGNVKPQELENYEMPFTDHTYEEGKADGKMGKIVKQDVFIAL
FT                   LQMCDAFDLVKLSEEFVNEIKPVIEEEYPILEPYFSHLKGSDISNAQELFDTHMAEALY
FT                   HDGKVCGYIKAAHDIDVNLSAHTMFENLVVKASGVLAAVELVTKNDINRDDIDYVIECS
FT                   EEACGDVNQRGGGNFAKSIAEIVGLQNATGSDTRGFCAAPIHSLIEASALVKSGVYKNV
FT                   MVVAGGSTAKLGMNAKDHVKKGFPVLEDVVGGFAILISENDGVHPVLRTDIVGRHTVKT
FT                   GSSPQAVISSLVSHSLEENGLKITDVDKYSVEMQNPDITKPAGAGNVPEANYKMIAALA
FT                   VKQGELDRKELANFITEKGLVGWAPTQGHIPSGIPYAGHAIKDLTEGDYNRVMFVGKGS
FT                   LFLGRMTNLFDGVSIVMERNDGKMEDESSVSSESEKDQIKKVIAESMRKLAENLLAE"
FT   CDS_pept        complement(485168..485401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0426"
FT                   /product="glycine reductase complex selenoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07844"
FT                   /db_xref="GOA:B0S0U4"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U4"
FT                   /protein_id="BAG07844.1"
FT                   /translation="MVKAIERTGLPVVHICTVTPISLTVGANRIVPAIAIPHPLGNPAL
FT                   TKEEEYSLRKKIVMKALNALTTEVEDQTVFED"
FT   CDS_pept        complement(485429..486478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0427"
FT                   /product="glycine reductase complex selenoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07845"
FT                   /db_xref="GOA:B0S0U5"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U5"
FT                   /protein_id="BAG07845.1"
FT                   /translation="MDKIKVVHYINQFFAGIGGEEKADTKPFIAEELPPISAQLAKALG
FT                   DDFEVVRTVVCGDSYFGENMEAAQKEVLEMIKEANPDFVVTGPAFNAGRYGVAAGTMAK
FT                   AVKDELNIPVLTGMYPENPGADMYKKDVYIVETKNSAAGMRDAMKKIGKLGPKVAKGEE
FT                   IGSPKEEGYIERGVRVNFFADKIGSQRAVEMLIKKINGEEFETEYPMPAFDRVEPGKAI
FT                   KDLSKARIALVTSGGTVPKGNPDHIESSSATKYGSYDFHGIDDLTEENSETAHGGYDPV
FT                   YANEDGDRVLPIDVMRELEKEGVIGSLHETWYSTVGNGTAVANADKFGTEIGEKLLADN
FT                   VDAVVLTST"
FT   CDS_pept        complement(486497..486823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0428"
FT                   /product="glycine reductase complex selenoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07846"
FT                   /db_xref="GOA:B0S0U6"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U6"
FT                   /protein_id="BAG07846.1"
FT                   /translation="MDLENQKRVKDFAEQYGAENIVVLLGAAEAEAAGLAAETVTAGDP
FT                   TFAGPLAGVELGLLVYHVVEEECKEQFDADVYDEQVGMMEMVLDVDEIAEEMNDIRSEY
FT                   CKFL"
FT   CDS_pept        complement(486839..486973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0429"
FT                   /product="glycine reductase complex selenoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07847"
FT                   /db_xref="GOA:B0S0U7"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U7"
FT                   /protein_id="BAG07847.1"
FT                   /translation="MGFLENKKVIIIGDRDGIPGLAIETCVNTVPNTEVIFSSTECFV"
FT   CDS_pept        complement(487034..488326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0430"
FT                   /product="glycine reductase complex proprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07848"
FT                   /db_xref="GOA:B0S0U8"
FT                   /db_xref="InterPro:IPR015417"
FT                   /db_xref="InterPro:IPR016585"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U8"
FT                   /protein_id="BAG07848.1"
FT                   /translation="MRLELGKIFIKDIIFDEGESRIEDHILYLNKKELADVSGVADDEH
FT                   LESIDFDIAHPGESTRITPVKDVNEPRVKVEGGEIFPGILNKVDPVGSGKTIALKDIAV
FT                   VTTGKIVGFQEGIIDMSGLGAEYTPFSKTVNLVVTIEPVEGVKQHNHEAGVRMAGLRIT
FT                   DFIGRLAKDLEADEWETFETLPILEQVKQYPELPKVVYVYMLQTQGLLHDTYVYGVDAK
FT                   KIIPTFLYPTEIMDGAICSGNCVSACDKNPTYVHLNNGVIKELYKEHGKSINFLGVVIT
FT                   NENVYLMDKIRHSDMTAKLCEFLGADAAIVSQEGFGNPDTDLIMNCKKIEGKGIKTVII
FT                   TDEYAGRDGASQSLADADPAANAVVTGGNANQFITLPKMDKVIGHIQFVDTIAGGSDGA
FT                   LKDDGTIEVEIQAITGATNETGFNTLTAKTY"
FT   CDS_pept        complement(488434..488754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0431"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07849"
FT                   /db_xref="GOA:B0S0U9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0U9"
FT                   /protein_id="BAG07849.1"
FT                   /translation="MLELDKKTFEPEVLEAEGLVFVDFWSDGCEPCKALMPGVHELAEK
FT                   YGDKIKFCSLNITSARRVAIKQQVLGLPTMLMYKDGQKIDEINKDDANLENIEAMIQKH
FT                   YN"
FT   CDS_pept        complement(488776..489150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07850"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V0"
FT                   /protein_id="BAG07850.1"
FT                   /translation="MLLITNNEYFKDAIKRTDIKVEYIDIDYIGILKKARDLIHQNYRL
FT                   VTHPLYGSVKPNETVFRSVILEKGDKFDTDSLMMIEECINTATKFMNISKPKRWPAEIL
FT                   DDFRVVDFDIISQTLDRILI"
FT   CDS_pept        489484..490890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0433"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07851"
FT                   /db_xref="GOA:B0S0V1"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V1"
FT                   /protein_id="BAG07851.1"
FT                   /translation="MGTNLQEMFKKLPQVSEILESEEILQAYEEYPESLIKDSVRESIE
FT                   FFRNRILNKEEFDFYNKDVIDKAFELMDKNFSPSLKPVINATGVILHTNLGRSLLNEKV
FT                   VDNLCKIAGNYSNLEYDLDEGKRGSRYVHAVELLKRITKAEDAVVVNNNASAVFLTLNT
FT                   LAQNKEAIISRGELVEVGGSFRISSIMEKSGAKLVEVGSTNKTHMYDYEDNINEETALI
FT                   MKVHTSNYSVVGFSESVSGDELRQLCDEKGIHLIEDLGSGSLIDLSKFGLSYERTVKDC
FT                   INEGIDLVSFSGDKILGGPQAGIIVGKKELISKIKKNQLLRAFRVDKFTLGALEETLKF
FT                   YLDEEKAIANIPTLKMISMPKEEILRKAEKLKSMIEKEVDLNMEIVESQSEVGGGAYPL
FT                   DKLDSYSIAIKPDMKVSEFERGLRLSKDHIIGTVHDDTFFMDLRCIFEKDFERIVKVIK
FT                   LNTILKKMPM"
FT   CDS_pept        491171..492304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0434"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07852"
FT                   /db_xref="GOA:B0S0V2"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V2"
FT                   /protein_id="BAG07852.1"
FT                   /translation="MKQKYNIGQVITYAGAFIALLIGSGFATGQEILQFFSSYRLYGLI
FT                   GIMICFGLFTFAGLSFLNDGYYQKFEKPNDIYKLMCGNKIGTIFDYYAVFFIFLSYTVM
FT                   IAGAQATAVQHFNAPKYVGGAIMAAVVILVVMLGLGKIVDVIGKIGPVIAIMAIVIGII
FT                   SIVMNMDKLQSSLALMDQLVKGGQVKVASKNFFLAAGSYVGFNMIWLVAFLAEVGNKAK
FT                   SLKDAQAGVYVGATGFSVAIFIMSIAIILSIPDLYNSQIPVLILAGKIHPLLATVFSIF
FT                   IMLGIFTTSVPLLWTVTGRFYKEGTKKYKLFTLIAGIVGAIIGLTLKFDSLVNVVYVVN
FT                   GYIGMVLLAWMIFRSASGRAKKQSIDGAKRNNIEYEN"
FT   CDS_pept        complement(492497..492823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0435"
FT                   /product="glycine reductase complex selenoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07853"
FT                   /db_xref="GOA:B0S0V3"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V3"
FT                   /protein_id="BAG07853.1"
FT                   /translation="MDLENQKRVKDFADQYGAENIVVLLGAAEAEAAGLAAETVTAGDP
FT                   TFAGPLAGVELGLLVYHVVEEECKEQFDADVYDEQVGMMEMVLDVDEIAEEMNDIRSEY
FT                   CKFL"
FT   CDS_pept        complement(492839..492973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0436"
FT                   /product="glycine reductase complex selenoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07854"
FT                   /db_xref="GOA:B0S0V4"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V4"
FT                   /protein_id="BAG07854.1"
FT                   /translation="MGFLENKKVIIIGDRDGIPGLAIETCVNTVSNTEVIFSSTECFV"
FT   CDS_pept        complement(493148..494080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0437"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07855"
FT                   /db_xref="GOA:B0S0V5"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V5"
FT                   /protein_id="BAG07855.1"
FT                   /translation="MYDLIIIGAGPAGLSAGLYAARAKMNTLIVEKEKTGGQITTTDSI
FT                   ENYPGGIVGESGPSLIKKMADQIDNFGLEIRRADVVDVDFSDKVKKLTLKNGDVLEAKA
FT                   VIIATGAAPRKLGCPGEKEFTGKGVSYCATCDADFFTDLEVFVVGSGNSAVEEATYLTK
FT                   FARKVTLLVRGDHLKCDKTAEDEAKACDNLSMRFNTSIKEIKGEGILESIVMVDKESGK
FT                   EEEYHCDEDDGTMGVFVFVGTIPYSDVFKGKIELDEYGYILGDEEMHTNVEGVYVAGDV
FT                   RQKTLRQVVTAAADGAIAATQAEKYVDKF"
FT   CDS_pept        494522..495913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0438"
FT                   /product="sodium/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07856"
FT                   /db_xref="GOA:B0S0V6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V6"
FT                   /protein_id="BAG07856.1"
FT                   /translation="MDQKVLNDTIVAINSFLSNNILLIALLGCGIFYTIYSKGVQFRKL
FT                   GAAFKQTFGGVFSKEKKSGDEGVSSFQALAVAIAAQVGTGNVAGVATAIMAGGPGAIFW
FT                   MWLAAILGMATIYAEAVLAQKFREKDDEGNFVGGPAYYIKNGIGPKHPGLAKVMSTAFA
FT                   ILIVIALGFVGNIVQSNSIATSVVAATGGKLNPIIVGIVVAVLAGGVFIGGIKRIANFA
FT                   QLVVPFMALVYIIAAIIMMVKFHAHIIPAFKLIFEAAFNPEAALGGALGITIKMAAAKG
FT                   VGRGLFSNEAGMGSTPHAHATANVAHPVLQGYTAMVGVFIDTIVICTVTALMILVTEAW
FT                   TDKSLNGALVTQEAFTRAFGPTGTILLAVALGFFAFTTIVGWYYFGETNIRFLFGHKGL
FT                   WPYRILVLLCIIAGSLQEVDLVWNTADLTNSLMVIPNIIAIIMLHKHVKNMTLHYETNG
FT                   KEGSL"
FT   tRNA            complement(496419..496509)
FT                   /locus_tag="FMG_tRNA16"
FT                   /product="tRNA-Ser"
FT   CDS_pept        complement(496680..496931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0439"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07857"
FT                   /db_xref="GOA:B0S0V7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0V7"
FT                   /protein_id="BAG07857.1"
FT                   /translation="MGIISWIIVGALAGWIGSKITGNDANMGAGANILCGIVGATIGGW
FT                   VMSIIGKSGVNGFNLYSILVAILGSVILLSIINKIKKK"
FT   CDS_pept        497120..498019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0440"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07858"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E0"
FT                   /protein_id="BAG07858.1"
FT                   /translation="MIYAVIDIGSNTIRLSVYKVIGDEVKNLFNEKSSASLASFIEKGM
FT                   MNEHGIQKLINTLKEFKNLISNFEDISKTYAIATASIRNSCNRREIIERVRTEVGIDIE
FT                   LISGEEEAKLSFLGSGIDSQSGILTDIGGGSSEIVVFEQGKVVKTSSLNIGSLVAFDNF
FT                   ARGLFITKDEKKLLEDDIKLMLASNNLNRVQHDLVCAVGGSARACLKLYNEYYDKEAGN
FT                   VIITMDGLKNLINTLINMENRAKMKLILKVKADRIHTLIPGMIILYRIAKYFYADIIRV
FT                   SMTGIREGFVYSKILERG"
FT   CDS_pept        498021..500207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0441"
FT                   /product="polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07859"
FT                   /db_xref="GOA:B0S0E1"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E1"
FT                   /protein_id="BAG07859.1"
FT                   /translation="MNDISFTQNRELSWLKFNERVLEEAADKSVELFERVKFFSIFDTN
FT                   FEEFFMVRVGSLTDINDMKKKVIDNKTLMSTQEQIDCIMDESKRLYEKKDTVYEDLKQD
FT                   LQEENVSICRVNELDDKEKRLVYYYFNSTIAPILSFQIVDRVHPFPQIPNLAIVVLFQL
FT                   TSQSKNKKQFMGLIQVPDKIKRYVKLSDTKVVLIEDIIREFGQEIFDNYDCTSKYILSV
FT                   TRNADIEYDDEDLEFDDDYRSYMKKMIKLRKRLRPVRLEINEYPNEETREFLLKNLNLT
FT                   EHRMFVTKSPMRCGFLFDLVYDMPKNVIKKYTYEDFSPQESSMISKEKSVIEQVYDKDL
FT                   FLSFPYESIDPFIRLLNEAAEDESVVSIKITIYRLAKDSEITKALIKAAENGKEVVVLM
FT                   ELRARFDEENNILWSSRLENAGCRIIYGFDHYKCHSKVCLITKIKDEKISYITQVGTGN
FT                   YNEKTSKLYTDFSYMTTRQEIGEDAKELFDNFLLGKIDGEYKHLMVSPHSMQVGLDKLI
FT                   DEQIEKAKVSEDGYIRIKMNSISDRKLIDKLSKASCKGVKIDLMVRGICCLVPGIKDKT
FT                   ENINVYQVVGRFLEHHRIYQFGKAENCKLYISSADFMTRNIRKRVEVAVPIYDDYIKHR
FT                   ILNFMDIMFADDTKIRKLNSDKSYSKVENTENKNSQEILIDIAKENSVKRNLQSDDNRV
FT                   ISSHSNKTINPDNNDNKRITVFDKIKNFFKNLTH"
FT   CDS_pept        500255..501037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0442"
FT                   /product="nucleotide-binding protein Mrp family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07860"
FT                   /db_xref="GOA:B0S0E2"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E2"
FT                   /protein_id="BAG07860.1"
FT                   /translation="MTERKVPNFLIESNTGSNIKNIVGIVSGKGGVGKSLVTCLLANEM
FT                   AKKGYKVGIMDGDITGPSIPKYFGLTEKATADSEGHINPVTTSNGIKVISMNLMLPKDD
FT                   DAVIWRGPVIAGVVKQFYQDVNWGDLDYLFVDMPPGTGDVPLTVFQSIPIKGIVVAMSP
FT                   SGLVEIIVKKALHMAKMMGKKVIGLVENMSYLECPDCGKHIEVFGTSTVDKIAQEENID
FT                   TVCKLPINPEISKLTETGKISDVDTNYLENITKKIETL"
FT   CDS_pept        complement(501101..502987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0443"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07861"
FT                   /db_xref="GOA:B0S0E3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E3"
FT                   /protein_id="BAG07861.1"
FT                   /translation="MKENKQSKKKIIIYYLIAIVLYAVVAGLLFPTFSKTKEEEVPYNK
FT                   FVEMLDKGEVKEVKILDTHINFKAKNQNNVIYKAGLIRDEKLVDRLLDSKVQFSSDIPS
FT                   KYAPLLSIFLQFVLPFIIIFGFLQLAMSQATKKMGGNALQFGKSNAKIYVESQTGKKFT
FT                   DVAGQEEAKDALLEVVDFLHDPKRYNEIGAVLPKGVLLVGPPGTGKTLLAQAVAGEAKV
FT                   PFFSMSGSEFVEMFVGLGASKVRDLFKQAADKAPCIVFIDEIDAIGKRRDTAGISGNDE
FT                   REQTLNQLLNEMDGFDGNSGVVILAATNRPEILDPALTRPGRFDRQIPVELPDLQGRID
FT                   ILKVHARKIKIEKDMDYKAVALMTAGTSGAQLANIVNEAALRAVRMGRNIVTQEDLIES
FT                   VEVVIAGQQRKGTVITPKEKELIAYHEVGHALVAAMQSHSAPVTKITIIPRTSGALGYT
FT                   MQVDQEEKFLMSKEELFNMIVTLTGGRSAEEVVFNTRTTGASNDIEKATKIARAMVTQY
FT                   GMTDEFDMMSLETTNSKYLGGGNTLAASDHKAGQIDNKVESIIKSAHEKARNILTENID
FT                   KLHEISKFLLEKETITGEEFMEILNLEDEKKPETDENSVKKEEVDDTTVSDL"
FT   CDS_pept        complement(502997..503434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0444"
FT                   /product="putative transcriptional regulator MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07862"
FT                   /db_xref="GOA:B0S0E4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E4"
FT                   /protein_id="BAG07862.1"
FT                   /translation="MDYNLINTELSQLLRETYRKTDALLAPISDKYGLTIMKVKTLFEL
FT                   GKNDDLTIGDIGVLVGMAGGNISNLCKALEKEGYVSRKRSEKDERIVTVRLTEKGKEII
FT                   ENIVNEISEKYKKQIKLTNEEYNSIIKSLNLLNEKLNVELM"
FT   CDS_pept        503558..504232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07863"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E5"
FT                   /protein_id="BAG07863.1"
FT                   /translation="MENFNKKDYKKLWVNFKSSTQAMDMLVILYNIEIFEISLITIESD
FT                   VNNNVLDLMDNLDWDVEVVFLKDFMSENDVVLSRFLGDFKNIDLLNFSDMKYLSEFFAE
FT                   NNETLQSIDDIFMYDKYIKSNESDLSVLNGKSVFMITNDTLNKNDYTDILNEMFDESSE
FT                   KLIEDLFLLYAYSKKDHFIYAQTNINIDEENNLIEGEGIDTYISVTYNIDRFREFLESV
FT                   II"
FT   CDS_pept        504232..505770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0446"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07864"
FT                   /db_xref="GOA:B0S0E6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E6"
FT                   /protein_id="BAG07864.1"
FT                   /translation="MNKKFKIGSSMSLFLASLSIGVFSGGLAVFYRFLLSKLEVVRNTI
FT                   YSNNSFPRAILIIAVSFVLGICVSKLLKWAPLSGGSGIPQVQGELIGAFNQNSFRVTVS
FT                   KIVGGAIASLVGLSLGREGPSIQLGASSAKWLSEKFGKSKTEEKLYLTAGAAAGLSAAF
FT                   SAPISGLVFILEELHKSFSKKVVAISFSAAVIADVIAVWVFKIKPVFSFGMTHVLPTKY
FT                   YLLIFPMIIICSVVGKLFNCSITFFQDIFAKIKLEQDIKIAIFFAFVSVVGLFYKDILG
FT                   GGHSFIENMATHNYNSFFVLIILLLFKMFMTSTSYATGTQGGIFLPVLVLGGITGLFYF
FT                   NLMSAFGFVQDVYLSNFVVLAMVCVLTAVVRSPLLSVVLVLELNGNMTHLLGLAFCSIM
FT                   AYFICKALDFEPIYDILLKRMLNKRVEGNGVNDEFTMFDIKLGYNNGVSNKKIKDIDFP
FT                   KDALIAEVDSNGEKYVPNGDSVLKTGDIVTVLVKDEQLYDTRMKVLEVFGENNG"
FT   CDS_pept        505763..506725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07865"
FT                   /db_xref="GOA:B0S0E7"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E7"
FT                   /protein_id="BAG07865.1"
FT                   /translation="MDKIKENLNYILLAIVALLVCILVVMMFSKKNVYTINTGNSTVLK
FT                   KNYVVTHYDNKIFMYKNEDLILKKDYDDKKPYYFDGKFLYLIDKKDLLQYNTKGKINSK
FT                   LSFKSDINYIFANKDHIIVDLENEFSIVSDMKVLESFDLKDEVSSLIASNKSNYALSTI
FT                   GKRDGRIFSKIYMYDDKGLFYKNIFVDKPIFRMKYVGDNLIVVFDGYIKVFDKANIIKS
FT                   KSFDGTKNVGISDNNVYVITKTGELLIYDKDLNLVSQSKIDDSLKIYSNDKNCILYNQN
FT                   GYFIFEDSKLVEYKASDLKSITGEDDFYLIFNNRIERIR"
FT   CDS_pept        506728..507309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07866"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E8"
FT                   /protein_id="BAG07866.1"
FT                   /translation="MEIVDARGQVCPRPIIMTKNVFDELEEGTVKTQVDDMYCVENLQK
FT                   YANGQGFEFSYEETDYGFETTIVKEKGAQKKVEETNGNLVLAFSTDKMGDGDEKLGKSL
FT                   IKSYIYSVAEADEVPSTLLFFNYGIHLTTEGSEVIDDLKRIEEKGAKIMTCGACLDFYD
FT                   RKEKLLVGEVTNMYVIYDTLSKADRNVIIR"
FT   CDS_pept        507309..507563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07867"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0E9"
FT                   /protein_id="BAG07867.1"
FT                   /translation="MEKILLTFTSVNFTMMTESKLVSMGYDIKTIPTPREISESCGLAI
FT                   MLDPDKKDEMIALKKELPISKIWSYLKVDGVIFVNEVKE"
FT   CDS_pept        507567..508406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0450"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07868"
FT                   /db_xref="GOA:B0S0F0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F0"
FT                   /protein_id="BAG07868.1"
FT                   /translation="MLFSIQKFNEIFYNSAGQLNLLAKILLSLLIIALTQVVVSILTTS
FT                   FDKLLMKKGSSIEGRQITVTKLLNNTIKYLIYFFCVVHVLDLFGVKTDKILATAGIGGV
FT                   AIGFGAQFIIRDVISGLAIILENQFKVTDHVIINGIEGNVQELGLRVTKIRGFDGAIHL
FT                   ISNGQINTVTNLSKENQRIEVKMEVPIKYSLDQYAEIVNEISNELVDKYSDIVKKPELI
FT                   GVTKMDKNSMTITIWGSCKPESQYLYQREIIKKFIEKAKSKSMDLNCYFVAGDENEI"
FT   CDS_pept        508396..508623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07869"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F1"
FT                   /protein_id="BAG07869.1"
FT                   /translation="MKYKVNDIVTLKKGHPCGENKWEILRTGADIKLKCLGCDKIVWLT
FT                   RLEFNKRIRKIQDKTGKFVSIVHYEPEDDE"
FT   CDS_pept        508641..509630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0452"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07870"
FT                   /db_xref="GOA:B0S0F2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F2"
FT                   /protein_id="BAG07870.1"
FT                   /translation="MNYVVIPAYKPDEKLTKLVDNLSVNHLNIIVVKDGPCDYDFSKLN
FT                   NIVLLEHQTNMGKGAALKTAFKYLKAQQANGTVVTSDADGQHLVKDILKLIKFSEQNKD
FT                   KLILGVRDLKRGIPIKSLLGNTITRMVFYSSSSKYIKDTQTGLRAFNTSQLDKMIEIEG
FT                   DRYEYEMNMLYEFDSESIMQVPIETIYIENNETSHFNALKDSAKIYKSILKFSTSSYLS
FT                   FLVDYFTFILLFYKLDVQSLVLSNIIARAVSSTFNFYVNNKYVFKNKDKILKKYIKYVT
FT                   LVVFILALNTVVLKILQALGIRVFVAKIITEALMFIVSYNIQKRIIFK"
FT   CDS_pept        509753..510226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07871"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F3"
FT                   /protein_id="BAG07871.1"
FT                   /translation="MKKIGYLLFAIIISLLMVSCAQSDKSRVSDELNLKLVKANQIMKY
FT                   DDHGAMGDGTRFITFEFGSNDTLNQIKSDSKWKKFPLDKTTKTLMYGDEKTSSYVTDNN
FT                   SRLLFPEISEGYYMLIDRQEDKSQNILKRSSLNFTLAVYDTKSNTLFFAEIDT"
FT   CDS_pept        complement(510296..510799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0454"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07872"
FT                   /db_xref="GOA:B0S0F4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F4"
FT                   /protein_id="BAG07872.1"
FT                   /translation="MITRIANENDISEIMEIVEKAKSYMKENKINQWSENYPNEDVFLT
FT                   DLKENRLYVAEIDKKVVGMAVLVLDGDDDYKNIDGKWLSDGKYGVIHRIAVHPDFKSQN
FT                   VAKNLLDFFEDKLKELNYDSIRVDTHKDNKSMLRFIEKNGFQKCGIVYIRKTDERIAFE
FT                   KSLK"
FT   CDS_pept        510939..512120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0455"
FT                   /product="arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07873"
FT                   /db_xref="GOA:B0S0F5"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F5"
FT                   /protein_id="BAG07873.1"
FT                   /translation="MKPNIYSEIDKLKSVIVHRPGEELNNLTPDFMEELLFDELPYLEN
FT                   AIKEHDFFCETMRNEGIEVLYLEDLAAESIEQDDVRKQFIEDFLEESGNKSADEINLLR
FT                   DLLTNISDEKELILKTMSGVRLDEIGINDESGRLLAVNPMPNLYFTRDPFSFVGNCVSI
FT                   NRMWSETRNRETLYAKYIFTYNSRFNDIEKIYDRTEDTSIEGGDILILNSECVAVGISQ
FT                   RTQKESVDKFAKNLLEKSDFKFVLSFKIPNKREFMHLDTVFTMIDKGIFTVHPLIEGPL
FT                   YVEKLYLEDSTLQREVQKGSLEEILSSNLHVDNVKIIRCGGTNPIDQMREQWNDGSNTL
FT                   AIAPNTVIVYDRNNVTNSLLQEADVNIRTIKSGELSRGRGGPRCMSMPFEREM"
FT   CDS_pept        512123..513112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0456"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07874"
FT                   /db_xref="GOA:B0S0F6"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F6"
FT                   /protein_id="BAG07874.1"
FT                   /translation="MLKGRDFLTLKDFTKEEIEHLLDVSAALKEKKRMGIVGETLKGKN
FT                   IVLLFEKTSTRTRCSFETACHDEGGNVTFLGMNDSQFGKKESVRDSALVLSRFYDGIEF
FT                   RGFDHATVEELAKYSSVPVWNGLTDIYHPTQILADFLTVKENIHKNLDQVKFVYVGDGR
FT                   NNMANSLMIGAAKLGMEFVNLAPKELHPSNEMMNTIQEIAKESGAKITVTDDFNSLKGA
FT                   DVIYTDVWVSMGEEDQFEERINLLKDYQVDMKKIEMTENPNVIFLHCLPSFHNLETKVG
FT                   REIHEKFGLSEMEVTDEVFYSKYSKVFDEAENRMHTIKAVIVETIGNK"
FT   CDS_pept        513297..514523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07875"
FT                   /db_xref="GOA:B0S0F7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F7"
FT                   /protein_id="BAG07875.1"
FT                   /translation="MKSLYNRILNYSTDQKLILLTAITMFMPFYIGIGVLIVDMFYFVY
FT                   QNKFKKIFDKSNLSVFGLIFGVYSLVVSIVFNNTYGILATVGMFVLFVFLLFIRKNMTE
FT                   QFMEDCMLIIMMFASICFLITLTQYSIILKDNSFNYTQFMKYISENRTTVGTFFFNANY
FT                   YAMVCSLVGIISAYKYFSTESFERLFSFVVGVLSVLTLLITDSRGAMFASFIAVFALTI
FT                   MMKKRKYTIAIISVFALAFVGIVALGRMDLIPRVDKIGFDMGLRRSIWISAIAAFKKNF
FT                   IIGVGPLGIHNIYTTIRDRAILHSHNLYLDILVNYGLIGAGLLIPIIYQLFREIKSLYS
FT                   QKYTKMIIAMVIMVMIHSMVDVTIFWTQTSFIFLTFVAGVGELSTVPVSEFSLFKAKKS
FT                   FKTKNIYEK"
FT   CDS_pept        514623..515456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0458"
FT                   /product="metallo-beta-lactamase superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07876"
FT                   /db_xref="GOA:B0S0F8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F8"
FT                   /protein_id="BAG07876.1"
FT                   /translation="MSFKFCSLSSGSSGNSEYIETEHSKILIDAGFSGKTIENLLKYIN
FT                   VDPSELDAIFVTHEHADHIKGIGVLSRRYNLPIIANTETWYAMDNKIGKINDKNIYIFE
FT                   NNRHINFKDLDILPIKTSHDSANSCGYVVSKDNKKLSIVTDTGIIEDSVYEEIKDSNLF
FT                   FIEANHDIDMLKYGSYPPTLKQRILSDHGHLSNDSCAYLLGDILRGNHEVIQLAHLSKE
FT                   NNTPTKALSTVEGYLKSLGLDVGESVTLEVAERYSPSNIVDLEKMEIYAKNCTRS"
FT   CDS_pept        515431..516258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0459"
FT                   /product="ATPases of the PP superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07877"
FT                   /db_xref="GOA:B0S0F9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0F9"
FT                   /protein_id="BAG07877.1"
FT                   /translation="MQRTVQEVERAIIKKYRKHIWSKFIKAIKEYDLIQDGDKIAVCMS
FT                   GGKDSLLLAKLFQELQKHGMNNFDLEFIAMNPGYSEENTRLEKENFEKLNIPYHMYDTD
FT                   VFSVSEKISSNNPCYMCARMRRGALYSKAKELGCNKMALGHHFDDVIETILLNVLCSGN
FT                   YKTMMPKLHSNNFEGIELIRPMYLIREESVKSWLNYSGLKALDCACSVTKKTEGSMRKQ
FT                   IKLLIAELSDRGFTNVENSIFKSSENVDVSRILGYEYNGEKHNFLDTYGENDL"
FT   CDS_pept        516281..517474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0460"
FT                   /product="flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07878"
FT                   /db_xref="GOA:B0S0G0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0G0"
FT                   /protein_id="BAG07878.1"
FT                   /translation="MGVEPIKIQENLYYLGVNDRQTEFFENMWPLPYGVAYNSYLITGE
FT                   KTCLMDTVKVSKSDEFVDNVKAILKDRKLDYLVIHHIEPDHSGSIPQILDLYPDIKIVG
FT                   NKKTRSMLNDYYEIDSDHFVEVGEGDVLDLGDRKLTFYLTAMVHWPESMVSYDAENKIL
FT                   FSQDIFGGFGTNDGAIYDDELDYDLRRTEFRRYYTNIVGKYSQMAVRAINKLSSLEIET
FT                   ICPVHGCIWRKQPSRIVEDYTKWATYEVSEGVVIAYASMYGNTELMADQLARYLADEGV
FT                   RNIEVMDVSKTHESYILSNCWEKKSLVLGSCTYNNTVYPVMNNLLNILKMQKLKNHVVS
FT                   VFGSFGWSGGAVKNLKEFVEEGKFETTETVVEAKGRMKEEDDQGLRQMAKEIAAKIK"
FT   CDS_pept        517660..519324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0461"
FT                   /product="formate-tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07879"
FT                   /db_xref="GOA:B0S0G1"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0G1"
FT                   /protein_id="BAG07879.1"
FT                   /translation="MFMATDVEIAQKAKLEKISVIAEKMGLTEEDYEQYGRYKAKLDLN
FT                   LFEKNKDKKDGKLILMTSINPTPTGEGKTTMNVGLAMGLNKIGKNAISVLREPSLGPNF
FT                   GMKGGAAGGGYAQVVPMDEINMHFTGDFHAITTANNLICAMMDNHIHQGNALNIDPKQI
FT                   LIKRCMDMNERELRDIIIGVGAKGNGVMRQDGFEITVASEIMAILCLAKDLKDLKERVG
FT                   NILIAFDKEGKPVYARDVKADGAVALVMKEAIKPNLVQTLEHTPAIIHGGPFANIAHGC
FT                   NSLIATKLGLKLGDYVVTEAGFGADLGAEKFFDIKCRNDLHPNMVCIVATIKALKHHGE
FT                   AEDFKVENVEALEKGYANLKRHIENMKKYKVPVVVAINRFATDTDAEIKKLTELVEADG
FT                   TRAIFCDVWAKGGEGAKELAEYVVENTKEENDFEFLYDLELPIKEKIEKIAKEIYRADG
FT                   VEFSAKAKKKLKQIKELGLDNYPVCMAKTQYSFSDNKKLIGAPTGFTITVSDFKISRGA
FT                   GFVVALLGSVMTMPGLPKVPSAENCDVLDDGTVVGLF"
FT   CDS_pept        519479..520579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0462"
FT                   /product="glycine cleavage system T protein"
FT                   /note="aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07880"
FT                   /db_xref="GOA:B0S0G2"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0G2"
FT                   /protein_id="BAG07880.1"
FT                   /translation="MLMSTKKTPLYEEHKKLGGKVVDFAGFYLPVDYEGLQQEHEAVRN
FT                   SVGLFDVSHMGEFTVKGKDALKFINYVCTNDYSKCADGQIQYSLLLHEDGGMVDDLLVY
FT                   KNNDEDFLMVPNAANTEKDFKHISKYVDKFDVELKNISDSVAEIAIQGPKAEELLQRLV
FT                   DYDLSKIEYYHFVKDIKYKEYDVLISRTGYTGEDGFEVYANAEAIVKLWDELLEKGKDL
FT                   GVKPCGLGCRDTLRFEAAMPLYGNELSDEVSPLEVGLKFAVKMDKDDFVGKAKTQEKID
FT                   AGINKKLIGIEMQSKRIARQGAEVQKDGKTIGKVTTGYLSPTFGVCLANAFVDKSAVAL
FT                   GDEVDVVIRNKPAKATVVKRKFLDRK"
FT   CDS_pept        520592..520972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0463"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07881"
FT                   /db_xref="GOA:B0S0G3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0G3"
FT                   /protein_id="BAG07881.1"
FT                   /translation="MAEVAKDLLYTKDHEWIKVDGDVYEIGLADYAQDSLGDIVYVELP
FT                   DVDDEIDAEDSVASVESVKAASEVYTPFACTIVEVNEELDDEPGNINKAPYESWIAKVK
FT                   FEDFDESKLMNADEYEKFLGEL"
FT   CDS_pept        520972..522318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0464"
FT                   /product="glycine dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07882"
FT                   /db_xref="GOA:B0S0G4"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0G4"
FT                   /protein_id="BAG07882.1"
FT                   /translation="MYPYISVTDQEIEEMLKTIGISSLDELYSDVPENVQFKGELNIPK
FT                   AKSEEEVRRYFKDIFAKNISTDDKVCFLGGGAYDRYVPSVIPAMASRSEFYTSYTPYQP
FT                   EISQGTLSYIFEYQTMMANLTGMPISNASLYDGGTAITEAALMTIQKSKKSKILCADTV
FT                   SPSAKEILLTYCHDRGVEVEFVPMKDLLTDMDELEKMMTDEVGTVIVQSPNYYGYIEDV
FT                   KKYEELTHSIKKNYLIMSADPMSLGLLKKPSEYNVDVVVGEAQQFGVNLQYGGPYLGYM
FT                   CFTDEFVRKFPGRVVGQTTDEDGKRSFVLTLSAREQHIKRDRATSNICSNQGVNLLAAS
FT                   IYLSLLGKAGIKEVATQSLQKAHYLFDELKKLDKVKVLSEKPFFDEFTIGFDKDTEEVK
FT                   KALFDKGFLAGISIKEATNGCGNGLIIAVTEKRTKEEMDNFVAAVKEVL"
FT   CDS_pept        522320..523774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0465"
FT                   /product="glycine dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07883"
FT                   /db_xref="GOA:B0S0G5"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0G5"
FT                   /protein_id="BAG07883.1"
FT                   /translation="MAYNKLIFELSQPGRTGYKLPELDVEEKDNLIPEEFLSNEELDLP
FT                   EVSEVDVVRHYTNLSTLNFGVDTGMYPLGSCTMKYNPKINEEIVANPKLARLHPKQDDY
FT                   QVQGALEAMYTLQKSLCEVSGMDYMTLQPAAGAHGEITAITIFKKYHEVNGNSEKNEII
FT                   VPDSAHGTNPATAAMAGYKVVEVKSNANGVVDVEDLRKVVNEKTAGLMLTNPNTLGLFE
FT                   TKIKEIAEIVHEAGGLLYYDGANANAILGHARPGDMGFDAIHFNVHKTFSTPHGGGGPG
FT                   AGPVGVKKFLREYLPKPIVEKDGDKYFLDYSMEHSIGRMKDFQGHFGILMRALTYILTM
FT                   GSDGLKCASTTAVLNANYLQAQLKDDYNLPHDFICKHEFVLGGLKDDCDGQVKTLDVAK
FT                   RLLDMGFHPPTVYFPLIVHEALMVEPTETEPKQTLDAFVAAMKQIAQEARENKDILLEA
FT                   PITTVVRRPDETEAAKNLILTFKKGE"
FT   CDS_pept        523774..525183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0466"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07884"
FT                   /db_xref="GOA:B0S0G6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0G6"
FT                   /protein_id="BAG07884.1"
FT                   /translation="MTKDIIIIGAGPGGYETAIRACQLGLNVTLIEKAEVGGTCLNRGC
FT                   IPTKTLWKIADLYKEIRESETFGIEVNDHKLLADKIKHRKTEIIERLRSGVEYLFKTYD
FT                   NLTFIRGEASFKDNKTVVVKTLEGETKELTADKIIIATGSKDYKPTNIEGIDHPRVLTS
FT                   TGLLELEEIPKSMVVIGTGVIGMEFASIYSQFGTEVTVVGNKLLKTEDGEIQKRLKSIL
FT                   KSDTLKFVTGVYAKKIVEEDGRLKIISQKVGKDKFEETYADYVLVASGRSSNTDNLGLE
FT                   NTDIKTENNAIVVDENLQTNVEGIYSIGDCVYKNTQLAHVASNQGKNLVREFSGKDRNI
FT                   NMDIVPAVVFTVPEIASVGLTEEKAKEQNIDYVTSKFMYQANGKALSLNATEGFVKIVA
FT                   TKDLSKILGCHIIGHDASTIIHFAAIAMNNNVGVEGLSAMIYAHPTISEVFMDSVEQLE
FT                   GLSINTPNPNK"
FT   CDS_pept        525353..526555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0467"
FT                   /product="trypsin-like serine protease Do"
FT                   /note="heat-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07885"
FT                   /db_xref="GOA:B0S0G7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0G7"
FT                   /protein_id="BAG07885.1"
FT                   /translation="MDRDPYSDYNDYIRKRRDGLSERKVENMIKKEIAKNKPKIGWLKA
FT                   LTIFLLIYSLVMSYFVVKNMTGITETINKNGQVESSTISIKNSSVSTENAVAKKSLDSV
FT                   VGITTVGVQENMFFQGRVVEGVGSGVVVSKDGYILTNAHVVQDGKAEKIDVLLTNGKKS
FT                   SAKLLWYDTTLDLAVIKTDLTGLKPVEMGDSDKVQIGDKAIAIGNPLGLDLQSTLTSGY
FT                   ISGKDRTITLQNGLQMDGLMQTDAAINSGNSGGGLFDQEGKLIGINTAKASAEGIGFTI
FT                   PINVAKSIVDNIITGGSFDGVKLGISGVDVKTFQQATGQKLSIDKGIYVVEVVKGSSAQ
FT                   KAGVTRGDIITKVNGKQINTMSSLKKVLLEVRPKQKGKITVYRDGSTKDLDIEFSTLEQ
FT                   K"
FT   CDS_pept        526754..527029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07886"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0G8"
FT                   /protein_id="BAG07886.1"
FT                   /translation="MKQIYSVKMILKYKTDVSIYEEDIVLIEMESIDELKDKCLEYVDL
FT                   IQEDLNDHEFVELHKIVNWNLSNEKFDSSMNFKEVYSEFIDEDEIA"
FT   CDS_pept        527145..527894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0469"
FT                   /product="putative iron-regulated ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07887"
FT                   /db_xref="GOA:B0S0G9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0G9"
FT                   /protein_id="BAG07887.1"
FT                   /translation="MSKNLLTIKDLSARVGDKEILKNINLNINYGEVHVIMGPNGSGKS
FT                   TLANVILNNPQYETTSGDILLDGESIMDLSTDKRAKKGIFMSFQNPMEVSGISVENFIR
FT                   SAKIAKTDENIGFLEFREELEDNMDILEFDHGYSSRYLNVGFSGGEKKKNEILQMLMLQ
FT                   PKLAILDETDSGLDVDAVRTVSKGVREFLNENNSVIVITHHKEILKEVKPDFVHVIMDG
FT                   SIVKEGSSELLDQIEEKGFNWIREEVK"
FT   CDS_pept        527894..529306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0470"
FT                   /product="putative iron-regulated ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07888"
FT                   /db_xref="GOA:B0S0H0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H0"
FT                   /protein_id="BAG07888.1"
FT                   /translation="MAPTKKTQVDEMDRGIYDIKNKFTFRKKTEEGLTPEIVRQISKEK
FT                   KEPQWMLEKRLEALEIFFNSEDPEWGPDLSVVDMDKVTTYIRPDADMSSDWNEVPDEIR
FT                   DTFDKLGIQEAEKEMMLSGVGAQYDSEVVYHNIQQSLVDQGVIYTDFDTALKEHEDIVK
FT                   KYFAKSITPRLHKYAALHYAVWSGGSFVYVPKGVDVKIPLQSYFRLNAPGAGQFEHTMI
FT                   IVEDDSYCHFIEGCSAPKYNALNVHAGAVEIFVGENSTLRFSTIENWSRNMYNLNSKRA
FT                   IIEKNGKVEWVSGSFGSAVSMLYPSSVLKGEGASSEYTGISFAGRDQNLDTGAVMIHAA
FT                   PHTTSYVNSKSISKSGGISVYRGLVDIKENAYDSKSSVSCESLMLDNESRSDTIPVVKI
FT                   ANKHVDLGHEASIGRIDDQVIFYLMTRGIPEEEAKSMVVRGFAEPIAKELPMEYAVEMN
FT                   NLINLELEGSIG"
FT   CDS_pept        529316..530365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0471"
FT                   /product="putative iron-regulated ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07889"
FT                   /db_xref="GOA:B0S0H1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H1"
FT                   /protein_id="BAG07889.1"
FT                   /translation="MEQIKGNRLGFKTFKYLKVNDTEINLPDIDIKEYRIDSDPVEALD
FT                   NKDFGVCQEALDMNEKSGNLFKKYKTEENQVKDFGVIELVTDREYDILLDTHKIVAEKN
FT                   SSLRIVLDYRDNDDNKKFRSSVIEINAKENSNVELFVIQTEKNTTALESVILNLDEESN
FT                   VILSQYELGSKDNYVNTKANLNGKHSYLDINSIYFTHGENSLNMLYEINHFGKESKSSC
FT                   IVNGALKESSYKNFKSTLDFKKGSMGSTGTEEEYAVLLSDDAKSLSVPILLAGEDDVIG
FT                   NHAASAGKIDQDMLFYIMNRAISRDVAESMIVESKFSESLSRLDDKNLEEKLLSFIREK
FT                   MSKRELDVR"
FT   CDS_pept        530355..531605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0472"
FT                   /product="selenocysteine lyase NifS family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07890"
FT                   /db_xref="GOA:B0S0H2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H2"
FT                   /protein_id="BAG07890.1"
FT                   /translation="MLDKKQVEDIRKDFLYLSKEYKNPIVYLDNAATSQKPIQVIDSVS
FT                   EFYKYENANPHRGAHTLSVLSTDVYESGREKVAKFINATDSSEIVFTRNTTESLNLLAY
FT                   SYGYENLKEDDEIVISIMEHHSNLVTWQEVCKKTGAKLKYLYVDKGNMQLDFEEFKKTI
FT                   TKKTKIFSITQASNVVGTMPDVEKMIKYVKSVNKDCICIVDSAQYIPHNKVDVQKLGCD
FT                   FLVFSGHKMLSIMGVGILYGKKELLNNLKPFLYGGDMIEYVFEDKSSYLDAPGRFEAGT
FT                   QDVGAVKSLITAIDYIEKIGIENIRDYEKALMDYAYDKIKQKSDIIDVYTTSDTHRSPV
FT                   LDFNFKEAHPHDVASIMDSYGIAIRSGHHCAQPLHRYLKTNFSCRASFAFYNTFEEVDF
FT                   FIEHLEDVRRLMRIGTR"
FT   CDS_pept        531592..532047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0473"
FT                   /product="iron-sulfur cofactor synthesis protein NifU
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07891"
FT                   /db_xref="GOA:B0S0D2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0D2"
FT                   /protein_id="BAG07891.1"
FT                   /translation="MELGSLYTELILEKSRDKSNRRELEHPTHCELGHNPSCGDEITLQ
FT                   LKVQDDTIEDIAYTGMGCAISQASTSIMCDVIKGKSVNEAIDLCNKFISMIKGEITDRK
FT                   ELKVLKDAVCFQSISTLPARVKCAVLSWYTLKDMLENDKSEGSFIPD"
FT   CDS_pept        complement(532167..533402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0474"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /note="phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07892"
FT                   /db_xref="GOA:B0S0D3"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0D3"
FT                   /protein_id="BAG07892.1"
FT                   /translation="MNRKVILAVADGVGDRPCEILGGKTPLEYASTPNLDKLASVGTTG
FT                   IMDVHGAGIPVGTDLGHMILFGYGLEDYPGRGPIEAFGREIELQAGDVAFRSNFATVNE
FT                   NLCVVDRRAGRIRENTNLLAQSLNNIEIDGIKVIFKEATEHRAVLILRGPGLSANITDT
FT                   DPKVAGVDVNYKKCQSKDGKPDSIFTAEIVNKFLLKANEILSKHSVNEERISKGLLPAN
FT                   FILTRGAGIMPKLEKISEKLNIKGACVAAEGTVLGVARLAGFTALTAPTMTGNIDTDVN
FT                   AKAQMAIDALKDHDFVLVNLKATDLFGHDGNPEKKAQAVEVFDKFIGLLLEANLENTII
FT                   AVTADHSTPCERMEHSGDPVPVLIAGPGIRQDRVTKFDEISCSYGGLCRIKGKDLSNTL
FT                   YDFLEKTKKQGN"
FT   CDS_pept        complement(533422..534873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07893"
FT                   /db_xref="GOA:B0S0D4"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0D4"
FT                   /protein_id="BAG07893.1"
FT                   /translation="MKTKSSASKKKTSTSAKIGGIIAVILFFVLMLMPTPKGMTPEAQK
FT                   SLAVFVFALIMWVAQPIPIYQTSIIGILLLPMIGAVEKQKVTFGALGYDIIWLMVAAFV
FT                   LTSAINETNLGKRLALSMLTKFGKTPKGTLISLMLVNFILAFFIPSTSARAALLIPIIM
FT                   ILLEVYEQVPGESNFGRLITLQGVMNNHLATSMVITATSSQLLAIGFINKMTGSKLGYM
FT                   DWLLGSLPQVLITGLIAFIAGYKLYHIKDLNIGGESTKEILKKQLIDLGPMTIAEKKTA
FT                   IIFALTLLSWATGNYQEKLFGFSISTEQTAVISMLVCLLPKVGVIDWKQANIKWNLMIF
FT                   SAGAYAIGNAFNDSGGASFIIQNFVEKIGLNTLNPNLVAVILIFITIFSHLIFTTKTVR
FT                   ATILIPTIITLAQSLNIDPVPLAMACSFGIAYTLTLPPHSKVNALYLSLGYFDVKDELK
FT                   LGLITCFIGSVVISLLYFTYYQIIF"
FT   CDS_pept        535002..535901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0476"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07894"
FT                   /db_xref="GOA:B0S0D5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0D5"
FT                   /protein_id="BAG07894.1"
FT                   /translation="MDISKLESFLVLADCKSFTKTAELRYLSQPAISKHIDSLEQELGV
FT                   FLFDRNGKTVSLTIQGRHFIKYAESIVKIYQKSQELIRQIEDLNQGTLYFGSTNFIGIY
FT                   LMPKFIKAFQDKYPKINVNMTVGSSKDLFKKLEKNEIEFVFLSHYVKIDTNKYISKPFF
FT                   TDEMVLVVSSKNKLAEKSTCSLSDIKDQVFITKSQTSSLYKFLESCVVDVKFKKELIID
FT                   NQEAIKKAVVENAGVSIMSKKSAQLEEEAGLIKCIKIVDCDFKRQINLVYDKNLHITPA
FT                   GQAFFDVLDTFNNLELGK"
FT   CDS_pept        complement(535951..536460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07895"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0D6"
FT                   /protein_id="BAG07895.1"
FT                   /translation="MHPMIQRFVDSEFLDEQQAEFIEKAIENHENIIISGHRSTGIRQL
FT                   LAIMMGIAKKQFKSVQVKGLESIDEDAEYYLIPGIDTEEFEDIVQKAFDKPNSSLITIK
FT                   EPEHPYSIMKIMKKGGKTSGDYSKVVNFLEARKIDGVPFMISTTKMTYNEKHGIDKDKV
FT                   ERFKAF"
FT   CDS_pept        complement(536541..537662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0478"
FT                   /product="putative thiamine biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07896"
FT                   /db_xref="GOA:B0S0D7"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0D7"
FT                   /protein_id="BAG07896.1"
FT                   /translation="MKKLLLVFLTLTMLVGCSQNKTENKPVAKDPAPQVKESDVSSSKD
FT                   FEKHEATLYDKFDTVIRYSLYTKTEKEFNQYSKFINDEFDRLHKLYSTYENFDGVDNAK
FT                   TINDNAGVKPVKVDKDLFDLIKLSVGDYAKYHKKTNIAFGSVTDLWKEYRDNALEKKII
FT                   KIPSQDVLKEKNLHTSIDNIVLDEKNSTVFLKDKDSRLDLGATAKGFATEKIAQELEKR
FT                   GLKSGIISAGGNVRTIGTPIIKGKDSWVVAIQNPNLNEEPDKQYVAILKIPGSTSMVTS
FT                   GDYQRFYVYNNKKYHHIIDPDTLNPANHFKSVTIVTKDSGLADFLSTTVFVMNYDEGRK
FT                   LVDSLDGVEAFWVFENNDIKYTDGLKDIIELEN"
FT   CDS_pept        537793..539157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0479"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07897"
FT                   /db_xref="GOA:B0S0D8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0D8"
FT                   /protein_id="BAG07897.1"
FT                   /translation="MKKAIILSAGEGTRMKSHNSKVLHKLLNKPMIDYVMDACDFVDQK
FT                   IVVGGNNYDILRENLDESIHLVKQNIGENYPYGTGYAVKLCLDEINDDDKVIILTGDTP
FT                   LIKQETLKKFFDYHEQQNSVATVLTSEIDDPFGYGRIVKDENGNLLKIVEQKDCNDQQL
FT                   LIKEFNSGMMIVNGDVLKMSIEKIDTNNSKGEMYLTDIFEIIRKDGKIIKTFKHSDVNE
FT                   TYGINTKAQLYFCEEILKQRVNEKFMEDGVVISNSDSVIIEPSVKIGRDTVIIGPSRIY
FT                   GSTEIGSDCLIKGDCEIVDSKIDDNVVIKSSYIENSVVGKNTDIGPFAHLRPNSVLKEN
FT                   VHIGNFVEIKNSTVGNKTKAGHLAYVGDSDLKENINIGCGVIFVNYDGKNKHRSVVEDN
FT                   VFVGSNSNVIAPVTLKKDSFIACGTTITEDVEEGALSIGRSRQENKKDWVYKKKR"
FT   CDS_pept        539173..539742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0480"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07898"
FT                   /db_xref="GOA:B0S0D9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0D9"
FT                   /protein_id="BAG07898.1"
FT                   /translation="MYLIAGLGNPGSKYEYTRHNAGFMVIDDLAKKLNIKVNKLKFKSL
FT                   IGEGFIGDEKVILMKPSTYMNDSGKAILDCFNYYNLSAENLIVICDDIDIPFGTIRIKK
FT                   KGSAGTHNGLKSIIYLIESQDFARIKVSVGQNDKYDLKDFVLSQFSKKEFEVLEKEIDM
FT                   SSDAAIKIVEENVDYAMNNFNGKSVI"
FT   CDS_pept        539739..543245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0481"
FT                   /product="transcription-repair coupling factor"
FT                   /note="superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07899"
FT                   /db_xref="GOA:B0S0H3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H3"
FT                   /protein_id="BAG07899.1"
FT                   /translation="MNFLTKIYEDNTEFQGYLDSLSANNSSIYIHGVIKEAFASFVYAT
FT                   SKNINKPLVVVVEDNMRARNLTEYLNDIEENICEFFPSRELNFYNAKSLDDNAEDQRVN
FT                   VLFKLLNNEKFIIVTTFDALTKKITKKSVAKKYAFTIKDTDLINLEELQEKLRALKYER
FT                   VDTIESKGQFAIRGGIVDIFPVHSRFPVRIELFDDEIDSMRFFEVSTQRSIEDCKFVDI
FT                   ISCSELIIEDSKKESIINSIQKNLDKRVDHPIFGENVDNVKDKFEKLMEYIRSDLEYEI
FT                   DLVSCFLTKKDYDTVFDYFADDTIMMIEDLSRCYDIYKEKEKRFLEDFVYLVEKGEVLS
FT                   KHEQSLIPISDILKFIKAKTSVNITSLVKRTRLIESNAMYQLKTLEAPNFNKNIDSLVE
FT                   NIKSNSLRGFKQIVFAANVERKNMLKDLFLTNGIPTLEAEDYNANIKSSQVLITQKNLP
FT                   NGFEIKDPKYLIITYKEIFGREKQLRKRKKKKSTGQDIVNYSDLNIDDYVVHENHGIGQ
FT                   YKGIEKIDVNGIQKDYIVIQYKANDRLMIPTDQMNLVQKYIGGGNVKKPSLNKLSGNDW
FT                   AKAKQKAKKSVDEMADDLVELYSKRAKLKGYQFSQDTEWQREFEDSFPYEETDSQVRSI
FT                   EEIKADMESDRPMDRLLCGDVGYGKTEVAIRACFKAIMDGKQVAFLVPTTILAQQHFNT
FT                   IKERFRDYPIRVEMMSRFVSPARQKQIMKDVQRGLVDLLVGTHRILSKNLKFKDLGLLV
FT                   IDEEQRFGVRHKEKLKSMRENVDVLTLSATPIPRTLQMGLTGIRDMSLLEEPPEDRTPI
FT                   STYVTEYNPSLIRDAIIRELDRGGQIYFVYNRIEDIDQMEFKLKELVPELNIAIAHGRM
FT                   NEKELENVMLDFQDGIYDLLLCTTIIETGLDIQNVNTMIIYNADKMGLSQLYQLKGRIG
FT                   RSDRTSFAYFTYEGQKSLTEISEKRLMAIKDFTEFGSGFKIAMRDLELRGAGNLLGESQ
FT                   HGHIAKIGYDLYVKLLEQAVREAKGETISENKNTVIIEIKVNGYIPEDYISENETKIDI
FT                   YKKIASIQDEDDYSEIIDELIDRFGDVPKPIVNIMDVSIIKAFCARLSIESIKEIKGEL
FT                   FLQFSSPDKISLEKLKYLTENYKKEMRFDLSEKPKIILGFEDKNLRDPIEVLSILLKDN
FT                   EK"
FT   CDS_pept        543257..544222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0482"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07900"
FT                   /db_xref="GOA:B0S0H4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H4"
FT                   /protein_id="BAG07900.1"
FT                   /translation="MKKFLAIVLAMMMVMVTACSNKPNGAVAKIGKEYIYQKDVDKVME
FT                   DYKQYYGQDIFNPNTEQGKEALKQIKPKIIDMLINEKIANKLMKDKKIEVSDKEVQAEV
FT                   DKLQKQLGGADKFKEQLKKENMTEQALKEQIEKQLKNKKLSQQFEKDFKPSDKEIKDEF
FT                   DKNIDTYTQYNADHILFSGKDAKGKNLDASKLKAKSELADKTYEEVKNGKNFNEVAKAK
FT                   SEDPSAKQNSGKLGDFLSSTMVKEFSDALKKMKPGEVSKPVKTEFGYHIIKLNSKVTEL
FT                   DKMTDANKQNIKTAISNKIIQEKVQKEFEKQKKDLGVKIY"
FT   CDS_pept        544336..544626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0483"
FT                   /product="DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07901"
FT                   /db_xref="GOA:B0S0H5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H5"
FT                   /protein_id="BAG07901.1"
FT                   /translation="MNKSELLSSIAKKSELSKVESERALNAFIKTVEETLAKGEKVQLV
FT                   GFGTFESRERKAREGRNPRNPEEKIQIPASNAPVFKAGKSLKEAVNQKKSK"
FT   CDS_pept        544696..545190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07902"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H6"
FT                   /protein_id="BAG07902.1"
FT                   /translation="MIYDFYINKDIKDRFRILSDDKLIYSGYKEGNSTSFFDAFIGSSF
FT                   DKGSNFVFYDENEDVVMKVERIFYENNKKYVINSKNLNFTLESDMSNTIKYDNDKMIDI
FT                   SDFKNINVLDFGNIELNKKGFSIYEKFTLDEKNHDYTFVVIAVALFIWDVYIKERLGFI
FT                   K"
FT   CDS_pept        545190..546071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07903"
FT                   /db_xref="GOA:B0S0H7"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H7"
FT                   /protein_id="BAG07903.1"
FT                   /translation="MSKTDFFVKNFGNRNEAKKKIISILLANLLAAVAIDFFFSQKNFL
FT                   SGGSTGIGLLVQYMTGIPTGVTVFLLNIPIMIIGYKYLTRQFVNYAAISTIVLSVYLTL
FT                   FHYLPNPFILKDDMLVAVVGGAINGTSMGTLFRFGTCSGGLDIIAAIMKNEKDISIGNV
FT                   LMTCNAVIIAIGSALYGIDKGFYTIISMFVAYRVLDKIELGIGETKQVFVITSKNEEVA
FT                   SIIMEDMNRGVTFLHGEGAFLNNEQEVIFCVLKRAQVAYLKKKLKKIDPRAFITVNDAY
FT                   EVLGKGFEREEY"
FT   CDS_pept        546170..547297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0486"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07904"
FT                   /db_xref="GOA:B0S0H8"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H8"
FT                   /protein_id="BAG07904.1"
FT                   /translation="MGFDNVYGALYGVQGLLDSKIIDLKSQIKTDKDLNRLKITPASAL
FT                   GSCRYKVDSEEKLAKIVEILKSFNINYFIYIGGNDSMDTVYQLSKYIEKIGEDINVMGS
FT                   PKTIDNDLFGTDHTPGFGSAAKFVANSVYEIAKDVEIYDYRTITIVEIMGRYAGWLTAA
FT                   GAISKKLCNLGADLVYISEDTFEFDNLVKEINENFKRTDNILILVSEGIKDSSNNFISK
FT                   TSGKKDKFGHAQLQGPSHIIRDKLKEIYDMPIRSIELNILQRCDMSFASKTDIEESFEV
FT                   GEFSVECVENHSGKMVGIKRISNKPYKTEFELVDIEKVANKTKMIVPKYTDSHFQIDDE
FT                   FMDYILPLIEGEIEVEYKNGIAQYFAFDKEDIVKL"
FT   tRNA            547398..547473
FT                   /locus_tag="FMG_tRNA17"
FT                   /product="tRNA-Lys"
FT   CDS_pept        547519..548322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0487"
FT                   /product="phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07905"
FT                   /db_xref="GOA:B0S0H9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0H9"
FT                   /protein_id="BAG07905.1"
FT                   /translation="MYLIVSALILLFLLISISYKINIVQYEIKSEKIDRDINILFLSDL
FT                   HSCDYGINQKKLMDKIKSVDCDVILLGGDIVDDKLKPKKAFELLEQLQQLGKKIYYVHG
FT                   NHEKRIENLVEIDETIRKYNVQILDNEDVFLSNNIKLIGVDDSSGKILENYENKLDDLD
FT                   EKLKSENFNICLIHKPDYYFKKNLKNFDLMISGHTHGGQWRIPYILNGVISPGQGLLPK
FT                   YAGGMYNDDYTLIVSRGLAKEKTVVPRIFNRPEINLIKLTKINNS"
FT   CDS_pept        548721..551165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07906"
FT                   /db_xref="GOA:B0S0I0"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0I0"
FT                   /protein_id="BAG07906.1"
FT                   /translation="MFTYKLKKLYRYRLIPFLILFSITMGVVVFFLHFRTTNHAFDFLN
FT                   SNDISISNNISWDELIIKKTDWKKITPEEPDKKSYEDHKAYLNEGKNVLQNLMKAHGLD
FT                   ENYKYDKSKYNEKDIIKYTNELDALNNKYHTDENMDNPKELRRSVLRSEGYINFLKDRN
FT                   SVEDRLIDENDNHSFSKVIFDEAGVIFGAVPIILLGFVIIFIMREDDITSVTSNSKIKD
FT                   VANNFGIIMCMIVMYIIISLLTVFVASLITGNGVGDLTYHYDSTFVIRTVQDRSGSIRE
FT                   YSYVMRTPLSTFFKSVFPFALITMSFGFAFSFVDKLIQNTKVKYFTLILIMSLLLVDFN
FT                   FFNHAYNPLSLFKSFSLKPVIATVFMLLITAIGTIFLNRRKEFTSHDTYKERNVFSLKG
FT                   SVKNCVLSFNGFLILFVVCAILVGNICLQNNWHNFNSTQIKNYTDLNSTMENLVYRDID
FT                   EIKAKYGNSKRAKEMIDSHSDALKFYENENKYFDAYENRYKTPQKFNNVNKERVTEFNG
FT                   FDFQGTGSETTGMVDVFNDFALEGAFFKQKYMLINNITPTDRFYIPQSGIDYNPFDVDS
FT                   FKGTLPKINYYITHGISERNNAFAMLHDYFYLKFNVVLIVFAVLLFTSTIIKSNKQLEL
FT                   KSVLPVSRTKSYKSKIMESLIYAIGINIVAVLVLFLAGGIMGGFADSDFPIINYIVDGG
FT                   IIYLNVGPFLVYILESFTITVLFTIFISMFVNAMYTTTNKLFTILISIIALIIPFTAIK
FT                   YMGAIGSFIPFNYVDSGFVTTGFLSALIRQNSYTMVIAVVVLVISSILFYILGRVSFGR
FT                   RK"
FT   CDS_pept        551165..552013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0489"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07907"
FT                   /db_xref="GOA:B0S0I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0I1"
FT                   /protein_id="BAG07907.1"
FT                   /translation="MLEVVNIEKSYGKKKILHDISFSIEKGQIKALVGPNGSGKTTLMN
FT                   TMTNLLKRDGGQVLVDGKEFKDEKIFNHISFFKDEKILDENLYGMDYLNYIKNVYKRTK
FT                   DDVDRVIKEIGIESFVKSKTGSYSLGMKKKLMLAMDFLPQRDIILLDEPLSGLDPTSVI
FT                   KMMALIKQKANDGQGILISSHSLNDIDEITNNILFLKDGKILEEVLENEKFIEIISNDN
FT                   EKLSSVLQSKGFNMDKNMISLNNSSINDILSIIIENNIEILDIKRRSKTSQERYKEIFK
FT                   I"
FT   CDS_pept        552145..552558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0490"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07908"
FT                   /db_xref="GOA:B0S0I2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0I2"
FT                   /protein_id="BAG07908.1"
FT                   /translation="MPTINQLVRQGRKSKTYKSDSPALSRNFNSIKKSYTEANSPQKRG
FT                   VCTSVRTMTPKKPNSALRKVARVRLTNGMEVLSYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAAVQNRMQGRSKYGAKKPKK"
FT   CDS_pept        552668..553138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0491"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07909"
FT                   /db_xref="GOA:B0S0I3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0I3"
FT                   /protein_id="BAG07909.1"
FT                   /translation="MPRKGHVQKREVMPDPVYDDKTVTKLINNIMLDGKKGTAQKIVYG
FT                   AFDIIKETTGEDALEVFYKAMNNIMPILEVKTRRIGGANYQVPIEVRPERRQTLGLRWL
FT                   TTYTRARGEKTMVEKLAKEIMDAANNTGASVKKREDVHKMAEANKAFAHYRY"
FT   CDS_pept        553167..555254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0492"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07910"
FT                   /db_xref="GOA:B0S0I4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0I4"
FT                   /protein_id="BAG07910.1"
FT                   /translation="MARQVSLKDTRNIGIMAHIDAGKTTVTERILYYSGKIHKIGDTHD
FT                   GAAQMDWMVQEQERGITITSAATTCFWKGNRINIIDTPGHVDFTVEVERSLRVLDGSVA
FT                   LFDAKSGVEPQSETVWRQADKYGVPRICFINKMDATGADYFMSVDTIRERLRANAVPIE
FT                   IPIGAEDKFVGVVDLITMKANIYKNELGTEFTVEEIPSDLVEVAEKYRAELLENIAEHD
FT                   EELMEKYLEGEELTEEEIKRAIRTATIANAMNPVLCGSAYKNKGVQPLLDAIVDYMPAP
FT                   IDVPDIKGVDPQTDEPTTRKSSDEEPFAALAFKIATDPYVGKLAFTRVYSGTVESGSYV
FT                   YNSTKGKRERIGRILMMHANKREEIDKAYAGDIVAIIGLKDTTTGDTLCDMDSEVILEN
FT                   MEFPDPVISVAIEPKTKASQEKMGIALAKLAEEDPTFRTYTDEETGDTIISGMGELHLE
FT                   IIVDRLLREFKVEANIGNPQVAYRESITQAAEAQGKYVKQSGGRGQYGDCTLRVEPLDN
FT                   PEESNGIEFVNAIVGGAIPKEYIPSVQAGAEEAAQTGILGGYPMLDMKITLLDGSYHDV
FT                   DSSEMAYKIAGSMGFRAAVAKAKPILLEPAMKVEITTPDEYLGDVMGDVSSRRGKIDGM
FT                   NPKNGVHVLDAFIPLAEMFGYATDLRSKTQGRATYSMQFDHYEQVPNSISEEVIGKKNN
FT                   K"
FT   CDS_pept        555268..556461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0493"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07911"
FT                   /db_xref="GOA:B0S0I5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0I5"
FT                   /protein_id="BAG07911.1"
FT                   /translation="MSKAKFERTKPHVNIGTIGHVDHGKTTLTAAITLVLNKRMGSGEF
FT                   VDYANIDKAPEERERGITINTSHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLARQVGVPKIAVFLNKEDQVDDPELIELVEMEVRELLNEYE
FT                   YEGDDTPIVVGSALKALEDPDGEWGDKIMKLMEEVDEWIPAPVRDVDHPFLMPVEDIFT
FT                   ITGRGTVATGRVERGRVKVGDNVEIVGLTEEKRTVVVTGVEMFRKQLDEAEAGDNIGAL
FT                   LRGVQREEIERGQVLAAPGTIHPHTKFEAEVYVLTKDEGGRHTPFFSGYRPQFYFRTTD
FT                   VTGNIELEEGVEMVMPGDNAKFIIELITPIAIEEGLRFAIREGGRTVGAGVVSKIIA"
FT   CDS_pept        556624..556923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07912"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0I6"
FT                   /protein_id="BAG07912.1"
FT                   /translation="MKMKKILFIVMITCMTVVCTINANVSSAVSSASYYGLENVEENEY
FT                   GENFTFVRGKSPVNFKYEDVYNDGYSGKLYRQRLITIDVTNNTETWYYSGEISK"
FT   CDS_pept        556954..559293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07913"
FT                   /db_xref="GOA:B0S0I7"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0I7"
FT                   /protein_id="BAG07913.1"
FT                   /translation="MFELKKLYKSLIFPVVVIIFCVYSFVTLNSIKYEYTGQDYAYFMK
FT                   TRDRFEDTMMESFALSKSSQNKEEQQKYLNLSKMNFNSLQYIKPLEYDVSMLMEETKAA
FT                   KYSSKTEHNFYNELLSQYDEIESFKRQNNLNKLASYGMYNELNPYFNLIRDEINRYGFY
FT                   TTTNNFSFFKSFGFLMENVMNDIFLCVVFLIAVFANEMNFKNLKLDMISMSSRKLVYAR
FT                   LIKHVVFFAIVIFSMILGNIIFSVIKGFPTGSANDMILKSVTDLKINTYITMNVNSMVL
FT                   ALKYIGTGFLIYSIAMMLYEIFRRYMKQNLSIIVVLLIYWIISLLSKRYNLSFSLNSFH
FT                   NLGNVSIAVPIVLALFIVCLILVNNNRYKLIYYNFSKTYSKIDIKNILQLDFAKIMRSK
FT                   LYKYFGILTLVVVVLFCFNTIKFKNIKSKDDLQTIDSEIESAKINVHNNPKDKGFKQTL
FT                   INLENFKKFYVNRANNPTEYYSNMFLYLNSKWGFDVEWIDPSTSRSNENRVNYFMDNNL
FT                   KPDSSYKLVSNEIEQSLLSNKKLSLYKTKQHDPTEQKGLIGNIISMYENGIIPAFTLII
FT                   CLIFTLEFKKERSNGTLKLAFVNEWKKDVWKSKQINSLVLSAGMYVVILAISMIIGLFN
FT                   GGLGEKLYPVFCYDYSYNGVVEGVFRASSGFILPMILINILIILLVVSFSNMMTTFIKN
FT                   ETVNIIATTFLIVLGIIISYFGTLGKFFLLNPFSSLDSLMILKGGYNYLNEFSFSNPIY
FT                   NVIMIVFYIIVFNLISMKRMKGDINA"
FT   CDS_pept        559286..560104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0496"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07914"
FT                   /db_xref="GOA:B0S0I8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0I8"
FT                   /protein_id="BAG07914.1"
FT                   /translation="MLEIKGLNKSYGENEVLKDLNLKLDKPGIYALVGPNGIGKTTLMD
FT                   IISDLTKYDSGEIKVNDIDNKNPEIFKYLSYARSLDMLYDNLTGLDHFIFAKNSRHVSD
FT                   EKFEEVLDIFKVHNFMKRKVSTYSLGQKQKTLLTYFFMGDYDIYIMDEPVTGLDPTSVI
FT                   LLRNYLLKLKDDGKIVVLSSHTLSEVDKLTDDVMFLVDKKIAFENLSEISKEQYKVVTS
FT                   DSENQRTVNIVAKNDLDDSLKKFMADGLIIDSIEKSDYTTEDRYIELYTK"
FT   CDS_pept        560189..561106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0497"
FT                   /product="putative malonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07915"
FT                   /db_xref="GOA:B0S0I9"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0I9"
FT                   /protein_id="BAG07915.1"
FT                   /translation="MVNYTQLYLTIINLFCLIFIGFLLRKFKIVDETTMTGLNKLIFNV
FT                   LFPLKIMMSFYKVDFGQNLSVKYFVYLNVVFVFHIFLTYFLAKITNKDKSYVVLEANAM
FT                   SRGNFIIMSFPILSVLFGDEGIVMAGAITGISQFFYNFYTVSMYEGLVGGNNSKKKLFI
FT                   NVVKTPLMIGLFVGIFLYVTKVNLFFLETPLRSLGDIAGTLALVTMGYGLSFRIDFREI
FT                   KSIMKVSIVKLLVLPLTGLFIGKIFGLSEIQKVVALILFGAPTAVNTYVFAKRYKQDDS
FT                   LAGYYVVSTTILYLFTLILLIKLI"
FT   CDS_pept        561172..562458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0498"
FT                   /product="sodium/citrate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07916"
FT                   /db_xref="GOA:B0S0J0"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J0"
FT                   /protein_id="BAG07916.1"
FT                   /translation="MDKKIAGLKIPYFIIACVVIIVSFIFDVLPKGMVGAFLFLIVFGE
FT                   LLNLIGNHTPIIKTYLGGGAIVSIFLGAAITYYKWLPADSIKSINTFMTKGGFLDFYIA
FT                   ALITGSILGMNRKLLIKAAIRYLPCILGSVIMALLLVGGVGLLFGKSVGESIAYIGIPI
FT                   MGGGMGAGAVPISKVFESALNIPSETILSKLVPAVALGNATAIVAGGLLNRLGKVKPSL
FT                   TGNGQLVRSNDDSLKAEKKENIILEDVKDYGAGIVIATAFFTFGAILAFLFGKVGIKIH
FT                   SYAWMIISVVIVKAAGVVPEKIEHVAEGWYNFVAKNFTSALMLGIGMAYTNLGQIFEAF
FT                   TPSYVILVLAVIIGAITGAGIVGYFVGFYPIETALTAGLCMANMGGTGDVAVLTAADRM
FT                   ELMPFAQISSRLGGALIILLASILVPIFF"
FT   CDS_pept        562588..563760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0499"
FT                   /product="malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07917"
FT                   /db_xref="GOA:B0S0J1"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J1"
FT                   /protein_id="BAG07917.1"
FT                   /translation="MNIEEIKQKALELHEKNQGKLEVVSKVKVNDAMDLALAYTPGVAE
FT                   PCKKIHEDNSLAYKYTNKGNMVAVVTDGSAVLGLGNIGGIAGMPVMEGKSVLFKEFGNV
FT                   DAFPICLNTQDTEEIISTVKAISPSFGGINLEDIAAPRCFEIEKRLIEELDIPVFHDDQ
FT                   HGTAVIVLSAVINALRIVKKDISDVKIVISGAGAAGIAISNLLTLAGAKNNLILNSRGI
FT                   IDPDDEKLDEARREIARTTNPNKVKGDLKTAMENADIFIGVSAPGILTKEMVSSMNHDA
FT                   IVLAMANPVPEIYPDEAKEAGARVVGTGRSDYPNQVNNVLVFPGIFRGALDAKADRITD
FT                   DMKLSAAYAIAHMVEQPVEERILPEAFNKDVAKNVANAVKKSWEEKKVIK"
FT   CDS_pept        563770..564981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0500"
FT                   /product="peptidase T"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07918"
FT                   /db_xref="GOA:B0S0J2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J2"
FT                   /protein_id="BAG07918.1"
FT                   /translation="MIDIVDRFIEYAKIYTTSDESSETCPSTARQKDLGNLLVKQLKEM
FT                   GIDNAHMDENGYVYASLESNLDRESKAIGFISHMDTAPDMSGENVKPQILEYKGGDIKL
FT                   SDTVTTTVEDFPFLKDLEGQTLIHTDGTTLLGADDKSGIAIIMDVVNKLCENKDIKHPT
FT                   IKIGFTPDEEIGRGADLFDVEKFGADFAYTVDGGPIGELEYENFNAAGATITIHGKNVH
FT                   PGSAKNTMINSQLIGMELFNELPVAQRPEYTEHYEGFYLLTSFEGTVENTVMKFIIRDH
FT                   DKKKFEEKKSYLKKLVEFLNVKYNNAIELNMKDSYYNMKEKIEPVMEIVDLAYKSMEDL
FT                   GIKPLVQPIRGGTDGAQLSYKGLPCPNIFTGGYAFHGKHELLSVDQMKKASDLVLKIIE
FT                   NYSK"
FT   CDS_pept        565077..566537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0501"
FT                   /product="putative amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07919"
FT                   /db_xref="GOA:B0S0J3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J3"
FT                   /protein_id="BAG07919.1"
FT                   /translation="MKNDVLIDDQKKKSLTVTNLIWMGFTVVWGFGNVVNNYANQGLAV
FT                   ITSWIFIMALYFIPYSLMVGELGSTFKEGQSGLSYWIKQTMGPLLAYLSGWTYWVVHIP
FT                   YLAQKPQNLMVAGSWAIFRNPKMVKSLNPIVLQTLVLIIFLLFVLLAANGIKSIKVLGS
FT                   IAGTASFVMGILFILLMLAAPALRGVEVASPNMTSIKTYLPNFNLHYLTTISMLVFAVG
FT                   GCEKISPYVNDTQDAGKNFPKAMIIMALMVTVSAILGSVAMGMMFDTTNVANDLKMNGA
FT                   YYAFEKLGQYYGIGPSLVIIYALTNFAGQAAALVMSIDAPLKLLLSEADAKYVPNFLRK
FT                   INDKKVPVGGYKLTTILVSILIIIPALGIGNSNELYNWLLDLNSIVMPMRYMWVFAAYF
FT                   ALKHYLNEKQGVEYKFTKSKSFGKIISGWCFAFTAFACILGMIPKEGEPFTSQWNFKLI
FT                   LNILTPVVLLGLGLILPSIARKEQAKNN"
FT   CDS_pept        566732..567814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0502"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07920"
FT                   /db_xref="GOA:B0S0J4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J4"
FT                   /protein_id="BAG07920.1"
FT                   /translation="MKIVTVVGARPQFIKAAMVSKELRKNFDEVMIHTGQHFDYNMSEV
FT                   FFEEMNIPYPDYNLGISGGTHGEMTGKMLMEIEKILIKEQPDMVLLYGDTNSTLAGALA
FT                   AVKLHIPICHVEAGNRLGTLDNPEEVNRIMTDHSSKVLCCCTESALGFLKKEGLEDRAT
FT                   LVGDPMYDAFLEYSKKVCDKIPEKIIDLNGEEVNLPENFYYLTCHRAENTASIKPLSEI
FT                   LAAMEELDEKCIYPVHPRNQKMVQELSEKHHYTNIIFCKPVGYMMSVYLVNHAKKIVTD
FT                   SGGLQREAYFARKQCVTIFDHIVWPETMTEKRNQLSKPNKEEILKLLNEKVDFENYDYP
FT                   FGDGHSSKKIIECIENYLNK"
FT   CDS_pept        567826..569046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0503"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07921"
FT                   /db_xref="GOA:B0S0J5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J5"
FT                   /protein_id="BAG07921.1"
FT                   /translation="MNILYINHYAGSPEMGMEFRTYYLASEWVKMGHNVTIIAGDYSHL
FT                   RRKNPEVSENFQTEIIDGIKYMWIKTGEYDGNGVKRAMSMFRFVSTLRKNARDIVENEN
FT                   PDVVITSSTYPLDTFAGQKMKKIKKDIKLVHEIHDMWPITLIEVGNMPKYHPFVVMMQI
FT                   GENSFCKNSDYVCSLLPAAKDYLIKHGMKAEKFFHVPNGIVESEWENYDKIPEDYVKIF
FT                   DKIHSEGKKVICFFGSHTKSYCLDNLAKACIDNDDVAAVFIGGGIYKKELMEKYSKYED
FT                   SIYFLDSISKTSIPDLFNYIDATYVAAMDNDMFRYGVCMNKLFDSMMGAKPIIYAINAP
FT                   NNYIVDYNCGINVESENLKELKKGIEKFVNLDEETLNQMGKNGRKAIEENFTYHKLAEK
FT                   FLKGLEN"
FT   CDS_pept        569122..569895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0504"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07922"
FT                   /db_xref="GOA:B0S0J6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J6"
FT                   /protein_id="BAG07922.1"
FT                   /translation="MFTLRDFKSPETLDEAYELLMKSKMNKILGGCHFLKAGSRSYNVG
FT                   IDLSKLDLNYIKVEDDEIKIGATTTYRDLEYNDFLKEFCDGIIPKSLKKIVSTQLRNTA
FT                   QVGASVFSRYAFSDFLPILLLLDAKVRLYNNGVMSVEEFLNSEIKKDLLVEVIIPNKDI
FT                   HCTQIVQRICCKDFPIAIVAVSKKDEKYKVVFGARPQKAMVMRDVSDEINSNGFDREKT
FT                   LELIDEFIGSNNKAKKKYRILLFVGLLGKALGELQ"
FT   CDS_pept        569892..570353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0505"
FT                   /product="putative carbon monoxide dehydrogenase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07923"
FT                   /db_xref="GOA:B0S0J7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J7"
FT                   /protein_id="BAG07923.1"
FT                   /translation="MIIELNVNNKNHIASVDCDTTLYNVLRDLGYKSVKCGCTTSNCGL
FT                   CTVWLDDVPVLSCSILALRCEGKKITTLEGISESQRKFGELLTEEGGEQCGFCSPGFIM
FT                   NVLSLKKTIKNPTDEEIEDYLMGNLCRCTGYASQMRAIKKYLEIDDEDK"
FT   CDS_pept        570340..572613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0506"
FT                   /product="putative hypoxanthine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07924"
FT                   /db_xref="GOA:B0S0J8"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J8"
FT                   /protein_id="BAG07924.1"
FT                   /translation="MKINKDFKKIDSNSLVTGKPVYTEDLKDPNALIIKLMRSPYARCE
FT                   ILEIDKSKAEAMDGIVAVYTYEDVFDNKFTLAGQSYPEPSPYDMSILSKNIRYMKEPVA
FT                   IVVGVNEKVCNQAMKRIKVKYDVKEPLLDYTKAIDNEIVVHEEDVFFNGPTKVFGYNTR
FT                   RNLVGEKKESWGEDIDKVMSECDVVLEDTFTTKAQAHCMMETYRSYCYMDQFDRLCCIS
FT                   STQVPFHIKRQLSVALGISDSRIRIIKPRVGGGFGGKQTSVTEIYPGFVTLKTGKPSIL
FT                   VFDREETFEASNSRHQMKVKVKIGAKKDGTIEACDIYALSDQGAYGYHAFTTLNLVGNK
FT                   TLPLYSRMRAARFFGQVVYTNKLPGGAFRGYGAVQGTFALESMVNKLAKELNMDPVELR
FT                   LKNTVREGEKTLAYGIDVKSCKLNECIEKGREMIEWDKYYPFKEEKDKIISVGMAIAQQ
FT                   GSGIQNVDTSTVEVRLNEQGDYTLLMSPTDVGQGTDSIMVNLANEVLQCGMDNIIPIIA
FT                   DTDITPYDPGSYASSGVYITGGAVVRACENLLNKIKKRVAMRFETSVEWLEIRDQAVYL
FT                   QNKKLIAIKDLARDLSTGPNGMQLIGVGNFDSKTSPPPYMAGFVKISIDKLTGEIKVED
FT                   YAAVVDCGTVMNTKLATVQVEGGIGQSIGYALYEDSLWDDEGRLKEHSFISYNLPSRKD
FT                   IGNIHVDFCESYEPTGPFGAKSIGEIVSNTPAPAINGAILNAISCTFDTLPIKAEDVLL
FT                   KMYE"
FT   CDS_pept        572929..574215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0507"
FT                   /product="proton/sodium-glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07925"
FT                   /db_xref="GOA:B0S0J9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0J9"
FT                   /protein_id="BAG07925.1"
FT                   /translation="MKFVALAVTLVLFALLMFMAKKKMNFGTRTIVAAILGIIVGFIFK
FT                   GNTEYVKVFGSIYANLLFAIVIPLLFTSIVSTVVSLESIEKMKKIGTKTIGILSLHNVL
FT                   GSLVGLILGVAFKIGQGSSLTLAADAKAKEVPTFAETFVNFFPDNVLGNAAEAKVVPII
FT                   IFSVLLGLAILQLEERGEGERAKPFLSFIDSAAAVIFRFTGMIIDFTPYAVLALMANAV
FT                   SRTDMASMMPLIVVLILTYVASIFHSYITTSALLAIFAKVNPVKFFKKFWPVQLIAFST
FT                   QSSVGCIPANTENLRDKLGVSEKIATFVASTGSTVGMPGCAGFWPVLSAILTINVMGIH
FT                   YSFGQYVMLVLVALAVSLGTVGVPGTATITTTAVFAAMGLPVEMVVLMSPISMLADMGR
FT                   TATNVTAAGSSAVIVAASEGELDREVFNS"
FT   CDS_pept        574319..574846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0508"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07926"
FT                   /db_xref="GOA:B0S0K2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0K2"
FT                   /protein_id="BAG07926.1"
FT                   /translation="MTEKAKSFFEWLFVIGIAIVLALLLRNFVISTTHVEGNSMNPTIE
FT                   QGDRIFVNRMGIFKNKLKRGNIIELHAPDKSGRDYIKRIVALPGDTVELKNNKVYVNNE
FT                   QLNENYTSSQTTLVSGDKTKWELGEDEYFVLGDNRLPRESNDSRIFGPINKKDIVGRAF
FT                   LRYFPFNKFGVL"
FT   CDS_pept        complement(574894..576846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0509"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07927"
FT                   /db_xref="GOA:B0S0K3"
FT                   /db_xref="InterPro:IPR009164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0K3"
FT                   /protein_id="BAG07927.1"
FT                   /translation="MNNLKYLKLLAKEFPTIEQAANKIISLTSLSVLPKGTEYFLSDLH
FT                   GQYDSFNRIIKSASGNTRIKIDLEFKDKLSESRKNQLANLIYDPKTIINITKENDEYTE
FT                   TWIRDTIFYLIRIAKRVASKYSRQKVRNQTPFYYRDLIDEMLNIQYESLNKKEYFNQLL
FT                   DSIIKIEVSENFIITLCELIQDLNIDWLHIVGDIFDRGKRPDIIMDTLIAKKDVDIQYG
FT                   NHDVTWIGAYLGSYVNACNVVRNAISYNNFQSLEDGYGINLRLLSTLADESYYDDPCER
FT                   FKVRILDDNKHSETDLLHAARMHKAISIIQFKLENQLFKRNPEFEQLDRLYLERIDFKN
FT                   GIYKDANGKAHALLDIKFPTVDPDNPLELTPSEQEVVECISKSFRTSHRLKEHMDFLFS
FT                   YGSVYKIANSNLLFHGCIPMNKDGSFEEFTYQSNTYSGKSLLDFFEGIINSARNMDDND
FT                   PDRQTALDFFWYMWCGPKSPMFGKSKISTFENFFITDKDVRKEVSNPYFSLSKIEKYAD
FT                   KIFEEFNMNPETSHIINGHVPVKSINGEKPVSANGKTYVIDGGISEAYQKKTGIAGYTL
FT                   TFNSHHLAIAKHKNFQVMESVHGAYTPEVTITEEFPKRMLIKDTDEGEEILELIEDLES
FT                   LIDAYRSGTIQQNSN"
FT   CDS_pept        577026..578363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0510"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07928"
FT                   /db_xref="GOA:B0S0K4"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0K4"
FT                   /protein_id="BAG07928.1"
FT                   /translation="MSKIVLIGANHAGTACANTILDNYKDEELVIFDQNSNISFLGCGM
FT                   ALWIGKQIKGPEKLFYCSKEVFEQKGATVHMETKVENIDYDKKIVYAKDKNGKEIQESY
FT                   DKLVLATGSQPILPNIEGMDLENVQKVKIFQDAQSVIDKINHEEIKKVVVVGAGYIGTE
FT                   LAEAFKRLGKESTLIEHGDTVLRGYYDDKFCKKMEDNLRDHGVNLVFNEEVVKLEGTDG
FT                   KVNKVITDKGEYDCDMVIMSIGFKPNSSLAKDHLKLNDHKAIITDKHQQTSDENVFAVG
FT                   DSTVIFNNATGKFEYVALATNAVRSGIVAGHNVCGTKLESNGVQGSNGIKIYDLCMVST
FT                   GLTVRNAEKLGMEVEYTDFTDLQKPPFMEENNKEVTIRIVYDKNSREIKGCQIMSEYDI
FT                   SMMIHMFSLAIQEHVTIDKLALTDIFFLPHYNQPYNYVTMAAIQAL"
FT   CDS_pept        complement(578406..579182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0511"
FT                   /product="gufA protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07929"
FT                   /db_xref="GOA:B0S0K5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0K5"
FT                   /protein_id="BAG07929.1"
FT                   /translation="MIKNIDPFLLTMLGLILPGLLTGVGAIPVFFTRNVNQGKLDVFLG
FT                   AAAGVMLSATCFSLILPSIEENGGGFRGVLISSLGILAGAVFLDLIDKYSPHEHLLDKR
FT                   VEGNPSDSLKKIWLFVIAITIHNFPEGMATGVGFGGNSIAHGLPIAIGIGLQNMPEGLA
FT                   VALALVRENYTVKKAFLIALFTGLVEPVGAFLGYGLVTWFSPILGFILAFAGGAMLFVI
FT                   SDEIIPETHSNGYERQATYGIIIGFIIMMILDVALG"
FT   CDS_pept        579338..580951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0512"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07930"
FT                   /db_xref="GOA:B0S0K6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0K6"
FT                   /protein_id="BAG07930.1"
FT                   /translation="MQAIYRKYRPDTFDKVYGQKHITDILKNQIETKNISHAYIFSGSR
FT                   GTGKTSCAKIFARAINCLDLQNGNPCNKCENCQSSLEESTLDIVEMDAASNRRIDDIRE
FT                   LRDKVIYPPTKLKYKVYIIDEAHMITNEGFNALLKIMEEPPKHLVFILATTEIDKIPQT
FT                   ILSRCQRYEFKMINSKDISDNIKYILNDLNRKMDDDAIELIANKADGAMRDALSILDQV
FT                   LSIEKENITKQDINDILGIVDNKGIFKLVNSIIKKDATDVLGNLYTISHNKPVENVMDE
FT                   LLNHFRNLLLSKNGLEKIRQNNTQYNDDYNAQSELITNRQIVESMSIIIEHQKKLKQAD
FT                   NQKALLEILVMRLIDYIDYDDLIARVNTLEDKLNNIEQNGIKINSTKELSEFDEKIDKK
FT                   IEISQKSSKKEAKQDELSDKNDIIKIDEKIDDKVEEVVENEDSFGKLREVLREFDKIPK
FT                   ELADDINASLENDRLILKTNQLYLYTLLPHKKVIEQLLKPHYDFKVLDLQIDNEKEEKG
FT                   NESVKKLQNLFGKNVQIIEK"
FT   CDS_pept        580960..581301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07931"
FT                   /db_xref="GOA:B0S0K7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0K7"
FT                   /protein_id="BAG07931.1"
FT                   /translation="MGNKFRGGMPGMGNMGNMMKQMQKMQRQMEETQKRLEETEVTATS
FT                   GGGAIEVVANGKKEIVSIKIDEDLVKDGDVEMLQDMVMVAVNDAIKKVLDMSESELGKI
FT                   TGGINIPGF"
FT   CDS_pept        581318..581926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0514"
FT                   /product="recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07932"
FT                   /db_xref="GOA:B0S0K8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0K8"
FT                   /protein_id="BAG07932.1"
FT                   /translation="MSLYPKAMDELIKNLSNLPTIGRKSARRLAYRIIDMDPKKVDELV
FT                   ESIVNVKTNIRPCANCGNLTDKKLCDICSDQKRDNSVITVVEDSMNVISIEKTGEYNGK
FT                   YHVLGGLLSPRDNIAPQDLNLENLFLRCKKDYVKEVILALSPTTNGDLTTNFIIEVLKN
FT                   EEYNVKVSRIAMGVPLGANLEYYDEMSLYKAILDRREIK"
FT   CDS_pept        582005..582697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0515"
FT                   /product="branched-chain amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07933"
FT                   /db_xref="GOA:B0S0K9"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0K9"
FT                   /protein_id="BAG07933.1"
FT                   /translation="MDSNRIKEAIKFSTPIMLGYIPIAMAFGLLCKGQNISMLDSTLFS
FT                   FVFYSGAAQFMAVELLGAGVGMFSIVLSVFLLNLRLFIMSTSLGIHTENVNPKALPAVG
FT                   FMLTDEAFSVMSFNKDKLNTEFALAVEFGPYLAWGIFTPVGYLIGQLMPKSVQTSLEVG
FT                   LTAMFIALVVPSIKKSSNGLVVSLIGVITYAIIFYLKFIPSGWDIILAILLSSYIGLKV
FT                   IMKRGQNV"
FT   CDS_pept        582690..582992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07934"
FT                   /db_xref="GOA:B0S0L0"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0L0"
FT                   /protein_id="BAG07934.1"
FT                   /translation="MYNIILILLCSLVTAVPKIIPLKYLKGKQLSRQTAEFLNIIPYTS
FT                   LSIMVIRGILTASSEMLIPTIVASIVAIIIAYLKENVGLTIILAVLTAFVCLKFF"
FT   CDS_pept        complement(583038..583358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07935"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0K0"
FT                   /protein_id="BAG07935.1"
FT                   /translation="MITYKIDVYIPEDYIDLLIKKLGDEKIITIGNYDYCYTTSKVKGH
FT                   FMPNNFSNNFSGEKNIINEVDEIKLEFRTTENNIKKCIQIIEDIHPYEECVYDIFEIKN
FT                   FK"
FT   CDS_pept        583442..583678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07936"
FT                   /db_xref="GOA:B0S0K1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0K1"
FT                   /protein_id="BAG07936.1"
FT                   /translation="MDLKLYYKETCPFCKKVLRFIEKKGIKDVELVDIKADEANEKYLI
FT                   EKGGMDQVPCLFIDEKPMYESMDIIKFLDEKFQ"
FT   CDS_pept        583967..585190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0519"
FT                   /product="NAD(FAD)-utilizing dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07937"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0S037"
FT                   /protein_id="BAG07937.1"
FT                   /translation="MKVGIIGAGASGVFAALILKQNYIDTTVIERNANALKKIYATGNG
FT                   RCNFTNRNVSYKNYHGENPKFTISAIKKFDNYDVIEFFNDMGIPEVELENGKIFPKSLQ
FT                   ASSIVKQMMCLANHLEVEFIFDSFVDDVRKNGDVFEVKSNGSIYKFDYLIIACGSKAYK
FT                   KSGSDGNGYILMKKLGHNIVKTHPGIVQLRLNGDSFKKMSGTKFKANAKLVVDGKEVFE
FT                   FYHDVLFTDYGISGPTILQLSGEAIRAKNNGLDVKIRIDTVDLDENKLYEHLIYIISLN
FT                   YYKKINELLVGLINDNLIEEVLNQAGINYDINVCELSKEEIYKLAHTLKNLEFSVSGYK
FT                   DEDSGQITCGGVDTDEINPSTMESKKIKNLYIIGEIMDVDGDCGGYNLQWAFSSAYSCA
FT                   MSIIKKEN"
FT   CDS_pept        585191..586483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0520"
FT                   /product="NAD(P)-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07938"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0S038"
FT                   /protein_id="BAG07938.1"
FT                   /translation="MNKMQRKLVDLDNHGQKVRVGLVGCGKMGSGLVSQLSRIKGMRPS
FT                   VIIDRHVDKCVTALRKAGVKDVDIVRTTDLKVAENAIKNNSFVVSDDYTLSYKLDMIDG
FT                   VIDATGNPPFGTQLAVESIEHEKHTILLNVECDAVVGPILNEMAKKKGVVYTGSAGDEP
FT                   GAIIQLSDFALGLGFKLLAVGKGKNNPLDNYTNEDILREEALSKGLVPKMLTSFVDGTN
FT                   TMIELTAVANALGFTPDVLGCHGITTNIHDIADKFKLKEQGGILNNYNIVDFAFGVAPG
FT                   VFAIVTHDTNEVHDLMEYLSMGKGPNYTLYRPYHLTSLETPLTIYDAIVEKEPTIYPKY
FT                   GQVSDTITVAKRDIKKGQKIEGIGGHDCFGKITSHKHQMENNLLPMPIITEKTTAKVDI
FT                   PKDTLITYDMVNLDEDHIITKLRKRQDELGL"
FT   CDS_pept        586595..588118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0521"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="aspartase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07939"
FT                   /db_xref="GOA:B0S039"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B0S039"
FT                   /protein_id="BAG07939.1"
FT                   /translation="MLISICNVINKRFLGGNMDYRLESDSVGEKQVPKDAYYGVQSLRG
FT                   MENFPITGRTLHEELIYGLTIVKKACAIANHRAGIMREDVKNAIVYACDQILKGEYHDQ
FT                   FLTDPIQGGAGTTANMNANEVIANIANEKLGGGLGTYEYVHPNDHVNMSQSTNDVFPTA
FT                   GKIATLRLLIKALNELKQLEISLLNKSVEFDDVLKMGRTQLQDAVPIRLGQEFHAYYSV
FT                   IKRDIKRIRRSSDQIESINMGATAIGTGVNVDKVYFTNIVPILAELTGFDLHQAEDLID
FT                   GTNNLDGLVEISSAVKSTAVSLSKMASDLRLMSSGPKTMVGDIELPPRQNGSSIMPGKV
FT                   NPVIPEVVNQVVFRIIGNDNTVTMCAEHGQLELNAFEPVLFDSLFESISILTNAVRTFR
FT                   ENCIIGIKPNRQKLSNDVEKSVGIVTALVPHIGYKKSAEIAKRALSTGITVRNIVLDEK
FT                   ILTEDELKEILDPIAMTMPGIAAEYLIKQKQQAYIEKKKLEDKEQKSKK"
FT   CDS_pept        588233..588607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07940"
FT                   /db_xref="GOA:B0S040"
FT                   /db_xref="UniProtKB/TrEMBL:B0S040"
FT                   /protein_id="BAG07940.1"
FT                   /translation="MMKNNTKNADNVILAISNVLMVVFVSTLLKGHNIISVLILLAWAV
FT                   YASQNKMILPKSLERKRTKFEYGSFIVLLIGFMLIYYHPNKVYVFLTYLAFVIYNTLLW
FT                   MNMIRMRAINKENKKSNKKK"
FT   CDS_pept        588616..589578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0523"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07941"
FT                   /db_xref="GOA:B0S041"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0S041"
FT                   /protein_id="BAG07941.1"
FT                   /translation="MMKIMVIGPGRWGSFIAWYLKKIGHEVLLYGLNGTEDFENFKKSR
FT                   TNGIITLQDDLELTDDITRAKECDVIHVSINAQGFRSVCEELKSIGIKDKIIVTNMKGI
FT                   EISTGKRLSEVCKEIIDGSNKVAAWIGPGHPQEFYRNVPNCMVIDSEDEDVKELLIENY
FT                   SSDLIRFYYGQDLIGNEIGAAYKNVIGIAAGMLDGMKISSLKGALMSRGCREVARFIKA
FT                   SGGKELSAYGLCHLGDYEATVFSQYSHNRMFGEMYAKSEKYDKLAEGYYTVKAIKIKAD
FT                   KMNLDLPINNAVYKVLYENSKCEEEIDKLFSRSLKKEFY"
FT   CDS_pept        589697..590062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07942"
FT                   /db_xref="InterPro:IPR007394"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0S042"
FT                   /protein_id="BAG07942.1"
FT                   /translation="MEKLLNITMMFDYYGKLLTKREYDVIDKYYNEDLSLNEIAQICDI
FT                   SKQAVSDSLKRAENKLYEYEQKLGLIEKSKKSHQFLRKIRNDLFSLSPEIKSKEIENII
FT                   IDIEDFLNDLEDVENDI"
FT   CDS_pept        590052..591392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0525"
FT                   /product="signal recognition particle"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07943"
FT                   /db_xref="GOA:B0S043"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B0S043"
FT                   /protein_id="BAG07943.1"
FT                   /translation="MIFENLSDKLQNALSKLTNRGKLTEKDIDVAMREVKLALLEADVN
FT                   YKVVKDFISQVKERAIDSSVLESLTPGQQVIKIVNEELTKMMGEKEEKLNVSPMKPTVI
FT                   MLCGLQGAGKTTHAGKLALNLKNKNKSVLLVACDIYRPAAIKQLQVVGGKVGVEVFEMG
FT                   QINPVEISKKAIEEAKRKNIDYVIIDTAGRLHIDDTLMDELKNIKQEVNPSDILLVVDA
FT                   MTGQDAVNVAAKFNEDLDITGIILTKLDGDARGGAALSIRQVADKPIKFIGVGEKLGDL
FT                   EPFHPDRMASRILGMGDVLSLIEKAQNQFDEKKAKELEEKIKAQSFDFNDFLDQMQQIK
FT                   KMGPMQDILAMIPGVDSKMLKQVNFDNKEFDKIEAIIKSMTKQERENPDIISISRRKRI
FT                   AKGCGQDQVAVNKLLKQFKEMKVMMKNMGALQKKFGKKGKMKMPFFR"
FT   CDS_pept        591412..591663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0526"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07944"
FT                   /db_xref="GOA:B0S044"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S044"
FT                   /protein_id="BAG07944.1"
FT                   /translation="MSVKIRLKRMGAKKKPFYRIVVADSRCPRDGKFIEEIGYYNPLVE
FT                   EKTVKVDSEKVQQWIKNGAKPTDTVDRLFKNNGVYEAK"
FT   CDS_pept        591685..591915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07945"
FT                   /db_xref="GOA:B0S045"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:B0S045"
FT                   /protein_id="BAG07945.1"
FT                   /translation="MEKLVKTIATALVDNKEAVEVTSRQDKHTVIIEIKADSKDLGKII
FT                   GKEGKIAKAIRTITKAAAIKSGEKVVVDILQ"
FT   CDS_pept        591975..592403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0528"
FT                   /product="16S rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07946"
FT                   /db_xref="GOA:B0S046"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S046"
FT                   /protein_id="BAG07946.1"
FT                   /translation="MRPLTDNIERFDEDICYYLGDKKVKVTIQNYRMYKGFLYIDFEEF
FT                   NDINEVLGFKKQYLYIDEKDRYELKDGSFYIDDLIGLKAYFNGEYIGDLVDVISIYSND
FT                   VYVIKNDEKEFMIPAVKEFIKKIDLENGLIDVVIIEGM"
FT   CDS_pept        592403..593104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0529"
FT                   /product="tRNA (Guanine-N(1)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07947"
FT                   /db_xref="GOA:B0S047"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S047"
FT                   /protein_id="BAG07947.1"
FT                   /translation="MKFIILTLFPESFDYLKSYGVIGKAIQNNLIELEVVNIRDYTKNK
FT                   HKKVDDEIYGGGAGMLMTCQPIYDCLEDVNKNQSKVVFMSPQGKVLNQQKCIELSKEKE
FT                   IVILCGHYEGVDSRIINHYCDEEISIGDYVMTGGELGAMVLIDCVSRMINDVLGNDESY
FT                   KTDSHYNLLLQEDSYTRPRVFNGYEVPEVLLSGNHEKIEQWREKSRLNNTKLKREDIYQ
FT                   KYLKEKNQGGS"
FT   CDS_pept        593104..593451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0530"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07948"
FT                   /db_xref="GOA:B0S048"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S048"
FT                   /protein_id="BAG07948.1"
FT                   /translation="MDIIKTLEDEQLRENKFDFHVGDTVKVDYLIKEGNKERVQVYEGT
FT                   VIKMQGTGLRRTFTVRRLAYGVGVERTFLINSPRVTNVRLVREGKVRRSKLFYLRHREG
FT                   KAAKVKEKQKF"
FT   CDS_pept        593503..594360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0531"
FT                   /product="putative GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07949"
FT                   /db_xref="GOA:B0S049"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B0S049"
FT                   /protein_id="BAG07949.1"
FT                   /translation="MDINNINWYPGHMKKAIDKIKENMKLVDIVLVLVDSRIVKSSMNP
FT                   VIEDILKDKPQLILLNKMDMADPKITQNWINYFAKKNITALPIDSKNGKNLDKIEPTTK
FT                   KILEDVLSSRKDKNIKSEIIRMMIVGIPNVGKSTIINKLSNRQSAKTGNTPGVTRTNQW
FT                   IRIKGKMELLDTPGVLWPKFEDNEIGLNLAFTGAIKDEILDEENLAYKLIEKLMSIDPQ
FT                   ILEKRYSVDTQNKETIEIMDDIAIRRGCLLKGKNIDYSKVSSIIIDEFRKTKLGRISLE
FT                   DVCD"
FT   CDS_pept        594347..594970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0532"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07950"
FT                   /db_xref="GOA:B0S050"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0S050"
FT                   /protein_id="BAG07950.1"
FT                   /translation="MFAIDYNEFEEELICGIDEVGRGPLAGPVVTCAIIMPKNCEIIEG
FT                   VTDSKKLSEKKRIKFKDMILNQALAYSVNFVDQGVIDEINIKQATRLSMKRAVESLKTK
FT                   DNKFIKPDLIVIDAEEIDTDIKQMSFVKGDEKLYPISCASIVAKVIRDEYMKEMAVIYP
FT                   QYGFEKHKGYGTKLHREMILEHGECPLHRKTFLRKLYENGKKPR"
FT   CDS_pept        594945..595292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0533"
FT                   /product="putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07951"
FT                   /db_xref="GOA:B0S051"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B0S051"
FT                   /protein_id="BAG07951.1"
FT                   /translation="MKMEKNRGKFAEDYACEYLTEKGYEIIDRNYSERIGELDIVCTYE
FT                   NFLVIVEVKARVDDKFGAPSDFVTSGKQDRIRKTTEIYIDKHDLYDYQPRFDVIEIYLD
FT                   NFKLNHYIDAF"
FT   CDS_pept        595365..595853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0534"
FT                   /product="molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07952"
FT                   /db_xref="GOA:B0S052"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B0S052"
FT                   /protein_id="BAG07952.1"
FT                   /translation="MYKVAVLTVSDKGSQGKREDLSGKKIIEIIEKNGYKLEKYDIVAD
FT                   EKELIKEKLIEYSNDNIELILTTGGTGFSKRDVTPEATLEVSEKLCLGISEAIRNYSMT
FT                   ITKRAMLSRAVSVIRKNSLIINMPGSPKAVEESLEYIIDTLDHALKILQGDASECARK"
FT   CDS_pept        595911..596468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0535"
FT                   /product="translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07953"
FT                   /db_xref="GOA:B0S053"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S053"
FT                   /protein_id="BAG07953.1"
FT                   /translation="MIQAGDFRKGTTFEMDGDVWQIIDFQHVKPGKGAAFVRTKIRSVM
FT                   TGSNRDMTFNPNEKYEEARIETREMQYLYNDGTLYYFMDPDSYEQLPIDKASVEEAILY
FT                   IKENDMATIKFFKGKAFQVSPPNFVELEITQTEPGIKGNTATGATKPATVETGATVNVP
FT                   LFVNEGDKIKIDTRTGEYLSRV"
FT   CDS_pept        596545..596694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0536"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07954"
FT                   /db_xref="GOA:B0S054"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S054"
FT                   /protein_id="BAG07954.1"
FT                   /translation="MRDKVILECTECKSRNYTTKKNKKLHPDRVETNKYCKFCKKHTLH
FT                   KETR"
FT   CDS_pept        596704..596922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0537"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07955"
FT                   /db_xref="GOA:B0S056"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B0S056"
FT                   /protein_id="BAG07955.1"
FT                   /translation="MAAKNAQNSNQKSAPKNQGFLKGVKTEWNKIVWPTPKETLEYSVV
FT                   VVIISFIVALIVYGLDTVFQRLIGLFI"
FT   CDS_pept        596946..597527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0538"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07956"
FT                   /db_xref="GOA:B0S060"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B0S060"
FT                   /protein_id="BAG07956.1"
FT                   /translation="MTEKNNTFIENATEDFKERAKEGKWYVVHTYSGHEGKVKVNIEKM
FT                   VENRGYIDDIFEVVVPTEEYVSEVGGAKKLKERKIFPGYVFVKMTITDVSWYLVRNTRG
FT                   VTGFVGPESKPVAVSEKEIQKFALKNQSYSKKEIDVNVGDNVNIVSGAFSDQVGIIEEI
FT                   NTEKAICKVLISLFGRDTSVEISFDDIEKI"
FT   CDS_pept        597616..598041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0539"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07957"
FT                   /db_xref="GOA:B0S061"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S061"
FT                   /protein_id="BAG07957.1"
FT                   /translation="MAKKVQAIVKLQIPAGKATPAPPVGTALGPHGVNIMQFTKEFNAK
FT                   TQDQMGMIIPVVMTVYQDRSFTFITKTPPAPVLIKKELGLNSASGEPNKTKVGQLTKEQ
FT                   VKKIAEIKMPDLNAANLESAMSMIKGTARSMGVTVEE"
FT   CDS_pept        598080..598781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0540"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07958"
FT                   /db_xref="GOA:B0S062"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S062"
FT                   /protein_id="BAG07958.1"
FT                   /translation="MAKKGKKYQESAKLIDRTVEYKLDEASKLVVETAKAKFDESVELH
FT                   AKLGVDSRHADQQVRGTIVLPHGTGKDQKVAVFAKGEKAEEAKAAGADFVGAEDLAEKI
FT                   QKEGWLGFDVAVATPDMMGVVGRIGRILGPQGLMPNPKAGTVTMDVTSAIKEIKAGKVE
FT                   YRTDKSNIIHVPVGKVSFGEEKIAENINALMQAILKAKPASSKGKYIRSLTIASTMGPG
FT                   IKVNPLQFAKE"
FT   CDS_pept        598839..599984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0541"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07959"
FT                   /db_xref="GOA:B0S063"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B0S063"
FT                   /protein_id="BAG07959.1"
FT                   /translation="MKLLKDDKRKIQIGITILIVPVILAYLLFNGKSIGNALSTFMAII
FT                   SPFIIGAALAFVLNMPMNFIENKLLKKWTSKPGLKRAISLLISLVIVSAILTFVVTLII
FT                   PNFLEAIKSLIQGIPVLVEKLRKYPEIAKQLDKIYDTYAITSTHDLFVKLKPYLTKNGL
FT                   DILNNVFFGISTVFSVVLSFVVSFTFAIYLLFSKETLRRQFTELTYVFFGGKTAKRIIV
FT                   FFKVAYEKFYSFFKGQFIEAFMLGFMCFIGMYLLKMPNAATVSVLIGFGALIPLVGAIL
FT                   GAALGALIILIESFSKAIMFVIFIIVLQQFDGNVTYPRIVGSSVGLPSIWVLVAVTIGA
FT                   AVSGIVGMLIFVPIFATIYELLYRYKKKKLEDKNICIIEEK"
FT   CDS_pept        600172..600714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0542"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07960"
FT                   /db_xref="GOA:B0S064"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S064"
FT                   /protein_id="BAG07960.1"
FT                   /translation="MKEHVLNQKKAVVEEIKGHINDAKSMVIVDYRGLDVSEATELREK
FT                   FRNENVLFKVYKNTMMNFAFKELGFEGFLDYLSGPNAVAFSMDDPIAAARIAKEFAADH
FT                   ENLEIKAGYLGDKFLDVEGVKKIASIPSREVLLTKMLGSFKAPVSKFVYLADAIAKSKA
FT                   EGSEETESNETTETVEE"
FT   CDS_pept        600744..601115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0543"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07961"
FT                   /db_xref="GOA:B0S065"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S065"
FT                   /protein_id="BAG07961.1"
FT                   /translation="MSIDEILEAVEGLTVLELNELVEKAEEKFGVSAAAPVAVAGGAPA
FT                   AGGAAAEEKSEFDVILASAGEAKMKVIKAVKDLTGLGLKDAKALVDEAPKAIKEGASKE
FT                   EAEELKAKLEEVGATIELK"
FT   CDS_pept        601508..603508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0544"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07962"
FT                   /db_xref="GOA:B0S066"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B0S066"
FT                   /protein_id="BAG07962.1"
FT                   /translation="MSEEKKSYYITTPIYYPSSNLHLGHTYTTIIADTLKKFKKIQGYD
FT                   VFLTTGTDEHGQKLYEKAKEKNMGDNPLNYIDPIVQSAKDLWKKLDIDIDSFVRSTDKV
FT                   HEKNVQEIFQKLYDKGDIYKSTYKGHYCVDCEAFWTESQLKDGKCPDCGRDVHYHEEES
FT                   YFFRLSKYKDRILQLYKDNPDFLKPESRKNEMVNNFLSGELEDLSVSRTSFDWGVKVPF
FT                   DDKHIIYVWIDALSCYLTGIGYGQDEELFNKFWPCDIHLVGKEIVRFHTIIWPALLMAL
FT                   DLPLPKRVFAHGWILFNEDKMSKSKGNVYYPEPIIDLYGVDALKYYILRDFTFGNDGNF
FT                   TTERFMNRFNSDLVNDLGNLVSRSVSMVEKYFDGVIPQPNDNNDIDKSLISVVEGCQEK
FT                   VEELLEELDFSNALEEIWKVVRRANKYIDETTPWILIKEDPERLKTVLYNLMDAIRVIC
FT                   ILTSPFITETSNKIKEQIGLSEIKWEDGKVFGKTVVGTRVQRGENLFNRLDIKKETERL
FT                   NEVNDKLIEERTGKKVSELRDDNDEEAAKKSKKKSKKAKTKEEITIDDFDKLDLRVGQI
FT                   MEAKQHPDADKLLVFKVKIGEETRQIVSGIKNWYEPNDLIGKKVIVVYNLKPVKLRGVE
FT                   SQGMLLAASKGDNLTMASLLDSEFEDGATVS"
FT   CDS_pept        603508..604275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0545"
FT                   /product="deoxyribonuclease TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07963"
FT                   /db_xref="GOA:B0S067"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0S067"
FT                   /protein_id="BAG07963.1"
FT                   /translation="MGDYVIYDTHCHLTDEKFDFDRDKIIENLKSNSVIKAMLPSDNVE
FT                   NSIKAIELSEKYDFLYNAVGIHPEEDNRFTDEDILKIEELADNPKCKAIGEIGLDYHYE
FT                   HDKQKQKYLFEKQMQIAERKNLPVIIHTRDAIQDTYDILKKFPNVRGIMHSYSGSYEMA
FT                   MKFIDLGYYISFSGVVTFKNARNVKETCEKLPIDKILVETDSPYLTPHPYRGKRNEPKY
FT                   VNLVLQEVSLLKKMSEKETAQIICKNADDIFGW"
FT   CDS_pept        604279..604803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0546"
FT                   /product="primase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07964"
FT                   /db_xref="GOA:B0S068"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B0S068"
FT                   /protein_id="BAG07964.1"
FT                   /translation="MIKEIIVVEGRDDEQRVKRALDCEVVCTGGIYFSDKLLKRLKKID
FT                   QDRGIIILTDPDYAGNKIRKRINDFIPTAKNAFIAQDLCIKDEDIGIENAKEEDIKIAI
FT                   ENAHPSMIDSKNEYTMDDMIYYGLVGEESKALRIKVGKILNIGYGNAKSFLRMLNNYNI
FT                   SREKLEEAINR"
FT   CDS_pept        604800..605651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0547"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07965"
FT                   /db_xref="GOA:B0S069"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0S069"
FT                   /protein_id="BAG07965.1"
FT                   /translation="MSYKLHQPSCIKEILDKFGFKFSKSLGQNFLIDGNLIENIIDYSD
FT                   ITEDDYVIEIGPGFGTLTERLVDKCKFLYSIEIDSRLMDVLKYTVGDRENFKIINEDVL
FT                   KVDLNELNHEDKKFKVVANLPYYITTPIIEHLFNYRDIIESITVMVQKEVANRMVADVG
FT                   SKDYASLSLFVKQNSDAKIILNAPKTVFMPQPKVDSAVVNMKLKKLDEDIDQELLRQLI
FT                   RSGFSKRRKTILNSFTSGFVNVDKEKLKAILQELGLKENLRAENLSLEDYKNIVKKLSL
FT                   ID"
FT   CDS_pept        605704..605934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0548"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07966"
FT                   /db_xref="GOA:B0S070"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0S070"
FT                   /protein_id="BAG07966.1"
FT                   /translation="MKDVVIYTSDGCQYCHAAKDYMDENNVKYTEKNISQDQEARKELM
FT                   KKGHMGVPVTIIGDEEIVGFDQAKLKEALGL"
FT   CDS_pept        606319..607686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0549"
FT                   /product="Mg2 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07967"
FT                   /db_xref="GOA:B0S071"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B0S071"
FT                   /protein_id="BAG07967.1"
FT                   /translation="MMDEKFERHEIDMDLLNKYLEDKDYLKLKNQIQKYNPVDITDYIE
FT                   SLDLKSAMLVFRLLNKDDSIDVFSHMEKDHQTRLLEAFSDKEVKFIVDELYFDDMIDLI
FT                   EEMPAGIVKKVLRHTDKSERNLINQFLNYPEDSAGSLMTIEYIELRSYYTVRKALEVIK
FT                   KTGVDKQTVYTCFVTNEKKTLLGFISLRTIVTNEPETLIEDLMDEDVIYVHTDDDQETV
FT                   ADVFKKYGFVVLPVVDNEKRLTGIITVDDIMEVMEQEATEDFQIMAGMSPDEDEYLDQS
FT                   VFNLAKKRIAWLLILMISATFTGSIMTHYESLLGQAIILTAFIPMIMDTGGNSGSQSST
FT                   LIIRGLATGEISTTDWLKVFFKEFRVALIVSVVMSMVCFIKTMIIDKVSVPVGLVVSLT
FT                   LIFTIVTAKLIGGMLPIIAKKLKLDPAIMAGPLITTIVDALSLLIYFEMAHVALGL"
FT   CDS_pept        607808..608047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="Veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07968"
FT                   /db_xref="GOA:B0S072"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:B0S072"
FT                   /protein_id="BAG07968.1"
FT                   /translation="MKEINDLNMIRSQVRSNIGKDVIVEADKGRNKIVTNKGTISQVFP
FT                   SLFTIKVTNEYDSERTISYTYSDILTSTVKLELC"
FT   CDS_pept        608124..608390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07969"
FT                   /db_xref="GOA:B0S055"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0S055"
FT                   /protein_id="BAG07969.1"
FT                   /translation="MKLKLYMSEKCPDCVDAIEILKNAGIDYEEINITDSMKNLKEFFT
FT                   YRDNRKEFESIVKDNKVGVPMITDGKKIVFFEKLEDLRVFDED"
FT   CDS_pept        608377..609213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0552"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07970"
FT                   /db_xref="GOA:B0S057"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S057"
FT                   /protein_id="BAG07970.1"
FT                   /translation="MMKINSYAKINLSLDVLDLREDGYHNIDTIMNLIDLHDVIEINRN
FT                   NTNELKLSSNNSNFPTDKTNLIYKIFENLKKFRKINCSYDVFVDKQIPISAGLAGGSSN
FT                   ACEFLMYVNDDLSLNLSNQEIKEICRLTGADTFYFTSKKCVRATGIGNEFVRLSDFSNK
FT                   NIIIVNNGMSISSKDVYDNLKESNGGLGKITVAIDSRDYETFYRKAFNTMESVSERLVE
FT                   EISDIKEQLNNLGCDLSLMSGSGPTVFGIFENYNDYENCYSKLKDKYKYVFKTKTL"
FT   CDS_pept        609188..609973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0553"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07971"
FT                   /db_xref="GOA:B0S058"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B0S058"
FT                   /protein_id="BAG07971.1"
FT                   /translation="MYSKQKPYNKIGFVDSGLGGLTVFKKVKKLMPNKEYIYFADSANV
FT                   PYGSKTREQMIKISENIVRFFNEQQIDLLVVACNTLTSIALSHMRSIANFDIIGVVEYG
FT                   VKSALQTTSNKKVGVIATKATVDNGLYKKLLEQNDIEVCQSACLDFVGFVEEDCKDKEK
FT                   ILKKVEEYLKPIVEFGADTIILGCTHYPILIEYLKEYTGENITFVDPADSLSEDIYEIC
FT                   GNYQNKCDIKYYVTKNPSDFKINGSKIIGEPIENVTEME"
FT   CDS_pept        609954..611363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0554"
FT                   /product="putative aspartyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07972"
FT                   /db_xref="GOA:B0S059"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:B0S059"
FT                   /protein_id="BAG07972.1"
FT                   /translation="MLQKWSDFMELNYEKKSIWEVVDEQEHKEIYAYGERYKNFLDNCK
FT                   TEREATGFIVNQAKEHGFVELKEALKGQIKKGDKIYINNKDKSCVLVVIGEDINEGLNI
FT                   VGSHLDCPRLDVRAVPFSEDKNILMMKTHYYGGIKKHQWTTIPLAMHGVIFTNEGKKVE
FT                   IKIGEKEDEPVFYITELLAHLSKDLNAKTLGAAIEGEKLAIIAGHDSYNFKNEKENPIK
FT                   KCILKYLNEKYGITESDFQVAELEIVPATKARDVGFDGAMIASHGHDDRVCAYATLEAI
FT                   LKVENPKRTAVALFVDKEEIGSVGNTSMNAPYMGNMIAEIANNQNENYNDLTMRRIMAN
FT                   SKVLSADVTAAIDPLYSDATEDSNTALSGCGISLAKFTGHGGKFSSNDANPEFLNELRE
FT                   LFKQEKVMWQTTELGKIDQGGGGTIAYILANQGAEVVDIGTAMLSMHAPVELLSKADCY
FT                   MTSKAYHAFLK"
FT   rRNA            611796..613319
FT                   /locus_tag="FMG_rrnC_16SrRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            613363..613438
FT                   /locus_tag="FMG_tRNA18"
FT                   /product="tRNA-Ala"
FT   rRNA            613574..616579
FT                   /locus_tag="FMG_rrnC_23SrRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            616618..616735
FT                   /locus_tag="FMG_rrnC_5SrRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            616929..617003
FT                   /locus_tag="FMG_tRNA19"
FT                   /product="tRNA-Asn"
FT   tRNA            617007..617095
FT                   /locus_tag="FMG_tRNA20"
FT                   /product="tRNA-Leu"
FT   tRNA            617100..617176
FT                   /locus_tag="FMG_tRNA21"
FT                   /product="tRNA-Met"
FT   tRNA            617306..617380
FT                   /locus_tag="FMG_tRNA22"
FT                   /product="tRNA-Glu"
FT   tRNA            617388..617463
FT                   /locus_tag="FMG_tRNA23"
FT                   /product="tRNA-Val"
FT   tRNA            617505..617581
FT                   /locus_tag="FMG_tRNA24"
FT                   /product="tRNA-Asp"
FT   tRNA            617587..617662
FT                   /locus_tag="FMG_tRNA25"
FT                   /product="tRNA-Thr"
FT   tRNA            617686..617770
FT                   /locus_tag="FMG_tRNA26"
FT                   /product="tRNA-Tyr"
FT   tRNA            617806..617879
FT                   /locus_tag="FMG_tRNA27"
FT                   /product="tRNA-Gly"
FT   tRNA            617885..617961
FT                   /locus_tag="FMG_tRNA28"
FT                   /product="tRNA-Arg"
FT   tRNA            617969..618045
FT                   /locus_tag="FMG_tRNA29"
FT                   /product="tRNA-Gln"
FT   tRNA            618050..618125
FT                   /locus_tag="FMG_tRNA30"
FT                   /product="tRNA-Lys"
FT   tRNA            618131..618219
FT                   /locus_tag="FMG_tRNA31"
FT                   /product="tRNA-Ser"
FT   tRNA            618239..618329
FT                   /locus_tag="FMG_tRNA32"
FT                   /product="tRNA-Ser"
FT   tRNA            618350..618426
FT                   /locus_tag="FMG_tRNA33"
FT                   /product="tRNA-Met"
FT   tRNA            618496..618571
FT                   /locus_tag="FMG_tRNA34"
FT                   /product="tRNA-Phe"
FT   tRNA            618572..618646
FT                   /locus_tag="FMG_tRNA35"
FT                   /product="tRNA-Trp"
FT   tRNA            618782..618857
FT                   /locus_tag="FMG_tRNA36"
FT                   /product="tRNA-Arg"
FT   CDS_pept        complement(618944..619348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0555"
FT                   /product="type IV pilin PilA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07973"
FT                   /db_xref="GOA:B0RZY1"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZY1"
FT                   /protein_id="BAG07973.1"
FT                   /translation="MKLLALKNKKKGFTLLELLVVLAILAILIAIAVPVYKNQKEKAAI
FT                   TAHNANVRVLETAVESYRQDNDGKLPGNLQELVKGEYIKSVPKVPASNNENLKGVKTYS
FT                   IDEKKGIIIPVEIDRDKKESDSSQSNTNRN"
FT   CDS_pept        complement(619434..620045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07974"
FT                   /db_xref="GOA:B0RZY2"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZY2"
FT                   /protein_id="BAG07974.1"
FT                   /translation="MNNKTKRILCSIIGNLLIGCSIGILKLSKSGLDPLSFMNSGFSSF
FT                   LNKDFGTVITVCNMIMLVIVFFCHRKSIGLGTVISMATVGYTADFVYMLIKFMNTDKFW
FT                   INFIFLLIGINIMCFGAGMYLEADLGASAYDSMPFVVNSVLKKDFSYKYTRIVLDIITI
FT                   LVGIAFGQQIGIGTIFLGFFSGPLIVFYRDLSEKLIFKNR"
FT   CDS_pept        complement(620038..620883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07975"
FT                   /db_xref="GOA:B0RZY3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZY3"
FT                   /protein_id="BAG07975.1"
FT                   /translation="MNENQLILNIETTGIDPHKNHIYLINIFTNDRYYNFYSINNKSEE
FT                   KIIKSAYKIIQDKQIICFSEFDIKFINAKIIKYTEFDAVNNYIYLQKLIRNYYKISFTS
FT                   LKAKDLATKLFDINIDEKSKSVKIYKRFSKSNHISDELIEFAKTSLAFKLKLYEYMIQY
FT                   FEKNFDTFEICSTNIRYLLYSIKKIKNNLEIILITDNKIEIDAMYESTQVQSQDMFLTL
FT                   SLSLHEGYIDKDFVECIMTSMKNNYNLVSNYYPLVINDEFIYENIKELVKYTLTEIFNE
FT                   "
FT   CDS_pept        620976..622103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0558"
FT                   /product="iron-sulfur cofactor synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07976"
FT                   /db_xref="GOA:B0RZU9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZU9"
FT                   /protein_id="BAG07976.1"
FT                   /translation="MIYLDNAATTKVSENAVKEMVNAMTVDFGNPSSLYDFGMKAEKLV
FT                   TDSRNSIANLLNVKPENVFFTSCGTEGNNISINGSVTNDKKEEFITTSIEHSSVFKTYN
FT                   KLKENRTVHFVNVGDDFKVDDIIDLINDKTRLVSVMHVNNETGKILPITELGKKIKEKN
FT                   PNTLFHVDGIQGFGKIKLNLNEAKVDFYTISGHKIHAPKGIGAIFIRNPERVKPIITGG
FT                   SQEFGISPGTENVAGIVALKCASEEVFSKIDETYDRLYKMKSYLMDELSNIDGVYFNSK
FT                   LEGYSPYITNVCFNYIKSEVLLHYLEQDGIYISTGSACNGSKKSRIIQSINTPDEFSDG
FT                   CIRISFTDDTPEDVLDVFVEKLKLRLEDIRDIMRR"
FT   CDS_pept        622104..623279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0559"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07977"
FT                   /db_xref="GOA:B0RZV0"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZV0"
FT                   /protein_id="BAG07977.1"
FT                   /translation="MLDWYISVSFGELTLKGKNRHTFEKRAISKILDAISDYKIEEYYQ
FT                   EQGKLYIKADVNDFDEIIDHIKKVFGIVYISPCVKCEKTVESMQDGVLKIIEGKIIKDK
FT                   LQTFKVDVHRVDKRFEPKSPELNPLLGGTILKKYGNYVKVDIKNPDFFIYVDIKDNCYV
FT                   YTDRIKGWGGLPIGSSGRGLLLLSGGIDSPVAAFLMAKRGVRVDCLHFHSYPFTSQRGF
FT                   EKVKQLAEEVSYYTGNINFYSVNLLPVYKAITKNCKERMMTIISRRFMMRIAERIANEN
FT                   KIDALITGESLGQVASQTIQGVSVINEVTSLPILRPLIASDKTEIIEIAREIGTYETSI
FT                   LPFEDCCTVFTPKRPVTKPRIYDVKREEENLDIEALVQECIDNMELIKIRQ"
FT   CDS_pept        623288..623842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0560"
FT                   /product="putative cytoplasmic membrane protein LemA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07978"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZV1"
FT                   /protein_id="BAG07978.1"
FT                   /translation="MKKAGVIIGIIVVLALLLIPQYNGLVQSKENVNEAYAQVQNVVQR
FT                   RADLIPNLVNTAKGFAKHEEDVFIKVSEARSGVKNAKDPQELAKANDELTNALNGMNVV
FT                   VERYPELKSDTHFTQLMDELAGSENRIATERKNYNTVVKTYNQKVKRFPTVIFARLMGF
FT                   SSEKYFEADASAQKAPQVNFE"
FT   CDS_pept        623855..624694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07979"
FT                   /db_xref="GOA:B0RZV2"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZV2"
FT                   /protein_id="BAG07979.1"
FT                   /translation="MRKQCRWIFSFVLAFLLIFNVNAFAQDLPKSPDTFYLDEMGVISQ
FT                   EVKDKIVKTNVELEQKTGSQVLVVTIKDLKGRDPVDYGVDLFNKWKIGDATKKNGVLIL
FT                   LSQDLNEPKGRNRHINIITGYGIEGRLNDGKVGRIIDEYMLDDLKDGNYSNALQEGFNA
FT                   VVSEVAAEYNVELNGDFDKYQENLSRNTQPPLFNTILRIIIFLIILYFISRNNRRNRRY
FT                   GGRRRGGTIFFPGFGGGFDDDDFGGFGGGFGGGSSGGWGGFSGGGGSSGGGGAGRSF"
FT   CDS_pept        624837..625376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0562"
FT                   /product="putative transcriptional regulator Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07980"
FT                   /db_xref="GOA:B0RZV3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZV3"
FT                   /protein_id="BAG07980.1"
FT                   /translation="MEIGDKIRSLRLKLGLTQEELAERSDLTKGFISQLERDLTSPSVD
FT                   SLNYVLNALGTDMATFFADDLSVKEIFTKEDYQSSEDVSMKSSITWLVPKSQVNTMEPV
FT                   LITLKGKGETKEYNPFEGEEFGYVLEGSCNIYLDNEKYKLKKGDCFYTKCNKTRMLENN
FT                   GTKICEVIWVMSPPNF"
FT   CDS_pept        625389..626435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0563"
FT                   /product="spermidine/putrescine ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07981"
FT                   /db_xref="GOA:B0RZV4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZV4"
FT                   /protein_id="BAG07981.1"
FT                   /translation="MDNIIELIGINKSFEDEHILKDLNLYIRNKEFLTLLGPSGCGKTT
FT                   TLRLIAGFETPDTGKIMFEGKDISNIAPYKRNVNTVFQKYALFPNMNVFENIAFGLRIK
FT                   KMNEKLIREKVTEVLKLVNLSGFEKRKINNLSGGQQQRIAIARALVNEPSVLLLDEPLG
FT                   ALDLKLRKGMQNELKNIQERIGITFVYVTHDQEEALTMSDTIVVMENGIIQQIGTPEDI
FT                   YNEPKNEFVAKFIGESNIIDGVFLEDCMVEFSNHKWKCVDKGFAKNENVQVVIRPEDVE
FT                   IVAPEKGQIKGTVISDRFKGIHYEMFVDTGDFKYKAQSTINKPQGSMVGINIDPDNIHI
FT                   MKRCDDEA"
FT   CDS_pept        626425..627234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0564"
FT                   /product="spermidine/putrescine ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07982"
FT                   /db_xref="GOA:B0RZV5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZV5"
FT                   /protein_id="BAG07982.1"
FT                   /translation="MKLKKLSIPYAIWILFFIVFPLFLIVYYSVTTGSLRDFSNPQFSL
FT                   EYFYRFFTSKYVKVLLNSIRLAFISTVICLLIGYPTAYFISKVDKKYKAVLMLMIVIPM
FT                   WMNFLLRTYAWIILTGKNGIINSVLIHFGFSPIKMLYTEGAILMGMVYNFLPFMILPIF
FT                   SILDKSDYSLVEASYDLGASRLQTFLRVVFPMSLPGVITGITMVFIPAISTFEISALLG
FT                   GNKYNLIGNIIEHQFRIAGNWHYGSAISVVLIIMILISLAFTNEKGE"
FT   CDS_pept        627236..628009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0565"
FT                   /product="spermidine/putrescine ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07983"
FT                   /db_xref="GOA:B0RZV6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZV6"
FT                   /protein_id="BAG07983.1"
FT                   /translation="MKEFFKKFYLALVFLFLYGPIAVLMVFSFNDSRLKGSWVGFTFKW
FT                   YKELLHNEEILSSFKTTILIAILATIIATILGTIAAIGIYYLRGYKKSLLLNMNYLPVL
FT                   NPDIVTAVGLMVIFNLMNFPFGFFTMLLSHITFTTPYVILAVLPKLAQMNKFLPEAAMD
FT                   MGATPFYTLRKVVLPEIKTGVFSGSLLAFTLSIDDFVISFFTTGHGVSNLSVTVYSMAK
FT                   KGVNPAINALSTIMFLVMVILLLILHKRTNLLEEL"
FT   CDS_pept        628011..629036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0566"
FT                   /product="spermidine/putrescine ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07984"
FT                   /db_xref="GOA:B0RZV7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZV7"
FT                   /protein_id="BAG07984.1"
FT                   /translation="MKKILLFLLTILVLTSCSKDESNVLYVYNWGEYIEPALLDKFEKE
FT                   TGIKVIYDTFEQNEDMYMKVKEGGSNYDVVVPSDYMAEKMIKQGMLEKIDYSKIPNFKY
FT                   IDQRFKNLDYDPKNEYTVPYMWGTVGILYNKNKVKEKVDSWNILWDEKYKDNIIMMNST
FT                   RDTLGVALKRLGYSMNSRNEAELEKAKQSLIKQKDLVLAYLVDETKTQMVNEEADLAVM
FT                   YSGDAIVSKGENENLEYVIPKEGSNLWFDTLAILKNAKNKENAEKFINFMTNPENAKLN
FT                   AEYIGYSLPSTQARKLLDKEIQEDKTAYPDLSKHKNMEIFKDPSDFVEKYDDIWADIKA
FT                   N"
FT   CDS_pept        629140..629973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0567"
FT                   /product="undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07985"
FT                   /db_xref="GOA:B0RZV8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZV8"
FT                   /protein_id="BAG07985.1"
FT                   /translation="MFIEILKVILLGIIEGVTEWLPVSSTGHILLLDEFIKLNMSDAFK
FT                   SMFTVVIQLGAILAVVVIYWNKVWPFKKGQSHLISISKSKMIMWAKIIVACIPAAIIGI
FT                   KFDDYIEEHFYNYFVISLALIIFGILFIIIENRNKESHKKLVDSIDKITYKQAFIVGLF
FT                   QVIAAVFPGTSRSGATILGGIAIGLSRTIAAEFTFFLAIPTMFGASLLKLVKFGFSFTA
FT                   MEAFVLLLGTAVSFVVSVITIKFLMNYIKNNDFKVFGYYRIALGVLVLIYFGLIR"
FT   CDS_pept        630099..632276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0568"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07986"
FT                   /db_xref="GOA:B0RZV9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZV9"
FT                   /protein_id="BAG07986.1"
FT                   /translation="MMNLDNLNDRQREAVENTDGPMLILAGAGSGKTKVLTTKIAYCLE
FT                   KGLCSKYEILAITFTNKAAKEMKERVENILQENVDSMWIGTFHAICSRILRVEIERIGF
FT                   ERNFTVYDRADQISLVKECLKDMGVDPKNVEIKNEINTISRLKNAGATEKNIDKEDFDI
FT                   SLSTFTMELFQKYEHKLKRYNSLDFDDLIVKTNLLFEENPDLREKYSDRFKYVFVDEYQ
FT                   DTNDTQYKLIKNLVSKNDNICCVGDSDQSIYGWRGANIQNIQNFEKDFKNAKVILLEQN
FT                   YRSTQPILDLANTVIKNNSLRKDKNLWTAKNEGDMPIYRRMYSDIDEADQVVQWIEQER
FT                   YRENPYEEMAILYRTNAQSRLFEERLNRLGIPNRVVGGLKFYDRKEIKDCVSYLRIVEN
FT                   LNDNMALNRIINEPKRGIGKTTMDKLLQCSQNRSISMMQYIIDTDLPDFSNATAKKLQE
FT                   FYYLIKSFPKDQMNVAELMEYILDKTGYRANLEKSTNRDDKTRLENIDEYVSSLYQFVQ
FT                   DNPDKNLREYLETSSLMTDLDKTDDNTKGVSMMTIHAAKGLEFDVVFFTGLEEGTIPSR
FT                   VDEDVEEERRLCYVAITRARKKLYITSVQSRRRFNEFQTKAESRFIEEMENKYKDESPN
FT                   KEVSFRESFNTKVVDDYRTEASASITKKQNNVTKNNEKYRAGDKVSHKKFGTGVIVGIV
FT                   EKENGDELTINFDKKGLKKLNSSLAPLTRVE"
FT   CDS_pept        632276..634264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0569"
FT                   /product="NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07987"
FT                   /db_xref="GOA:B0RZW0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZW0"
FT                   /protein_id="BAG07987.1"
FT                   /translation="MEKQDRIKYLVDILNKYAYHYYTLDDPLIADSEYDVLYDELVNLE
FT                   KETGIVLPNSPTNRIGGEVLSGFEKHEHLNTLYSLGKAQSKEEVRNWVDKTIEFVQNYN
FT                   ENHVNKLPKVEFYVEFKFDGLTVNLTYDGGYLVMATTRGNGTIGEVITSQVKTINSIPL
FT                   KIKDTRLMEIQGEGVMPLSSLENYNKTHEPKLKNARNAAAGALRNLDPAVTRERNLDAY
FT                   FYNVNYLQDNELETQEEMIKFLGDNYFKLYPYEKHATSFEEVSKFIDEIFELRNEIDVL
FT                   TDGVVIKVNDFKTREKLGYTNKFPRWAIAYKFEPERFTTIVKEVEWNVGRTGKVTPTAL
FT                   LEPVEIGNVTVKRATLNNIDDIERKQVRLNSEVFVRRSNDVIPEIMGVVNPDQEDTEEI
FT                   EIPHYCPYCHSELFRDGVHIFCPNSMSCTPQLVKRMVHFASRNAMNIDGLSEKTLEVLL
FT                   EKLNIKSIEEIYDVKKEQLMQLDGFKEKKSQNLINAIEKSKNVDLANFIFALGIPEIGE
FT                   KTSFELAQKYKSFDNLREAKFEELIQIEDIGNVIAEEIVEFFHDETISNSIDSLLSKGI
FT                   KIKNPENIEKKLDNLTFVLTGSLVNYSRKELTDKLSNLGAKVSSSVSKNTDYVVYGEKA
FT                   GSKLTKAKDLGVKLMTEDELNSFLDNL"
FT   CDS_pept        634315..634596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0570"
FT                   /product="glutamyl-tRNA amidotransferase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07988"
FT                   /db_xref="GOA:B0RZW1"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZW1"
FT                   /protein_id="BAG07988.1"
FT                   /translation="MINRDEVVKIYDLANLELTENVDDLYEKYNTVLDFASMIMECDTE
FT                   GVEYLEFLPQYHSILREDTPKESIPRDVALKNAKSREYGYFKLKKVVE"
FT   CDS_pept        634596..635987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0571"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07989"
FT                   /db_xref="GOA:B0RZW2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZW2"
FT                   /protein_id="BAG07989.1"
FT                   /translation="MIENLRNKFVENPESLRDYYNDLDKLIESKKDLNVFITYDKSFVD
FT                   EQIEKLIEKAKNNENLGKMFGVAVSVKDNINVKDLKMTCGSKMLEDYVSIYDATVIKKL
FT                   KEEDCVIVGKVNMDEFAMGSSSETSYFGPTKNPVDTKLIPGGSSSGSAASIKAEMAVVS
FT                   LGTDTGGSSRQPASCCNVVGFMPTYGSISRFGVQSMANTLDEVGILSNSVEDIMDTYNV
FT                   IAGHDDNDMTTIQSEVNVKKKDYDFKGKKIAVVDLKKYSNDETVIKEYKEILEILKNMG
FT                   ADLVEIDFEYLKYANALYNVIVTSEVSSNMSRFDGIRYGYLTDDYENTRDLFVKVRSEG
FT                   FGEEVKRRIAMGTFYLASSNDQKVYKQGLKVRNLLSQEFKNIFKEFDLIATPTMTSLPY
FT                   ELDSRKDDPLAVYDSGIFNVIVNLSGLCAISIPYKSGISTSLQLIANSHDEENLLNAAL
FT                   AFERR"
FT   CDS_pept        635989..637410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0572"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07990"
FT                   /db_xref="GOA:B0RZW3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0RZW3"
FT                   /protein_id="BAG07990.1"
FT                   /translation="MNLKTLIGLEIHVELSTKTKMFCGCKNEFGQIPNTNVCPICLGHP
FT                   GALPHMNKQALRYAIMAGLAFDCDIANEFKMDRKKYFYPDLVKGYQITQEDQPLCTNGY
FT                   IELKTSTKNKKVRIRRIHIEEDTGKSIHNESGNTLMDYNRAGVPLIEIVSEPDMSNPDE
FT                   AREFLETLRERIKYLEISDVKMSEGSLRCDVNINVYDEDSDFKTKISEIKNLNSFKSVS
FT                   KALIYEQERHMQLAKENKIGEKETRRWDEDTQTTIVMRHKEEGNDYRFSVEGDIPKTYV
FT                   EQSYIEEIKKNLPELPEMRKERFMNEYKIDEYDADILTRNGYLADYYEKVVEISNDPVQ
FT                   SSNWLLGDVLRQVNENEIEIEEMNMSAENLAKLIKLSSAKKINNQTAKKVLREMFNENF
FT                   DPEVYVKEKGLLQVDDDNLLQQIVDEVVAENPESIESIRNGKDRAIGFLVGQCMKKSKG
FT                   KGNPQKFNELIKEKI"
FT   CDS_pept        637410..638012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07991"
FT                   /db_xref="GOA:B0RZW4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZW4"
FT                   /protein_id="BAG07991.1"
FT                   /translation="MKKIYLSTGNKGKVSEIKEILSDLTYDVYSKSELGINEDAVEDAE
FT                   TLEENSLIKAKFLKKYTDDIVMSDDTGLFVNSLDGRPGVYSARFAGDECDDSKNRKKLL
FT                   SELKDKEDRSAYFETVITIIDLNNEIHQAKGRVDGKILLEECGEHGFGYDSIFMPDGYD
FT                   KSFAQMEDCEKNKISHRKRALENAKIILKGLNESSNN"
FT   CDS_pept        637993..638457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0574"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07992"
FT                   /db_xref="GOA:B0RZW5"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZW5"
FT                   /protein_id="BAG07992.1"
FT                   /translation="MKVAIISDTHNKIAKVYDYLFDKEIDIIVHLGDVCDDAILLEDLL
FT                   KKEVIYVKGNNDFYVVGGEYDKVIRISDKNIFITHGHKYNVSSGVKRLVEKSKSLNCQM
FT                   CLYGHTHRYFNEKIDGVWVINPGSVTYPRDGQAGFVIYDTNNEKIERILL"
FT   CDS_pept        638454..639257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0575"
FT                   /product="methylenetetrahydrofolate dehydrogenase"
FT                   /note="methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07993"
FT                   /db_xref="GOA:B0RZW6"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZW6"
FT                   /protein_id="BAG07993.1"
FT                   /translation="MNVLDIKELREDLGKRIIDGVEKLGREVKVATVRVGENAGDISYE
FT                   KAVKNNCAKLNITCDQIVLEEGENEKLIQTIKELNETHDGILMFRPLKDKNLEKEIQYI
FT                   IAPEKDIDAMGMVNLGKVLAAEEDAYYPATARAVVEIVKYYNFDVKNVVIVNRSLVLGK
FT                   PLFNMLIKENKTVTMCHSRTEDIKSFTKNADLVVTAVGKAKMFDDSYFTKDSYVVDVGV
FT                   SLDENGKLSGDVNPEVDVKVLANSVGKITTRVLLLQMVEGALNRQ"
FT   CDS_pept        639347..639931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07994"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZW7"
FT                   /protein_id="BAG07994.1"
FT                   /translation="MKIGAVIMASGLSKRMKTDKLMLKYNDKFIFEYIIDLVVKSNFYD
FT                   RIVITNNSTIIEYCKNIGIKAINNPNNEIGQSESIKLGVKYFNEMDGICFLVSDQPFLT
FT                   DFSIEKLITSFEKGKISQLRFANRIGNPVIFSNKFFNELSSLKNDEKGSIVKNNNLNHV
FT                   KYVDALYERELMDIDTNDDYERILNAENLFD"
FT   CDS_pept        639909..640721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07995"
FT                   /db_xref="InterPro:IPR017695"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZW8"
FT                   /protein_id="BAG07995.1"
FT                   /translation="MQKICLIRGAGDIATGTIQKLVHAGFKCVVTEVSNPSSIRRKVSL
FT                   SEAIYDKKATVEDIEAILCENLDEIDKYLELYNPVVIVDPKLTILNKKRFDVVVDAILA
FT                   KKNTGLKKEMADITIALGPGFEAGVDCDIVIETMRGHDLARIIEQGFAKKNTKIPGVIE
FT                   GFSTKRVIYSDFEGKFTSIKKISDIVRKGEIIAKVEKNDIRATLDGVIRGMIRDNFDVT
FT                   KGLKIIDIDPRYEEVKNCFTISDKARAIGGAVLEAIMMLENRREKDAK"
FT   CDS_pept        640711..641481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07996"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZW9"
FT                   /protein_id="BAG07996.1"
FT                   /translation="MQNDVLLEMYKSLEDGYKCMMVTLFKNKGSVPGKQGNIMAVREDG
FT                   KTFGTVGGGAIEYQVIKDSIENLKKDNDFEFDYVLNEGEKVSMSCGGRASGFGKVFFPK
FT                   PTLIIFGAGHCSQKLARIATLTNFEVVVVDDRDEFIYNEDFSNIKKFINKEIEDSIDDL
FT                   RFTPDTFIIAATRDHKHDEEVAFNILNKPHKYFGMLGSRKKANTLKQNLIDRNVDKKLV
FT                   DSINVPVGLDIDDGSVEEIAISIMSQILKVKNNK"
FT   CDS_pept        complement(641507..641926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0579"
FT                   /product="transcriptional regulator Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07997"
FT                   /db_xref="GOA:B0RZX0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX0"
FT                   /protein_id="BAG07997.1"
FT                   /translation="MKNEVLLKNGLKITKARKLIISILEKEEDPISAEDLYEIFKKKEN
FT                   SNLSTIYRNLKILKSKEIVEVVCEIDGISYYRLKGKKHKHSIICESCGKIIPIDHCPVE
FT                   KIEMDLEDKTGFKIDSHNLEFRGICPDCQKKNETK"
FT   CDS_pept        642092..643285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07998"
FT                   /db_xref="GOA:B0RZX1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX1"
FT                   /protein_id="BAG07998.1"
FT                   /translation="MNILFSPPDISDKEIEEVVDALKSGWITTGPKTKLLEKKLQEYTQ
FT                   SKKTCCFNSATAALECALRILGVNGKKDECITSAYTYTASCSVIDHLDATIKLVDVQKD
FT                   SYFMDYDKLYDSINENTKAIIPVDIAGVPVDYDKIYEIIEAKKSIFRPSNEIQESLGRV
FT                   ALISDSAHALGSTYKGKKIGSFQDIASFSFHAVKNFTTAEGGMLSINIGDVDKIYNDLQ
FT                   LYSLHGQNKDALAKTKLGAWEYDIKGLYYKYNMPDILAAIGLAQLERYDDLLARRKEII
FT                   KMYNDGFDNTSISYLNHFGKDYTSNGHLYLTRVEGIDEATRNDIIVKMAEKGIATNVHY
FT                   KPIAMMTGYKNLGFDIKDYPNTFEQYKNEITLPLHTLLSDDEVAYVIETYKDIVSGK"
FT   CDS_pept        643287..643919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0581"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAG07999"
FT                   /db_xref="GOA:B0RZX2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX2"
FT                   /protein_id="BAG07999.1"
FT                   /translation="MDNRVDEILKNSKFNLFIKRLFDILASLFGILVMAIPMIIISIAI
FT                   KLDSKGPVFFKQKRVKKNNKDFTILKFRTMVVDAPKLGMAITVGDDPRITKVGKFLRKT
FT                   KLDEFPQLFNVLIGDMSFVGPRPEVRKYVDLYSDSDRDILKIRPGITDLASIKYRDESE
FT                   ILDKSDNPEKTYVEEIMPNKIELNKQYIENINLINDIKIILQTLKIL"
FT   CDS_pept        643966..645153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0582"
FT                   /product="pleiotropic regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08000"
FT                   /db_xref="GOA:B0RZX3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX3"
FT                   /protein_id="BAG08000.1"
FT                   /translation="MNIPLLNLKRQYKNIEEEVNASVLECFKNAQYIMGENVKQFEKEI
FT                   AEKIGVKHAITVGNGTDALIIALKSLGIKEGDEVITTDYTFFATAEAIRFVGATPVFCD
FT                   VELDTYNIDPSQIEEKITDKTKAIICVHLFGNACKMDQINDIAKRHNLYVIEDAAQAIN
FT                   SQYKGKNVGNLGDVACFSFFPTKNLGCFGDGGMITTNDDDLATIIRALKVHGSGENGMK
FT                   AYAILNDEEVEVVEQNSGDNTVYNPLKYYNYLIGHNSRLDEIQAAILRIKLKHLDEYTE
FT                   NRRSISHKYIDALKNTSLVMPTETEGGKHVFHLFILQSENREEIESKLKEKGIATGTYY
FT                   KVPMHLQKAFNDLGYKKGDFPNAEYLSERTFAIPLFPEMNDEEREYIINSIKEIV"
FT   CDS_pept        645153..645731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0583"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08001"
FT                   /db_xref="GOA:B0RZX4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX4"
FT                   /protein_id="BAG08001.1"
FT                   /translation="MDFFAHESCYIDEETKIGKGTKIWHFSHVMSGCTIGENCNIGQNV
FT                   VISPDVTLGNNCKVQNNVSVYTGVVCEDGVFLGPSCVFTNVINPRAFIEKKDEYRKTTI
FT                   KEGASIGANATIVCGNTIGKYAIIGAGAVVTKDVGDYEVVVGNPARHHGFACSCGENLK
FT                   RVSLTDYICEKCDKKYLLNDYKLSEVSNE"
FT   CDS_pept        645724..647055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0584"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08002"
FT                   /db_xref="GOA:B0RZX5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX5"
FT                   /protein_id="BAG08002.1"
FT                   /translation="MNNLKEELLGKIEDKSLVVGVVGLGYVGLPLAVEKAKAGYTVIGF
FT                   DVQPEKVQMVNDGVNYIGDVVDSELKAIVESGKLRATSDFKSVASCDFIAIAVPTPLDI
FT                   YQQPDISYVEKSTTDVSKHLKKGSIVVLESTTYPGTTEELMRPILENGSGLKCEEDFYL
FT                   AFSPERVDPGNKQYKTKNTPKVVGGIGSESTEVAAALYRNVLEGEVMTVSSPRVAEMEK
FT                   ILENTYRNVNIGLVNEFAKLANKMDINMWEVVDAAKTKPYGYQAFYPGPGVGGHCIPLD
FT                   PFYLTWKAREYDVHMPIIEASGTVNDSMPEWVVDRSMKILSRKFKKPLNGSKVLILGIA
FT                   YKKDIDDLRDSPAFVVMDKFREEGAIVDYYDGFNPSYFNPDGSKTYSLKEINPEVVKGY
FT                   DLVVITADHTNVDYQMVVDNAPFVFDTKYATRDVENNRDKIELL"
FT   CDS_pept        647064..648083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0585"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08003"
FT                   /db_xref="GOA:B0RZX6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX6"
FT                   /protein_id="BAG08003.1"
FT                   /translation="MQKIKCAIIGCGRISYKHVEGIANNDSEIELVAVCDIIEERAIEK
FT                   RDEYLERFPDRDVKVYTDYKKMLEEVDIDMCSISTESGYHGKIALHCLEKSKHVLIEKP
FT                   MAMSLEEIDKINKLADEKGLKVGVCHQNRFNPPIQKLKKTIDANKFGKMTNITARVLWN
FT                   RNQNYYNLAPWRGTKALDGGTLMNQCIHALDLLLWMMDDELVSVKAETETFLRDIEMED
FT                   YGVILMRFKSGRIGLLEGSADVYPKNLEETISVFGSTGTAVIGGLAVNEIKTWVFEDES
FT                   ETGELKDDKSIDNVYGNGHTPLYKDFIHAINTDTQPLINGHEGRKPVEVLMKAYGWID"
FT   CDS_pept        648407..648952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08004"
FT                   /db_xref="GOA:B0RZX7"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX7"
FT                   /protein_id="BAG08004.1"
FT                   /translation="MSGFKKFVHILFSILLILFSLVMFFTVFNFGQVSYNLREFMMNEV
FT                   CFYIFAIIGALVLIGAIFIMFKAILSDDLSDFLISKDKDGEVMISTDALENTVKRTVDK
FT                   YEDIRTSNVNVRVNNSSEPYMNCDVEVGVRDMSNIAGLGENIKEDIRLNLENLSGYKVK
FT                   DITVKFLDLTKSTNKRVV"
FT   CDS_pept        648962..649261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08005"
FT                   /db_xref="GOA:B0RZX8"
FT                   /db_xref="InterPro:IPR018730"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX8"
FT                   /protein_id="BAG08005.1"
FT                   /translation="MNNNNMLDNFESPDEEKRIVFVREYSKDKFDERLIKNLSGLRKPT
FT                   KYGILGVIIALLFLKLGFWATILILLLFGIGYGYGLYKEGNPKFIRFLMNLFRK"
FT   CDS_pept        649288..649743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0588"
FT                   /product="alkaline shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08006"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZX9"
FT                   /protein_id="BAG08006.1"
FT                   /translation="MEEKKYNEVNKVNEKKAEKEQEQKHESKLTFDNSVVQKIAAIAVR
FT                   EVPGVLDMEGGFFSGIQETFGGYDATKGIEAEVGEKEAAIDVSVILEYGVSAVKVFHQL
FT                   QEVVKQSVNKMTGLDVVEVNCKVVDVMTRKEFNLKNKKEEENKSGLK"
FT   CDS_pept        complement(649777..650631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08007"
FT                   /db_xref="GOA:B0RZY0"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B0RZY0"
FT                   /protein_id="BAG08007.1"
FT                   /translation="MQKIAILTDTTSDVDPSIIKEYNIVEVPLQIIYNSEVTYKDKYEK
FT                   NIDDVINDINSNTISSSLPLTSDLIEKIEYIISEGYTHIIATCMSCGISGTYNLFRQIL
FT                   NLYSDKITYHLIDCRSCSMGMGFLIEKAVKMKENGISYEEIVKELEKLKTKEDFFFTVD
FT                   KLDYLYTSGRIKRSSKVVGNLLNIKPIITCIKKTGNLEVIDAVRGRKKVNQQILNYIID
FT                   FAANDQIDNIYIMHSNLQENADELEKVIQDYYPNVKIYKRSISSLFVIHTGPHIYGAVV
FT                   TLK"
FT   CDS_pept        complement(650716..652419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0590"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08008"
FT                   /db_xref="GOA:B0S0W8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0W8"
FT                   /protein_id="BAG08008.1"
FT                   /translation="MKRKIYTRISLVIIIALAVGLGLQNFIFYNYNKSKEETTLLRQVQ
FT                   YLDSISDNSRDNTITNIKKFKIINPSNRFTLIDKNGNVVYDTDTNVNSLDNHNNREEVK
FT                   DARESKIGSITRKSDSFGKNMYYVAILQENSDVLRVSCESASFLKTILDLLPYTLLILA
FT                   LSLILLIDINRRQVRQILDPIETIANELDDNIVNDKESKLLEQPVYDELIPFINIIRRK
FT                   NETIKKYVDELQERSTTIKTITDNMREGLILLDKNMNVLSVNKSAEFLFGASDSRYEGR
FT                   PFISLNRDLKIHSAIKDVISTKTAHHINIEMQGILLSMYIAPVLDEENINGVLLFLVDE
FT                   SDKIKAEKRRREFSANVSHELKSPLTSINGYAEMIENNMVSPENVSKFASIIHQEGLRL
FT                   LELIDNIIKLSKLDESGDNIEKILFNPEKIIDEIIKSNQNKLDSKQIEIITDLQENCLI
FT                   YGNENLIKEMIENLVTNAIKYNKISGKIKISIFKDNDKTKIICEDTGIGIAEKYQKRVF
FT                   ERFFVVDKSRSSQESTGLGLSIIKHIVDIHDGTIELESKLDVGTKITITI"
FT   CDS_pept        complement(652419..653135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0591"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08009"
FT                   /db_xref="GOA:B0S0W9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0W9"
FT                   /protein_id="BAG08009.1"
FT                   /translation="MGNILSYWRKIRGKCTMICCVEDDKSIRELIIYALNNEGYDAMGF
FT                   GDYGEFKSTLYSSSIDLIILDIMLPGKSGLEILKEIRNNEKTKNIPVMMLTAKTTEYDK
FT                   IVGLDSGADDYMIKPFSIMELLARVRALLRRSSLSKTKSKIIYKNIELDYDKRTVSVDG
FT                   ENVELTYKEFELLYYLLSNVGKVLTRENIMTKIWGFDFEGESRTVDVHIATLRQKLKNA
FT                   SSIIKTIRNLGYKAGE"
FT   CDS_pept        complement(653084..653740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0592"
FT                   /product="phosphate uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08010"
FT                   /db_xref="GOA:B0S0X0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X0"
FT                   /protein_id="BAG08010.1"
FT                   /translation="MRKYFTHQLEELKHNLIFLGANVERQIEQSTYALETQDLEIAQKV
FT                   YDSQETIYEMSKEVEDTCLRLLTTQSPVAKDLRFISSALRILSCMSKIGNHAQEISELV
FT                   MLIGKSQLPKDLTMIRSMGKSAQKMLVESVNAFTDDDVELANSVIKKDDEVDELFAHFM
FT                   EESIELIKSGCENPEQIIDLIQVAKYIERIGDNAERIATWVIFSVTGERYEENAQ"
FT   CDS_pept        complement(653755..654507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0593"
FT                   /product="phosphate ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08011"
FT                   /db_xref="GOA:B0S0X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X1"
FT                   /protein_id="BAG08011.1"
FT                   /translation="MSKISIKDVDLYYDDFQALKKINMEMKSNEITAFIGPSGCGKSTM
FT                   LKCLNRMNDLIDGCRIEGLITLDGKDIYDKNYDVNLLRKRVGMVFQKPNPFPMSIYDNI
FT                   AYGPRLHGEKNKAKLDEIVEKSLKGAAIWDEVKDNLKKNALSISGGQQQRICIARALAV
FT                   EPEVLLMDEPTSALDPISTNKIEDLCQDLKSKYTIVMVTHNMQQAARISDKTAFFLTGE
FT                   VIEFNNTDILFSKPEDKRTEDYITGRFG"
FT   CDS_pept        complement(654507..655382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0594"
FT                   /product="phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08012"
FT                   /db_xref="GOA:B0S0X2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X2"
FT                   /protein_id="BAG08012.1"
FT                   /translation="MENNSIDVSTNSLKNLRKNKTKSRIIKGFIYLMAFITLAVLFYLI
FT                   IYMLVNGIPHLKPNMFSNHYTSKNVSMMPSIKTTIMLVLFTLLIASPIGIFTAIYLSEY
FT                   SKKNSKVVTLIRLATETLSGIPSIVYGLFGMLLFVMRLKFRYSLISGVLTMFIMVLPLI
FT                   IRASEQALLSIDDELRAGSYALGAGKLYTIRKVLLPVAMPGIMAGIILSIGRVVGETAA
FT                   LMFTLGTDPRVPSSLMQSGRSLALHMYVLSSEGFHVEESYATGVVLVILVLIINIISNL
FT                   IGKKLTKGSK"
FT   CDS_pept        complement(655372..656241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0595"
FT                   /product="phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08013"
FT                   /db_xref="GOA:B0S0X3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X3"
FT                   /protein_id="BAG08013.1"
FT                   /translation="MKKKYLSESIMKYVFLVSALTSIFAIVLICFFIFGESMPFIKKVG
FT                   LTNFIFGKDWAPVDVPAQFGILPMIIGSIYVTIGSIIIGVPIGIFTAIYLAKFCPKKLY
FT                   NFLRPCIDLMAGIPSIVYGFFALVVIVPMIRKAFGGTGMNIVTASILLGIMILPTIITL
FT                   SESAINTVVDSYYEGSVALGASHELAVMGVVVPAAKSGILSSIILGIGRAIGETMAVYL
FT                   VAGNQPVIAKSIFSGTRTMTTNIVLDMAYASGAHRDALIATAMVLFVFILLINLIFNLI
FT                   KRGVNNGK"
FT   CDS_pept        complement(656448..657383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0596"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08014"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X4"
FT                   /protein_id="BAG08014.1"
FT                   /translation="MKIKKFMLVAMMLVFGVFMVACAKQDDGKTSDNSSKTETTSTDSK
FT                   SNESAGGEIHVVSRENGSGTRGAFTEITKILEKGADGKEQDKTAASAIVQNSTNAVMMT
FT                   VGQDKDAIGYISLGSLNDKVNAVKINGVEATSENVQKGDYKISRPFNIAYKGELKPLPK
FT                   DFLDYILSKEGQEIVKKEGYEQLPQEAKPYNKNSQKGKIVLAGSTSVSPLMEKIAESYK
FT                   AMYPEVEIEIQSTGSSAGMNSAIEGVCDIGMASRELKDKEKEQLKSQPIAIDGIAVIVN
FT                   KENTNATDLTLEQVKDIFTGKVKSWSEISK"
FT   CDS_pept        657526..658524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0597"
FT                   /product="L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08015"
FT                   /db_xref="GOA:B0S0X5"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X5"
FT                   /protein_id="BAG08015.1"
FT                   /translation="MKKLLLITTGGTIASVATDKGLAPGLQAKDILEYVKFKKFDFELD
FT                   TISLFSIDSTDIRPKHWLHIKQTIKENYDKYDGFVITHGTDTLAYTASALGYLIQKSPK
FT                   PIVITGAQKSISNDITDAKNNLIDALIFASKEKSHGVNIVFNGKVICGNRARKVRTKSF
FT                   DAFDSINYPLIAIIHDGKVLRYIDDKSDNEVEFYDHLDDSVYLLKLIPSMRSDILEDIF
FT                   EKYDCIIVESYGVGGMPAGISEEFLRLMDRYSTNKIIVMTTQVPQEGSDIGVYQVGMRI
FT                   REKLDVLESKDMTLESVVCKMMYVMGKHNRDIQKIQDEFYSIINHDISIIE"
FT   CDS_pept        658626..659156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08016"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X6"
FT                   /protein_id="BAG08016.1"
FT                   /translation="MKRNVDFYVKKRNELIDLLDEEKITKQEFISRNNVLINSFNLRPF
FT                   TEIRTVNEGIFNYQYYNLKAKEYNTIANKYKNKKHKKYLASLNKCRNYYLEKDNTILKI
FT                   LELIEYKNVEAYYIDILSYRIRDNLFEIVLKDYEKMIFHTINENIKQHLIANNVFEPIK
FT                   KKSLIDDYVNKGY"
FT   CDS_pept        complement(658938..659081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08017"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X7"
FT                   /protein_id="BAG08017.1"
FT                   /translation="MLFNIFIYCVKNHLLIIFKYNFKKIIPNSVRQNVYVVCFHIFVFY
FT                   QF"
FT   CDS_pept        complement(659157..659546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08018"
FT                   /db_xref="GOA:B0S0X8"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X8"
FT                   /protein_id="BAG08018.1"
FT                   /translation="MKNFIDIIVDFIYKFAKLLLLLLILVFTTFYVYKTIESMFSKNYT
FT                   SSQTYSKDLKIQQVTDEVKDIEITIPPEAKDLDVSKILISGNIIKNEQEFLDYLKQNNV
FT                   TAFKDGNYKLNKNMTTEEIVNQIKK"
FT   CDS_pept        659607..660572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0601"
FT                   /product="putative ribosomal large subunit pseudouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08019"
FT                   /db_xref="GOA:B0S0X9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0X9"
FT                   /protein_id="BAG08019.1"
FT                   /translation="MRHINIDNSNSNQRVDRFLMKLMPKMSKNHIQKLIRTKKIKVNKK
FT                   RTEPDYDLKIDDVVNIYLYDEVIEKYQDNKIYTADDFNLDIIYEDDDLILINKKTGVLS
FT                   HAANPQDYGKNIVDMMVSYLIKTNQFKPTQNSTFTPALVNRLDRNTSGIVVGAKTYDSL
FT                   KYFNDLFKKHEITKIYETIVVGNLKDQTIDLALEKDNDKNKSVINSSGKKSMTKVWNVK
FT                   NFGKYSLVNVDLLTGRTHQIRAHLSHINHPIIGDIKYGNREVNKYFKNKYDLNFQLLHS
FT                   YKLVFPEKMGKYQKYESMVFESKRDDLFEKILNDLESKYD"
FT   CDS_pept        660565..662187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0602"
FT                   /product="uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08020"
FT                   /db_xref="GOA:B0S0Y0"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Y0"
FT                   /protein_id="BAG08020.1"
FT                   /translation="MIKIINNNKIYDYEDKTIYDYAIKYGFEDSIVALKNNKLVDIMSY
FT                   VENGDTIEFVNEKSVYSQDTLMQTGILLLLLAFKLKFPKDQLEVEYTIGDYMYLEFENN
FT                   NEIHFKDLEEIRKLMDDLINQNLRIERVKVSRKEAFDIFEKEGYIQKSRLLKSLDKEEV
FT                   YLYKCLDHYFGIEGFVAPYTRFLKHYKLINYFPGIALSVSKTGEFTDFKEQKALSKIFS
FT                   KSKKWTDMLDIGYVGSLNEKIQDGNMDFLVSVNEAYFENQISYIADKIIYNNARLVQIS
FT                   GPSSSGKTTMAERLSVQLAVRGKKPIPISMDNYFVNRVDTPLDEDGNKDYESINALDLK
FT                   TFNTDLMRLLEGDYVNLPIYNFITGEREYGDTYTKLDNNGIIIVEGIHGLNPKLTSLVP
FT                   EKDKYKIYVSALTQLSIDCHNRISTTDMRLMRRMVRDFVQRDKSVDDTLSEWPRVHAAE
FT                   YINVFPYQNEADSIIDSSLIYEINILKKYVLKLVDNYDKNGPNFTEIERLKSILNYFIE
FT                   IKDDSIVPKNSILQEFIGDYDEQ"
FT   CDS_pept        662174..664855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0603"
FT                   /product="putative ATP-dependent exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08021"
FT                   /db_xref="GOA:B0S0Y1"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Y1"
FT                   /protein_id="BAG08021.1"
FT                   /translation="MMNNRIVYTNSNSSKLFDDNISYLKNQITNGNTDFILILPNRKLI
FT                   KNIRNKFLKEQSVLCDVKIWTIDDLVNASDISTYLTDLILRIAIQELIDEGEFEDNKFF
FT                   NSNGMINSSKRFISACKYSNKSIGDLGEISTHNISLNILSKVYQRYQKIMSQYNLLDKF
FT                   DAYETHNFNIQKNKDIYIHGFSEFRPIELEVIKQLENYDINVYVFVDYYNEYKSKLANQ
FT                   LQDIGFEVVQNDEKSNPNKFIEKKVVKLTNEILEKDRLIDEIANDSYIYDYNKMAILLE
FT                   KDSSKREILNTLKLHDIPVFGDDYISYRDYKIFSDIINLLDKNRSFKQYIFSLLDSCFL
FT                   EFDLKDKINFRNILSDFDFDKWEDLEKILKLNVNYGTNLKILEKIKSYYHSFIETDNMI
FT                   LSNLIELVQQKESEDVGFKLFAEKLLIILEDLDKTHDELVKKSKNINSYLIDLIKILKV
FT                   DSTDYLVDGIRIYSLTDIRLSNYDVLYVVNMNDDVIPGKMNYDFFNNEDNIVFLQKNGI
FT                   DILSDADNRRRNIDRFIDAVSRADSKIYLSYNTESNVKSRLILDKNIKQNQKIAKINSQ
FT                   NIKKVDTKKLHSISVYEKYSLKQHLNRIESRISSKDISDFEVDDKTTQYILSKELSSTK
FT                   LETYFECPMKFYFRYYLKLRPQIKSRLLDIGTILHNTLEEFYGINISQIKDAIDGKCEL
FT                   DISSLDGLLKNSFEKFGLNTDIKENEFDYEKYLNKLKDFVRTDIYNMKNEPEKFYPFKL
FT                   EEDFIISLDESTKFTGRIDRVDKTDSGKIRLIDYKLSKNSFRKAKDLDKNKGFQFAIYS
FT                   SYGDVVSCKYKSIKDNDEYEFLQNISKDQLDEIMIQKVNEFRENIRNKRLFIKASDDNS
FT                   CKYCDYNKICKLKNTEGEASND"
FT   CDS_pept        664848..667751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0604"
FT                   /product="putative ATP-dependent exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08022"
FT                   /db_xref="GOA:B0S0Y2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Y2"
FT                   /protein_id="BAG08022.1"
FT                   /translation="MIKFSENQKLAYSTINQNVCVNAGAGTGKTEVVSERFRYMYEKGI
FT                   DIKSIVCITFTNKAADEMKDRIIQKLNNPRLIDDINVSTISSFCKKIVSDNSYYLSIDP
FT                   SFQIIEDDQANKLLNEIFDKILENRIDFIKKLGRKLDISYSDTLKIIRDSFNKLRTNNI
FT                   DFKLIKRETLLLLTNLRNVDDEDIIGIKNYLFDLKEESGSIKGLTKNSRLYKFLHDDKQ
FT                   NLEIQEFTQFLLESYDNLGESKKENVQEIIDEINKKVDAILSNKEKQYVDLYEGFFDIL
FT                   IDINREYSIKKNEKSFLDFNDIEMMCKKALENGNILKSCKQKYKYFMIDEYQDTSNLQR
FT                   DIFYMLCSDNETLDRNNLFVVGDPKQAIYSFRGANIKVFEKTREDIKKSGGKDITFHEN
FT                   HRTHPNIMEPINYIYSNKMKDRYDSLIAVNEVGDVIGRDEFKLNNKDAKTKDDSTDVLV
FT                   SYINKDNFKDTAILARTKNDFSEYEKSLNNRNIPYYIFDKQGLEECREILNLIQFIKYA
FT                   RYGDEISKVGILSNVYDVDYNEILNQTENYQSTMKKIDEEVEDFTENLTKYTIYDSISN
FT                   YIEKIDYFRLFDNLQAKANVIKFLEIAKQFDSNNYSVEDFVEYFENNSNLYQMSYEDEH
FT                   SDLVKLMTIHKSKGLGFEKVIVDNLSKPSNNKDKFLLFIDNENIQMQFVLDFPFSKFRM
FT                   SKVKKLIEEEEDYEVDNVYYTAFTRAKKELSFSNSKKSGHFKQISPYIEDLQQRGSIKF
FT                   LDMRDIPFLLETKEINFKRTEPKKVEIEKFIPIGITSILNSDEEIFEGNLQKTTINYIL
FT                   LGNLVHMYAKLSDGSNIPHITEVDFLNNDEKKIFDVATENFNKFIKDFSDYKNEMDFNL
FT                   LYENLMISGFMDRVEFDDSEIKVYDYKISSQSQEYLYEKYHMQLKFYSYVLNKKYNKNI
FT                   KMILVNLRKGYVIEKHYDKNCEQEVEDFLNNYLNQLN"
FT   CDS_pept        667788..668477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0605"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08023"
FT                   /db_xref="GOA:B0S0Y3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Y3"
FT                   /protein_id="BAG08023.1"
FT                   /translation="MSIKVLLVEDEDNIRQFTKINLAREGFEILEADSGEKGVELAELN
FT                   KPDVAVLDIMLPGIDGFEVCKILRNKFPNIVIIMLTAKTQDNDKIEGLERGADDYLTKP
FT                   FNPRELILRIKSVLRRSPQKQNNSQIIEDETFKLDMYSRTFYKNGKEITLTPTELSIIK
FT                   LLMQNPGKAITRDELMDKAWGEDFIGDAKIVDVNMRRLRSKIEEDSTHPKYIVTVWGVG
FT                   YRWENKK"
FT   CDS_pept        668477..669883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0606"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08024"
FT                   /db_xref="GOA:B0S0Y4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Y4"
FT                   /protein_id="BAG08024.1"
FT                   /translation="MSIKNKIMYSFVFLTSITAIILVIFSIYATKFYYYSTMEGVLNNE
FT                   IRYSTNLYSSYMADYELDEVIAEDKNQFYRQTDCQVQILDNNQIVVFDSIASPNLGKKI
FT                   ETSDVVNAVNGQSGSYTGKVSYSDSNIISVSVPLESRGKQVGVLRYISSLKDVDRAIRV
FT                   KSVSFALFGFLVILFSILLSKILTKSIVKPINSLAKTAEKMAKGNMEVRAKENNTDEIG
FT                   RLGMTLNLLTDNINKKEQLKNEFISSVSHELRTPLTSIKGWAQTLKYDPSDLETTTMGI
FT                   DIIDSECDRLTTMVEELLDFSRFTSGRISIVKRKQNLIELAEHIKNQLLPKVRSKGIDL
FT                   ILNYESPELIATFDEDRIKQVFINILDNAIKFTPDKGTIIINIEKTEKFAEVSIIDTGI
FT                   GISFEEIELVTGKFYKGSNSNSHVGLGLSICEEIVKLHKGELMIKSKIDEGTTVSFTLP
FT                   LGDDENEKDN"
FT   CDS_pept        669861..671336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0607"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08025"
FT                   /db_xref="GOA:B0S0Y5"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Y5"
FT                   /protein_id="BAG08025.1"
FT                   /translation="MKMKKTTSILIGTIVLILLIVFIMFRNKEQSAVENVKVPDNNLLV
FT                   AAGVWQIDKKESFADSKSKISDEIGKFYVDESIVVFGKRFTINPKFSSKFVSLQNYINK
FT                   KTSDENLSKNFSKDKKMVITISDGSKFYQDVVVMDKNNLILPYNGVLYYMKKTENKVSR
FT                   TFIENYQSTYESKYYENKGNNLKDKENIAMLIGIKNKVVRNGKSDISYRTILLDIDKKN
FT                   SAQIYQTSALFFPRKNGFWIMEYKKNEFDNNYVEQFIAKPVYSGENIKDNRKLEFDSPS
FT                   EITYLGPEYISILKIKDQFENYSIFDIDKMSNNNELNIDQIGGKEAVNVLKSSIAEESA
FT                   DPNIEVTTEDKNEDYKNIGITRNSGKWSYQTQYTLKDNNEIKLKNINLNIVSHLNISTD
FT                   ELSMNWQSIKNLKSSALDAYSSPDKRILVVQTTDEILIYDYSNDNKLIGSIPITKDDSI
FT                   IMSEWAIGNYAEMWKKEFKNNEKIPSSFIINQR"
FT   tRNA            671487..671562
FT                   /locus_tag="FMG_tRNA37"
FT                   /product="tRNA-Lys"
FT   tRNA            671581..671656
FT                   /locus_tag="FMG_tRNA38"
FT                   /product="tRNA-Lys"
FT   CDS_pept        672130..672855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0608"
FT                   /product="phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08026"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Y6"
FT                   /protein_id="BAG08026.1"
FT                   /translation="MKIGAFFDIDGTIARDSLMIEHFKKLVNFEIIDQKLYYEKVYPAY
FT                   QKYEKRKIDYDDYLNELVDVYKYNLKGFSSEFNEFISNQVISQVKEKVYRYTRKMIEFH
FT                   KENNHLIFFISGSPDFLVKEMAESYGVTEYRASLYLKKSGMYTGEVVPMWDKNSKKAVI
FT                   DKIVESYDIDVDNSYCYGDTSGDFSMINMMGKPTAINPTKELFELIRANEKINEKTKII
FT                   IERKDVIYDFPKNGKILDI"
FT   CDS_pept        complement(672953..673624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0609"
FT                   /product="sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08027"
FT                   /db_xref="GOA:B0S0Y7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042007"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Y7"
FT                   /protein_id="BAG08027.1"
FT                   /translation="MRKKFGIFLMTIGILLFALYFAARLIPTYYSENDISNDISSTEME
FT                   QNNKKEFKNDFDAVNSISTTTSLFNFTAISGENVIGQIIIPDYNLSLPIHRGVTDEHLL
FT                   SGAATMKENQKMGEKNYTLTGHYMKRNGSLFSKVYDLTKGTKVYITDKKNIYEYEIVDR
FT                   KVTDSYAFYMLDDDRIEKYDNKPIISLMTCDMPNDPDNRVFQIGKLVRSFKYDKNYFKQ
FT                   N"
FT   CDS_pept        673792..674223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08028"
FT                   /db_xref="GOA:B0S0Y8"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0Y8"
FT                   /protein_id="BAG08028.1"
FT                   /translation="MFINEYFHNIDSKGRVIMPSKFRDEIGEEFYITKGMDECLFVYPV
FT                   SAFIQMTEKLNKLSLTRRQARAFSRVFFSGASNQEIDKQGRFLIPQSLRSYADIKKEVA
FT                   IIGVSNRIEIWDKEKWEQYSNDSSLNYDDLADGLNDLDL"
FT   CDS_pept        674231..675169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0611"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08029"
FT                   /db_xref="GOA:B0S0Y9"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0Y9"
FT                   /protein_id="BAG08029.1"
FT                   /translation="MEFKHVPILLNECIENLNIRDGKIYVDCTVGGAGHSREIAKRIGN
FT                   GKLICFDQDEDALKVAKQRLEEFGDKIIFIKDNFKNIKNDLHNLGIEKVDGILMDIGVS
FT                   SYQIDEDSRGFSYMHDADLDMRMDQSNPISAKDIVNTYSKEDLENVIFKYSDEKWAKRI
FT                   AEFICNARETKPINTTFELVEVIEKAIPKKVRMNQKGHSAKKTFQAIRIEVNKELDVLE
FT                   QAVGDSIDLLNPEGRICIITFHSLEDKICKDIFRQRQKGCICPPEIPVCVCNHKPEIKI
FT                   ITRKPIEPSKEELEQNSRARSAKLRVAEKII"
FT   CDS_pept        675205..675594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08030"
FT                   /db_xref="GOA:B0S0Z0"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Z0"
FT                   /protein_id="BAG08030.1"
FT                   /translation="MGNAQRKIEVFPQYVEKKELEIKKIEQTKKLNRPSRKTNLFSTFN
FT                   KVMICVVICLSILVMNRYSKIQSMSSELKEVKNQVMLIEGNRDVIKSSIESKLTNKNIE
FT                   EIAKNNLGMQFPENAQIMYLKLEEK"
FT   CDS_pept        675594..677813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0613"
FT                   /product="cell division protein"
FT                   /note="penicillin-binding protein 2 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08031"
FT                   /db_xref="GOA:B0S0Z1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Z1"
FT                   /protein_id="BAG08031.1"
FT                   /translation="MRRRNLSKGKINKNFNKNYNSRIVVLFCILTFIVLLIVGKLIYLQ
FT                   LTPAGDKYRKLSAKQSTNTINIDAERGKILDTNGETLADNVVSNNLYVNATYLNDQAKS
FT                   NLVDSLSKSLSMKPEELRKILEKKKTVLVKPSLSKSEIDNIKKLPISNQKFISVVSEKK
FT                   RYYPNKEMLSQVLGFTNVNNDGVVGLESFYNSKLKGKPGKRILNSSVNRSIDLSDDSSV
FT                   IINPENGYDLKTTIDITIQGFVEDSLKDIENNFKPKSATIIVMNPNNGDVLGMGSYPNF
FT                   NPNDPKKPLLKEQLDELNDLKKENDEDKISKFYFNMWENKATSWTYEPGSVFKTITSAA
FT                   ATEEHTATQHSHYFCNGFIRDIPGVVIRCERYWNPHGDETFQEAFNNSCNIAYVHIGRD
FT                   LGKANMQKYVNGFGFNQKTDIDLPAEELGIAPKSVKDIDAARLATLSYGHGISATPIQM
FT                   LTALNSIVNGGMLIEPHVAKEFISKDTKKVEKVQSKVKRQIISAQTSKQINKMLQGVVD
FT                   DGSGKKAAIQGFGIGGKTGTSIKIEDGKYTDSKTTASFFGSFPTDHPEYTVLVVVDEPQ
FT                   RKNGGSAVCAPSAGKIFSKIIEYKRMNKTRLDSDDSDKITVPELEGLTLKLAVDKLNSL
FT                   GLKSKVTNSDSNLNSIVTSQETEAYSKVNKGDIIELTTGSVEDSLIRIPEIVGFTVEDA
FT                   VDTLKKYGINNIEIKNGKKGKVVKTDPEENKLIDPKSYIKIYTEQ"
FT   CDS_pept        677909..678871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0614"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08032"
FT                   /db_xref="GOA:B0S0Z2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Z2"
FT                   /protein_id="BAG08032.1"
FT                   /translation="MNFKSEILMSMLLAIIISLILGKFIIKILRKKHIGQEIRDDGPKS
FT                   HYSKAGTPTMGGIIFIISTLITVIVFRLFNSEVLLAIYGMIAFGAIGFIDDFMKLVMKR
FT                   SLGLNEKQKLVLQLLFSVIACFLIKQVNPNFTKQVIPFFHKTVDFGLITYPFLIFVMMG
FT                   TSNATNLTDGLDGLATSVSIPVFISTSIIMYNLNSTASIFSIIFAGSLLGFLVYNSNPA
FT                   KVFMGDTGSMAIGGALVMIMAMYGLSLYLIILGFVYMIEVLSVIIQMTSYKLRNKKRVF
FT                   LMSPIHHHYELKGYKEQKIVSTFMVVSVITSLITLLDIL"
FT   CDS_pept        678879..680204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0615"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08033"
FT                   /db_xref="GOA:B0S0Z3"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Z3"
FT                   /protein_id="BAG08033.1"
FT                   /translation="MKKILVFGLARTGISALKTLKLKGYNLGAIDDNIDEEKTKILNEL
FT                   DVQIESIDTIDKYDIILKSPGIRMDNPVILKANELNIEVVSDLELAQRIFGDIKIVAIT
FT                   GTNGKTTTTSLMTKMLNDSGRKAISIGNIGVGMLWEIYNSDKDTYFVIECSSFQLESTK
FT                   NFKPQYSCIINITPDHIDWHGSMQNYVNAKKNVLKNQDENCYTVLNADDEYYEECKKFT
FT                   KANVYDISTSKNVKRGSFIKDNSIYFSDSDCDKIIDLKDVKLIGYHNYQNVLFCVTLAK
FT                   LIGINDDSIRETLMSFSGVEHRLEFVRDLSGVKYYNDSKGTNVDASVKAIESFDKNVII
FT                   LAGGYDKKVSLDNFFIAGKDKFKALILMGQTRDLFEQKAKEYGFKHIYLVDDMKQAVTQ
FT                   ANKIAESGDVVLLSPASASWGMYNNYEERGNEFKDLVNNLRG"
FT   CDS_pept        680209..681318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0616"
FT                   /product="cell division protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08034"
FT                   /db_xref="GOA:B0S0Z4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Z4"
FT                   /protein_id="BAG08034.1"
FT                   /translation="MKLSKDGKALLYITVFLTIFGIIMVLSSSWPTAVSEHRAWYYYGL
FT                   RQGIFALLGFVFMQFTGVYDNENYKKNALWIFLIALILCALVFTPLGKEINYAKRWIKI
FT                   KSFSFMPSDILKFASINLAAAIVSQKINKIKTFNEGFLRMIFLVAVSGGIVFMQPDLST
FT                   AIVIIGSVFCVFMVSGLNVRYIVSTLLTTLVFGYIAIFKVKIGYSRIDRIIAFVDPLGN
FT                   LEDEGWQLSQSLAAVSNGSFLGSGLGMSKQKFLYLSQAHNDFIFAIICEEFGFLGALIL
FT                   IIAYFAFLVCGIRIAMKTKYIYSKLLVSGILFVIGIQAYVNMTVVTGLIPPTGLTLPFI
FT                   SYGGTSLMIMLGLVGIILNVDRNNEEERK"
FT   CDS_pept        681315..682427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0617"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08035"
FT                   /db_xref="GOA:B0S0Z5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0Z5"
FT                   /protein_id="BAG08035.1"
FT                   /translation="MNIIVSGGGTGGHIYPAISLIEELKKRDKDNKILYVGTEKGLESS
FT                   IVPKLGIDFKTIHVRGIPRKINANSFKALKELFQGLREANKILKEFKPDLVIGTGGYVS
FT                   GPILYKATKTKAKVAFHEQNSFPGITNRILSRYVDKYFVTFKESIKYFKNQDKAVVTGN
FT                   PIRNRFTDIEKNKKSALEQYDISENKKVVFIFGGSNGSEILNKATLNMIEKISNQDKFE
FT                   IVLATGKLNYDEFIQQSGKEIKNLHVYPYIDDIDKAYAVSDLIVTSSGAITLAELSFLG
FT                   KASILVPKAYTTENHQEHNARAFEKNGASKVILEKDLNSDTLFDQINEILSDDNLLNEL
FT                   SENSKKMSYPTACKDIVDELYRLVEQDEKA"
FT   CDS_pept        682414..683136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0618"
FT                   /product="cell division septal protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08036"
FT                   /db_xref="GOA:B0S0Z6"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Z6"
FT                   /protein_id="BAG08036.1"
FT                   /translation="MKKLRTVIIVAISLLIALIVYLCATIDYFSIKTIKVKNNKIVKLS
FT                   EIKNYANYSLGENIFRFNKNKLQTKISKDIYIRSANIKKIYPNTIEVTVEETKDICYFE
FT                   IGKDKFFVDSDFNVVKNKDRIDYSKIVKIVGANENLSKINNLESDEKFYEFLKNLFSHK
FT                   VLNQLTEINVYNASDITLLTKNEISVFFGDLNDSEKKSNNISKILNEISTKSINTKIVD
FT                   TKDPKKPFLIKENAEQSE"
FT   CDS_pept        683470..684552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0619"
FT                   /product="cell division GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08037"
FT                   /db_xref="GOA:B0S0Z7"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Z7"
FT                   /protein_id="BAG08037.1"
FT                   /translation="MTFDMELEDNDLAKIKVIGVGGGGNNAVKRMKEEGLQGVEFVAVN
FT                   TDKQILNNLDINTKLQIGSKITKGLGAGANPAVGMKAAEESRNEIEEALDKTDMVFVTA
FT                   GMGGGTGTGAAPVVAQIAKEKGILTVGVVTKPFTFEGRKRQMQAEQGIEALKGKVDTLV
FT                   IIPNDKLLQISDKRTTMSEAFMMADEVLMDGIQGISDLIAVPNLINLDFADVRSIMLNQ
FT                   GIAHMGIGKANGDNRAMEAAKLAVKSPLLETSIGGAKAVLINVTGKELGLFEVNEAAEL
FT                   IREEVDPDANIIFGAGIDESLGDDIKITVIATGFDSDNPMANKLKSNKKSDPVSQKSEE
FT                   TSEKDHDDIEIPSFLKRRGF"
FT   CDS_pept        684552..685004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08038"
FT                   /db_xref="GOA:B0S0Z8"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S0Z8"
FT                   /protein_id="BAG08038.1"
FT                   /translation="MKCPFCNASDTKVVDTRASEDDKIVRRRRECISCHKRFTTYERYD
FT                   FNNLTVVKKDKNREAFDRDKVYRGMKKSCEKRPVPDSVLLEATKEIEVELTHSNKREVD
FT                   SSEIGELIMKKLKKIDKVAYIRFASVYREFTDVKSFNEEISKLDNE"
FT   CDS_pept        685098..686393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0621"
FT                   /product="ATPase related to the helicase subunit of the
FT                   Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08039"
FT                   /db_xref="GOA:B0S0Z9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B0S0Z9"
FT                   /protein_id="BAG08039.1"
FT                   /translation="MDLFEYNLQLQKENSSPLANRLRPKSLDKYFGQSHVVGEGKLLNR
FT                   LIKADKIPSMIFYGPPGTGKTTLAEIISNQTNSLFERLSAISNGVKDIREVISTAKTNL
FT                   SMYNKKTVLFIDEIHRFNKSQQDALLGYVEDGTITLIGATTENPFFEVNKALLSRCQII
FT                   ELKPLTDNDIRNIIENALTEDKKLKEMNIQIDEKAIDVLVNSANGDARSALNALEIAVE
FT                   STDQVNGCLIIDEDAIKNSVFKPVLKYDKEEDHYNVISAFIKSMRGSDIDAALYYLARM
FT                   IESGEDPKFIARRMVIFASEDIGLANPEALTVAINVFNAVNLIGLPECRINLSNGVIYL
FT                   ASSEKSNTSYIAIDKALEDIRQNKIYDVPSHLKDAHYYGAKSLNRGLGYKYPHSDDSYQ
FT                   QYLPDELKNQKYYDPKDIGFESKIYKKIRSKE"
FT   CDS_pept        686390..687775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0622"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08040"
FT                   /db_xref="GOA:B0S100"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B0S100"
FT                   /protein_id="BAG08040.1"
FT                   /translation="MILIKDLIKDYEKYSDKEVEVGGWIKNSRFSKNVGFIELNDGTFF
FT                   NPVQIVVGKDNEDFERAEKLKLSSAIIVVGKLVLTPNSKQPFEIQASKVIVEGESTDDY
FT                   PLQKKRHTFEFLRTILHLRPRTNTFNAVFRVRSRLAFAIHKFFNERGFVYVHTPIITGS
FT                   DAEGAGEMFRVTTLDLDNLPKDDDGNVDFTQDFFSKSTNLTVSGQLQAEAYALAFRNVY
FT                   TFGPTFRSEHSNTPRHAAEFWMMEPEICFADLDDVCSLAEDMVRYIIKDVMENCEEEIK
FT                   FFNSFVDKNLIERLTKVANKSFKKLTYTEAIDILKKSGEKFEYPVKWGMDLQTEHEKYL
FT                   SEKVVDGPVFVTDYPKEIKAFYMRLNDDKKTVAATDLLVPGIGELIGGSQREERFELLD
FT                   QKMDELGFNKEEYKWYLDLRKYGGVKHGGFGLGFERMVMYMTGMSNIRDVIPFPRTVGH
FT                   CEY"
FT   CDS_pept        688041..690449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0623"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08041"
FT                   /db_xref="GOA:B0S101"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S101"
FT                   /protein_id="BAG08041.1"
FT                   /translation="MDKYNPNSIEKKWQKYWEENKTFKTSDDKSKKRFYALVEFPYPSG
FT                   QGLHVGHPRPYTALDIVSRKRRMQGYNVLYPMGWDAFGLPTENFAIKNKIRPEVVTENN
FT                   IKNFKRQMQSIGFSFDWDREINTTDPDYYKWTQWIFIQMFKKGLAYKKEMPINWCPSCK
FT                   TGLANEEVINGHCERCGGQVVRKVKNQWMLKITEYADRLIDDLKDVDYFDRIKSQQINW
FT                   IGRSYGAEINFAVKEVDEKITVFTTRADTIFGATYMVISVDHPLIEKYSDRIKNIDEIR
FT                   SYRSEVAKKSELERTDLSKEKTGYKIDGLTAINPLTNKEIPVYVSDYVLMTYGTGAIMA
FT                   VPAHDDRDYEFAKKFNIEMIPVIEGSDIQNCAFTETNEGNLINSGFLNGLTVDEAKEKM
FT                   YEYIEEKEIGHKKTNYKLRDWVFSRQRYWGEPIPLVYCEHCGWVPLDEKDLPLVLPKVD
FT                   NYEPTDNGESPLSKIDDFVHTKCPKCGRDAVRETDTMPQWAGSSWYYLRYTDPHNDEAI
FT                   ASKENLDYYTPVDWYNGGMEHTTLHLLYSRFWHKFLYDIGVVPTKEPYMKRTSHGMILG
FT                   DNNEKMSKSRGNVVNPDDIVRDFGADTLRCYEMFIGDFEKSAPWSENGVKGCRKFLDKV
FT                   WRTQDLVDGDSNFEKMETLIHQTIKKVSEDYENLKFNTAIAQLMTLLNEFNNLDKISKE
FT                   QFKIFLILLNPVCPHITEEIWQRMGYEGYVHESSWPEYDESKTILDVIELPIQVNGKLR
FT                   ATVEINREASEDEVYEKAVKDDVVAKYLENKNVVKKIYVKGRIFNIIVK"
FT   CDS_pept        690556..690963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0624"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08042"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0S102"
FT                   /protein_id="BAG08042.1"
FT                   /translation="MRLSTRGRYGLAAMIYLGKKYGDNPVSLNEISKATGLSNNYLEQL
FT                   IRELKKQDLVISVRGVQGGYLLKKSPKEISVAEILECLEEFFGVTECSVVPGLCSREDT
FT                   CPSRLIWTQMHDDMINSIKNVSLQDLISKEK"
FT   CDS_pept        690966..692153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0625"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08043"
FT                   /db_xref="GOA:B0S103"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B0S103"
FT                   /protein_id="BAG08043.1"
FT                   /translation="MIINSEFLHNALVFITIIFMVFGTYFLITVGNSKVDEKYKIVFNF
FT                   HKIKKTTILILILLGLLALFSKYPVIYHTINTLLIGIILSYIINPLVKYFENKGIRRSF
FT                   AILIIYVIVIFLIILLGMIVVPQTIQQIKKMIISLPGFMADISIKVNDFNRKIFKEYPN
FT                   VSKIMSNAMQTVNQKLGTIQTSILDMLSQTGNITGSIFTNLLRIILIPVVSFYMLLDKE
FT                   KCIDFIMGFIPNKNKDKFLSVCNDMDKAYSEFIRGRLIMAIFVGVLTAIALIIMRVDFA
FT                   IIIGILTMVGDIIPYIGPFIAVTPAFILAFLDSPIKAVVVVIVFVSIQWVENNILAPKL
FT                   LGSKIGINPLLVIVSLIIGGGMFGVVGMILSVPFVATIKILYLHFKDKIKMFFKN"
FT   CDS_pept        692164..694785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0626"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08044"
FT                   /db_xref="GOA:B0S104"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S104"
FT                   /protein_id="BAG08044.1"
FT                   /translation="MKNYGLNEIRKKFLDYFGERGHLVIKSFPLIPQDDKSLLLINAGM
FT                   APLKKYFTGEKKLKKDRATSSQRCIRTADIDEVGKTQRHGTFFEMLGNFSFGDYFKREA
FT                   ITWAWDFLTNELEVPKDILWVSVYEEDEEAYNIWVNEVGISPERVVKLGKADNFWELDQ
FT                   GPCGPCSEIHVDRGFEFDPREDAKPGDEGERFLEVWNLVFTQFNKTADGKYERIAHPNI
FT                   DTGMGLERITMVLENADNIFEIGLVKDIIKTIEEISGVKYKENHKNDVSIRIIADHVRA
FT                   MTFLIYDGVIPSNEQRGYVLRRLIRRACRHGKLLGINDSFIEKVIDSCIKVYESGYPEL
FT                   KEDRDRIVKIANAEEKKFQETLDLGLNILDSMLKETDSDVFSGENAFKLYDTYGFPIDL
FT                   TKELVGEVNKTVDEVQFKKLMEEQKERARGSRNESNMGWSSDKKYGEELPETKFDGYNS
FT                   LKDESKVIEIYGEDENNLKAGQMGIIVLDCTTFYGEGGGQVGDKGIIYNDNFKAEVYDT
FT                   KKTGKKVFLHYVKVTEGSLHVGDKVTIEVDELNRRDIMKNHSATHLLHQALKDVVGDHV
FT                   NQAGSYVDGERLRFDITHFEAVSKEQLEKVEQIVNDKIALGIPVKIDEMSLEESQSIGA
FT                   RGLFEDKYQDVVRVVQMGDYSIELCGGTHVKTTSDIQMLKIISESSVAAGVRRIEAITG
FT                   RAVYKYLKERDRLIDNVKHSLKASNEDEITRRIEMNTEEIKGLKKKLKDITNKDLSSNV
FT                   DSVINDAVEVNGTKVCTFELSGLDNNSFRDFGENIKSKLEDGVVILANSDESKVSFIAL
FT                   VTDSSVKKGVFAGDIVREVAKVCGGNGGGRKDFAQAGAKDSSKVDEALQKGIETVKSKL
FT                   NA"
FT   CDS_pept        694798..695064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08045"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/TrEMBL:B0S105"
FT                   /protein_id="BAG08045.1"
FT                   /translation="MEGKDLNHTVRFEASKLEKKSIKETLKKVYQALEEKGYDPKNQII
FT                   GYILSGDPTYITSFNNARNLIRQIDRDDLLGEMLEVYLNEIDK"
FT   CDS_pept        695117..695530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0628"
FT                   /product="putative endonuclease involved in recombination"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08046"
FT                   /db_xref="GOA:B0S106"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:B0S106"
FT                   /protein_id="BAG08046.1"
FT                   /translation="MERYIGLDVGDRTIGVAISDPFLLTAQSLMTIKRKSKIEDIEIIN
FT                   DIIKEKEVSKIIVGLPKNMNNTIGPQAKKVKTFVKELRKHTDLDIEYVDERLTTVSATR
FT                   VLIEQNVSRKKRKDVIDSVAATYILQTYLDMGR"
FT   CDS_pept        695533..695775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08047"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:B0S107"
FT                   /protein_id="BAG08047.1"
FT                   /translation="METIKLYDENNNEKEFKIINTFGMDDDNYCVLEDVSNGENVILKY
FT                   IENDEQIEFIGLENENELNDAIEVYEDLMNSQKEQ"
FT   CDS_pept        695775..696227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0630"
FT                   /product="transcriptional regulator Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08048"
FT                   /db_xref="GOA:B0S108"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0S108"
FT                   /protein_id="BAG08048.1"
FT                   /translation="MNIETLKTKLINAGYKVTKQREVIFEALLENMDSHLSPEELNEIV
FT                   SKKDPEIGIATVYRTLLIFEELNLVYKLDFDDKRYRYELVDEDEDHHHHHIICTNCGKV
FT                   DEVKYDLLEGIEKQIRKDYNFDIQNHDVKFYGICSDCQEKLKNEEK"
FT   CDS_pept        696228..697895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0631"
FT                   /product="putative Zn-dependent hydrolase"
FT                   /note="beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08049"
FT                   /db_xref="GOA:B0S109"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:B0S109"
FT                   /protein_id="BAG08049.1"
FT                   /translation="MAKKNIDKLKVIPLGGLNEIGKNMTVVEYKDDIIVVDCGMTFPDE
FT                   EMLGVDIVIPDISYLEKNKEKIRGIVITHGHEDHIGAIPYVLKKLDAPVYGTKLTMGLL
FT                   ENKILEHKLSLKSLHTVDYRKPIKLGAFSVEFVKVCHSIPDSASLAITTPVGVLFFTGD
FT                   FKIDYTPIDNNRMDFGRIASIGNKGVLALFADSTNVERQGYTLSEKSVGKTFINLFDDA
FT                   PARIIVATFASNVHRIQQVISAAEHFNKKVALSGRSMINTVNVARELGYIKVGDKTIID
FT                   INDINKHKPNEIVLLTTGSQGEPMSAMTRMANGTHRKVHLDPTDTVILSATPIPGNDNQ
FT                   VSSVINKLMEMGVKVIYSSLADVHVSGHACQEELKLMHSLVRPKFFVPLHGEMRHLKCH
FT                   ANLALDMGMKEKDIVIADNGNTIEFTRKSINLVDTKFASNILVDGLGVGDVGNVVLRDR
FT                   RHLSEDGLIVVVITLDARNKEVIAGPDIISRGFVYVKENNDLMEECKSVVQNVLDECYT
FT                   KNIYDWSTLKHNIRETLKKFLYQEIKRNPMILPVIMEV"
FT   CDS_pept        697897..698235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08050"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/TrEMBL:B0S110"
FT                   /protein_id="BAG08050.1"
FT                   /translation="MEYKKKAEELAQMLNNSSEFQELKKLHKDVYKKNENNKNMIDDFK
FT                   KHLFEYQLKIQQTGKEDPEDVKKLQNLQNIIMTNHDIAAYLQADARFSMILKDVYDALE
FT                   SGIKLEDE"
FT   CDS_pept        698228..698872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0633"
FT                   /product="caffeoyl-coA O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08051"
FT                   /db_xref="GOA:B0S111"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0S111"
FT                   /protein_id="BAG08051.1"
FT                   /translation="MNSIVNEHLQDYLRQLSKSNDETILELEIFAKENHIPIVEPEVRQ
FT                   LLKIILLMEQPKSILEIGTAIGYSSIIMKKTCPDAKIITVENYEKNANFARENFKKYGY
FT                   DDIQLVFGDGYEVMKNMDTKFDLIFIDAAKGQYIKYFEEAVRLANKNSVIVCDNVLFRG
FT                   MVCEKEFYEHRHRKITIVKRLREFLEIISDSSKYDTTIIPIDDGMSITKLK"
FT   CDS_pept        698919..700145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0634"
FT                   /product="collagenase family protease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08052"
FT                   /db_xref="GOA:B0S112"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:B0S112"
FT                   /protein_id="BAG08052.1"
FT                   /translation="MKKVELLAPAGDLDKLKTAIDYGADAVYMAGPDYGLRTASKNFTI
FT                   EDMKEAVDYAHSRGKKIYITMNILAHNDDLEGIEDYIQNLIDINVDALIVSDPGIYSII
FT                   RSINKDVEVHMSTQASVTNFRTVKYWMDQGIKRIVLARELSLKEIQDIKKNIPDSELEC
FT                   FVHGAMCMSYSGRCLLSNYMTGRDANRGDCAQACRWKYRLVEEKRPGEYFPIEEDEKGT
FT                   FIFNSKDLCMIEHLDKLIAAGIDSLKIEGRVKSQYYVATVVRSYRIAIDKYYNNEFDEP
FT                   TAKRLLEEIKKVSYRDFTTGFFEKKPDENDQLYESSSYIRKYDFVGLLLDYDEESKIAT
FT                   FEQRNRVFKGDEVEIFGPEDGFITTKIEKMYDEKMNEIEVANKAQQIFKIKIDQKLQPN
FT                   SMMRKKSDN"
FT   CDS_pept        700183..701340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08053"
FT                   /db_xref="GOA:B0S113"
FT                   /db_xref="InterPro:IPR032681"
FT                   /db_xref="UniProtKB/TrEMBL:B0S113"
FT                   /protein_id="BAG08053.1"
FT                   /translation="MKTKKLNKKEIFIIIISVLVLIFIVHNLLGFFFKRNLYLVNDISK
FT                   IKNEINANALVLKDEYIYLNDVDTKAAENVKYPVGSNVINIPKEINSQMSTKYIDDKLN
FT                   DLETNHSDKTTSNFDIKDTDIKSLSNSIRNRKFDEKFLSEYDKKKNITEEEYFHSKKEL
FT                   KILKQVLNSKSTTVKTTVSGVLKNNVDNYENFVGYNSSSIFGSDYYLRDIGENYNTKGL
FT                   SVVDSMNLSLVFDVESSKLNRNLKNNDEIEIHVDKNDYSAHIKDIKVNGNIITIVCDMN
FT                   DGINNLMNKRFVPITVIDKKTKVFKIPKKSIITKDSTQGVFIKKETGIIKFVAVKVLKT
FT                   DDKFAYVSTGTDGQIDVNNRKVKTLELYDYIVKNPRFVKEGELLK"
FT   CDS_pept        701340..702020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0636"
FT                   /product="putative proline synthetase associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08054"
FT                   /db_xref="GOA:B0S114"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B0S114"
FT                   /protein_id="BAG08054.1"
FT                   /translation="MSIKDNLNEVNENLKKFASHGETPKLIAVTKTVDIDRIKEAIDCG
FT                   VTDIGENKPQEMSWKYDELKDSVNYHMIGHLQSNKVKDVVGKACLIHSLDRMSVLKEIE
FT                   KRASAINKPQDCLIQLNVAEEEQKSGLYLDDLDSFIEEIEKRKFVKVKGLMSIAPFAED
FT                   PEEIRWVFKKMREIYDKIKNTEYKNIEMKYLSMGMSHDYKVALEEGSNMVRVGSFIFGK
FT                   RNYN"
FT   CDS_pept        702030..702515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0637"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08055"
FT                   /db_xref="GOA:B0S115"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S115"
FT                   /protein_id="BAG08055.1"
FT                   /translation="MSFMNSFKKLVGVEDDYDEYYDDQYYYDESDHVESESKDYEQKQN
FT                   YETKSNIVSMNNSATKPVESKPLNRVKINIHEPISFDDAPKVIDVILKNEVAVLNIEML
FT                   EKDVKQRIFDFVSGAIYSLDGKMQKVTKDIFVLVPKGVEIDGKIKDQITKNNGFFQL"
FT   CDS_pept        702786..703562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0638"
FT                   /product="putative RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08056"
FT                   /db_xref="GOA:B0S116"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR040591"
FT                   /db_xref="UniProtKB/TrEMBL:B0S116"
FT                   /protein_id="BAG08056.1"
FT                   /translation="MSYELNYIQDIEIKKTIDRFIDSLISVKKTKTIYSTDFMNPKEIE
FT                   YAISILNTETDVGYMATNCPKNCENSIIIMWDRYCYSEEYINMFDYIGLLEIQTDQEIS
FT                   HRDILGAVLNLGINREKIGDIFTHNKRFYICATNTMIKFLNLNLTKIKKFNISTSIVEK
FT                   NIEKDEEKYKPFTGIINSERLDCLVSEMANISRKDAQILIKNKKIKLNYEVVSNTSKSV
FT                   EENSLVSIRGYGRYRLIEYLGNTKKDKLRIKYIKYI"
FT   CDS_pept        703571..704017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0639"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08057"
FT                   /db_xref="GOA:B0S117"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B0S117"
FT                   /protein_id="BAG08057.1"
FT                   /translation="MVTILMMILVIGLDHLTKYMAISLKEGDIVIFDKFLKLTYLENRG
FT                   AAFGILENKKIFLLIITLLIIGFVILYIFKNYKSLMNFEKVIYGLLLGGALGNLIDRIF
FT                   RGYVIDFISVRLPFNYDFPVFNVADIAVVVSCILLVIFSLKGHK"
FT   CDS_pept        704017..704694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0640"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08058"
FT                   /db_xref="GOA:B0S118"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B0S118"
FT                   /protein_id="BAG08058.1"
FT                   /translation="MSVNIGNSWDELLKDEWNKDYYKKIRQVLIHDYKNYKVYPDMNFI
FT                   FEALKLVAFEDCKVVILGQDPYHNPNQAHGLSFSVKPDVKTPPSLINIYKELQNEFGYP
FT                   IPNNGYLMKWAKQGVLLLNTSLTVIENKPNSHSKIGWQILTDKIIELLGNSNRPIVFIL
FT                   WGNNARMKKDLIKSKNALILESPHPSPFSANRGFFGCNHFIKTNDYLIDNGLEPIDWKI
FT                   ENI"
FT   CDS_pept        704691..705614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0641"
FT                   /product="pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08059"
FT                   /db_xref="GOA:B0S119"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B0S119"
FT                   /protein_id="BAG08059.1"
FT                   /translation="MIYEFLIDDSNQNTRLDVFLANEVELSRSEIQKFIEDKKVLVNYK
FT                   PQKKNYKLNSNDKIKFDYEKEDKTIRAQKHDLDVVYEDDYLAIINKDKDVIVHPTETIY
FT                   SDTLVNYLMYNFKNLSDVDGDYRRGIVHRLDKDTTGLIIIAKDNDTHLKLKEIIKNHEI
FT                   IKTYLCIVHGKIDESGTIKEYMTRNPKDRKKMMVSDEGKLSISQYERLDYNDDYSLVKV
FT                   QIKTGRTHQIRVHMNYIHHPILGDKLYGLKKEKILFDSQVLHAYNLQFIHPQTHEKINV
FT                   IGKLKPDFMTAIEKTKLDYTKIPSKL"
FT   CDS_pept        complement(705630..706517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0642"
FT                   /product="conserved hypothetical protein"
FT                   /note="DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08060"
FT                   /db_xref="GOA:B0S120"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B0S120"
FT                   /protein_id="BAG08060.1"
FT                   /translation="MSIKIITDSGSQLTGSNENENLILLNMPVISSDQEYIEGQTINSS
FT                   DMFSRMKNGEVFKTSQVPYKTYYETFKRELEAGNEVICITLSSGLTSTFQTATMAMNDV
FT                   LEENNDYKIIVKDSVSACSGETSVVNKALKLVELNYSFKEVNEKLDEIICAQEHIFTVT
FT                   NLEYLYRGGRLSKTQKVMGSLLNIRPIMSVDKNDGSLYVVEKARGEKQTFAKIKNLMAE
FT                   KCNNNVNLNQTLYVCYGENEDEADLLIEKIKEDYDFKKIVKCPLGCVIGAHTGPNMLSI
FT                   YFSNKDLGDELSEV"
FT   tRNA            complement(706548..706623)
FT                   /locus_tag="FMG_tRNA39"
FT                   /product="tRNA-Thr"
FT   CDS_pept        706740..707414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0643"
FT                   /product="endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08061"
FT                   /db_xref="GOA:B0S121"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:B0S121"
FT                   /protein_id="BAG08061.1"
FT                   /translation="MKNKKLIKKRVGIFLLMIVFCSCLIINYSENYFSFSRKITHHKSE
FT                   LEDNELKTLNKLEKDLVEFKKVGALKITEDNIFYPTHKSKISERMLEVALEGTDLEGNA
FT                   HSFIKVEKKYGVNALYLLAIANHESDFGQSRIAKDKNNLFGFNAIDSNPYNGASQYDSL
FT                   DEGIQDIGKKIKILYLSDNGKYFKGYNSYAMNKNYASDKNWGEKVNNHMILIAQKILSS
FT                   YK"
FT   CDS_pept        707433..708122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0644"
FT                   /product="thermonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08062"
FT                   /db_xref="GOA:B0S122"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B0S122"
FT                   /protein_id="BAG08062.1"
FT                   /translation="MKKFLLGILILISLTGCDKFGQVEAENNLYEVVRVVDGDTVILNI
FT                   DGNKTRVRLIGIDTPESVAKDKSRNVKEGKVASDYTKRLLENKRVRLEYDDEKNDVYDR
FT                   KLGYLFLDDEFINEKLLKEGMAKLYTKTTNQKYYERLKKAEQYAKDNKKGFWKDFYVND
FT                   TNVYKKYIDSKGRGMIKGNINSKGLKIYHLPNQKSYKDVKINFKKGEKYFVTEKEAQEE
FT                   GFSKSSK"
FT   tRNA            708248..708324
FT                   /locus_tag="FMG_tRNA40"
FT                   /product="tRNA-His"
FT   tRNA            708328..708411
FT                   /locus_tag="FMG_tRNA41"
FT                   /product="tRNA-Leu"
FT   tRNA            complement(708835..708921)
FT                   /locus_tag="FMG_tRNA42"
FT                   /product="tRNA-Leu"
FT   CDS_pept        709098..710054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08063"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="UniProtKB/TrEMBL:B0S123"
FT                   /protein_id="BAG08063.1"
FT                   /translation="MKKITVFLLAILISLSSTISFAGKIDTNVIDEKWGKPTFVYGGSL
FT                   DKSQIRKTKGLLDIEDDSNIKPVMVTYNDLLKYIGGDDSNPGSMISSVLVKKENKNKGI
FT                   KVNITTPKNITLITEKQYENAAITAGVKDCTIMVAAIRPVTGESALTGVYKAFESNGEK
FT                   LDKERIKVAQKELEVVSDINKENKDKGEFDRDKLNDVIVVIKDNIANININNNGQAPSL
FT                   DEIKKIVNDAIKENNLENVITEDQKQELINLFEKYSNVKSINSKDIKDELSNISDKVIE
FT                   GAKDIYKKAEDAGIIDKIINFFSSIIKSIADSFGSEN"
FT   CDS_pept        710186..710749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0646"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08064"
FT                   /db_xref="GOA:B0S124"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0S124"
FT                   /protein_id="BAG08064.1"
FT                   /translation="MSLIKKHVEEFKVPAYHNEELTEVSSEDLKGHWSLLFFYPGDFTF
FT                   VCPTELEDLQNLYSEFKELNCEIYSISTDSEFVHKAWHDKSEKIKKIQYPMLSDRAFAL
FT                   SKQFGVLKEADGQSQRGAFLINPDLDVVLYEVSADGIGRNAHELLRKLQAAQYVDKYGD
FT                   QVCPANWAPGQDTLKPGIDLVGNL"
FT   CDS_pept        complement(710777..712618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0647"
FT                   /product="DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08065"
FT                   /db_xref="GOA:B0S125"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B0S125"
FT                   /protein_id="BAG08065.1"
FT                   /translation="MKFTENQQKAISHYESPALVLAVPGAGKTTVLLNRIKYLEKVHNV
FT                   DPKSILSITFSKSQAMDMKERFSEKFPETDSAYFSTIHSFCYYIIKLYYKMNNRIFKIL
FT                   ESNNDTNKYLVIRNIMRKINKTNSKDEDVEKFLQYYGYCKNMMIIKDFPKFDIENFEQI
FT                   YQEYESFKKKNFFIDFDDMLTKSFEILNEDEYILKRIKRKYKFFQVDEGQDTSKIQFEL
FT                   IKKIAYPENNLFIVADDDQSIYSFRGADPSYLLDFNKIFSNASIYYIDQNFRCSDKIVN
FT                   ASNLFIKQNKNRYNKDVTSTKASNKKIIIKFPQNFLSLYSYLKNNINPDKKTAILYRKN
FT                   ISSIALTKYLHDQDIDFHSRYQKDDFYNHFVLNDILKMIAFSENKTSVGLFRDIYYKLN
FT                   SYIKKTSINQLETYDESMPVLDRLLDDSTLSRYYVDRFMDLKSFFSGIKRAKGSKKIDI
FT                   IMNDIDYKTYIEDSVLLQNQKISLDHLVEIYKYLFKDCECYEDFINEIESLKKIQKESI
FT                   KHTSNLNLLTVHSAKGLEFDEVFIIDLIDGEFPTNIDSNKKNYENIFEEERRMFYVAMT
FT                   RAKDKLTLLSPKTRNSVEVDSSQFLKDIIEIENNLKN"
FT   CDS_pept        712714..713514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08066"
FT                   /db_xref="GOA:B0S126"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029478"
FT                   /db_xref="UniProtKB/TrEMBL:B0S126"
FT                   /protein_id="BAG08066.1"
FT                   /translation="MSMNEFLENRKSVRDFKSKNLSDSDLQKVESIIFDINNSAKKHDV
FT                   SFKLYKDGSVVYNALDGEGGYGGAMIKANHYIAMEADKNNEQSMIFGAFYFENLITKLD
FT                   ALNVGSCWVTISNASEESKKRAFGENCNVDFLLAMGYAPSEFGFGKKKFSSRIGVEEFV
FT                   CDKSLSTPIDIDKLQNYGLDELFSYLRFAPSTKNEQPWRFVLNDDDLDLYIKDYKGIEN
FT                   LIDAGIVMYYYTELANYNSIDANWVVKDNLSDKDNYKYIASVNF"
FT   CDS_pept        713582..714388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0649"
FT                   /product="molybdate ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08067"
FT                   /db_xref="GOA:B0S127"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B0S127"
FT                   /protein_id="BAG08067.1"
FT                   /translation="MKKKYLLLMIVGCLILASCAKNEKQNTEKKEEQKTEQKAETQSIS
FT                   LFAAASLEESLAKIIPEFEKENNVKVDVNLASSGKLQKQIEQKAPCDVFVSAGQKQVKA
FT                   LEEKELAKDSKSLLKNKLVIVKNKETDIKISKIEDLENIKGKIAVAELETVPVGQYTKD
FT                   SLTHYNLLDKLQEKFVYGKNVKDTLRFVDSKEAEVGFVYSSDAVTDEKVEVVFNVDDSS
FT                   HKPIIYPITKTTYSKNTEMQNKLYEFLQNELSEKYFKEAGFESSHE"
FT   CDS_pept        714369..715064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0650"
FT                   /product="molybdate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08068"
FT                   /db_xref="GOA:B0S128"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0S128"
FT                   /protein_id="BAG08068.1"
FT                   /translation="MNLAMNNDIMMPIIISLKVSVISTIITSVLSIFIAWMMVKFNKKN
FT                   GSILEAIITLPLVLPPSILGYILLIIIGNNGLIGKFFYDNFEWSIIFTWKACVIASVIV
FT                   SFPLMYQNCKSAFQSIDKKILNAARTMGASEWKIFFRIAIPLAYTGIISGLVLAFARSL
FT                   GEFGATMMVAGNIPRKTQTIPLAMYYAVERGDKTMANTLMIVVVTFSFLLIYFLNRWIE
FT                   KRRNRNAEL"
FT   CDS_pept        715051..715665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0651"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08069"
FT                   /db_xref="GOA:B0S129"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S129"
FT                   /protein_id="BAG08069.1"
FT                   /translation="MLNCNIEKKLNHFVLNVDFTVENEILCIMGESGSGKTSILNSIAG
FT                   ILTPEKGDIILDDNILFSDKINLKPQLRNIGYVFQDYALFPNMSVKDNIFFMNPDKDYT
FT                   NSLIEKLRIEYLLDNFPNTLSGGEKQKVSIVRALANKPRLLLMDEPFSSIDEKFKNKFY
FT                   EELIEIKKSLDVPIIMVTHNRHEAEILADKLIFIDKGRIIK"
FT   CDS_pept        715742..717847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0652"
FT                   /product="exoribonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08070"
FT                   /db_xref="GOA:B0S130"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B0S130"
FT                   /protein_id="BAG08070.1"
FT                   /translation="MKIKQKVLNIVNSNDYIPLTFDELSSRLNIEKKDKKIFHKIINEL
FT                   QKDKKILLDKNSNIIPITEQKAYPGTIQGSGSDFCYFIPDDENVDDIFIAKKDLNGAIH
FT                   KDKVLVTITVEKKPNRSPEGKVLQILSRETKKLVGTFDEAKGYGFVILDDKKYGFDVFV
FT                   QSGNKNGAKNNDKVVVKLIKTPSKNHKNPEGVIVEVLGGKDDPGIDIYSIAKTFKLPYE
FT                   FPKKVKQQAKEIEQHVDESEKKSRMDFRDLLTVSIDGSDAKDFDDAISITKKGENFVLY
FT                   VHIADVSHYVKKNTALDKEAFRRGTSVYMLDRVIPMLPVELSNGICSLNPNEDRLCLTI
FT                   KMEISPTGKTLDYKFYESVINSDYRLIYKNVSDFLEDIDNPYEDEKLTDNLLLMKELYE
FT                   ILSARRKKRGSIDFDFPETKIILDENSKVIDVTKDERRIGNKLIEEFMLITNETVASHF
FT                   GYLDRPFLYRVHEEPDEEKVNTFKRILSNFGYHLKGKNLYSKDYQRILNELDGKPEKPL
FT                   LASLLLRSMQKAEYSENPSIHFGLASMFYTHFTSPIRRYPDLFIHRIVKNFINHKPDTN
FT                   NEKEFMKYIKDIAKQCSATERRAEEAEREAIDMKSAEYMQQHIDEEFEGIISSLTKFGI
FT                   FVQLDNTIEGLVQFQSMIDDYYVFDEKNYTVYGERTKKSYHIGQKVRVKVINSDKDKRQ
FT                   IDFEFVN"
FT   CDS_pept        717860..718309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0653"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08071"
FT                   /db_xref="GOA:B0S131"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:B0S131"
FT                   /protein_id="BAG08071.1"
FT                   /translation="MSEIKLLANNKKARHEYFIEEVYECGIELKGTEVKSIKKGKVSIK
FT                   ESYCMIENSEVFVYSMNVSPYTEGNIFNVDSLRKRKLLMHKSEIRKLIGKTKEQGYTLI
FT                   PLRVYAKNGLVKVEIALAKGKNLYDKRETLKKRDDLRNMQRAMRR"
FT   CDS_pept        718318..720054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0654"
FT                   /product="fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08072"
FT                   /db_xref="GOA:B0S132"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="UniProtKB/TrEMBL:B0S132"
FT                   /protein_id="BAG08072.1"
FT                   /translation="MSFDGIVTKAIVDDIKEKLINGKISKVNQPDKNELDLIIYNNKQN
FT                   YKLLISASSSLPRMHFTNENKKNPIEAYNFCMLMRKYLQGAVITDIYQESMDRVVSIDI
FT                   NSRDEMGYDMNYTLVVELMGKHSNIILIEKESQMIVDAIKRISFDTKSIRQILPKTKYS
FT                   YLEDDKINILKSDDLPTDIAEGTTKLQQVFYKNYTGFSPTISREICLRADLDYNIRVED
FT                   LNDDEKSRFNQAFIDIRENIRNCNYEYSIVIDEDEKLKDFHVIKLEKYGYQKKNFHDIH
FT                   EMLDYYYKKHSSNDSITQKSSHLKKIVSNKIQRNSNKLSNLTVDLQEAKKRDIYKVYAD
FT                   LISSNMHLINKGMDKITVDNFYDDMNPIEIPLNPIKSGNENAQIYYKKFSKLKTREKMI
FT                   TQELPLIKQENEYLLQLLETLERITEYQELSEIKDEMVKIGLIKKSKRKTAKVKPSKPR
FT                   HFVTENNVDIFVGKNNYQNDNLTLKQANREDIFVHVKDMPGSHVIMRNENLIQKDYDVA
FT                   CFLAAYFSSMSKEKYVEVDYTEKKNVKKAKGAKPGMVFYNNFNTVNVDMSSFNIDNIKE
FT                   IV"
FT   CDS_pept        720124..720999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08073"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B0S133"
FT                   /protein_id="BAG08073.1"
FT                   /translation="MKSMTGFGSSSLELEDCSIDIEIKSVNNRYLDFNFSMPSYLNFML
FT                   EDMKSLIKNKLKRGRVDVYIKIKKYQLAVDSVDINYELAQKIKEKLDSLNENLDMKSDI
FT                   NVRDLLKYDDVMSFTYKDLDNEFLHDNILKVLNEAVNKIYSMRSTEGDNLREDLSTNLS
FT                   KIEEEISKISSLTENSVKEYRENLFNKISELLDEEKIDKDRMYLEVALMADKVDINEEL
FT                   KRFDSHIVQFKSAMDMKDCIGRKLDFIIQEMNREINTISSKSNDENISVCVIEVKSLIE
FT                   KLREQVQNIE"
FT   CDS_pept        721007..721258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08074"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S134"
FT                   /protein_id="BAG08074.1"
FT                   /translation="MESLGIGFSNLVNSNRIIAIVSPETNPIKRIVQKAKEDNNLIDVT
FT                   FGRKTRSVIIMDSSHVVLSCLQPETLQMRLDKSNNKED"
FT   CDS_pept        721260..721847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0657"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08075"
FT                   /db_xref="GOA:B0S135"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S135"
FT                   /protein_id="BAG08075.1"
FT                   /translation="MRDGFLLVVSGPSGVGKGTVCEKLISQKKDIVYSVSATTRKKRPY
FT                   EVDGENYYFLSLDEFKKKIDQGDFIEYANVHNNYYGTPKSFVFDQINKGEIVILEIDVQ
FT                   GALKVKENYPEAVFVFILPPDLIELRRRIEGRNTEDEETINIRMQNAKKELSFIDEYDY
FT                   AVINEDVDETVKNIETIIDAEKFRVVKGEKYD"
FT   CDS_pept        721840..722037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0658"
FT                   /product="putative DNA-directed RNA polymerase omega
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08076"
FT                   /db_xref="GOA:B0S136"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S136"
FT                   /protein_id="BAG08076.1"
FT                   /translation="MINPSFKKLSEINNSRYALCVMVSKRARMLIDGKETKLKKAKAQP
FT                   VTTALEEVMEKKVWEDKSNE"
FT   CDS_pept        722030..723196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0659"
FT                   /product="phosphopantothenate-cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08077"
FT                   /db_xref="GOA:B0S137"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B0S137"
FT                   /protein_id="BAG08077.1"
FT                   /translation="MNKNILLGVTGGIAIYKVVDVVSRLKKLDYNIKIIMTDSACEFVS
FT                   PMTFETIGKCDVKNKMFHNNSHKVVEHIELANWADLFMIAPASANTMAKINYGIADDLL
FT                   SSTALAYTKPIMFCVSMNTNMLNNPATQKNIKDLKEKEHLIIDSNNGMLACNTKGDGRL
FT                   KEPWEIVEEVEKYFCKKDLKGKKILITAGATVERIDPVRYITNDSSGKMGYSIAKKAFM
FT                   RGADVTIISGKTTAESPYGVENIKVDSAIEMKEKIESCIENYDCLIMAAAVSDFKVKNR
FT                   KELKIKKQDGIDSLELEENPDILKSLIKKENQIFIGFAAETNNLLENARKKLDKKNLDY
FT                   IVLNDVSKKDIGFNSEYNKVSVISKDNILDIERDTKLNIADRILDLIK"
FT   CDS_pept        723203..725572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0660"
FT                   /product="primosomal protein N"
FT                   /note="superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08078"
FT                   /db_xref="GOA:B0S138"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B0S138"
FT                   /protein_id="BAG08078.1"
FT                   /translation="MYIDVIFRNKSKMTNRLYSYHSNEEVEVGMRVIVPFGKSNINKLA
FT                   LVVRVNENPNQDIDYKEIISVVDLNPIVTQESIDIAFFMIDKYLSDYSSAFQTILPPGN
FT                   FEELKEYFVANDKLNNVDEDLYNILKTKKEYSEIKEISDISHKKLMEYVKFGLLKMDLV
FT                   YDQKISPKLLKYVKLIDNNPVISKRANAQQKIVDMLKKESNILYSELLAKTNTTSSVVK
FT                   ALEEKKVVKIYFKEVDRIVVDDTKSYHKISLNSQQENAYNSILENQFNLLHGVTGSGKT
FT                   EVYLHLVEKMLNEGKDSIVLVPEISLTPQTIERFEGRFPGKVAIIHSKLNINEKFEQFR
FT                   KMYNGEYKIVVGARSAVFSPFKNLGLIIIDEEHETSYVSEKNPKYNAIDISRFRAEYNN
FT                   AKLLLGSATPGVEEYNNALKGQYNLIEMNKRANNTTPVDCTIVDMRKELETGNMRMFSK
FT                   VLLNKIQENLNNKKQTILFLNKRGHTSFISCRRCGYVLKCDSCDVSMTYHKTKNRLICH
FT                   MCGRTALKPKVCPNCGSKFIKEFGAGTQKLEEETRELFPDARIVRMDRDTTNTKKDYEK
FT                   IYDMMNNQEIDILIGTQMLSKGFDFPNVTLVGVMAADISLNLGDYKSNEKTFQLITQVA
FT                   GRAGRAEYEGDVIIQTYKPDNFAITSAALHDYKMFYEKEIKLRKSFNYPPFYRILNINI
FT                   SSRNRNVAMKKINEVSNYVAALIRRYKLSTTLINGPHPSPIERINNMYRFDLYYKFPNG
FT                   DDKIIEIIKKVLINNEYNINLEGITLKITLDPQSYF"
FT   CDS_pept        725582..726070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0661"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08079"
FT                   /db_xref="GOA:B0S139"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S139"
FT                   /protein_id="BAG08079.1"
FT                   /translation="MALRQIRLENDPILRKKSREVEKIDDRIKQIVEDMFETMYENKGI
FT                   GLACVQVGMLKRIVVIDMQDEDGKMVLINPKIIEKSEEKQINIEGCLSVPGKNGYVERP
FT                   KTVVVEYTDLNGNTQRVMGTDYKAHCFCHELDHLDGVLYTDKVLNLSEEEVERLNNEK"
FT   CDS_pept        726060..726992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0662"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08080"
FT                   /db_xref="GOA:B0S140"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S140"
FT                   /protein_id="BAG08080.1"
FT                   /translation="MKNKIVFTGSPDFAVESLQRLYDNPNNEIQLVISQEDKKRNRNKF
FT                   SPTAVKKRAMELGIDVITPKNINDEEVFDLLDKLNPDFIVVVAYGQLIKKRILDRFKNK
FT                   ILNVHASILPKYRGASPINYSLLNGDKESGVSIMLVEQGLDTGDVLAVDKIKLDNEIML
FT                   EELHDKLMIMGADLINKVIDDYQKYFDSRKEQNENEASIVGKIHKSMGQINFNEKSDVI
FT                   YNKFRGLTPWPGLFFKLEDKIIKVHNINIIKQYNDNKNGEVVKVDKNGIKVACEDGFII
FT                   ITRLQLPNKKPLNISEYLNGNSFEEGIIL"
FT   CDS_pept        727002..727685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0663"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08081"
FT                   /db_xref="GOA:B0S141"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:B0S141"
FT                   /protein_id="BAG08081.1"
FT                   /translation="MFNFYYDRTMLLLIPALILAFYSQYKVSHTFDKYQKITNSKGLTG
FT                   KEMARVLLDYEGLSEIEIVNVQGSLTDYYDSSNKVLALSDEVYNSQSISAVSVASHEVG
FT                   HAIQDKENYGFLRFRESLFPVVNFASKSVWILILLGFLFSMRPLVEFGIILFSATVLFQ
FT                   LVTLPVEFDASKRAIRALSNGLLADDEIEPAKQVLKAAALTYIASALVSLLQLVRLILI
FT                   SKDRD"
FT   CDS_pept        727799..729070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0664"
FT                   /product="putative rRNA methylase"
FT                   /note="SUN family"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08082"
FT                   /db_xref="GOA:B0S142"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B0S142"
FT                   /protein_id="BAG08082.1"
FT                   /translation="MNIRNEIINITNSINNKSGYSSEILKTYDYGDLDKRDIAYIKKCV
FT                   FTEIENRFFVDYVISKCSDLEINRLDKIVLEILRMATTEILFMKTADYAVVDEAVELAG
FT                   SITRYKDYVNAVLREVCRINVDSEDLEDDIKFSINKDLLKMLNKSYSKKTVRKLLKSFF
FT                   YKSDFVIKQNKLKENNLKINLENQGFALNDHPFLKDSFIVENPESIIDTKEFKEGKFLI
FT                   QDGSCSLCAEILEPLENSIILDICAAPGSKSCNIQEITNNQSIIYCNDINQNKIARIKE
FT                   NVEKCAVKNVQYMNFDATTLQKDLINKFDRILVDAPCSATGVINKNPEIKLFRTKKDVE
FT                   NLVNTQRQILENCEKYLKKGGILVYSTCSLLKEENEENVEFIENRLHLKRKDIEFYGDK
FT                   NEFIKLMPFQKGTQGFFISKFVKD"
FT   CDS_pept        729120..730169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0665"
FT                   /product="putative Fe-S-cluster redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08083"
FT                   /db_xref="GOA:B0S143"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S143"
FT                   /protein_id="BAG08083.1"
FT                   /translation="MQNKIILENMTVDELKEFFVNNGEKPFRALQYFQAIHKNRIFNPD
FT                   EMTNFSNSLRGKLNQYNDIKNCSIIKRIDSKLDNTKKYLIEMSDGNIVETVFMQYKTHT
FT                   SICLSTQIGCKMGCKFCASTKKSFVRNLQPYEMCAQIYLVENDLDIRINNIVLMGIGEP
FT                   LDNYDNVSRFIDLITDKDGQDMSIRNITLSTCGLVDKIIRLANDDIGINITISLHNPFD
FT                   NERNKLMPIGNKYSIEEILDACDYYFKKTKRRIGFEYTVIENVNDSKKYMDKLVSLLKN
FT                   RNCLLNLITLNPIEEFNQKSPDRYKMTEFMEYMNKNNVNTTIRRKQGIDIDGACGQLRI
FT                   NNMTKRGVK"
FT   CDS_pept        730166..730903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0666"
FT                   /product="serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08084"
FT                   /db_xref="GOA:B0S144"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B0S144"
FT                   /protein_id="BAG08084.1"
FT                   /translation="MKYASNTDIGLVRKLNEDYHMNYMTDDFSLLVVCDGMGGHKAGEV
FT                   ASKKAVETVVNFVKENENEKDYERILTEAIELANDEVFNDSENNSEHRNMGTTIVACLI
FT                   HDDNAIVANVGDSRLYLYRDEELKQITVDHSLVNDLLSSGTITEEEAVDFAQKNVITRS
FT                   LGIQDNVDVDIFNIKLVNGDLILMCTDGLTSQLENEDIVDIIKEESDLDQIIKNLIDEA
FT                   NDIEGIDNVTITLYLFEGENYDR"
FT   CDS_pept        730893..732776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0667"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08085"
FT                   /db_xref="GOA:B0S145"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B0S145"
FT                   /protein_id="BAG08085.1"
FT                   /translation="MIGKILGDRYEIIEEVGVGGMAKVYKALDTVLNRYVAVKVLKNEY
FT                   MEDQDFLRKFAMEAQSAASLTHANIVSVFDVGSSYVDGRKYNYIVMEYVDGKTLKDIID
FT                   EKQVLPIEDIVNYGVQIASALECAHKNGIIHRDIKPHNMLIDKSNNLKATDFGIARISS
FT                   SATLTYTSTVLGTVHYISPEQAKGKFIDEKSDIYSLGVVLYQMATGEVPFDAPNAVGIA
FT                   LKHIQDPLVPPINLRHDLPQGLNDIIVKAMAKDPNDRFKSATELKEMLKNYQNYSSDLY
FT                   QKTTKNPIIKENDEQPEVKEAIYKTPIQSSTKDNKNKSKKILWIILPIILAFLVFVAVL
FT                   LGKKYINKNKQDLVIVPALTGLTENDALNKAKASNLIAVVSEYKTENSVEPGKVIEQTP
FT                   ESSSEVKKGTIIKLVVSKGEEQVSVPNLSNMTIENAKIQLNKLGLEIGEITKENSDNFE
FT                   VGKIMKQHPEAGTSIGKDSKIDLVISLGKKEELVEMVDLMGSDISQAINKLKSIGLNIG
FT                   NIEKKYSNSYDTNQVIWQQYDAGKKLKKDSSIDVIISKGKKDSEMVERLFRISKPVDRG
FT                   IYTVTIKDETEDNIIYEENHKASEGDIRIKLKVKPKNDIKVYINGELINVG"
FT   CDS_pept        732766..733644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0668"
FT                   /product="putative GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08086"
FT                   /db_xref="GOA:B0S146"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/TrEMBL:B0S146"
FT                   /protein_id="BAG08086.1"
FT                   /translation="MSDKTGIITKIQRELFYVSIGNNVYPSKAKGNFRNKKITPVVGDK
FT                   VDIHVENGLGFILKIHPRSVLLHRPEVSNVDKCFVLSSIKSPNINLMLLDKYLLMIEKN
FT                   NIDCVIVFNKSDLVSDDEKKIFADIYRNIGYKVIFNSNESSHVNEELLKEFKNHISCVI
FT                   GPSGAGKSSTLKKLFPNENFVSGKISEKTQRGKQTTRHIEIKMVDENTYVLDTPGFSSF
FT                   DLSFLKDKSEIKNNFLEFRKNSSKCKFNNCEHINEPKCEIKKLLESGEISKSRYDNYLK
FT                   IVEEYEKIRRY"
FT   CDS_pept        733644..734300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0669"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08087"
FT                   /db_xref="GOA:B0S147"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B0S147"
FT                   /protein_id="BAG08087.1"
FT                   /translation="MASLSPSLLACNFFELEKNLDILKNKGIRYLHLDVMDGNFVPNIS
FT                   FGPAIIKQIREKYPEFIFDCHLMVNKPENVINDILDAGADIITFHPEATFHPHRIIQTV
FT                   HKAGKKCGLALNPSTGLESCKYIIDDLDIILVMSVNPGFGGQSFIESQYLKLIDARNMI
FT                   KASKKDIILEVDGGVKTSNIDKVLESGADLIVSGSDVFNHNIESQLDIYNQKLKR"
FT   CDS_pept        734311..734850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08088"
FT                   /db_xref="GOA:B0S148"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:B0S148"
FT                   /protein_id="BAG08088.1"
FT                   /translation="MNKNLKFMVEGAITLALTAVLNSIVIFKMPRGGSVSLAGYVPILL
FT                   FGLRWGLKPGILIGLMYGILDSLIDPYVIHPIQYLLDYPIAYMALGLSGLGCNEETLSG
FT                   KINIKMILACVFAVLMRGVAAILSGYVFFKDTLPKDIPALLGSFLYNITYIVPNGIIAI
FT                   VVILILIKPVSKVSKK"
FT   CDS_pept        734847..735479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0671"
FT                   /product="putative thiamin pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08089"
FT                   /db_xref="GOA:B0S149"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:B0S149"
FT                   /protein_id="BAG08089.1"
FT                   /translation="MIGLICCAGELSDRILFEEYYEKSDFKIAVDGGTKYFTDYDKDFD
FT                   FAIGDFDSIKIEDKKFLEVNNKIYEKYKRKKDFTDFEAAINILIEKNCKTIYAFGATGT
FT                   RLDHTMSNLIYSKKCFDIGIELVFVGNNNIIKFLGESTECVMRYDYISIVVLSNNGMRI
FT                   RLKGFEYDSENLDVDYCSTLTISNKIKDKKAYIELIEGYGLLIDSRD"
FT   CDS_pept        complement(735508..735723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0672"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08090"
FT                   /db_xref="GOA:B0S150"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S150"
FT                   /protein_id="BAG08090.1"
FT                   /translation="MSKKCEICGKSRTFGNNRSFSLRSSNRSWAPNIRKVRALVDGKPK
FT                   RINVCTRCLRSGLVERPQFIKTTEEE"
FT   CDS_pept        735903..736265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0673"
FT                   /product="putative alkaline shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08091"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B0S151"
FT                   /protein_id="BAG08091.1"
FT                   /translation="MTTKIDNEYGSILISDNIVRTIASETAMTCYGIVGLAYKNLSDGF
FT                   LMLLNKDNMSKGVKVYTKNNKIVIDLTVVLEYGTKIAVVCQNIIDTVKYSVENKTGLEV
FT                   ECVNVLVQDMRINEGK"
FT   CDS_pept        736274..737899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0674"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08092"
FT                   /db_xref="GOA:B0S152"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B0S152"
FT                   /protein_id="BAG08092.1"
FT                   /translation="MKNDATLFKNCLLAGFKNLENKREIVNSLNVFPVPDGDTGTNMTL
FT                   TIKSAISKVNGVTDLSIASLAKAMSDGSLMGARGNSGVITSQIMRGFYNGFKDYTEFNI
FT                   LALRDGFVESYKTAYKAVMKPTEGTILTVSRCMGEFAEDNYQNYEDIKEFLTDIISEGN
FT                   KALLKTKEMLPVLKEADVVDAGGQGLMLFLEGVLNYDNEKLISETVIDESSRTINENTN
FT                   VVSDEEIKFGYCTEFFIMTDADENSYRSKLENLGDCLLVVKGDGVIKTHIHTNNPGKVL
FT                   EIALELGALKDIKIDNMRLQHQNLYSTEEEINQASSKPSEPEKDFGFVVVSSGKGFSKV
FT                   FEMLNVDEVITGGQTMNPSTEDIVNSIEKVNAKTVYVFPNNKNIILSANQAKQIVDKQV
FT                   YVVETKAVPQSISALLAFNEEASAQENFDSFNDVISTVKTGEVTFAVKDLNMSDIKVKK
FT                   DDIIGLDQKNIRAVGNDINKVSMDLLRQLIQKDDSLVTIYYGEGCDEMMANKLRDSLEE
FT                   EYKDIDIEVVEGSQPLYYYVFSIE"
FT   CDS_pept        737988..740024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0675"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08093"
FT                   /db_xref="GOA:B0S153"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B0S153"
FT                   /protein_id="BAG08093.1"
FT                   /translation="MQLSEIKGIGKKKLEVLNSMGIININDLLNYFPYRYENRSIIKNI
FT                   IDTRDEENCVIKVKFISKPITKYLRRNLNLTTAIAFDDTSKISVSWFNQPFIRNQILPN
FT                   TTYYLYGKIQRVQNQFKISSPILSKTFGGKLGIIYPIYKVKKGITNNDMIKFVDFAIKH
FT                   CIDEIKNVIPYSMIKNYDIENKRNAIKNIHKPVDYMQFKRARTALVLEEVIIMQLAMKS
FT                   MKTSLNQQNYIKLQSDESINIFINSLKFELTKGQLEAIKDIEMDMTSEKRMNRLVQGDV
FT                   GSGKTIVAEAAIFKSHSSGYQSAFMAPTDILATQHYESLSEDFSKFGIKVCLLKSDLTK
FT                   SEKDLVLKGIKSGYFDVIVGTHAIIQDFVEFKRLGLVITDEQHRFGVGQRKKISDKGQN
FT                   PDVLVMTATPIPRTLALSYYGDLDISTINEMPKGRKIIETYSVGFSYEKRIADFIRKQV
FT                   DNGFQAYIVCPLIEESESLELENVTELYNRLTGEYFSDINVGMLHGKMKSSEKEETMKD
FT                   FVDGKTKILVSTTVIEVGVNVRKANVIVIYNAERFGLSQLHQLRGRVGRSSDQSYCILI
FT                   NKAHSDEQMERMNIMVKTNSGFELSQKDLMMRGSGDLLGTRQSGIPLLNIADLEKDYDL
FT                   IEKAAVITDYIYTNDLLKNKEYSYLNEEINKFKDKLLENVIFN"
FT   CDS_pept        740033..740593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0676"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08094"
FT                   /db_xref="GOA:B0S154"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0S154"
FT                   /protein_id="BAG08094.1"
FT                   /translation="MKVISGKMRGMNLNTDLDRFTRPTEGKIKEAIFSVIFQVKPNSKA
FT                   LDLFAGSGAVGIEFLSRGCDLVVFSEASSDNIRCINENIEHTKSQEFTKVFKGDFKKNI
FT                   LNIKRQGIKFDYVFIDPPYERLNYYKESIQMLLDNDILNDDCLVILESEKELPDEYFGS
FT                   LNLEKQKQYGKKKNIYFLRKDNE"
FT   CDS_pept        740586..741074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0677"
FT                   /product="putative phosphopantetheine adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0677"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08095"
FT                   /db_xref="GOA:B0S155"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S155"
FT                   /protein_id="BAG08095.1"
FT                   /translation="MNKTKVLYPGSFDPITNGHMDIIERSAKIFEEVNVAVVKNIQKKS
FT                   TFTLEQRVEMIEKACKHLSNVKIHQFEGLTVDFAKQIGCSTIIRGLRAVSDFESEMQMS
FT                   LANKKLNDELETLFLVADGKYAFLSSSIVREIASYGADISELVPENIVEDIKQRFNDK"
FT   CDS_pept        741151..741624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08096"
FT                   /db_xref="UniProtKB/TrEMBL:B0S156"
FT                   /protein_id="BAG08096.1"
FT                   /translation="MDIIKLIEEMEDILDEASTVPFSKKVMVEREELLSVLKDMRENLP
FT                   EEIKQAQWTNAEKNRIIDEANRESENIRTQAYKEAEKIDQEARNRFETMVNEHDVTIAA
FT                   QKNAEEITSQAENNARLLKSQSIQYIDEMLETTQDKLHNLLDELQENRNELKG"
FT   CDS_pept        complement(741665..742084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0679"
FT                   /product="flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08097"
FT                   /db_xref="GOA:B0S157"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0S157"
FT                   /protein_id="BAG08097.1"
FT                   /translation="MNLLILYWSQTGNTEKMAQIIKDECESKGSKVEMVFSDDYQNCNI
FT                   DNFDVIAFGCPAMGDEELEDTSFEPMFSDLENKLNDKKIALFGSYEWNNGEWMGFWKER
FT                   CDKNNLNVIDTVICYDAPDENSTNDIKTFADNLLK"
FT   CDS_pept        complement(742088..742633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08098"
FT                   /db_xref="InterPro:IPR024523"
FT                   /db_xref="UniProtKB/TrEMBL:B0S158"
FT                   /protein_id="BAG08098.1"
FT                   /translation="MLQDILLEHCYPTLSNLKFANMINVDYTENIFEDILKLNEKLSEY
FT                   NFSLIILKQTEKKLLLYLINYNLIENYNDKRLKKALESYGYPVDNFNSSINFLKKRLLE
FT                   NEFPHEIGFFLGYPYEDVLGFINYNGKNECISGKWKVYSDVERAKNIFKKYDYAKQITK
FT                   RLSLQGNNLFDIINYFKE"
FT   CDS_pept        742839..743063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08099"
FT                   /db_xref="GOA:B0S159"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B0S159"
FT                   /protein_id="BAG08099.1"
FT                   /translation="MKTVFSVILVLASIVIIFAVMSQETKSEGMAALTGETNVGGHGGR
FT                   LTKDNYINRVVVVSSVIFLVSALALAYIK"
FT   CDS_pept        743088..745100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0682"
FT                   /product="vacuolar-type H+pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08100"
FT                   /db_xref="GOA:B0S160"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:B0S160"
FT                   /protein_id="BAG08100.1"
FT                   /translation="MDNMYYYLAIAAGIIALLFAAIKFSSISKKGAGNERMKEISGFIH
FT                   DGAMAYLSRQYKALIIFVVVVCVILGVAIDYKTAICFLAGAIFSVLAGYIGMQAATKAN
FT                   VRTANSAKEEGMNGALNVAFSGGAVMGMCVVGLGILGITLSYIIFQDAEIVTGFSFGAS
FT                   SIALFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDVAGMGAD
FT                   LFESYAGSILSGITLGLLAYKEAGVSFAIAIAAIGVIASIIGVFTVRGGKDPQKSLNTG
FT                   TIISSILAIAGSFFLSRTILGNNNAFFSVLAGILVGLIISQFTEYYTSEDKKPVQKIAE
FT                   ESETGSSTNIISGLATGMKSTTGPIIVIAIGIIVSFFASNGATNPTEGLYGIAVAAIGM
FT                   LSTCGMTIAVDAYGPIADNAGGIAEMCELPEDVRNITDKLDSVGNTTAAIGKGFAIGSA
FT                   ALTALALFASYTAVVGLKQINVTSPEVVAGMFIGGMLPFLFSALTMDAVGTAANDMIVE
FT                   VRRQFKEFPGIMEGTQQPDYKKCVDISTGAALRQMIVPGLLAVICPVIMGFLLGAEALG
FT                   GLLAGSLVTGVLMAIFMSNSGGAWDNAKKYIESGQHGGKGSDAHKAAVVGDTVGDPFKD
FT                   TSGPSLNILIKLMTVVSLVFAPLIAQHGGIILNLF"
FT   CDS_pept        745224..746567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0683"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08101"
FT                   /db_xref="GOA:B0S161"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0S161"
FT                   /protein_id="BAG08101.1"
FT                   /translation="MDEVGPNLFIELVILLVLIIINAFFSASEIAIVSCDKNKLRAMSE
FT                   DGNDKAKLVLEQFEKHTKFLSTIQVILTYIGFVAAAICSSSLSGSLSKKLVFLGLNSSL
FT                   TYWLSVCIVLLVLSFLYILFGQLIPKRIALSVADSFALFSISAVKFVYFILKPFVFLLS
FT                   RATKLILSIIGIKTLNVESKITVEEIKSMVEVGKEQGIINSNEKDMIDAVINFNEKTAE
FT                   EIMTARTEVFAIDLEDCIEDYLDKLMELKFSRIPIYEGDIDNILGIIYIKDYMSEAYKL
FT                   GFNNVDLRKILKPAYFISETKNINDLFSDMKKKRIHMAILIDEYGGFSGIVSMEDLIEE
FT                   IVGNIEDEYDHEAPDIVQVDKFNYIVKGSTSIKEINSNIGLEIDELSDDYDTLGGMLIN
FT                   RLGYIPEDGFKRKIDIDGVLYNIIFVEDKRIKKVKITLPKNFFEQVSK"
FT   CDS_pept        746564..747319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0684"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08102"
FT                   /db_xref="GOA:B0S162"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B0S162"
FT                   /protein_id="BAG08102.1"
FT                   /translation="MIIIKNKDEIEKMDISGNVISGMHEALREYVKPGLTTMQVNDFCE
FT                   KFIRSKGAIPAQIGYEGFPYATCCCVNDEICHGYPSDYVLKSGDLLKVDTVVELNGWMS
FT                   DSCWSYAVGEVDEETKKLMEVTRECMYEGIKLAVIGNRLGDIGARIQSIAEANGYSVVR
FT                   EFTGHGIGRGMHEDPMVLHYGKEHRGLRLQEGMVLTIEPMINMGTHKLKIDKNGWTART
FT                   IDGKKSCQYEHTLAITKDGPRILTKQQGQ"
FT   CDS_pept        complement(747357..748502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0685"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08103"
FT                   /db_xref="GOA:B0S163"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B0S163"
FT                   /protein_id="BAG08103.1"
FT                   /translation="MNIAIVCEYNPFHFGHLHQIKKIKKVFPKANIITIMSGNVVQRGE
FT                   FSVLDKLYKTKIALEYGIDCVIEIPSVFSLQSAQNFGYYAIKIIDAIGCDYVSFGIESE
FT                   IEDLISFKNFLLENNDNIEQFICDNKNLSYNKSIMEFSKQNYMDYSDEIFRSNNILALE
FT                   YIKSLDKINSNCKILPIKRINSDYNSNSIENISYSASSIRSNIELLDQYESKIPTLTYE
FT                   FLKNSYIEVNKKLLDILSYKLLIEKYKLDNITGYEKGLENLLTKGLDKNYHALFKNIKN
FT                   RKYSQNRLKRLILNYILEVDKKFVDDILKKDIEAIRLLGFNKKFDLSMINKNCKICSLI
FT                   RDFSKLSEDYQKLFEFDIKVSRLIYSTRKVNDFYDFPVIKK"
FT   CDS_pept        748589..749029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08104"
FT                   /db_xref="UniProtKB/TrEMBL:B0S164"
FT                   /protein_id="BAG08104.1"
FT                   /translation="MDIRFVKGNIFELQSDAILYFIENSLLEENSKKLVEKAGERILEP
FT                   LTKISGIEKGECKIIPAFNLISDYVILANLPENLKDYNKNIFKNLIYNVFCEMKKFEIH
FT                   SLNIDYSFLTEKYSSEFVNLINEVIDEKSLRISDFLVFMCKS"
FT   CDS_pept        749088..749729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0687"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08105"
FT                   /db_xref="GOA:B0S165"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:B0S165"
FT                   /protein_id="BAG08105.1"
FT                   /translation="MINIFPETHKRIVREINQDIKDSYGINLNIKKLEWGAVSPDILPK
FT                   YKLIRHYKEESINYIVKEIITIIYLFQFTDLTRLNSLQNKILSTKLGVISHYLSDYVCL
FT                   PHAKRWRCNQHLKDHMNYERVLNKISQNHVFNKKAIKTSRINIDNDECVMLKTLVKNYI
FT                   EDIVDEYSMSEGKTRDLDFAYGLNYSIFCFIFETIEIFSTERYYQKSFVF"
FT   CDS_pept        749750..750475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08106"
FT                   /db_xref="UniProtKB/TrEMBL:B0S166"
FT                   /protein_id="BAG08106.1"
FT                   /translation="MYKAYNMNNLKKKLEKKFLFEDDLLALYLMLDIVQQENKIQPCYV
FT                   KYNAINKINNVLNNHLSYRNDKDNIIKAVFDLISEDINKIEFTYYLQAYTEGFNNKYIS
FT                   DELEFYVLRHIPASTIKKSDILLHNTESRSAKFLKSKMICSIKNKSNAFRVQDSIIDNY
FT                   CENILKDKIFSINSKMDKQLVMKSINDSIVISEEKFLNMWQLENLYKKIVKTLKNVLNN
FT                   SIEDALWYGLNDRVLQRYK"
FT   tRNA            750565..750640
FT                   /locus_tag="FMG_tRNA43"
FT                   /product="tRNA-Phe"
FT   tRNA            750649..750723
FT                   /locus_tag="FMG_tRNA44"
FT                   /product="tRNA-Gly"
FT   tRNA            750727..750800
FT                   /locus_tag="FMG_tRNA45"
FT                   /product="tRNA-Cys"
FT   CDS_pept        750852..751982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0689"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08107"
FT                   /db_xref="UniProtKB/TrEMBL:B0S167"
FT                   /protein_id="BAG08107.1"
FT                   /translation="MIFIDLLKDEHIEELSDFVYKLRNNILCQNKFDSNIAKNRSTILK
FT                   SMKKQILEKNHFVIYEEDKLIGYIVLDFEDNELIINEIYFDKINNSILFKVFRFLMDYA
FT                   VSNLFDIIKFKFKGFIFDEIIKEHLDNQNRLEIRNDIFEEFRKKFAIVSFKSKDGLIKF
FT                   LQESSYDIIYSFNSNKLDKKVCDHVDMQIRKINDNTFVCSQESYNHYRAYLPNYITLYV
FT                   TEFDISDKYPKDCLLNNFSIKNHLICNKKSIDPVILKLLKDEKIIMVNQGYSKCSTIVT
FT                   NHFVITSDKSIFNSVQKEHIEAFLIDSGEIKLEGYDTGFIGGTCGYSSDLGLVFYGNLE
FT                   KYKYKEKLIDILNKEKIKYYYPKDDDFIDRGSIIFN"
FT   CDS_pept        751996..753291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0690"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08108"
FT                   /db_xref="GOA:B0S168"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S168"
FT                   /protein_id="BAG08108.1"
FT                   /translation="MIQPSTLPGMMELLPEDQLVFDTIKRKIEDVFIKNAFFSIDTPAI
FT                   EKLDVLLSKGGGETSKQVFRIDNSKKNQGLRFDLTVPLAKYVSMYMQDLAFPFRRYQIA
FT                   KVYRGERNQKGRYKEFYQCDIDIIGNEKLSLYNDAEIVKCMYEALKSIDVPEFEFQFNN
FT                   RKILNGYFSYLGIDDFESCLRVIDKLDKIGIDNVKEELSKINLDASKIDTLLKFLEIDG
FT                   TNQEIIEKLESLNIDNELFTCGVNELKFVYQDILSLGVNPENIKINLSITRGLDYYTGS
FT                   VFETFFKDYREIGSICSGGRYDSLANNFTKSKLPGVGMSIGLTRLFYQLQELNLVKGKQ
FT                   TNFDCIIIPMKGYEKNAVKLMNDLRNSSVKCMSYLEDDKLKKKFNYADKLSVKYVIIIG
FT                   QDEVEQNKFTLRNMENGNQELLELNEIIEKLK"
FT   CDS_pept        753487..755391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0691"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08109"
FT                   /db_xref="GOA:B0S169"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S169"
FT                   /protein_id="BAG08109.1"
FT                   /translation="MFEVKLKDGSAKEFDGEISLLDVCKSISEGLARDCVGAVVDGKIM
FT                   GLMETIDSDCEVQFVKFDDDEGKQVFWHTSSHLMAYAIQRLYPGTKFAIGPSIDSGFYY
FT                   DLDTDHKFVPEDLEKIEAEMKKIVKENPKLVRVEISRKEALERFKNEGQDYKVDLIENF
FT                   DEDATITLYEMGDFVDLCRGPHLLDVKNIKAFKLLSIAGAYWRGDENNKMLQRIYGISF
FT                   PKKKLLDEYLDRMEEAKKRDHRKIGKEMGLFSIQEEGPGFPFFHPNGMVVLNELEKFLK
FT                   EQLLERGYGQIKTPLILNEHLWHQSGHWDHYKENMYFTKIDGEDYAIKPMNCPGSILVY
FT                   KDELHSYRELPIKVAELGQVHRHELSGALHGLFRVRTFVQDDAHVFCLPEQIEEEVSKT
FT                   IDFCDYIYSKFGFKYEVELSTRPEDSMGSDEDWDLAISSLKNALEHKGLPYKINEGDGA
FT                   FYGPKIDFHLEDAIGRTWQCGTIQLDFQMPERFDMTYIASDGSKKRPAMIHRAILGSEE
FT                   RFMGILIEHYAGKFPLWLSPVQVEILPISDKFNDYAYELQQKMKARGLRVKVDDRSEKI
FT                   GLKIRESQLKKVNYSLIIGQNEIDNNEVSVRKRDIGDVGSKNTDEFINELVDEYQNRK"
FT   CDS_pept        755467..757194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0692"
FT                   /product="multidrug ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08110"
FT                   /db_xref="GOA:B0S170"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0S170"
FT                   /protein_id="BAG08110.1"
FT                   /translation="MYKKFYWFLKYYKNKLILAVTFLLLSDLVGLIPPYITGKLTDRVL
FT                   NDSIKLKPFLIILLIDVLIIGIKYFFAMGWCYYTFRASNEIDYVTRNRLMDKYLNESMK
FT                   YFQTFKTGELMNRATGDVNSLSDLMGFGTLTFFDSTVFPLFIIIIMMVVVDVRLTLVSI
FT                   IPLPILAFLCLKIGRKIHEKYSIVQSTFDKLNNSVLEDVEGIRIIRVFGIKDARYFSFK
FT                   NRSKMLVQKNMDVVKYRAMMAPFQRIIPAITFVIAIGYGSYLISKNVISVGQLVSFTYY
FT                   LNMLIWPMYALGNFINVYQQADASMDRIDNILDYKDDLDLNEDYKKVSEIESVKFENYS
FT                   FKYPYSEENALKDISFEIKKNMRVAIVGKTGSGKSTILKQFLFLYPRQDEFKINGKNTN
FT                   LINLKSARDNIAYVSQKSMIFSDTIKNNIKLSKIDASDEEVVNASKSADIYKDIVNFPD
FT                   GFDTLCGENGLSLSGGQKQRISIARALLKDSNLVVLDDCLSALDTQTEKNILRELKKLK
FT                   KTVILSTHRLNQIDDFDLIIVLKDGHISEMGTHSELMENKQWYYTQYNIQLVRERYEE"
FT   CDS_pept        757184..758923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0693"
FT                   /product="multidrug ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08111"
FT                   /db_xref="GOA:B0S171"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0S171"
FT                   /protein_id="BAG08111.1"
FT                   /translation="MKSKLRNKFVSEKLKMYSMKQSKELLIGFVFSFLRTSMEILGPIV
FT                   IGYVLNEFVAKNNIVGNFLTIIKYLAIYLVIYVACGIFSNLSMIYFELAANNVTYFVQN
FT                   DIYKHINELPIEYFDNLAAGSIVSRITNDTMRLKIMFQLILADIATAAIMIIAIYIMMV
FT                   VTNIKVSLMLLILFPLVFLIFYDYRYKSAKHNKRIRHLVSKINANINENINNMEIIQAL
FT                   NVKKTIKDKFDKINKEIFSNNLALTKLRSYGGYRAIDIIGLLSTVIILFYFGYGQITKN
FT                   YPVTVGGLYIIIDYTSKIFSNVSVIVTRFGDMEQAYASASHIFDIMKLDTIEKSDGVID
FT                   KLEGNIEFKNVYFAYDKNDVLKNVSFKIPKSTSAAFVGTTGSGKSTILNLILKFYDVKS
FT                   GEILVDGVNINDLNEDVLREDFAVVLQDPFLFETTLKENITLDKDYSDEEVINALEELG
FT                   CYTLLKKGLNEQIKEKGSNLSQGERQLISFARAYIRNPRVLILDEATSNIDTETEQIIQ
FT                   QPLEKLKYSRTTLIVAHRLSTIRNVDKIFALSNGKIIESGTHDELLEKDGFYKQMYDEQ
FT                   SAN"
FT   CDS_pept        758933..761335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0694"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08112"
FT                   /db_xref="GOA:B0S172"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:B0S172"
FT                   /protein_id="BAG08112.1"
FT                   /translation="MDKKLKYIRTFYTIIFTIIVLYIVRNNFILPSHIFKYKIFLSMEQ
FT                   KIENLVLGILVFFVSSISYFVVDEKFNIKNLKNYWALESLRKFIWINEVESVFKEADTY
FT                   QNKKINKSISNFISLSLISLFTIFYIKPEWTLFLIYLFVIVIAVCVIYFKNKSLYFLEY
FT                   ISIEDIGFKRKILSTLYELIVTICNIMFFVFVIKQFTDVNFSNLVLIYCVSNVFGQISL
FT                   MQDGLVVSDLLQIHLLSKLIEPRAAIIAILMYRMVSSVIPWIISLIMILRRIYDNYNTD
FT                   QHKKQFAFNILSIFTLIVGIILCLSVATPSILLRIKFLRRFVKKDVLVLARFITLTSGG
FT                   LLILLSQGIKKSVKKSFYIAETVLIISVFSTLLKGLDIEESIITLILGIVMYIMKDGFT
FT                   EKAIKFRTKYFANTIIKLSAVTVFFIFISNSVRKVNFLSSHRKYSLHYLVENKKFILLY
FT                   VLFVLILSYLAQYTRTKKITFSKLTDEDFSKIGKFLGEYGGNEFSHLVYLNDKNVYFDK
FT                   TNTVMIMYRPVQNSVIVLGDPIGKKENFVEAINDFIIYCNEYHMNVCFYEINGENLELY
FT                   CDQGFRFVKVGQDATLNLNEFSLVGKKNRTWRHVINNFDKGNYEFKVEEATDNLLSQMK
FT                   VVSDKWLGNKNEMGFSLGFFDEDYLKRTKIACIYKGNELLAFANLQPFYDNKTLSIDLM
FT                   RYDRSNEDGLMDFIFIKLILWGQDNNFEKFYLGMAPLSKVGDKIYSKKKEKILNIVYNT
FT                   QNKIYNFKGLRNYKDKFKPDWSNKYIAYTSDFNLPYILINVVNSKKK"
FT   CDS_pept        761435..762013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0695"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08113"
FT                   /db_xref="GOA:B0S173"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B0S173"
FT                   /protein_id="BAG08113.1"
FT                   /translation="MIINFWRVSLPAIIFLEVNNIKDLMINEEIRSSKVRLIDDEGEQI
FT                   GVIPIKEALKMAEDKHLDLVNVAPNAKPPVCKILDYGKYKYDALKKEKEAKKNQKVINV
FT                   KEIRLSPNIEKHDLEVKANQASKFLSNENRVKVSVRFRGRELGHKDLGKEVLDKFYELT
FT                   KDVGQIEKKPSMEGRMMIMFMGPLTDKDN"
FT   CDS_pept        762027..762218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0696"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08114"
FT                   /db_xref="GOA:B0S174"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S174"
FT                   /protein_id="BAG08114.1"
FT                   /translation="MPKMKTHRGSAKRFRRTGTGKLRRFKAYASHLTGKKSAKRIRNLR
FT                   KGTTVSEADMKRIDKMIP"
FT   CDS_pept        762237..762590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0697"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08115"
FT                   /db_xref="GOA:B0S175"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S175"
FT                   /protein_id="BAG08115.1"
FT                   /translation="MARIKRGTNNRKRHKKVLKQAKGYYGSKHTLFKTANQAVMKSLAY
FT                   SYVGRKRRKRDFRKLWIARINAATRMHDLSYSKFMHGLKVAGVDLNRKVLADMAVRDEK
FT                   EFAKLVELAKNNL"
FT   CDS_pept        complement(762622..762897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08116"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B0S176"
FT                   /protein_id="BAG08116.1"
FT                   /translation="MYYLYILECADKSLYTGITNDFSKRIKMHNNGKASKYTRARLPVN
FT                   YVFMKKIDNKSDALKLEIKTKKLTRDDKLKLINSNENEINEILKKA"
FT   CDS_pept        complement(762897..763514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0699"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0699"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08117"
FT                   /db_xref="GOA:B0S177"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S177"
FT                   /protein_id="BAG08117.1"
FT                   /translation="MIIQKIEFNDKKDKFVIETDTKESFLLSYNDFEKFKIHNEMIIDD
FT                   ELYAHLLNISKFGEAFDISLNFLSYKLRTEKEIITKLKSKKFSTEIIDDVITKLKNLDL
FT                   LDDYNYAKIFINDKINLTNYSKRRIINDLYQKGIDKKIYEDYLEEVFGYNMELDKATLI
FT                   VETKINIWKEKYEGYELKNKIFTFLLQKGFSYDVAKQISGMY"
FT   CDS_pept        763703..763942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08118"
FT                   /db_xref="GOA:B0S178"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="UniProtKB/TrEMBL:B0S178"
FT                   /protein_id="BAG08118.1"
FT                   /translation="MADLKFEIVERIGVLSTKANNWNKELNIVKWSDYDAKYDIREWNP
FT                   DHTRMSKGLTFTEDELRVLHALIEDELKQLDSEK"
FT   CDS_pept        763951..765027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0701"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0701"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08119"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B0S179"
FT                   /protein_id="BAG08119.1"
FT                   /translation="MKFIHAADFHLGMKFEKSSIPQSMSKIRRQRIWTSVEKLIKYSID
FT                   KNVDYIFLSGDLYNLENFSISDMNRLIDLFSRTNSQICIIGGNHDPIYNDNLWDMVNIS
FT                   DNINVFKKDCLEKIEFDDTDVYGITYNKNNYDFMDIFNDLKLDKLKTNVLMIHSDLLND
FT                   NNSYMFFDQEKVNNLGFDYVALGHIHKPTIFNDKFVYPGSIEPLSFKEQGRHGAVIGSI
FT                   VDNKLDMDFLDCSESNFNEFEYNISDKFSYYDLVGALSKCLLEDKKNYIRINLKGQLED
FT                   GFDLDIDSLQESLKKYCEYVVIVDNTESNINLDKIYEFNRNNVLGYFIEETKNLDSNDP
FT                   IVKRAIDLGIHSLMENNL"
FT   CDS_pept        765024..767276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0702"
FT                   /product="putative DNA double-strand break repair rad50
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08120"
FT                   /db_xref="GOA:B0S180"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:B0S180"
FT                   /protein_id="BAG08120.1"
FT                   /translation="MKIIRLDLISFGRFNNYTIEFGDKFNLIYGLNESGKTTISKFIEG
FT                   VFYGFVKPYLKRTVYTEDYEKYRPWNNENYEGSILVEKDDKRYVIYRNFKEKYFNIFNE
FT                   TTGNNETDLDGFNRDNLSFPGEYFFKMPSDIFTSTVFSNLKELDSENKNVNSIVDMLLN
FT                   SSDSNNDSVSFKKALDNLEKMKSSIGTKQSKSKPLGSLYQKKFDLEDEIKNINNDKKEY
FT                   EDSLNKLNEYKFKHESLILNKEKLVSLHKKNDIEKIEDAKNYKMQILKEKASLLDTISK
FT                   IKYINDINENDVNSLEHENKILNENRIKFNELSKKKKLLNKDYYQLKAKLSNYETISKY
FT                   IEEINNLNGKLNGIAKLNIKLIVIGLIFTIIASAMIYMMGKTKEFVIAPILFVLYYIVV
FT                   IFLSKLRKLSFTRQLNKIVQKINQITNMRYKSHNEVINDFRYDSNMDKSIDYLNTLEEQ
FT                   IKGIDLRLDSIINEDENSKSKINSILSSSKNLKNIDVEDYRRKRIEYDQLIHRISDKDD
FT                   QLQKISSEYDFSILLDNVDSDSIKLDDNDIKDINVLNKEIDESIEKNAKLYERTKILEK
FT                   SVNLLLEKEEKLSDINENIQKYENEIISIELAMDLINKSINKLHKNFIPRINKKVSEMM
FT                   AYSTKDKDRFRVDENLDVSIYDGVKFYEQKHLSSGTFDLLSVFIRISVLEELMGLDYLM
FT                   ILDDCFVQLDDVRYKKCLDLLFKISNNNQIILFSCQNRDEQLLNELDIIYKKIELK"
FT   CDS_pept        767279..767959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0703"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08121"
FT                   /db_xref="GOA:B0S181"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014578"
FT                   /db_xref="UniProtKB/TrEMBL:B0S181"
FT                   /protein_id="BAG08121.1"
FT                   /translation="MIYAIGDLHLDYTKEKSMDVFGDNWDNYEEKIFHNLGKLNDQDII
FT                   LIPGDISWAMQLDDALVDLKRIDKSPGRKILTRGNHDYWWSGISKLRKLDLESISFIQN
FT                   DSLDLGDINICGSRGWLDPTSKEATEKDEKIFQREILRVNMSLESVRNDNDIIMMLHYP
FT                   PFDINKQPNELFNCLKNYNVTDLIYGHLHGYGHLNVVQGKIDGINVHCVSSDYIDFKVK
FT                   KIKE"
FT   CDS_pept        767961..768503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0704"
FT                   /product="adenylate cyclase 2"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08122"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:B0S182"
FT                   /protein_id="BAG08122.1"
FT                   /translation="MEKELECKVFTDDFNALMDKAIEMGAKMIAHEIQDNILIESNDFD
FT                   LINNSDYLRIRITEDIFNNKTKKYLTYKKRINDTNVRHYDEYTIEFDNEENLKQILRFV
FT                   KLDKQSSSKKERKSFEFMGARLDFDRWDKDFYPYPYLEIEVKNEEHLTQIINKLGIRKD
FT                   QISTESISELRLKLQEN"
FT   CDS_pept        768523..770589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0705"
FT                   /product="topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0705"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08123"
FT                   /db_xref="GOA:B0S183"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:B0S183"
FT                   /protein_id="BAG08123.1"
FT                   /translation="MANKKLVVVESPTKAKTIQKMLGSGYKVVATIGHLRDLPKSKLGI
FT                   DIENDFEPRYINVRGKANVINALKKDYKNSQKIFLATDPDREGEAISWHLCYLLGINPK
FT                   EENRVKFQEITKDSVKEAIKKPEAIDLKLVDAQQARRVLDRIVGYSISPLLWKKVKSGL
FT                   SAGRVQSVALRLICEREKEIREFEPEEYWSIHANLSKDKLDFDSELYYSKSDKSNKINI
FT                   KNKDEADKILNDLSDKFVVDSIKQQKKARKPYAPFTTSTLQQEAYKKLYFQTSKTMRIA
FT                   QQLYEGISLGSEGSVGLITYMRTDSTRISQVCVNDCLDIINELYGKQYATRGYDYSKKK
FT                   KGSQDAHEGIRPSSVKRRPNEIKKYLTEDQYKLYKLIWERTVASQMKDARYLSTSIDFD
FT                   NNGYTFRSNGNVVIFDGFTRVYSLNTKDSELPELKDREAISSNEIEPKQHFTKPKPRYT
FT                   EASLVKTLEEDGIGRPSTYASIISSILSRNYVELKEKKFYTTEIGEKVCEFVVKYFDSI
FT                   INEKFTAEMENELDNIAENDVEWKKVIRDFYNGFNEDLVNAKNAQDKFKVKDEPIGRKC
FT                   PECGNDLVIKHGRNGKFIGCSAFPECKYTETIVKDTKVKCPKCGHRIIEKVSKRGKVFY
FT                   GCENYPNCDFALWDKPTGEKCPECGSLLVHRKNRRGESVLCSNEKCNYKKLEK"
FT   CDS_pept        770705..771514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0706"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08124"
FT                   /db_xref="GOA:B0S184"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S184"
FT                   /protein_id="BAG08124.1"
FT                   /translation="MSVVSMKSLLEAGVHFGHQTRRWNPKMSKFIFTERNGIYIIDLQK
FT                   TVKQIDDAYNYVRDIVADGGEVLFVGTKKQAQEAIETEAKRCGQHFVSQRWLGGMLTNY
FT                   KTIKTRINRLHKLYEMEEDGTFDLLPKKEVSQLEREREKLEKNLGGIRKMNKMPSVLFV
FT                   VDPKKEYIAVHEAKILGIPVVGIVDTNCDPDELDIAIPGNDDAIRAVKLLTSTIADAVI
FT                   EANQGREDSEDVYSETENDTEETDEELVSEEDLKEFVENSEEESDEE"
FT   CDS_pept        771593..772267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0707"
FT                   /product="translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08125"
FT                   /db_xref="GOA:B0S185"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S185"
FT                   /protein_id="BAG08125.1"
FT                   /translation="MAQITASMVKELREKTGAGMMDCKKVLSEADGNIEKAVELLREKG
FT                   LAGAEKKAGRLASEGIVETYIHGGKIASLVEINSETDFVAKNEEFKNFAKDIAMQVVAS
FT                   NPKYVSREEVPAEEVEKEKEVLIHQALNENDGKNIPEDKAKMIAEKKVEGRINKFYSQI
FT                   CLLEQPFIKDPNKTVEQLLTDLIAKIGENIKIRRFARFEVGEGLEKKNEDFAEEVKKQM
FT                   GQ"
FT   CDS_pept        772389..773108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0708"
FT                   /product="Uridylate kinase"
FT                   /note="Uridine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08126"
FT                   /db_xref="GOA:B0S186"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B0S186"
FT                   /protein_id="BAG08126.1"
FT                   /translation="MSLKYKRVLLKLSGEALSGDQGHGLDDDIIESICDAIKVVHDEGL
FT                   EIAIVVGGGNFWRGRSSKIDRATSDSMGMLGTTINALRLQASLEAKGIQTRVQTAIDMK
FT                   QVAEPYIRRRAIRHIEKGRIVIFAAGTGLPYFSTDTTAALRAVEINADVILAGKRGTDG
FT                   IYDSDPNKNKNAIKYDKLTYIDILNKGLGIMDATATSLCMENNMGLVVFGIDDPKNIIR
FT                   VSHGENIGTIVEGDKNE"
FT   CDS_pept        773101..773658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0709"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08127"
FT                   /db_xref="GOA:B0S187"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0S187"
FT                   /protein_id="BAG08127.1"
FT                   /translation="MSKQILKDMETKADKTLHALKEELKTVRAGRANPSILDNIMVEYY
FT                   GTSTPLKQVATISAPEARLLTIQPWDKSIMKEIEKQIQASNLGITPSNDGTIIRLPFPQ
FT                   LTEDRRKELTKVVKEYGEKSKVTIRSIRRDFVDDAKKMEKNAEISEDELHVLLDDIQSL
FT                   TDKLTKEIDNIVTDKETELMEI"
FT   CDS_pept        773865..775634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0710"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08128"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B0S188"
FT                   /protein_id="BAG08128.1"
FT                   /translation="MNKKGLGLSIGLASVIAVGTFVSPYLSSTTLIGDNSIESNQSLDS
FT                   KYSVAVKNDSTLNQRAEEKEKALNEIRNSQVRNVLNDSTKTISKKQDDKSKEEINSETK
FT                   QEKTNKQELIAFSNNVSTYKNKSEKVDTKKDSNNKEEKHAKEVIGKTSVAENSKKSELK
FT                   KEKSEVASLTLSRNSENEEEKIYSNITKSTTGDLFVREKADKDSEAIGVLPKDTKVVVK
FT                   DNSDNAWAKINYKNKEAYVSKSFLANEKSNKKVISESKKEVSKKSPQTKTEKSEGKSKS
FT                   SEKLVEMWVKSPVYLRSDKSISSDKLGVLEKNTKVQGKLEDGWFKTSANGKNGFISLKY
FT                   LQNKEIKEKAFDKIQTSEIKSNEQIKSSKSTSFEGTNYTGYVKESVNVRDNDSMDSNVV
FT                   SVLEKGTKVSGIKGKYWIKISEGRYISVNYVQDDKVDLNQSSNAESTDSYKKESKAKVV
FT                   RSNEGGSGSAVAQAAYNYLGEKYVWGSAQPGVGFDCSGLTSYLYNKVCGISLYRNSAAQ
FT                   SNNGYPVSKNNLKQGDLLFFSTNGSGSISHVGIYVGNGKMIHASTPSTGVIISDIDSNY
FT                   YSDTFVTARRILN"
FT   CDS_pept        775733..776371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0711"
FT                   /product="late competence protein"
FT                   /note="DNA binding and uptake"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0711"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08129"
FT                   /db_xref="GOA:B0S189"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B0S189"
FT                   /protein_id="BAG08129.1"
FT                   /translation="MNFNFSKDKIIIGIAIIALAGFGYYKSSSDSLNSNQIQSIVDTKQ
FT                   NDNINNQSEVENKENEDNSSKMCQIDGCVNKPGVYSFKKDDRIKDIIDLAGGFTKDADT
FT                   KSVNLAMKLKDEMKIFIPSKNEISKLQNHNTENSQIVTLKDNNSTNLVNINTADSNKLQ
FT                   TLPGIGPSKAKKIIEFREKNQFKKIEELKNVDGIGEKTFESLKSLITID"
FT   CDS_pept        776385..777449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0712"
FT                   /product="selenophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0712"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08130"
FT                   /db_xref="GOA:B0S190"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B0S190"
FT                   /protein_id="BAG08130.1"
FT                   /translation="MLDKKYKTIKPEDVKLTEFTQTAGCAAKIGPGKLAEVLSHLEKIN
FT                   DENLVVGLDTSDDCAVYKVRDDLCLIQSLDFFTPVVNDPYTFGQVAAANSLSDLYAMGS
FT                   DPLLALNIVCFSDCMNQDILVEILKGGADKAKEAGCLLVGGHTIQDDEPKYGLSVTGIN
FT                   HPDKIWANSTAKVGDVIVLTKKLGVGIVNTAIKGGMDNQKLFDEVIKSMSTLNKYAKEA
FT                   CDGLDVHAATDVTGFGLCGHALEMAKGSDLTIEIDSKNLPIFEGVEEFVNLGLVPKGAY
FT                   DNRNFIRNDVKISKNVSSFVDDVVFDPQTSGGLLIALSEDDANKLVKKLHESGQVGNII
FT                   GKVKEKADHFIEVI"
FT   CDS_pept        777457..778155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0713"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0713"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08131"
FT                   /db_xref="GOA:B0S191"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0S191"
FT                   /protein_id="BAG08131.1"
FT                   /translation="MKLRILLVFPSSVYKDEIILNFSNDENYEVSECSTIQDALEKLKK
FT                   GYYDFLLCDMNFSDGTGLDFKKEISKLYSIPTIFVSDESDDMKKILALEYGADDYVVYP
FT                   FNMLELKARIRAVLRRTKSDFDSENKNSNIMQIGGFEFNLISRSVKRYGQDVELTGREF
FT                   ELLYALVSNKDKVLSRKELAAKLWEDAQSHIRTVDVHIKRLREKIKDNESIIIRTKWGE
FT                   GYYFSSNTKL"
FT   CDS_pept        778196..778780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0714"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0714"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08132"
FT                   /db_xref="GOA:B0S192"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B0S192"
FT                   /protein_id="BAG08132.1"
FT                   /translation="MYQTDIPKKDQLIANITTNLGEIKICLFENDAPNCVENFVTHAKE
FT                   GYYDGTIFHRVIKDFMIQGGDPQGSGYGGESIWKKPFEDEFSENLKNIRGALSMANSGP
FT                   NTNGSQFFIVQNNSIRKDYIKYLDECDLNEEQKDFYKNNGGCFWLDGKHSVFGQVFEGM
FT                   EVVDKIAKVDTDFSDKPLEDIMIKSIEISRS"
FT   CDS_pept        778782..779414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FMG_0715"
FT                   /product="thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FMG_0715"
FT                   /db_xref="EnsemblGenomes-Tr:BAG08133"
FT                   /db_xref="GOA:B0S193"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0S193"
FT                   /protein_id="BAG08133.1"
FT                   /translation="MHQYKGKLIVHTGSMFSGKTSSLWKEVNRFKIAKYNVVVFKPRMD
FT                   SRYSKEKVVTHDKNEIEAINVDNIDDIVEYTKTHDVNVIAIDEIQFINSKADHFVKQIN
FT                   YLLEKGFTIIAAGLDMDYKAKPFQLVKELLPICDYVEKHHAVCAVCGNDAWVSYRISDD
FT                   KNRIQ