(data stored in ACNUC30630 zone)

EMBL: AP009044

ID   AP009044; SV 1; circular; genomic DNA; STD; PRO; 3314179 BP.
XX
AC   AP009044;
XX
PR   Project:PRJDA19193;
XX
DT   14-APR-2007 (Rel. 91, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 4)
XX
DE   Corynebacterium glutamicum R DNA, complete genome.
XX
KW   .
XX
OS   Corynebacterium glutamicum R
OC   Bacteria; Actinobacteria; Corynebacteriales; Corynebacteriaceae;
OC   Corynebacterium.
XX
RN   [1]
RP   1-3314179
RA   Nonaka H., Kos P.B., Okai N., Inui M., Yukawa H.;
RT   ;
RL   Submitted (10-AUG-2005) to the INSDC.
RL   Contact:Masayuki Inui Research Institute of Innovative Technology for the
RL   Earth (RITE), Microbiology research group; 9-2 Kizugawadai Kizu-cho,
RL   Soraku-gun, Kyoto 619-0292, Japan
XX
RN   [2]
RA   Yukawa H., Omumasaba C.A., Nonaka H., Kos P., Okai N., Suzuki N., Suda M.,
RA   Tsuge Y., Watanabe J., Ikeda Y., Vertes A.A., Inui M.;
RT   "Comparative analysis of the Corynebacterium glutamicum group and complete
RT   genome sequence of strain R";
RL   Microbiology 153:1042-1058(2007).
XX
RN   [3]
RA   Inui M., Suda M., Okino S., Nonaka H., Puskas L.G., Vertes A.A., Yukawa H.;
RT   "Transcriptional profiling of Corynebacterium glutamicum metabolism during
RT   organic acid productions under oxygen deprivation conditions";
RL   Unpublished.
XX
DR   MD5; 83f9fda6941b44c18c3090ef92cbce66.
DR   BioSample; SAMD00060924.
DR   EnsemblGenomes-Gn; EBG00001248658.
DR   EnsemblGenomes-Gn; EBG00001248659.
DR   EnsemblGenomes-Gn; EBG00001248660.
DR   EnsemblGenomes-Gn; EBG00001248661.
DR   EnsemblGenomes-Gn; EBG00001248662.
DR   EnsemblGenomes-Gn; EBG00001248663.
DR   EnsemblGenomes-Gn; EBG00001248664.
DR   EnsemblGenomes-Gn; EBG00001248665.
DR   EnsemblGenomes-Gn; EBG00001248666.
DR   EnsemblGenomes-Gn; EBG00001248667.
DR   EnsemblGenomes-Gn; EBG00001248668.
DR   EnsemblGenomes-Gn; EBG00001248669.
DR   EnsemblGenomes-Gn; EBG00001248670.
DR   EnsemblGenomes-Gn; EBG00001248671.
DR   EnsemblGenomes-Gn; EBG00001248672.
DR   EnsemblGenomes-Gn; EBG00001248673.
DR   EnsemblGenomes-Gn; EBG00001248680.
DR   EnsemblGenomes-Gn; EBG00001248860.
DR   EnsemblGenomes-Gn; EBG00001248861.
DR   EnsemblGenomes-Gn; EBG00001248862.
DR   EnsemblGenomes-Gn; EBG00001248863.
DR   EnsemblGenomes-Gn; EBG00001248864.
DR   EnsemblGenomes-Gn; EBG00001248865.
DR   EnsemblGenomes-Gn; EBG00001248866.
DR   EnsemblGenomes-Gn; EBG00001248867.
DR   EnsemblGenomes-Gn; EBG00001248868.
DR   EnsemblGenomes-Gn; EBG00001248869.
DR   EnsemblGenomes-Gn; EBG00001248870.
DR   EnsemblGenomes-Gn; EBG00001248871.
DR   EnsemblGenomes-Gn; EBG00001248872.
DR   EnsemblGenomes-Gn; EBG00001248873.
DR   EnsemblGenomes-Gn; EBG00001248874.
DR   EnsemblGenomes-Gn; EBG00001248875.
DR   EnsemblGenomes-Gn; EBG00001248876.
DR   EnsemblGenomes-Gn; EBG00001248877.
DR   EnsemblGenomes-Gn; EBG00001248878.
DR   EnsemblGenomes-Gn; EBG00001248879.
DR   EnsemblGenomes-Gn; EBG00001248880.
DR   EnsemblGenomes-Gn; EBG00001248881.
DR   EnsemblGenomes-Gn; EBG00001248882.
DR   EnsemblGenomes-Gn; EBG00001248883.
DR   EnsemblGenomes-Gn; EBG00001248884.
DR   EnsemblGenomes-Gn; EBG00001248885.
DR   EnsemblGenomes-Gn; EBG00001248886.
DR   EnsemblGenomes-Gn; EBG00001248887.
DR   EnsemblGenomes-Gn; EBG00001248888.
DR   EnsemblGenomes-Gn; EBG00001248889.
DR   EnsemblGenomes-Gn; EBG00001248890.
DR   EnsemblGenomes-Gn; EBG00001248891.
DR   EnsemblGenomes-Gn; EBG00001248892.
DR   EnsemblGenomes-Gn; EBG00001248893.
DR   EnsemblGenomes-Gn; EBG00001248894.
DR   EnsemblGenomes-Gn; EBG00001248895.
DR   EnsemblGenomes-Gn; EBG00001248896.
DR   EnsemblGenomes-Gn; EBG00001248897.
DR   EnsemblGenomes-Gn; EBG00001248898.
DR   EnsemblGenomes-Gn; EBG00001248899.
DR   EnsemblGenomes-Gn; EBG00001248900.
DR   EnsemblGenomes-Gn; EBG00001248901.
DR   EnsemblGenomes-Gn; EBG00001248902.
DR   EnsemblGenomes-Gn; EBG00001248903.
DR   EnsemblGenomes-Gn; EBG00001248904.
DR   EnsemblGenomes-Gn; EBG00001248905.
DR   EnsemblGenomes-Gn; EBG00001248906.
DR   EnsemblGenomes-Gn; EBG00001248907.
DR   EnsemblGenomes-Gn; EBG00001248908.
DR   EnsemblGenomes-Gn; EBG00001248909.
DR   EnsemblGenomes-Gn; EBG00001248910.
DR   EnsemblGenomes-Gn; EBG00001248911.
DR   EnsemblGenomes-Gn; EBG00001248912.
DR   EnsemblGenomes-Gn; EBG00001248913.
DR   EnsemblGenomes-Gn; EBG00001248914.
DR   EnsemblGenomes-Gn; EBG00001248915.
DR   EnsemblGenomes-Gn; EBG00001248916.
DR   EnsemblGenomes-Gn; EBG00001248917.
DR   EnsemblGenomes-Gn; EBG00001248918.
DR   EnsemblGenomes-Gn; EBG00001248919.
DR   EnsemblGenomes-Gn; EBG00001248920.
DR   EnsemblGenomes-Gn; EBG00001248921.
DR   EnsemblGenomes-Gn; EBG00001248922.
DR   EnsemblGenomes-Gn; EBG00001248923.
DR   EnsemblGenomes-Gn; EBG00001248924.
DR   EnsemblGenomes-Gn; EBG00001248925.
DR   EnsemblGenomes-Gn; EBG00001248926.
DR   EnsemblGenomes-Gn; EBG00001248927.
DR   EnsemblGenomes-Gn; EBG00001248928.
DR   EnsemblGenomes-Gn; EBG00001248929.
DR   EnsemblGenomes-Gn; EBG00001248930.
DR   EnsemblGenomes-Tr; EBT00001593249.
DR   EnsemblGenomes-Tr; EBT00001593250.
DR   EnsemblGenomes-Tr; EBT00001593251.
DR   EnsemblGenomes-Tr; EBT00001593252.
DR   EnsemblGenomes-Tr; EBT00001593253.
DR   EnsemblGenomes-Tr; EBT00001593254.
DR   EnsemblGenomes-Tr; EBT00001593255.
DR   EnsemblGenomes-Tr; EBT00001593256.
DR   EnsemblGenomes-Tr; EBT00001593257.
DR   EnsemblGenomes-Tr; EBT00001593258.
DR   EnsemblGenomes-Tr; EBT00001593259.
DR   EnsemblGenomes-Tr; EBT00001593260.
DR   EnsemblGenomes-Tr; EBT00001593261.
DR   EnsemblGenomes-Tr; EBT00001593262.
DR   EnsemblGenomes-Tr; EBT00001593263.
DR   EnsemblGenomes-Tr; EBT00001593264.
DR   EnsemblGenomes-Tr; EBT00001593265.
DR   EnsemblGenomes-Tr; EBT00001593266.
DR   EnsemblGenomes-Tr; EBT00001593267.
DR   EnsemblGenomes-Tr; EBT00001593268.
DR   EnsemblGenomes-Tr; EBT00001593269.
DR   EnsemblGenomes-Tr; EBT00001593270.
DR   EnsemblGenomes-Tr; EBT00001593271.
DR   EnsemblGenomes-Tr; EBT00001593272.
DR   EnsemblGenomes-Tr; EBT00001593273.
DR   EnsemblGenomes-Tr; EBT00001593274.
DR   EnsemblGenomes-Tr; EBT00001593275.
DR   EnsemblGenomes-Tr; EBT00001593276.
DR   EnsemblGenomes-Tr; EBT00001593277.
DR   EnsemblGenomes-Tr; EBT00001593278.
DR   EnsemblGenomes-Tr; EBT00001593279.
DR   EnsemblGenomes-Tr; EBT00001593280.
DR   EnsemblGenomes-Tr; EBT00001593281.
DR   EnsemblGenomes-Tr; EBT00001593282.
DR   EnsemblGenomes-Tr; EBT00001593283.
DR   EnsemblGenomes-Tr; EBT00001593284.
DR   EnsemblGenomes-Tr; EBT00001593285.
DR   EnsemblGenomes-Tr; EBT00001593286.
DR   EnsemblGenomes-Tr; EBT00001593287.
DR   EnsemblGenomes-Tr; EBT00001593288.
DR   EnsemblGenomes-Tr; EBT00001593289.
DR   EnsemblGenomes-Tr; EBT00001593290.
DR   EnsemblGenomes-Tr; EBT00001593291.
DR   EnsemblGenomes-Tr; EBT00001593292.
DR   EnsemblGenomes-Tr; EBT00001593293.
DR   EnsemblGenomes-Tr; EBT00001593294.
DR   EnsemblGenomes-Tr; EBT00001593295.
DR   EnsemblGenomes-Tr; EBT00001593296.
DR   EnsemblGenomes-Tr; EBT00001593297.
DR   EnsemblGenomes-Tr; EBT00001593298.
DR   EnsemblGenomes-Tr; EBT00001593299.
DR   EnsemblGenomes-Tr; EBT00001593300.
DR   EnsemblGenomes-Tr; EBT00001593301.
DR   EnsemblGenomes-Tr; EBT00001593302.
DR   EnsemblGenomes-Tr; EBT00001593303.
DR   EnsemblGenomes-Tr; EBT00001593304.
DR   EnsemblGenomes-Tr; EBT00001593305.
DR   EnsemblGenomes-Tr; EBT00001593306.
DR   EnsemblGenomes-Tr; EBT00001593307.
DR   EnsemblGenomes-Tr; EBT00001593308.
DR   EnsemblGenomes-Tr; EBT00001593309.
DR   EnsemblGenomes-Tr; EBT00001593310.
DR   EnsemblGenomes-Tr; EBT00001593311.
DR   EnsemblGenomes-Tr; EBT00001593312.
DR   EnsemblGenomes-Tr; EBT00001593313.
DR   EnsemblGenomes-Tr; EBT00001593314.
DR   EnsemblGenomes-Tr; EBT00001593315.
DR   EnsemblGenomes-Tr; EBT00001593316.
DR   EnsemblGenomes-Tr; EBT00001593317.
DR   EnsemblGenomes-Tr; EBT00001593318.
DR   EnsemblGenomes-Tr; EBT00001593319.
DR   EnsemblGenomes-Tr; EBT00001593320.
DR   EnsemblGenomes-Tr; EBT00001593321.
DR   EnsemblGenomes-Tr; EBT00001593322.
DR   EnsemblGenomes-Tr; EBT00001593323.
DR   EnsemblGenomes-Tr; EBT00001593324.
DR   EnsemblGenomes-Tr; EBT00001593325.
DR   EnsemblGenomes-Tr; EBT00001593326.
DR   EnsemblGenomes-Tr; EBT00001593327.
DR   EnsemblGenomes-Tr; EBT00001593328.
DR   EnsemblGenomes-Tr; EBT00001593329.
DR   EnsemblGenomes-Tr; EBT00001593330.
DR   EnsemblGenomes-Tr; EBT00001593331.
DR   EnsemblGenomes-Tr; EBT00001593332.
DR   EnsemblGenomes-Tr; EBT00001593333.
DR   EnsemblGenomes-Tr; EBT00001593334.
DR   EnsemblGenomes-Tr; EBT00001593335.
DR   EnsemblGenomes-Tr; EBT00001593336.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00236; ctRNA_pGA1.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP009044.
DR   SILVA-SSU; AP009044.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3314179
FT                   /organism="Corynebacterium glutamicum R"
FT                   /strain="R"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:340322"
FT   CDS_pept        1..1575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52962"
FT                   /db_xref="GOA:A4Q9R9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Q9R9"
FT                   /protein_id="BAF52962.1"
FT                   /translation="MSQNSSSLLETWRQVVADLTTLSQQADSGFDPLTPTQRAYLNLTK
FT                   PIAIVDGYAVLSTPNAMAKNVIENDLGDALTRVLSLRMGRSFSLAVSVEPEQEIPETPA
FT                   QQEFKYQPDAPVISSNKAPKQYEVGGRGGASTSDGWERTHSAPAPEPHPAPIADPEPEL
FT                   ATPQRIPRETPAHNPNREVSLNPKYTFESFVIGPFNRFANAAAVAVAESPAKAFNPLFI
FT                   SGGSGLGKTHLLHAVGNYAQELQPGLRIKYVSSEEFTNDYINSVRDDRQETFKRRYRNL
FT                   DILMVDDIQFLAGKEGTQEEFFHTFNALHQADKQIILSSDRPPKQLTTLEDRLRTRFEG
FT                   GLITDIQPPDLETRIAILMKKAQTDGTHVDREVLELIASRFESSIRELEGALIRVSAYS
FT                   SLINQPIDKEMAIVALRDILPEPEDMEITAPVIMEVTAEYFEISVDTLRGAGKTRAVAH
FT                   ARQLAMYLCRELTDMSLPKIGDVFGGKDHTTVMYADRKIRQEMTEKRDTYDEIQQLTQL
FT                   IKSRGRN"
FT   CDS_pept        complement(1594..1920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52963"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S0"
FT                   /protein_id="BAF52963.1"
FT                   /translation="MIVDNFVYLWIDFEVRILSPVCADVSPAYPQFLESCAQSGKFRGI
FT                   TFSVTKLTELQVCNYTAVNKVVDNFVSWGFIGSCPQNPCTTPKLQKDPSEDGSSRAAEL
FT                   NFVI"
FT   CDS_pept        2292..3476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52964"
FT                   /db_xref="GOA:A4Q9S1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S1"
FT                   /protein_id="BAF52964.1"
FT                   /translation="MESQNVSFRVAREDLVTAVAWVARNLPTKPTQPVLRAMLITADDE
FT                   GLELAGYDYDVSTRVRLSAEVSQPGRIAVAGKLLSEITGSLPNKPVDFRIDGSKAFVTC
FT                   GSSRFELPLIPLDDYPMLPKLPAGTGSINAKLFTEAVSQVASAAGKDDSLPMLTGVSME
FT                   IVGNQINLAATDRFRLALRTFEWEANDPELNVKLLIPARTLLDNARSLDSGLNDSIDIA
FT                   VGTGDQVGREGLFGVHTDNRETTTRLLDADFPNIAPLLPKEHTAIASVEIAPLVDAIRR
FT                   VSLVAERNAQIVLHFSEGQVILTAGATEAGHAEETLPCAFTGKELTIAFNPGYLKDGLS
FT                   VVPTSRAVFGFTEPSRPAIMIPEPEEMPSANENGIFQTPDTYFTYLLMPVRLPG"
FT   CDS_pept        3585..4769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52965"
FT                   /db_xref="GOA:A4Q9S2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Q9S2"
FT                   /protein_id="BAF52965.1"
FT                   /translation="MHIRSLELRDYRSWPELKVDLEPGITVFIGRNGFGKTNIVEAIGY
FT                   LAHLSSHRVSSDAPLVRAHAENARVSAVAVNQGRELAAHLLIKPHAANQASLNRTKVRT
FT                   PRELLGVVKTVLFAPEDLALVKGEPAERRRYLDDIIATRQPRMAGVKADYDKVLKQRNA
FT                   LLKTATIALRRGYGTEEGAAALSTLDTWDGQLARLGAEVMAARFALLNELGPKIYEAYT
FT                   TIAPESRPAAVNYKTTIDQGLSQFSEFDAGIIEATLLTELAAKRQREIERGSSLVGPHR
FT                   DDVDLMLGDQPAKGFASHGETWSFALSLRIAEFNLLKSDDTDPILILDDVFSELDAGRR
FT                   QKLVGIAQEVEQVLITAAVHDDLPENLKKVLTAQHTVTVQDTDTGRISLLDVQP"
FT   CDS_pept        4766..5302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52966"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Q9S3"
FT                   /protein_id="BAF52966.1"
FT                   /translation="MTDPIEQAFERIRAEAMRRNGSVPDLNKNDAFRRPPAPKGGVEKR
FT                   KKGRASGLDGRQKRYVRGAESLGSVLNKEIQRRGWGKDIAGGWVTSNWEELVGAKIAQH
FT                   TRVEMIKDKKLFITCDSTAWATNLRMMQRQILQVIAEKVGPNIITELRIFGPQAPSWRK
FT                   GPLHVKGRGPRDTYG"
FT   CDS_pept        5435..7489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52967"
FT                   /db_xref="GOA:A4Q9S4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S4"
FT                   /protein_id="BAF52967.1"
FT                   /translation="MANTEHNYDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEV
FT                   VDNSVDEAMAGHATKVEVTLLEDGGVQVVDDGRGIPVDMHPSGAPTVQVVMTQLHAGGK
FT                   FDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGKHWYQNFEKSVPDELIEGGNARGT
FT                   GTTIRFWPDAEIFETTEFDFETISRRLQEMAFLNKGLTITLTDNRATDEELELEALAEQ
FT                   GETATELSLDEIDNETELVEETTDAPKKPKKREKKKIFHYPNGLEDYVQYLNRSKTNIH
FT                   PSIVSFEAKGDDHEVEVAMQWNSSYKESVHTFANTINTREGGTHEEGFRSALTSLMNRY
FT                   AREHKLLKEKEANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANE
FT                   HIGHWLEANPAEAKVIINKAVGSAQARLAARKARDLVRRKSATDLGGLPGKLADCRSKD
FT                   PEKSELYIVEGDSAGGSAKSGRDSMFQAILPLRGKILNVEKARLDKVLKNAEVQAIITA
FT                   LGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRFMPDLVAEGHVYLAQPP
FT                   LYKLKWQRGEPGFAYSDEERDEQLNEGLAAGRKINKDDGIQRYKGLGEMNASELWETTM
FT                   DPTVRILRRVDITDAQRADELFSILMGDDVVARRSFITRNAKDVRFLDI"
FT   CDS_pept        7830..8798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52968"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S5"
FT                   /protein_id="BAF52968.1"
FT                   /translation="MIQTYILKIQSLKRAQREMLKTTLITDTLGHVTSTEPTTTAHVPL
FT                   PDGSSTPVQIWASDNKDSQLVMLWPGFGMGGYYYRPIAAALNKAGFHVAIGELRGQGQS
FT                   SAKSSRKNQWGYHDLASVDFPLQIAAAKKALDLEEGHPMRFLSHSMGGQISCLFAARPE
FT                   AEKYNLRAIFGVGAGSPFRPTFSPKMGKRLGLGAVLLGGIGGHVVGFWPGKVLGKDLVG
FT                   YGRQSGTHMREWRRFHKHNSLDDLTAQDINYVEAMKKVSIPITFSRCPDDEDCPQASID
FT                   GLASFVPAAQIKMIEIPEALGHNRWAREPESTVKLFLEQAL"
FT   CDS_pept        complement(8795..9466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52969"
FT                   /db_xref="GOA:A4Q9S6"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S6"
FT                   /protein_id="BAF52969.1"
FT                   /translation="MSNPNKKPLDPAQRFSLPTRWAMFFVGIFIMSFAIGITVHAGLGT
FT                   TTISSLPVVWTAASGLSLGWTTIYFNGFMILCQIIVLRSQFKPQMLVQILWAVLFGFLC
FT                   DLSLQLTTWAQTDNYFVAWIWVIVSTILMSIGVFIQVLPNITFIAGEGIVSALVKKFPN
FT                   VEFGTMKQIVDWTFVSVAAILSWITMGGLIGVREGTVFAAFFIGFFVRQWRKLYLRSIG
FT                   H"
FT   CDS_pept        complement(9471..9914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52970"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S7"
FT                   /protein_id="BAF52970.1"
FT                   /translation="MTSLKDLLVSTNADAAIADMSAFIEETVGKQSGTSGIALKGAMGA
FT                   ATKIDSDIVAKGSRRLLPELADSLDGLWQEYQNGGTAANFGEHLEANSSTALDAILSVA
FT                   DKNAESINVPGLGKVYKGVRGKAAKVIEQELPAIGQLIEKNAQ"
FT   CDS_pept        complement(10105..11178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52971"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S8"
FT                   /protein_id="BAF52971.1"
FT                   /translation="MFMLAQRTLPIHITAPHLPVARVFHQIRATDADRTSLQRDLELSQ
FT                   AGITRHVSALIDAGLVEETRVDSGARSGRPRTKLGIDGRHLTAWGVHIGLRSTDFAVCD
FT                   LAGRVIRYERVDHEVSHSTPSETLNFVAHRLQTLSAGLPEPRNVGVALSAHLSANGTVT
FT                   SEDYGWSEVEIGAHLPFPATIGSGVAAMAGSEIINAPLTQSTQSTLYFYAREMVSHAWI
FT                   FNGAVHRPNSGRTPTAFGNTNTLKDAFRRGLTPTTFSDLVQLSHTNPLARQILNERAHK
FT                   LADAVTTAVDVVDPEAVVFAGEAFTLDPETLRIVVTQLRANTGSQLRIQRADAHILRTA
FT                   AIQVALHPIRQDPLAFV"
FT   CDS_pept        complement(11261..11524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52972"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9S9"
FT                   /protein_id="BAF52972.1"
FT                   /translation="MKGLSAENVLAIADEVCAEHGVVVRDFAALAAAAAVSTANFHGVR
FT                   VFGSAEAMAGKVSEMIRALKPLSGRNETFAAVTQRVLLEINK"
FT   CDS_pept        complement(11521..11730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52973"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T0"
FT                   /protein_id="BAF52973.1"
FT                   /translation="MAMTLRLNDAQDRALTLLARTQGCSKQEAATRAIIAAASRAVDDA
FT                   EIAGLARTMLHEYAGVEKRIRQAR"
FT   CDS_pept        11832..14402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52974"
FT                   /db_xref="GOA:A4Q9T1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T1"
FT                   /protein_id="BAF52974.1"
FT                   /translation="MSDDNTGQFDRVNPIDINEEMQSSYIDYAMSVIVGRALPEVRDGL
FT                   KPVHRRVLYAMFDNGYRPDRSYVKSAKPVADTMGNFHPHGDTAIYDTLVRMAQPWSMRY
FT                   PLVDGQGNFGSRGNDGPAAMRYTECRMTPLAMEMVRDIRENTVNFSPNYDGKTLEPDVL
FT                   PSRVPNLLMNGSGGIAVGMATNIPPHNLNELADAIFWLLENPDAEESEALEACMKFVKG
FT                   PDFPTAGLIIGDKGIHDAYTTGRGSIRMRGVTSIEEEGNRTVIVITELPYQVNPDNLIS
FT                   NIAEQVRDGKLVGISKIEDESSDRVGMRIVVTLKRDAVARVVLNNLFKHSQLQANFGAN
FT                   MLSIVDGVPRTLRLDQMLRYYVAHQIEVIVRRTQYRLDKAEERAHLLRGLVKALDMLDE
FT                   VIALIRRSPTPDEARTGLMSLLDVDEAQADAILAMQLRRLAALERQKIIDELAEIELEI
FT                   ADLKDILASPERQRTIVRDELTEIVEKYGDERRSQIIAATGDVSEEDLIARENVVITIT
FT                   STGYAKRTKVDAYKSQKRGGKGVRGAELKQDDIVRHFFVSSTHDWILFFTNYGRVYRLK
FT                   AFELPEASRTARGQHVANLLEFQPGEQIAQVIQLESYNDFPYLVLATAHGRVKKSRLLD
FT                   YESARSGGLIAINLNEDDRLIGAALCGEEDDLLLVSEFGQSIRFTADDEQLRPMGRATA
FT                   GVKGMRFRDNDQLLSMSVVRDGEFLLVATSGGYGKRTPLEDYSTQGRGGLGVVTFKYTP
FT                   KRGRLVSAIAVEEDDEIFAITSAGGVVRTEVKQIRPSSRATMGVRLVNLEEGVELLAID
FT                   KNVEDQGEASAEAVAKGAVEGPASKTAAEETDSVDNGSDENGEE"
FT   CDS_pept        14406..14750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52975"
FT                   /db_xref="GOA:A4Q9T2"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T2"
FT                   /protein_id="BAF52975.1"
FT                   /translation="MASREVSITRISPLSTFRVALAMSIIGLVAWIICVTVLYFGLNVA
FT                   GVWQNFNDVIGGVGAEQTITFGLVLSISALLGAIGAITVAVLAPLCAIIYNSIVDLFGG
FT                   LKIQLQEEVD"
FT   CDS_pept        15244..16440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52976"
FT                   /db_xref="GOA:A4Q9T3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T3"
FT                   /protein_id="BAF52976.1"
FT                   /translation="MYGLFGFSLSAAIAAWTGVAIPWWIVGLVGWVFVALMGVSNVELS
FT                   AKVLGVLVALEFLVAIVVMIVALIHSPEGISTATLHAEDFFVPGIGVLLAFSIAAFMGF
FT                   ESGAIYSEETKDPSKTVSRATYIAVGIIAIFYAASTWALAMGVGPSAIIDESRIYGPDL
FT                   VFVWLASFSPALSNVAHLLFVTSILAALLAFHNAAARYFFALGRSKVIPSVFGKLGKNG
FT                   APIGGSIAQSVVGLVVVIVFAIGGANSTLGELFPVTTLFTWFSTAAAFGLVFLMAITSV
FT                   AVLFWFRRNHHGYGVFTRVIAPGAAALFLVVIAVLILMNFDIMIGEESPRAMIFIMPGI
FT                   IIGTGVLGALWSLRFDREIDVNAIPIAETAVVDESGTGSNAGSNAEDTQASSPAHTTI"
FT   CDS_pept        16467..17780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52977"
FT                   /db_xref="GOA:A4Q9T4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T4"
FT                   /protein_id="BAF52977.1"
FT                   /translation="MTKKVVVVGAGFAGLVAARELQMFGIDVEVVEARDRVGGRAWTEN
FT                   RLGADLELGATWVHWHQPHTWSEITRYQREIYQSPECEEAYWLTGGQVKTGTEAEMDGL
FT                   QLRGMEKIFEGSRTFFPDPYNQLAALDDPSMRDAFIAADHRSPIDELLSDPSFTQEEID
FT                   LCEAFWSGGYIGDPRQGSALMAKHWASLSSHSMEEMVEQQLKYKLKGGMKGLYENIAAD
FT                   LTCPVHLSTPVTAIKHTPNESVVTLQNGEKIECDAVIVTVPVGALDTISFDPPLPPAMR
FT                   KVVDDKWNSTGAKIWIKVEGHHSMAAMAPQPAVANVLKSEVFTDDGSTIIVAFGAFHDK
FT                   FNLEDPECGQHIMNQWRDDLKVTACTGHDWVADPWSGQAWASLKKGQFTDSWHHFHETG
FT                   TRLHFAGSDWARGWRGVVIDGALEMGIRTARDVAKEIL"
FT   CDS_pept        complement(17786..18712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52978"
FT                   /db_xref="GOA:A4Q9T5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T5"
FT                   /protein_id="BAF52978.1"
FT                   /translation="MESIQAYNFTQWRQIVASSFHNVRAAAPAPNFRATAHHKHVGDIE
FT                   LFDMITDPHTVIHTEGDGSFPLSTMCKFSLQLEGVATLVQDGRSCTMSPGDLALYTGKR
FT                   PYHLVFDEPQRSLVVYFPRSLLQLRDDQIDMITATPISRDEGLGKIIIPLFEQFARNLD
FT                   DLQGLHAQSLIRASLDLLVTVFAEHTERMNGELEDSSQLFRRATSYIDENLHDLDLAPG
FT                   TIADALYVSVRNLHAHFSSQGLTVSAYIRARRLNAIHADLGNPQMRDFTIQSISARHGL
FT                   VDASYVSKAFRAEYGESPRTYRTRTLT"
FT   CDS_pept        18907..20316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52979"
FT                   /db_xref="GOA:A4Q9T6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T6"
FT                   /protein_id="BAF52979.1"
FT                   /translation="MSDQLLSIVGVGKEEGRPIENPATGDVIGYAPDHTADDLDAAVGG
FT                   AVEKQPEWARLGHSARSNYLNKMADAIDAHAEELAQLLTLESGKPLNGPNSRMEVSMCG
FT                   DWLRANAEFETPSEVLVDDGEARAVLEYEPIGVVGAISPWNWPMMITIWQIAPALRMGN
FT                   TVVVKPSENTPLSVLALVHVLNTVLPEGVLHAISGGREVGARMSEHAEIGKIMFTGSIA
FT                   TGRAIAAASADTLKRLTLELGGNDAAIILDDCDPAAIAEDLFWGAFINTGQTCAAVKRV
FT                   YVADNIYDELCQALASIAQAAPMGPGTDENNVLGPLQNKGQRDIVAKLVDAARDSGAQI
FT                   LTGGQPSDGPGNFYPATIVTDIAPDNPLVVEEQFGPALPIVRYSNIDEAIGWANGLEVG
FT                   LGASVWSADRNRAMDVARQIQAGTVWINNHARPDPRIPFGGIKQSGYGLEFGADGLKAV
FT                   AVXKGLQRLIV"
FT   CDS_pept        complement(20826..21863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52980"
FT                   /db_xref="GOA:A4Q9T7"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T7"
FT                   /protein_id="BAF52980.1"
FT                   /translation="MSTNLLESTPPFTQLRTGVLQKYTPGLLLCSIAVLIAMIVNHFFS
FT                   GVSPLIVAIILGIILTNLIQLPASISPGITLASKKLLRLGIVFLGLQLVFSDILSLGFP
FT                   MLGVIVCIVAGGIFGTILMGHLLRMKPTQVLLIACGFSICGAAAVAGVEGVNDSEEEEV
FT                   VTAVALVVIFGTLMIPFIPFATKVLGLSPEIGGMWAGGSIHEIAQVVAAGGIIGGGALG
FT                   VAVVVKLARVLLLAPIAAILSFRQRRQGYTSPDGKRPPVVPLFILGFLAMVVLRSTVAL
FT                   PDEVIAAGGFLQTALLSAAMFGLGCGVKIQNLIHVGVKPFILAFGSTTLVTSIALAGTL
FT                   LTHLG"
FT   CDS_pept        21934..22830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52981"
FT                   /db_xref="GOA:A4Q9T8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T8"
FT                   /protein_id="BAF52981.1"
FT                   /translation="MDNGWPNLQTLALFVAIVEEGSLGAGARKVGMAQPNASRAIAELE
FT                   ADMKAELLVRHPRGSHPTAAGLALIEHSRNLLQSVQEFTEWVTEGRTEQPLKLHVGASM
FT                   TIAEALLPAWVADMRARFPASRVDVSVMNSSQVIEAVQKGHLQLGFIETPHVPVRLHAR
FT                   VVQEDKLIVVISPNHEWANRTGKISLRELSETPLIVREIGSGTREALQELLADYDMAEP
FT                   IQVLNSNAAVRVVVEAGAGPAVLGELALRDHLALGRLLSVPFEGSGVTRPLTAVWSGPR
FT                   RLPILAGELVSIASNHI"
FT   CDS_pept        22871..23293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52982"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9T9"
FT                   /protein_id="BAF52982.1"
FT                   /translation="MTIMNEIPEWLTLVSVEAGKRLGLPGPLVFPPELITLAVEGIELI
FT                   ELEPSWTSDLPLPEFAFLAADMVDFYDDYEFSEWIPGAWPLALDGGGGFFCLDLRAANA
FT                   DGEIPVVWVHASNLGWGDDEAVRVAASLADLLSPSK"
FT   CDS_pept        complement(23476..24348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52983"
FT                   /db_xref="GOA:A4Q9U0"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U0"
FT                   /protein_id="BAF52983.1"
FT                   /translation="MDVGLVTAFLGGTLALLSPCAALLLPAFFASSVGAGPRMILHGVV
FT                   FYAGLLVLLVPLGLGAGILGELFITQRQTIIVVSSIVLIVLGIVQIFGGGFDFGKALPG
FT                   LGRLQSKATVSSGLGKSFLLGMTSSIAGFCSGPILGAVLTLAATSGNFITSALILSAYG
FT                   AGMVLPLMAIAALWAKLGQRGQQVLRGREFTFLGRKWHIVSVISGALIIGVGILFWTTN
FT                   GLVSMPELVPMDTQIWLQEATFSLGSPLFDIAVIIVAAGLFLYFWNKRQKRKEEAQRPK
FT                   ESGWVINPR"
FT   CDS_pept        complement(24352..25098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52984"
FT                   /db_xref="GOA:A4Q9U1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U1"
FT                   /protein_id="BAF52984.1"
FT                   /translation="MNQQSKKWLVPTLVVIIAVLLIAVVLLMYRGNASETAEGAAATAP
FT                   AGSDSGSASGTDSGSGAADSDLTSVEARDPSDPVAVGDVNAPVGLVVFSDYQCPFCAKW
FT                   SDETLPQMMKHVEDGNLRIEWREVNIFGEPSERGARAAYAAGLQDSYLEYHNALFANGE
FT                   KPSEELLSKDGLIELAGELGLDVSKFTEDFQSPETAAAIAQHQQLGIDLGAYSTPAFLL
FT                   GGQPIMGAQPASVFEAAFEQALAAKE"
FT   CDS_pept        25336..25707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52985"
FT                   /db_xref="GOA:A4Q9U2"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U2"
FT                   /protein_id="BAF52985.1"
FT                   /translation="MNIEQGIPTLGPLEEQVMHILWDRGQLTVREVIEFLPGDPAYTTI
FT                   ATVLRHLGRKGMVTIVKDGRTARHSALMNREEYTASVMDQLLSTSRDRSASILHFVDSI
FT                   TDTDRELLLEYLQQQEGRK"
FT   CDS_pept        25704..26702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52986"
FT                   /db_xref="GOA:A4Q9U3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U3"
FT                   /protein_id="BAF52986.1"
FT                   /translation="MTAASALTAVLIIGISLAVIGFFGPALLRHAAPALAKTPRLAVAL
FT                   LVGGILIWPTTLLALSLALAWVLAGPALLPEKAALVCEQCLTAANPFSVESIQTALPTV
FT                   LLLVIPTVIAAMCTVGIAAQFLARVRCSRSTAARVQHEAYRRPLLGYDVSVVQDHRPWA
FT                   LTFSPRLGGIALSSGAIDQLADDELAAVLAHEQAHMDQRHHIVTALADSIAAQLRWVPF
FT                   IREAAEILPDYLEIAADQQACRKVNITALVRALLVLGEKKIPTGTIGSAAGTLFAAGPG
FT                   RISHLVGSSTGRKGYVPALAAGSQILLLGTVSVIVLLSYAIALLTGCSLPS"
FT   CDS_pept        27029..28984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52987"
FT                   /db_xref="GOA:A4Q9U4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U4"
FT                   /protein_id="BAF52987.1"
FT                   /translation="MFLSAYRAPIAAGTAEAAALAGVSVAQAQENISQFNIANITDFHG
FT                   YISATAAHPGAAMLKCAVDEAAGGRAQAFVSSGDNIGGSPFQSFILGDEPTLEALNQMG
FT                   LDYSAVGNHEFDKGYADLSGRVADIADFDYLGANVDGENPDLAPYGISELDGVKVAFVG
FT                   TVSQETPMLVNSEGIEGITFTDPLEATNRLADQLVESGEADVVVALYHEGITGTEAWSE
FT                   NIDAVFAGHTHQVRDLGTDNGPLIMQCGNYGHALADVDFSFNHDTGELTVDDARMLGVA
FT                   DINACGNPDGTLAGIVAQAELDAGEAGKEVVATIDGDFLRATDEGAESGSNYGAESQLV
FT                   NMIASAVRWSMSTNTATTADIGLMNAGGLRADLFGGEVTYAEAFEIQPFSGEDSFVTLK
FT                   GSDFKDALEQQWKEDSARPVAALGVSDNVSYTYDIKRPIGDRVTSVTIDDAPLGPECDY
FT                   VVAASLYLLSGNEGMTALTRGTAPAQTGIVDVQSTIGYLANNVVTPRTGQAQISITPSG
FT                   DFNAGETVTLDLAGLRYTQGDTAKEVTVSLGDAIDSAPIDPQLGAAGFGEAGIATVSLE
FT                   IPAALSGTQNLVVTTDAGTRISMPVEVVGAEQPAPQPAGSSVLGTGILSGILGMVGLGN
FT                   WIDPSFIQHIQQQLFA"
FT   CDS_pept        29651..30901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52988"
FT                   /db_xref="GOA:A4Q9U5"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U5"
FT                   /protein_id="BAF52988.1"
FT                   /translation="MENTNVSSTEYEESEHEETEHEEPGKSPTHAKHARAIDLKPQKRI
FT                   EGLDIARGFALLGMITVHLIPWDIEIGVSVFHDLFSGRAAALFALLAGISLALITGGST
FT                   PHTGKKLRRDRIAVVTRGLILLIFGLALNSLTPGDISILPYYGVFFLVGSLLIGLHTRT
FT                   LAVLTGILIVAGPAVVHMALWVEGFDSVRSSTLPEFFTSPLNTVFSLLFIGFYPAATWI
FT                   TFVACGIALGRIDVQDLSVQIKLMFFGGLTAVCSALASEVIVYHFGVLDRIIEATPWEY
FT                   SDIMFALDYGGETVPGYSWWWLMVDNPHNNTPFSLLDAGGSAVFMVGLSLLASRVLAKE
FT                   LSPIAAAGSMTFTLYTAHLLALKIDHSELQIMWVCINITVAIVFAYFWKKHIGQGPLER
FT                   LISSASKSTARAVVPRV"
FT   CDS_pept        31102..33330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52989"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U6"
FT                   /protein_id="BAF52989.1"
FT                   /translation="MNSRDVKKPNYLFVNENIGGHRTVHRSLRKILADREDVTVEFIDG
FT                   EDPGFVGKVLRAPIPGLSKLDMDFQPLRGQLVHSFNLRRRVRKRLKQGGVDAMHVYTQN
FT                   GMLGGAELLRETPSVITTDSTGRLNVFSVPYRTPTRFTSPLSKVNPIFERPVLKAASRV
FT                   FACSNAVETSLTSSDYSMTLQQVERLEMGVHSPYFTDPLPPRDPAKRPVIVFVGTSLER
FT                   KGGSLLLDVWREQLRDRADLVLITLETPPAEEGLTVINDLQPGEDRLWDLLAQADIFCL
FT                   PSLIDQAPNAILEAMAASLPVVAHPNGAIPEMVIDGETGFLVDASKPEPVAEALNKLID
FT                   DPELRATMGAAGYRHAKDHYDMSSSVETILAALHHATDIGARPNDNDMVFELHEEVDDD
FT                   LLKQWMELATVHSTRFASRPSYVLNWFEFLGKGQMAIATVHREGQLVALLPLHSRTRLG
FT                   VSVYRLAGHGLGTIGEALSADPQALKALVEGLYERKLLLALTHLPENSALVQALIDHGG
FT                   WTLNHNVDDVCPVTDLPEGTTAVDLRSARSLRRLRNARNKSAKDAGEVTFEVVDSPERF
FT                   IEVWPEIVSVAAVAEADEQVARLNLTAGVHGNFTRAFLFEEAQQGRLRVLLLRVGGEAK
FT                   AFEIMFLSGTYAESWLTRFDPEQRGLSVGHQLIESTANDSETAGITVLDHMIGESDYKQ
FT                   AWETRTYQVGTVIAAPAKTAWFWLPLERLIRGTSELVYHKVQEWRERK"
FT   CDS_pept        33327..34814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52990"
FT                   /db_xref="GOA:A4Q9U7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U7"
FT                   /protein_id="BAF52990.1"
FT                   /translation="MTTAPAQSESRQLFSSSVAMIGGRLVSAGFGWAGSVIIARSLTGD
FT                   DWGRYSFVFALLGMLEIVTDLGVGRVVLARLTSNDRAETSKIAGSFFVLRAVLGVIGFA
FT                   IAVGYAWTIGLDPVVMAATMLAGTTVLIATPANALFVLYQSRLKLTYVALFDIAGQAAQ
FT                   FLLIVVVSLFSPTLIMFILPAVVREVIVFACRAFGIPKLLDPEFRPSFREPTAYWGEML
FT                   REAIPLSVGFALLHLLERIDMLMLQQMDTFDAVGKYAVGYKFSDLLGLAVSALAIPFTT
FT                   VLITAWPGKPEVFRARFRQAVLIAALLAGVAVVVFIPSAQAVITLLYGVEFESASLAAI
FT                   LLVVGAGFSGVTYAVVSSLIAAKKLRVFPIIAAAGLILNVVLNLILIPLQSIVGAALAT
FT                   VITESAMLVAMLLVLQWSLKVAQLIPWTIFIRMIIIVGVAVFLFTQLIDINWVLEVVGS
FT                   LVVFVAVWGVAERKTSAVVVDLIRNRFGTETEPADDH"
FT   CDS_pept        34804..35556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52991"
FT                   /db_xref="GOA:A4Q9U8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U8"
FT                   /protein_id="BAF52991.1"
FT                   /translation="MTISEFLQRRLTESGVVLAYHDIIDDSASIYPYAVRESTFRAQIN
FT                   LARRLGFEFIPLSSLVEALLSRASVSGKAALLFDDALRGVHLRAMPYLSEESIPWSLLP
FT                   VVDRLGVFPDWWEPADRTMTLDEVLEAVDSGAQLCGHTATHPSLPKLDDVSMLMELQHS
FT                   REKLSDWGNREVLDMCYPFGHQDARVRKLAREAGYRSGWSFTNGRCHPADDPFSLARMA
FT                   MREDMSGARFAKFLLRPRWTWPAVEELS"
FT   CDS_pept        35553..36893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52992"
FT                   /db_xref="GOA:A4Q9U9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9U9"
FT                   /protein_id="BAF52992.1"
FT                   /translation="MIGFLTALLLAGLIFLVSLQRPQWGLLIVATLVPFHGLLLIAPVT
FT                   ASWWKEAAVLAVVAGALFAPRERDRVAVLPWLRPALVLVAVGSASAFLVLGEQAAFPIK
FT                   IAFFYIIPAVVIYCHPFTRADKDLLVTLLLSTGAITAAYGLWQQIIGGWALADLGYEWN
FT                   EAIRHAGPLLRSFGTFNQPFPFAFFLMLVLVVGFAAAIAQPRRFRSKLYWWLSPFLLAA
FT                   MLSSVVRAAMVGLVVALIVLGIVLYRRLLALLAVLAAVVAMLLPLALLLDPGGAVSTLF
FT                   SATSLEDRGGHWSDRLPEMLVQPFGTGLGTTGSAAERLHNWGSPVAAAYQPDNQYLKIG
FT                   LELGIPGVVLYAVVVIIAAVVLIRLISVHTDALEQAITAAALAMTLAACVAGFFSTYLE
FT                   IFPLDFYFWFLLAVGASVPASTKAQVVFWQKSPEFSTANESEKVDDH"
FT   CDS_pept        36883..38031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52993"
FT                   /db_xref="GOA:A4Q9V0"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V0"
FT                   /protein_id="BAF52993.1"
FT                   /translation="MTIREVETPARPVPRPLDLGLLWGAFIRSLPIALLIGVLAGGATY
FT                   FIQDGEPPVYEVTSTVSLGVLSDADIPDWIVARAEPVYLSMAQDRETVEQVSAVTGVPD
FT                   PVISAESGAVQGVILISAEASDVAQARSLVDETVITLIRRSARMHETAMFAASTQSEQL
FT                   TAPLRAQIAARQLEDPLADISDLEWEIQLIAREIETSIPEVVPPVQVSQTDNDGKPIRP
FT                   QPLNTALVGGMAAGLIALLPLIWWNFSNPRRVGRMWLRSLRNRYGVDTEAASFARSISP
FT                   LAEARAVQTLSTSGTVLLLGQMGSLSELEGSGRIYQADWFDPWWREVPPNEVGLAIVTV
FT                   EKRSKKLRDIEKLVAHLTGMGIPTMVAFNNKEENNGSHSDRS"
FT   CDS_pept        38006..39124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52994"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V1"
FT                   /protein_id="BAF52994.1"
FT                   /translation="MARIAIAHERWTDIAGSEQVTQQLTKTWSETSVHVPFAKKSLIPE
FT                   DLRDSFHISPLQVAYQLIRQRTYAPLLPLVPPAMQWGSLRQAHDVDAVVVSHHAFALAA
FT                   VGAAQAINKPSVAYVHSPARWAWDARFRQEEEHSRAGKAALSVLSARARANETRWAPHV
FT                   TSIMGNSSAVVKRIEQHWNREAQVVHPPVDTEFFHPDEAIEKGDYFISVGRLVPYKQVP
FT                   LGVAAAVAAGVRLVVVGDGRDMDRARAFAGPNVEFKGRLPGDEMRDLIRGARALLMPGE
FT                   EDFGIVPVEAMACGTPVIALGKGGALDTVKPGISGELFSGDGEKEVIANLAEVLKNFDD
FT                   SRFNISTLRNWAEGFSEAAFREKMAEVVDAVV"
FT   CDS_pept        complement(39121..40152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52995"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V2"
FT                   /protein_id="BAF52995.1"
FT                   /translation="MTSIVFGALALRPHGSGVQTYQRELIHALTKVEGLPSFSAVVQKD
FT                   SVGALPPEVKPVTRPVGSGTRRAVEGLRPVPATLFHSLDVDLPLAQKGLTVSTVHDMSA
FT                   FDTPWAMSKFRARGEQLLLRRSLRRADAIIAVSQFTAERIKALTGRDSTVTPLAPATWT
FT                   HIPDEASVNRVREKYNLPKRFVFQLGTLEPRKRPDVVNDALRGLGVPLVLAGGHTDGLK
FT                   RPAGAIGLGYVDREDIPALYRAASVVAYASSYEGFGLPPVEAMACGAVVVASAVGGIPE
FT                   AVGSGACVVKRLRTSEWRASLSAALNDAAFRSSLLDDATLQVASLNWQATARSTAQVYA
FT                   EML"
FT   CDS_pept        complement(40149..41435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52996"
FT                   /db_xref="GOA:A4Q9V3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V3"
FT                   /protein_id="BAF52996.1"
FT                   /translation="MDTVAIFLSAWIVDIPSPWITALVMVIILQVLPDFYRHRLNLSLL
FT                   NALPTVVPRALIVGFFAYIVVNPHVDARDSFDFIVVSTIGLIISWALSFAAIRSWRRHA
FT                   PISLHRTLVLGSADDSIEIVTALKENPQFGLSPVAVIDLESQAASDEFPEVETEYFSDN
FT                   LTELLQRHEADVVIVAPNQHSEEFLLSAFRASLRDPTTFYVVPALPLQGQRHDTEELGL
FT                   ISLRPVKRSAYRSFWWLLKRPIDVTLSLIAMLLLSPLMAVLAILVKLDSPRNPLLFRQT
FT                   RIGLDGKPFELLKFRTLTPATVNESDVTWNVSHDDRLTPLNRIMRKFSLDELPQILNVL
FT                   RGDMTLVGPRPERPHFVEKFGADYPIYHDRHRVPVGLTGWAAINGLRGDTSIKTRAEYD
FT                   NWYIEHWSIWLDVKILLLTVRAVLKGTGG"
FT   CDS_pept        42155..43027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52997"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V4"
FT                   /protein_id="BAF52997.1"
FT                   /translation="MGLPFLWFFSAKEIRKISADADTIIVNSTFALPAVGLAFPMHGRK
FT                   RGGPVISWLVHDTITSLKQRVVAKLGAHSITRAVAVSEVTAASVRPFVGTVLVQPNGVE
FT                   VPSEVVAVKHSQVPTIGILAVITGWKGHDVLLEAVALLPDVHLDIAGEVFAGSEDFEAA
FT                   LRERASQPDLQGRVHFLGHVNKQDVFPQWKALISASTSPEAGPLGVLEAMAYGVPVVAT
FT                   NHGGAAEYLRDGAGILVTPSDPQDLANGIRRILENPEQTAQIIAVARERIIEKHNLVHT
FT                   RERMLEVLS"
FT   CDS_pept        43027..44136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52998"
FT                   /db_xref="GOA:A4Q9V5"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V5"
FT                   /protein_id="BAF52998.1"
FT                   /translation="MGFLHPRYLAWRATLLTLLVIALVGGVVGRVVVVSLESNEAMVKD
FT                   KALDRCDSLGIAGPMSWENMTSEEFHVMVNEMADIGASWIRIGVIWRDVEPSSGNFKWD
FT                   DLDERLQLAVDAGLRPLLLIHTTPSWIDDVGEVGNGTAQEYARFSGEVAKRYHDQAEGY
FT                   EIWNEPNLDRFWPKPSPESYAELLTATAPLLRQIDPDAEIVAAGLAPAASIEEYSVTIE
FT                   DFLRGLYDLDALQDVTAIGIHPYSYPEMPSGTSSWNTFAQLPRIQAIMHSYGDREREIW
FT                   LTEYGAPSEGNGGVGLELQSDMIVEALQMTEDGDNFGPIFIYTMYDIDFDPEDRESHFG
FT                   LLYGPGDPKPAFLALSDATKRCSLLSDLE"
FT   CDS_pept        44709..45146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAF52999"
FT                   /db_xref="GOA:A4Q9V6"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V6"
FT                   /protein_id="BAF52999.1"
FT                   /translation="MAIESIAYTTEALSTGSGRLGQVRTTDGALEFDMTPPKALGGSGE
FT                   GTNPEQLFAAGYAACFHSAMHSVARSRKITLEDTAVGARVSIGPNGAGGFEIAVELEVS
FT                   IPHLPLAEAQELADAAHQVCPYSNATRGNISVTVSVIDEEA"
FT   CDS_pept        complement(45296..46819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53000"
FT                   /db_xref="GOA:A4Q9V7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V7"
FT                   /protein_id="BAF53000.1"
FT                   /translation="MGLSEPDFTPVEGFDSQASIQFIRAGLNPQDRDALKVEPVPHHEI
FT                   HEMTVDGAEVVLVSVSPLAVNGPCYYLPGGIINGSFKRVGDEDRKLSHLEIYELQNRFV
FT                   QTKTDRNPVPDSSINDLNNQLVASFKQRLVETGSRSLGTDDNWLLRKNITTPIGELTIA
FT                   GLLALGSYPQQFFPRVIIDVAVHPGLHKSPIGTSIRFEDRKICEGNLLEMVQEAMTAIK
FT                   RNLRVRRVVEGLSGKDVLEIPEEVLREALANAVLHRDYSELAQNEAIHVDIYKDRVEIT
FT                   SPGGLPNGKRPESILDGYSEPRNRVLSRILMDIPWTHEVQGVLAESNGTGVPRMFNLMR
FT                   EAGLPVPNFKIDISSVTVELSRHGLLDTQTNEWLVEKLGSDFSNTQGIALVLAKELGAV
FT                   TPRDLRNQTGHDSEDMRSLLDALVDRGVLNQNSQNQYQLATSSVNVTQSEQEVLDAINK
FT                   TTPVTIREIATKTGKTASSLRPLLRGLVEAGLVVATAPPSSRNRAYLQA"
FT   CDS_pept        complement(47232..48512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53001"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V8"
FT                   /protein_id="BAF53001.1"
FT                   /translation="MKNSKLLLIAAVSTASILLASCGTDSSADTATASSSATASSEAHD
FT                   HDGHEAEGSSTAVEVSSPQARIVTTYDSGIITLDANTLEVLDDTELAGFNRLNSAGDGR
FT                   HVFVSTGGGFQLFDTGAWTEPHGDHTHSYTATPELTDITYSTNKPGHVVNHAGKTVLFG
FT                   DGDGKIQIFDTASLLKGDEVEPEIKNALEAHHGVAVVLENGDLLHTLGDEDSRNGAIVF
FT                   NAAGEEIARNEQCPGVHGESAALGDAIAVGCEDGVLIYKDGEFTKVQAPDSYGRIGNQS
FT                   GSDVSPVVLGDYKVDKDADLERPERVSLTNTETGELTLVDLGTSYSFRSLGRGPAGEAV
FT                   VLGTDGALHIIDANTGAITNTYPVIDAWTEPEVWQEARPTLFINKDRAYVSDPSNNELH
FT                   VVDLANGNILASATLPGTPNELTGVSG"
FT   CDS_pept        complement(48594..49550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53002"
FT                   /db_xref="GOA:A4Q9V9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9V9"
FT                   /protein_id="BAF53002.1"
FT                   /translation="MILKDIFNNGELFGASSAKNFRKLLAVPAVAASLAFGITACSAVD
FT                   DTPDIVVTTNILGDVVSHIVGDSADVQVLMKPNADPHSFGVSAQDAAAMEHADLIVANG
FT                   LGLEEGLQSNVDNAKNQGVPVLEVGEHIDVIDYSPGVPDPHFWTDPARMIVATEVIEAE
FT                   LIKELDPSLTESITQSAQHYREELVALDEEVTELLSSVAPENRKLVTNHNVFGYLANRF
FT                   NYIVIGTIVPGGSTLAAPSASDLNDISTAIEDNNVPAIFTDTSSPQRLAEVLASNAGID
FT                   VQVVSIFTESLTDADGEAPTYISMQKINAERIASTLS"
FT   CDS_pept        complement(49547..50398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53003"
FT                   /db_xref="GOA:A4Q9W0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W0"
FT                   /protein_id="BAF53003.1"
FT                   /translation="MKFFIDALIVPFDVSFISRALVAGCLAAILCSLIGTWVTLRRLTF
FT                   FGDAMSHGMLPGVATASLLGGNLMFGAAISALIMSAGVVWTSRKSSLSQDVSIGLQFIT
FT                   MLSLGVVIVSHSDSHAVDLTSFLFGDILGVRPSDIFIIAIATVLGGLTIFLFHRQFTAL
FT                   AFDERKAHTLGLNPRFTHLLMLALIALATVVSFQVVGTLLVFGLLISPPATAALLVQDK
FT                   ASISLIMIVASLLGCAEIYLGLLISWHASTAAGATITLLSAAIFFATLLTKSAISGLNF
FT                   TA"
FT   CDS_pept        50428..51087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53004"
FT                   /db_xref="GOA:A4Q9W1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W1"
FT                   /protein_id="BAF53004.1"
FT                   /translation="MAELSVRNLTCTYGNHIALNNITARFPTGKITALIGSNGSGKSTL
FT                   LETLAGTLQPRSGSINNLAPDIAFVPQRSHVSHNLPITIRQTVSMGRWSAKKNWQRLTA
FT                   ADRNIVDSCLDRLEISGLADRPLGEVSGGQRQRALIAQGLAQQAPLLLLDEPLAAVDSH
FT                   AASLIEDVINQQRNQGTTIILATHDLDQAHQADQIIALEKGIIKPQRKATESIKKR"
FT   CDS_pept        51130..52113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53005"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W2"
FT                   /protein_id="BAF53005.1"
FT                   /translation="MKLPRLAAALIGAALLITGCSATGGAPRATDGASGGGTVDTPRLV
FT                   VAMVSHGAPGDTFWDLVRKGAEDAAQKDNVELRYSSNPEIPEQSNLVQNAIDSRVDGIA
FT                   MTMPNAQSLGPVAQKAVDAGIPVVGLNAGMNEYQDYGMTGFFGQDESVAGASAGARLAE
FT                   ENAQKVLCVIHEQGNSSQEARCGGVSEGLGKQVETLYVNGMDLTSVNSTLQAKLAQDRS
FT                   IDWVVGLQAGVSMAISDAADAANSEVKIATFDTNAQLMTAIRDGKIQFAIDQQPYLQGY
FT                   MAVDSLWLAHRNGTTVGGGRPVYTGPAIVDATNVDVIAEAVGEGLR"
FT   CDS_pept        52110..53135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53006"
FT                   /db_xref="GOA:A4Q9W3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W3"
FT                   /protein_id="BAF53006.1"
FT                   /translation="MTKIKSGEASTSIVERALKRPELTSLLGAVLVFTLFMVVAPAFRS
FT                   WDSMATVLYASSTIGIMAVAVGLLMIADEFDLSTGVAVTTAALAASMFSYNLWLNTWVG
FT                   ALIALVISLAIGFFNGFLVVKTKIASFLITLATFLMLQGINLAVTKLISGTVATPTIAD
FT                   MEGFPSARAVFASSIPIFGVNIRITVFWWLLFVIVGTFVLFKTRIGNWIFAVGGDEEAA
FT                   RAVGVPVRGVKIGLFMFVGFAAWFVGMHNLFLFDSIQAGQGVGNEFLYIIAAVIGGISM
FT                   TGGRGTVVGTMIGALIFGMTNQGIVYAGWNPDWFMFFLGGTLLLAVLLNHRFERFNKER
FT                   S"
FT   CDS_pept        53132..53893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53007"
FT                   /db_xref="GOA:A4Q9W4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W4"
FT                   /protein_id="BAF53007.1"
FT                   /translation="MTDLIQLREVSKKYGAFQALNDINLSVRAGEVTCVLGDNGAGKST
FT                   LIKILSGLHPATSGEVIVAGDVVNFGSPRDALDAGIATVYQDLAVVGQMSVWRNFFLGQ
FT                   ELTGRFGVLKQEEMRRITDEQLREMGIELRDVDVPVASLSGGQRQVVAIARAIYFGARV
FT                   LILDEPTAALGVKQSGMVLRFIAAARDRGIGVIFITHNPHHAYLVGDHFILLNLGKQVM
FT                   DKSRAEVELEELTLAMSGGGELDSLSHELKR"
FT   CDS_pept        complement(53895..54725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53008"
FT                   /db_xref="GOA:A4Q9W5"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W5"
FT                   /protein_id="BAF53008.1"
FT                   /translation="MNMSTIGNLKLVVDGARKAYGTYADYRDRKVSETYEALSHAAGEY
FT                   APKAEQAVETARESAKEFYAESRDKAGNVTKAARARLEKALAEAEKQGTSALKDTRESG
FT                   KKLNRKARRKADKAAKAARKATEKKESHWVRNLSLAALATSGIVAVAYAFLNKTKKETP
FT                   GTQPPRVEVQLKKAVEQDEPEVVAEAAVEEPELVYSTESPETTEAPAEATETPAETTEE
FT                   EAKTEAELEAEFEAELEAEADAEQEAAEEAEAEAIQAEFDKKNAPQRTQSEKKK"
FT   CDS_pept        54774..55346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53009"
FT                   /db_xref="GOA:A4Q9W6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W6"
FT                   /protein_id="BAF53009.1"
FT                   /translation="MGHVVGISLDVVMMGVMTSKTATAILHTNRGDITIDLFGNHAPET
FT                   VANFVGLAQGTKEYQAQNAQGDSEGPFYNGSVFHRVIDGFMIQGGDPTGTGRGGPGYTF
FT                   ADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTPTPHLNNAHTIFGEVTDAESQKVV
FT                   DAIATTATDRYDRPADAVVIESVEITA"
FT   CDS_pept        55426..56115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53010"
FT                   /db_xref="GOA:A4Q9W7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W7"
FT                   /protein_id="BAF53010.1"
FT                   /translation="MKDELKIVGFMNVERIYRQAPASTLISLAIIAVYAVTAIQSRSVT
FT                   DNLGSTSIGDAWILYAPLMDDGGFGPLRAIGGIFLHIGPGHMLLNLVLLWLLGREIERD
FT                   FGSALFTAMYFVGGIGASAAVIWMDPYSPTAGASGAIYAMMAILVGLFVLRSADIRAPL
FT                   ILIAINIAYTLMSTNVSLWGHLGGLITGALITWPMVKAKNKRTRWIIVLIGLAVVVVAV
FT                   ILGIDRV"
FT   CDS_pept        complement(56688..58112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53011"
FT                   /db_xref="GOA:A4Q9W8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W8"
FT                   /protein_id="BAF53011.1"
FT                   /translation="MFLNRHVVTITPNAVLIWVYSGQVRITNGSTFELSAAHGILIPAG
FT                   SDITIEYSEDSLVIPIQLPNQCRPNLGVLRIPDDAHNRLMYAFAQGLGYLKENPESDAF
FT                   LVDLVEAVPQQYSITPSKPHSPEALKASQIIIDDPATTVPIAEIVHRVGLSERTLQRRF
FT                   FDETGLNISTWRTRTRLSLAVAYLSDGHSAEWAAHHVGFSGASSLSKAFRTHMVISPSQ
FT                   ILTLPQPEHLDPPLPLLGSLEIPANETWSRINGSHIMVWAFQGTSTVRVADRELTVHQG
FT                   EGLILPAGMRLDLHTPAGGLMLPLGYQVPDSHSISAQHVDIIQFDCSIQQLLQCTISAY
FT                   TPFHPHKAAPDQCFSLPFQKSSTKNTENAPTESHNDELVSLAVDLAVSRETNVSAIRGG
FT                   IAEEFAHITGIAVQRWGLLRRMSLARIQLSKGLSPGVVARNLGYSHLPAFNRAFTATHG
FT                   CTPMQYQADCARIPTP"
FT   CDS_pept        58176..58607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53012"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9W9"
FT                   /protein_id="BAF53012.1"
FT                   /translation="MSRTLKLLAIGMVALFATGCSQSASEEADAPTTQSGEWPRTITHE
FT                   AGETVIPEQPLRIVSTSPSITGTLLAVDAPVVGTAAALVTSLSDDKGFFTQWADVADDR
FT                   HVEVVYPNLEIDLDAIDAFEPDLIIGSISGGDSVAAEYE"
FT   CDS_pept        58758..59039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6001"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK01"
FT                   /protein_id="BAQ21063.1"
FT                   /translation="MISLPEQPVTVLSYMGADGGWVLDAESQQALLLDSIGFDYVRCGP
FT                   QQVFARDALWYYCQRHMVRQQRRRPRRYRLTRIALLAGRGSESFSWTW"
FT   CDS_pept        complement(58879..59034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53013"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X0"
FT                   /protein_id="BAF53013.1"
FT                   /translation="MSMKSFQTLAQQAKQSWSDDTVAVDDAAASPYAADSNTRVHLGRT
FT                   LAEAHT"
FT   CDS_pept        complement(59134..59274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6002"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VM91"
FT                   /protein_id="BAQ21064.1"
FT                   /translation="MFCTFHGSKTVLLLGGYDKGKDPSPKRQQKEIQRAQKQLTQWRKS
FT                   L"
FT   CDS_pept        complement(59595..59867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53014"
FT                   /db_xref="GOA:A4Q9X1"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Q9X1"
FT                   /protein_id="BAF53014.1"
FT                   /translation="MPKARVTKNETAPVSSNPSANRTPVKINSAGTPMWYKVIMFAFMI
FT                   VGLAWLIVNYLVGPQIPFMADLGAWNYGIGFGLMIIGLLMTMGWR"
FT   CDS_pept        complement(59980..61932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53015"
FT                   /db_xref="GOA:A4Q9X2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X2"
FT                   /protein_id="BAF53015.1"
FT                   /translation="MTFVIADRYELGAVIGSGGMSEVFAATDTLIGREVAVKMLRIDLA
FT                   KDPNFRERFRREAQNSGRLSHSSIVAVFDTGEVDKDGTSVPYIVMERVQGRNLREVVTE
FT                   DGVFTPVEAANILIPVCEALQASHDAGIIHRDVKPANIMITNTGGVKVMDFGIARAVND
FT                   STSAMTQTSAVIGTAQYLSPEQARGKPADARSDIYATGCVMYELVTGKPPFEGESPFAV
FT                   AYQHVQEDPTPPSDFIADLTPTAAINVDAVILTAMAKHPADRYQTASEMAADLGRLSRN
FT                   AVSHAARAHVETEETPEEPETRFSTRTSTQVAPAAGVAAAGAGSGSGSGSDSRKRGSRG
FT                   LTALAIVLSLGVVGVAGAFTYDYFANSSSTATSAIPNVEGLPQQEALTELQAAGFVVNI
FT                   VEEASADVAEGLVIRANPSVGSEIRQGATVTITVSTGREMINIPDVSGMTLEDAARALE
FT                   DVGLILNQNVREENSDDVAAGLVIDQNPEAGQEVVVGSSVSLTMSSGTESIRVPNLTGM
FT                   TWSQAEQNLISMGFNPTASYLDSSEPEGEVLSVSSQGTELPKGSSITVEVSNGMLIEAP
FT                   DLARMSTEQAISALRAAGWTAPDQSLIVGDPIHTAALVDQNKIGFQSPTPATLFRKDAQ
FT                   VQVRLFEFDLAALVQ"
FT   CDS_pept        complement(61929..63338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53016"
FT                   /db_xref="GOA:A4Q9X3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X3"
FT                   /protein_id="BAF53016.1"
FT                   /translation="MSQEDITGKDRLQELIGADYRLQWIIGHGGMSTVWLADDVVNDRE
FT                   VAIKVLRPEFSDNQEFLSRFRNEAQAAENIDSEHVVATYDYREVPDPAGHTFCFIVMEF
FT                   VRGESLADLLEREGSLPEDLALDVMEQAAHGLSVIHRMNMVHRDIKPGNMLITANGIVK
FT                   ITDFGIAKAAAAVPLTRTGMVVGTAQYVSPEQAQGKEVTAASDIYSLGVVGYEMMAGRR
FT                   PFTGDSSVSVAIAHINQAPPQMPTSISAQTRELIGIALRKDPGRRFPDGNEMALAVSAV
FT                   RLGKRPPQPRTSAMMAQAEAPSPSESTAMLGRVARPATITQEAAPKRGSGIGIGLFIAA
FT                   LLAVIIGAVIYAGTTGILFNDTPEETTTPETITETYTPTVEETTSQWVPPTPPTRSTFT
FT                   EPETTSHRPTTSEESTSAEPTTEAPTSSRTVPQIPTSTPRTSASVPVETNAPADDLIDA
FT                   VNGLLDVGGAQ"
FT   CDS_pept        complement(63342..64766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53017"
FT                   /db_xref="GOA:A4Q9X4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X4"
FT                   /protein_id="BAF53017.1"
FT                   /translation="MNRSIRITSLFSLLLILVLVANLTWIQAFRDDDLAQNPLNARGFF
FT                   AAKSTPRGQISTGGQVLAESSQDNQGYYQRSYITNPTTYAPVVGYFSDVYGAAGLELGY
FT                   NSILNGSDSSLFTTQWLDVISGRPTHGANIELTLDPNAQQTAYEQLSQSGYEGAVVALR
FT                   PSTGEVLAMASSPSFDPNQIVNPATAEDAWAEYTSAEGAPLLNHATQESLPPGSIFKII
FT                   TTAAALENGYSADSTVTAEAAVTLPGTNTTLTNYGGQTCAGGGTTTLLTAFQLSCNTAF
FT                   VETGIDVGADALRASAEDFGVGQTYSLGLDNVPGGLGEIPDDAALGQSSIGQRDVQMNV
FT                   LQAAVMAGTVSNGGVRMEPYLVSRVTGQDLSELSTHKPKSVGGVEPEIAEQLKTLMEAS
FT                   ERNTSGYAGIQIASKTGTAEHGDENTPPHTWYVAFNNDIAVAVLVKDGGGFGTSATGGQ
FT                   VAAPIGRAVLQAAGGF"
FT   CDS_pept        complement(64763..66088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53018"
FT                   /db_xref="GOA:A4Q9X5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X5"
FT                   /protein_id="BAF53018.1"
FT                   /translation="MNTLERLKLRRTEMWLLILATLVVSIMFISLELAMGNELGTHILM
FT                   LMGGYIGIFIVAHLAMAWVAPFADQIMLPVVAVLNGIGLVMIYRLDEATGYSTVNSQLM
FT                   WTVVGVTLMVAVLLLLRDYKSLSRYSYLLGVVGIVLLALPLVWPQPGGVEARIWIWLGP
FT                   FSIQPGEFSKILLLLFFAQLLATKRALFTVAGYRFLGMDFPRLRDLAPILVVWALAILI
FT                   MAGANDFGPALLLFTTVLAMVYLATGRGSWLLIGAVLVAVGAFAVYQVSGKIQERVQNF
FT                   VDPVAHYDTTGYQLSQSLFGMSWGGITGTGIGQGYPNMIPVVHSDFILAAIGEELGLIG
FT                   LAAIIVLFGVFVTRGMRTATLARDSYGKLVASGLSMTIMIQIFVVVAGISSLMPMTGLT
FT                   TPFMSQGGSSLMANYILLAIILRISDSARRPVMSKQASEVAA"
FT   CDS_pept        complement(66085..67440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53019"
FT                   /db_xref="GOA:A4Q9X6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X6"
FT                   /protein_id="BAF53019.1"
FT                   /translation="MLKLKYAVASDRGLVRGNNEDSAYAGPHLLALADGMGGHAAGEIA
FT                   SQTMINHLRALDVDPGDNDMLALVGMVANEANTAIAEGIAEDPARDGMGTTLTAFMFNG
FT                   RDLAMCHVGDSRGYVLRDDKLVQVTVDDTFVQSLVAEGKLDPEDVSTHPQRSLILKAYT
FT                   GHPVQPTLEQFPALRGDRLLLCSDGLSDPVTHSTIEETVRVGTPQDAATKLVELALRSG
FT                   GPDNVTVIVADVVEVTKAEAAAEASVPVTAGALNGEQPEDPRPDTAAGRAAAITRRAQV
FT                   IDPAPKISDAGTEDIPTIEEPPEKSSSKLAVLIVALVILIGVVAAGWWGYSRIDSTFYV
FT                   AVNDEEAITVEHGVDYRIFGKDLHSQFQVACLNEAGTLSLKESCENGTSFKLDDLPASV
FT                   RGSVAGLPSGSYDEVQAQMQRLAAQALPVCVNLEVTTGGDRNEPGVNCREVS"
FT   CDS_pept        complement(67440..67904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53020"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X7"
FT                   /protein_id="BAF53020.1"
FT                   /translation="MDSLVLLGLRIALLVVLWFFVLMALRAMRADLKVTGQASTSSTSV
FT                   AAPQGLARAFNRSSPPRLLTVVEGPLAGSSIEVSEDMTMGRSPECTFVVGDDYASGMHA
FT                   RVFKRGSEWFVEDLDSRNGTFVGGTRIDQPEQIAVGTDIRIGRTTVRLVP"
FT   CDS_pept        complement(67921..68817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53021"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X8"
FT                   /protein_id="BAF53021.1"
FT                   /translation="MATSNRIANAMNSLAKLDSSMQRGLDNALAFVFRGRVVPAELEEL
FT                   LKQEAEDNVVHTEFGYVEAPNVFKVSVSPNDFSNLVDRFPDQPARFGDQMMRFCRNSGW
FT                   TLVGPVIVLIEEDSSLHTGQLKSVSEKDPDPELSSGYLPLEGDGILPVAESESKNVSDS
FT                   SPYTGTEFLPAQSADRPLVQGVPQSQVDASRQSALKPAGPTVTLLLQDGSSRTYLVREG
FT                   SNIIGRSNDADLRLPDTGVSRQHVEITWDGRDAILVDLKSTNGTTVNDTPVDNWLLADG
FT                   DVITVGHSNIEVRIVSP"
FT   CDS_pept        69130..70284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6003"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21065"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VPN7"
FT                   /protein_id="BAQ21065.1"
FT                   /translation="MAELADALASGASVRKDVGVQVPPRAPFKTTLLRKGGFCPFGLSS
FT                   VRTFGTKILAKWGSKSGNLGVEFTSAGKLGTFRPFQQSNLSMARRIWTYQQLIDSGKTK
FT                   RQIESLVHEQQLTRIFRGVYISGEVTGDSVWWALKSRRKNIALDGYSAIQSHLNQHLTL
FT                   PILIRVPTSSKSNITDAYVRQVRSTRMPNGQRVSFIDAIATCLDHNYFRDSYLHQIVEE
FT                   YYSGDYGAQNLKKHLAEIGGRDCTKLADFLAVATPGSDSELELILVRLLQRFGFKTEQN
FT                   TKIGGYKWDVCIRDLWVLIDIDSWKYHGGDNRTQFVLDRWKSNHAAAMGWTALRLTDSC
FT                   VGYDQVEIVDFLNRIREFREKAPNGRLKGVTSRPVWEWHSDLNI"
FT   CDS_pept        complement(70422..72176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53022"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9X9"
FT                   /protein_id="BAF53022.1"
FT                   /translation="MSKSSTSIKTITTDRTCDVLVIGSGASGLATALAAAHQGLDVIVA
FT                   EKEKYFGGTTAISAGWAWVPGNPKGAEATGDSREEVETYLKALAPEHYNEAGVSAFLDT
FT                   VPEAISFFENNTEVNFVYPEKAPDYQMDLPGARLSGRAILPDDADARMLGDRRRELQPY
FT                   LSSYTVFGYMPQVGADLNQVLHANRSIKSFLYVATKLTRTWFDTAIHGQPLKRTNGSAL
FT                   ITRMVKSALDAGVQIWTSTPVESLIQESDGSVSGAILGGVHSGKVKARMGVVLAGGGFT
FT                   GNTSLRSQYFPHDSHGTNHITPTVGHDGSSAEMAIQAGGRINDDLFAPGSWAPITAFKQ
FT                   LRDGRQRLFPHLRQIGLPGMITVDRTGKRFGNEALSYHDFGRQLLEHDKNHDDTYAWII
FT                   ADEACMHTYGIGYAKPWPIPRKYFHDIGFLHKANTLRDLAIKIGADPATLEATVNRFNG
FT                   FAEKGVDDDFGRGSTAYNHFRGDPEHKPNPNLATLEKAPYYAVKIQMGDLGSFAGIDVD
FT                   DHSTVIDTAGEPIRGLYSVGASAVSVFGGGYPGYGSHIGPALVFGYRMGRDIAKLSQET
FT                   STVKAESA"
FT   CDS_pept        complement(72209..73549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53023"
FT                   /db_xref="GOA:A4Q9Y0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y0"
FT                   /protein_id="BAF53023.1"
FT                   /translation="MASFLGSTLEYYDFFIYGTAAALVFPKLFFPDGNPAIATIAAFAT
FT                   FGVAYIARPLGGLVMGHFGDRLGRKNVLLVTLLIMGIASLSIGLLPTYSQIGIWATILL
FT                   VVARLAQGFSAGAEAAGASSLTLEHSPEGRRGFFNSFVMTGYASGMVLSTLVFIPVAAL
FT                   PEAQMLSWGWRIPFLLSVVVLIIAFWVRTRLDETPVFEDEVAEAGEEKKLPAGRVLKYQ
FT                   GGDVLRVLLMSIFSVMQTIFTVFGLSYATSHGGFERSSILAVNAIAIGLSMIMMPLAGR
FT                   LSDRIGRKPLMLTAMIGCGFTIFVYFLALGTGNILLVFGASFLFMTILYSGFNGVWTSF
FT                   FAELFAAPVRYTGMAMGNQLGLVVAGFGPMIGGMLLNDGTYGWIPVAVFGAGCSLLAIG
FT                   AVLSTRETAFTDIKLLGEPYLKATGAWPTQQAAQPAMSQTKEPAPSL"
FT   CDS_pept        complement(73641..73934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53024"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y1"
FT                   /protein_id="BAF53024.1"
FT                   /translation="MIRHVLMIRWKDSFTDDIRSKWVDGLEKLEANIPGLLKLIHGHDI
FT                   LKTEKSWDHVIIADFTSTEAIAVYNTHPLHEAIKPYSLPNAEEIAYVDFELP"
FT   CDS_pept        complement(73931..75580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53025"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y2"
FT                   /protein_id="BAF53025.1"
FT                   /translation="MKVLNAENLANHYDLIVVGSGAGGLTAAATAAHAGLSVLVLEKAE
FT                   LLGGTSAVSGGMLWVVDNHYAREAGFADSKQAGREYVEAVARGRGRAELLDAALLHGSD
FT                   MLEFIEDELDVKFLFLDNFPDYRQDLPGAVHGGRTIEPQLFNYREALGKLADYVRTDGR
FT                   HPYTMQEYETWGAFTKFPWDELNKRVEDGFAAKGHALVAMLIAACIRLNVTFAVDARVT
FT                   KLLGDAQQVTGIELEEGHTISAGSVMIASGGFEWDRQLADSLLATRLYTMCSPPTNTGD
FT                   GLKMAQRIGAATRGTREAWWAPMSITGGMRDGEPIGSLLRFERQGPGSIMVNRHGQRFA
FT                   NEAQNYNDLARCLQSWDSPNNQTLNTPAHVVFDQSYLDRYGILDHRSGQPTPDYLIEAA
FT                   TLEELAAKLNVPASNLTATVERFNQMALKGVDEDFGRGDSEYDRYWGDADSPWPNPSLG
FT                   PLQQGPFYAMEVVNGAFGTCGGIATDGNAQVIDVDGNPISGLFAAGNATESPYASGYPG
FT                   AGATLGPLMTMAYQAGRTIAATVRIPAESHAS"
FT   CDS_pept        75667..76506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53026"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y3"
FT                   /protein_id="BAF53026.1"
FT                   /translation="MEQSVPLNGFLFGGWRFSYGLMGILRLMTHTTKRVEGKVAFITGA
FT                   ASGMGASHARVLAAHGAKVVITDLNDELGQELVKEIGEEKAHYVHLNVTSFEEWEVAVQ
FT                   KALERFGKIDTLINNAGIFSSGSVEDATAADWDKTIAIDLNGTFYGMKAALPALKENPT
FT                   ASIINISSIAGVTGFKNRAAYSAAKWGVQGLTKTSAMDLGKYNIRVNSVHPGSVETPLT
FT                   ANLKRGLGQIPLGRAAQVEEISNLILYLSSDESSFVTGSSFVIDGGETAGNNLRDDQ"
FT   CDS_pept        complement(76511..77314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53027"
FT                   /db_xref="GOA:A4Q9Y4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y4"
FT                   /protein_id="BAF53027.1"
FT                   /translation="MANSPSGESMIARVVRLLSVFPKYNRPLSVREIAEYASLPVTTTH
FT                   RLLKELEAEDLVTRMTDGGWQHGTRLWEIASRNSPVQSLRDAALPPMEDLVAGLRVHVS
FT                   LAILDRHEVLYLERITPDDYTVNITSVAGRLPAHATSAGLVLHAFGSQEGQRLFLSRGH
FT                   ARFTETTPTEIEQLKEKLSRARIDGFVASLGTIIPESTGISVPIFGPKKLAIAALTVIV
FT                   PIGDEDLDLIVPQMKITARAIQRRTGVVPEINSRVTRETRQSPLG"
FT   CDS_pept        77357..79504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53028"
FT                   /db_xref="GOA:A4Q9Y5"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y5"
FT                   /protein_id="BAF53028.1"
FT                   /translation="MELPQDLNPGSTLAIFLTAEPDVDNISITRGRVRHAKDPLAVAAA
FT                   WRARAEKDNLSIRELVIEAAARTSFVGTYKSVAEQINEFIQQRAADGFILVFVGGGPRT
FT                   TGILLRLAANIPAEGAPITDIHVVDLYPAGSGRIWRTKQSGLLWMNSMAQDVTIFADDS
FT                   VEMAGPVIPGPSLAEWVLGIGREQVKAAGLGEELEHFSGRSFASRRLQSLYLDWAFQEA
FT                   VARLGKVTVHEALAIGLDDSQTVHLDNGLKIHADTVVLTQGHLDMVKSPESAALASIAA
FT                   TEGLAYVPPGFTADQDLSVLPSGKPVLVRGFGLAFIDAMVLLMEGRGGTFVTVDDQLEY
FT                   IASGEEPELWVGSRRGVPYLPKIGYSVPLYTEAPLYFDDDSLSAFGFVLDYREHIFPLL
FT                   TWNLQYAHYGQLLATDPSRATVPWGELSAALHRTLPPELGGSDHDISAFLESAIPDPAD
FT                   RFDFLKLDKPLTELHFTTQEELSDHIANYISDRIKRASDPRYSMDQAVFFTLLKIYFRV
FT                   HELAETGHFTLNDLRENIDRSPHNLFSYIASGPPPIRLEQLLALNRAGLVHFLGPDIRI
FT                   GIDDTHFTASSTATQGEIKAKALIDAYLASDSASAVDDTLLQNLLQAGEVTVESIDGSI
FT                   WGKFLVDGIGRPIRHDGTTHPSRFLLGPLVSGGGSEAPFSRPGTNARGFQRADRLARKL
FT                   LDLDEELDTDIQLATASRHPD"
FT   CDS_pept        complement(80263..81735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53029"
FT                   /db_xref="GOA:A4Q9Y6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y6"
FT                   /protein_id="BAF53029.1"
FT                   /translation="MTINVSELLAKVPTGLLIGDSWVEASDGGTFDVENPATGETIATL
FT                   ASATSEDALAALDAACAVQAEWARTPARERSNILRRGFELVAERAEEFATLMTLEMGKP
FT                   LAEARGEVTYGNEFLRWFSEEAVRLYGRYGATPEGNLRMMTTRKPVGPCLLITPWNFPL
FT                   AMATRKVAPAIAAGCVMVLKPARLTPLTSQYFAQTMLDAGLPAGVLNVVSGASASAISN
FT                   PIMEDDRLRKVSFTGSTPVGQQLLKKAADKVLRTSMELGGNAPFIVFEDADLDLAIEGA
FT                   MGAKMRNIGEACTAANRFLVHESVADEFGRRFAARLEEQVLGNGLDEGVTVGPLVEAKA
FT                   RDSVASLVDAAISEGATVLTGGKAGTGAGYFYEPTVLTGVSTDAAILNEEIFGPVAPIV
FT                   TFQTEEEALRLANSTEYGLASYVFTQDTSRIFRVSDGLEFGLVGVNSGVISNAAAPFGG
FT                   VKQSGMGREGGLEGIEEYTSVQYIGIRDPYAG"
FT   CDS_pept        complement(81844..82167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53030"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y7"
FT                   /protein_id="BAF53030.1"
FT                   /translation="MLRARSDQIVLVFGEESGGEFLRSNVVPLHRLWIFQLRCHEGGPS
FT                   LIESTEVCRSWVVLVVVGAQQRFRRTTRKHVAELPAGRCGRSINPSKLSAMLVNLWVSM
FT                   PLI"
FT   CDS_pept        82192..82629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53031"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y8"
FT                   /protein_id="BAF53031.1"
FT                   /translation="MGRRFKSDIALRRCDAVTTHIGHEHSADGGWKKAKTHHSTASLQK
FT                   TATATQSSISRPSTSSITTPSTCSMRQRSSSHELDHTSCKTSKTSGPHWIPRTSSSPVA
FT                   SAAMAQLLSFAQTSTSQQSSRLRTLPDWPSSSMAICLSHKP"
FT   CDS_pept        82281..82622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6004"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21066"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038220"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR83"
FT                   /protein_id="BAQ21066.1"
FT                   /translation="MEESEDSPLNRFTPEDGDRNAIFDIKAIYQQHYHSFDLFDAPEVF
FT                   FPRVGPYKLQNLENVWTALDSQDIFESRGISRDGAIVVVRPDQYVAAVLPLEDTAGLAE
FT                   FFNGNLLEP"
FT   CDS_pept        82789..84159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53032"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Y9"
FT                   /protein_id="BAF53032.1"
FT                   /translation="MLIERIYDEDLAQASYFIGCQAHNTAVVVDPRRDIAIYLDMAKKN
FT                   GMEIVGVTETHIHADYLSGTRELAAATNATMYVSGEGGADWQYEFDAERLYDGGEIRLG
FT                   NLVLTAVHTPGHTPEHLSFLLKDGAFADEPGFMLTGDFVFAGDLGRPDLLDQAAGGVDT
FT                   RFEGARQMFKSLKEKFLTLPDHIQIFPGHGSGSACGKALGSVPSTTLGYERQFAWWGKY
FT                   LEADDEQGFIDELLEGQPDAPAYFGRMKRQNRQGPAIMGAREPLPQLEASDLHDVIVVD
FT                   TRSADEVHQGTVAGAVNIPAGNSMAKFGSWTVDPEKDSRALVLLAASQIGAMEMWDHLV
FT                   RVGIDNVAGFVTNFDGVDLVAPQTVSPDELDKFEYDLLLDVRNRSEVEEGYIPGALHIN
FT                   GASVLWNLEKLPRDGKIVSYCKSGTRSSIAASTLRNAGFDVVELEGSYDNWVRHNAQ"
FT   CDS_pept        complement(84235..84981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53033"
FT                   /db_xref="GOA:A4Q9Z0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z0"
FT                   /protein_id="BAF53033.1"
FT                   /translation="MTATLIITLFLSLFIGISLGLLGGGGSILTVPILTYVAGLEPREA
FT                   IAASLFVVGTTSLVSAISHARNGRVRWKTGLLFGAAGMVGAFGGGLLGGYIPGTILMIA
FT                   FALMMIATSTAMLRGRKEKKGASKSSLWRVLVDGLVVGAVTGLVGAGGGFLVVPALALL
FT                   GGLSMPVAVGTSLVVITMKSFAGLAGYLTSVQLDWGLVLMVTAAAIVGSLAGSRLAGRV
FT                   PETLLRKGFGVFVLVMGVFVLGLELL"
FT   CDS_pept        complement(84991..85284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53034"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z1"
FT                   /protein_id="BAF53034.1"
FT                   /translation="MPITITETNKRRNLDQILDVRENFEITEGMIPEAIHIPMGDLSFR
FT                   FKELDQNRPVIVVCRSGNRSTQVANALKQAGYTAYSMTGGMSAWYQNNLPIK"
FT   CDS_pept        complement(85285..85878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53035"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z2"
FT                   /protein_id="BAF53035.1"
FT                   /translation="MTSTQPITSVDAQTLKSWIDKREGLTIIDVRTSHEFSNLHIRGSY
FT                   NVPLTTLAEHSEEIASRVGEHVVLVCQSGIRAGQAQQKLAPLGISTVAVLEGGINSFAK
FT                   TDGDVVRGTQVWDIERQVRFAAGSLVLAGLAGGKFLSPKVRALSGIIGAGLTFSGVSNT
FT                   CAMGKALSALPWNKTKPVPTKAETLSKLPSPKEN"
FT   CDS_pept        86004..86261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53036"
FT                   /db_xref="GOA:A4Q9Z3"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z3"
FT                   /protein_id="BAF53036.1"
FT                   /translation="MQLNPDEITPVLNRLKRAQGQLTGVIRMLDEGEDCKAVVTQLSAV
FT                   AKALDRAGFAIIATGLEQCLTNPDGDMDKKELEKLFLSLA"
FT   CDS_pept        86722..87579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53037"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z4"
FT                   /protein_id="BAF53037.1"
FT                   /translation="MRTVFQLVQDFHKKARGEGLPIKWGPSRGEFGVLEFPADVIPENI
FT                   KHIAQTKFQTEATSVEDIRRAINLLSDQAERAGASFNPGFILAQVGSTIVEVYGGAPVA
FT                   WLDAVELLISPDVEWVGVHGSRKLDINVSGELSGVISAGDKLGELLGDDWTINIVHGEY
FT                   KIQIEDAQLCTAFFADAAELINKANAEIVPFHVRMLSNSKIVMSGFSDYSLAGDSITLA
FT                   GKLAELARPFAHWKENIIPKIEIAMDYEPLPVADLWQEDSSEAPEPFDDFERLLREEIL
FT                   ITEF"
FT   CDS_pept        87726..88568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53038"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z5"
FT                   /protein_id="BAF53038.1"
FT                   /translation="MMIGMSNQTVKQTVPSGVKVSPHRFNRFEIKYLIPEQDVPALREQ
FT                   LATRMSTDPLSPPGGYRVESLYFDSADLRCYTEKIEGLKFRRKLRIRTYGDGVLTPEST
FT                   VSVEIKQRVNKVTQKRRLDLPFIYALALGDSTGAAVGEQVDVEKLLEISPENQHALIHE
FT                   MASFAKNYRLRPIATTKYHREAFVGADAEASSRVTIDHGVSGRDRDFLLGQDLEDRPTV
FT                   AQGLAVVEIKCDERVPFWLTDMTAQLEMSVIRMSKYCETIEAFHNRPASAFGAVDPIF"
FT   CDS_pept        88587..89300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53039"
FT                   /db_xref="GOA:A4Q9Z6"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z6"
FT                   /protein_id="BAF53039.1"
FT                   /translation="MLSDLSSIFDFQDLSGTFSVVDVLITLVLSFVLTSIVGVVYQKTH
FT                   RHISYSQSFVQTLVLVGMVIAIIMLVVGSNIARAFALVGALSVIRFRNAVKETRDVGFL
FT                   FLAMAIGMTCGTRFYVLAIAATIVVCGVLFIMYRFDWFKADIQRQVIKVQVPADGQADS
FT                   GRSYAEEVELILAQYCTSFEMMSAESVRGGALTEFSYTAQMRKNVKPHELVAKMRDVNY
FT                   GQKATVLTGHDQTDV"
FT   CDS_pept        89304..90980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53040"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z7"
FT                   /protein_id="BAF53040.1"
FT                   /translation="MPSFKSARWRMNRRLFLGTSAAIIAVGGVLGGVQVVPYISSGEIQ
FT                   TSASSTATIDVGAGNVDIFDTSVSHEISLQVSQESLDEMLADYQEDGSKTWVKATITID
FT                   GVTIENVGIRLKGNSTLSGLGRTSEEGGPQAPEGVEEFTDLSEEEIAQFEEQFAAQQGT
FT                   TDASETGETAETEETRGPGGGMGGGGMGGMTSVDADDVSTWPLLISFDKYEDGRVYQGM
FT                   TQLALRPGTTVVNEAMALALTAETDQVSQQSSFTTFSLNDEPSTTRLLLEHPDENYADA
FT                   LGNGVLFKADSNSSFTYQGEDQTEYDGQFKQINGDGNGDIQPIINLLKWLDTASDEEFA
FT                   EHLSDYVDVESFARYVATQNLLVNSDDMAGPGSNYYLWYDYDTGLISVISWDLNLAMSG
FT                   STDAGPDDEISMGGGGGMRPGGTTDTEIEGTTTEDMPAMGEMADTENMPDMANMQQGER
FT                   PEGMPDMGEMPDREGGGSMGGNQLKERFLASDAFTEIYEQVYWELYEEMYGSGTAIELL
FT                   DEIAASIPETDAVTADEIATEVASMREWITARTEALAALQE"
FT   CDS_pept        complement(91043..92164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53041"
FT                   /db_xref="GOA:A4Q9Z8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z8"
FT                   /protein_id="BAF53041.1"
FT                   /translation="MPKNYDINGAIRRRDMLRRRYLPDSANSTPVPEEVSPLTRYVTDG
FT                   IPKRPPLGATVADGLKFAEGASNRMVMSLYPAPSKPAIEELAEAWDLHPTIVEDLLLGQ
FT                   QRPKLDRYEDIIFIAIRSARYIDSREEVDFSEFHILMKPQAIAILCQDNQWIDGTSAAS
FT                   FSDPEQIDKRIKTLLADAELLSSGPRAVAYRLVDAIVDGFSPVLRGIAIDQEQIERQVF
FT                   SGDAAVAERIYNLSQEIIDMQHTTSSVTEVVQRLNKDFIRSGMSEELRAYLDDVADHLT
FT                   RDNTRVSEYRESLSQILNVNATLVAQRQNEDMKKISGWAAIIFAPTLVSSIYGMNFDIM
FT                   PELHWAFGYPLALLAMLGFTLLLYWIFKRSKWM"
FT   CDS_pept        complement(92247..92696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53042"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR028116"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9Z9"
FT                   /protein_id="BAF53042.1"
FT                   /translation="MPTYTCWSQRIRISREAKQRIAEAITDAHHELAHAPKYLVQVIFN
FT                   EVEPDSYFIAAQSASENHIWVQATIRSGRTEKQKEELLLRLTQEIALILGIPNEEVWVY
FT                   ITEIPGSNMTEYGRLLMEPGEEEKWFNSLPEGLRERLTELEGSSE"
FT   CDS_pept        92847..94118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53043"
FT                   /db_xref="GOA:A4QA00"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA00"
FT                   /protein_id="BAF53043.1"
FT                   /translation="MSTIPLNRLAVIAAIIGVGTGLFVAALNWSAIGVERLVYGADHLH
FT                   NHNPVANVSPLRLSITVIVLSVVASWAWFFVHRTGSKEVSIVGAIRGEKMPILETIASA
FT                   FLQVTTVAAGAPVGAENAPRIAGALVGERFSRWLQLDIDAKRILVASAAGAGLGASFHL
FT                   PLAGVLFALEVLLVEASTRTVVIAIITTTAAVATTGFFVQTPDVFSTVPLTESPWMLLA
FT                   AMVTGVVAGMCGHWFSAAAHKMAQASPKGVRILWQMPLGFVVIAAVIYFFPETLANPRW
FT                   LADSMLGDGLILSTILLVLVLRTAMFLLAFRVGMVGGNLIPAFALGSMVGGVVGAVLEP
FT                   ITNVPIAAFALLGAAAFLSTTMAAPLFGLIAAVEFTDMEAQGYLPIFLAVASAVLAVRV
FT                   WSVIAKRELRAIPITYASWTGELK"
FT   CDS_pept        complement(94162..94854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53044"
FT                   /db_xref="GOA:A4QA01"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA01"
FT                   /protein_id="BAF53044.1"
FT                   /translation="MNPITELLDATLWIGGVPILWREIIGNVFGLFSAWAGMRRIVWAW
FT                   PIGIIGNALLFTVFMGGLFHTPQNLDLYGQAGRQIMFIIVSGYGWYQWSAAKRRALTPE
FT                   NAVAVVPRWASTKERAGIVIAAVVGTLSFAWIFQALGSWGPWADAWIFVGSILATYGMA
FT                   RGWTEFWLIWIAVDLVGVPLLLTAGYYPSAVLYLVYGAFVSWGFVVWLRVQKTDKARAL
FT                   EAQESVTV"
FT   CDS_pept        95384..96643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53045"
FT                   /db_xref="GOA:A4QA02"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA02"
FT                   /protein_id="BAF53045.1"
FT                   /translation="MLLSDPLSLTRFAEHDVVLPIVVITELEAKRHHPDLGFFARQALR
FT                   MLDELREIHGDLSKPLPIGDEGGHIHVELNHQNAESLPVGFRLGNNDTRILAVAKNLQE
FT                   EGHNVVLVSKDLPMRIKASASGIAAQEYRAALARDRGYTGMTHANITDDQLSELYDTGE
FT                   VRIEELEKLPVNHGFTLKSNSGSALGRMNSDKIIELVPGDQQVFGISGRSAEQRVAIDL
FT                   LNDDAVGIVSIGGPAGTGKSALALCAGLEAVMERRIQRKIIVFRPLFAVGGQELGYLPG
FT                   DQEEKMGPWAQAVFDTLSSMVSQNIIDEALSRGLIEVLPLTHIRGRSLHDAFVIVDEAQ
FT                   SLERNVLLTMLSRIGQNSRVVLTHDVAQRDNLRVGRYDGIVSVVEALKDHELFGHITLQ
FT                   RSERSRIAELVTQVLDAPSL"
FT   CDS_pept        96737..96844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53046"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA03"
FT                   /protein_id="BAF53046.1"
FT                   /translation="MAIGTAVNPGSLQGKDPPRLSGNLGSVVDSCKIGL"
FT   CDS_pept        complement(96904..97290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53047"
FT                   /db_xref="GOA:A4QA04"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA04"
FT                   /protein_id="BAF53047.1"
FT                   /translation="MSNREYGLGFRSFIVGIIFAALWLVFTGANEFSQMQVIGACTNFV
FT                   LICAALTFWGYRQRLTAKRVITRVSAGLTLAIGAAFAAISAPFDETGLWGVGLVFIAVG
FT                   SYAGAALVSSIVLALLSLSHLRQQ"
FT   CDS_pept        complement(97373..98953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53048"
FT                   /db_xref="GOA:A4QA05"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA05"
FT                   /protein_id="BAF53048.1"
FT                   /translation="MSSSTLLLASGQVTALAADYSLSHTPSDGILVVLGFAMILTFMTL
FT                   IMLGRMTPMVAMLLVPTIFGLIAGAGLGLGDMALDAIKDMAPTAALLMFAIMFFGIMID
FT                   VGLFDPLIRGITRVLHDDPAKVVLGTAILAGVVSLDGDGSTTFIITTSAMLPIYLRLGM
FT                   SPVVLTCTAGLINGTMNILPWGGPTVRAAAALGLEPADVFVPMVPSLIAGVVICLLFAW
FT                   FLGLSERKRLGKIDSSRFGGPGLDAPETGTGSGSSPNKKGFPGLGGLGKAKNAPKPGPT
FT                   GGVLVEDREVETEQHINLDDSTLTENMTDTLLDPHRATLRPKLFWFNAALTLVVMVLLV
FT                   ADIFPLAFVFMAGAGLALAVNFPKVKDQATEMLAHSSSIVGVVSMVLAAGVLVGVLSGT
FT                   GMVDAMATWITTVIPNAMGPHLAVITGLLSIPMTFFMSNDAFYFGILPVLAESASHFGI
FT                   EPVEMARASITGQPVHMQSPLVPAILLLVSLANVNLGDHHKKVLWRACIVSIAMLAVAL
FT                   FIGVVPLSA"
FT   CDS_pept        99122..100816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53049"
FT                   /db_xref="GOA:A4QA06"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA06"
FT                   /protein_id="BAF53049.1"
FT                   /translation="MLHALLIITPGGRYVCWSIRTKNFKEVDIIRFATRILVIQVATVA
FT                   LVVAICTGIFAVLMMDQMKTEAEHTALSIGRSVASNPQIREEVALDTQTGANPSAEELA
FT                   DGDIQAVAQAANERTGALFVVITDGLGIRLSHPDEERLGEQVSTSFEAAMRGEETMAWE
FT                   TGTLGASARAKVPIFAPDSNVPVGEVSVGFERDSVYSRLPMFLAALALISVLGILIGVG
FT                   VAMGMRRRWERVTLGLQPEELVTLVQNQTAVIDGIDEGVLALSPNGTIGVHNEQAQSMI
FT                   GAGPMSGRTLKELGLDLGLDGVVLHGQHPETVAHNGRILYLDFHPVRRGDQDLGYVVTI
FT                   RDRTDIIELSERLDSVRTMTHALRAQRHEFANRIHTATGLIDAGRVHDAAEFLGDISRN
FT                   GGQSHPLIGSAHLNEAFLSSFLSTASISASEKGVSLRINSDTLILGTVKDPEDVATILG
FT                   NLINNAIDAAVSGEAPRWIELTLMDDADTLVISVADSGPGIPEGVDVFATATQIGDSED
FT                   NERTHGHGIGLKLCRALARSHGGDVWVIDRGTEDGAVFGVKLPGVME"
FT   CDS_pept        100816..101472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53050"
FT                   /db_xref="GOA:A4QA07"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA07"
FT                   /protein_id="BAF53050.1"
FT                   /translation="MDQTLKVLVIDDDFRVAGIHASIVDASPGFSVVGTARTLAEAKTL
FT                   IATFSPDLLLVDVYLPDGDGIDLVGTSNIDAFVLSAADDIKTVRRAMRAGALGYLLKPF
FT                   PQKRLVERLDRYVRYRHVLSGTQGLSQDKIDQATAILNGTQAPVTVSRSATEQLLLDAL
FT                   EGQELSATEASEAAGVSRATAQRRLAAMASQGVIQVRLRYGQSGRPEHLYSKPLL"
FT   CDS_pept        complement(101469..102383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53051"
FT                   /db_xref="GOA:A4QA08"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA08"
FT                   /protein_id="BAF53051.1"
FT                   /translation="MKIFVGFGDYPLTTKALKEAGAEIVDSLEKAEGFVFTQTPGTEFP
FT                   LLPDGVRWVQFPNAGLNAYFTAGQIDDKRRWSNASGVYGQQVAEAAMGLLLGLIHMHPT
FT                   MVRADSWAPRTHVDQQTRWLDGAIVAIVGAGGIGKHLAAMLKPFGAKSLSVSRTGTPTQ
FT                   DFDATEPISNLHQVLADADHVVLCVPLTADTYHLIGKAELKAMQSTAILINVARGEVVD
FT                   TEALVDALDAQEISGAGLDVTDPEPLPDDHPLWGRSNVIITPHVANTLTSMDRMLAPVV
FT                   AENYRRLLAGEKMLTEVDIHKGY"
FT   CDS_pept        102499..102930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53052"
FT                   /db_xref="GOA:A4QA09"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA09"
FT                   /protein_id="BAF53052.1"
FT                   /translation="MSISNAILRGVSGAYILQSGYGKLGLPNEAAAGIQGLAATGIPAV
FT                   ADMDSDTFGKFVAYSELGIGGALLAPFIPSRLAGLGLGAFSAGLLAIYFRNPAMTQDDG
FT                   IRPSQDGTGLSKDLFLAAIAGALVFAPAKKRKKAKNKSK"
FT   CDS_pept        103145..104149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53053"
FT                   /db_xref="GOA:A4QA10"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QA10"
FT                   /protein_id="BAF53053.1"
FT                   /translation="MTIPATILDTARTQVLEQGIGLNQQQLMEVLTLPEEQIPDLMELA
FT                   HQVRLKWCGEEIEVEGIISLKTGGCPEDCHFCSQSGLFESPVRSVWLDIPNLVEAAKQT
FT                   AKTGATEFCIVAAVKGPDERLMTQLEEAVLAIHSEVEIEVAASIGTLNKEQVDRLAAAG
FT                   VHRYNHNLETARSYFPEVVTTHTWEERRETLRLVAEAGMEVCSGGILGMGETLEQRAEF
FT                   AVQLAELDPHEVPMNFLDPRPGTPFADRELMDSRDALRSIGAFRLAMPHTMLRFAGGRE
FT                   LTLGDKGSEQALLGGINAMIVGNYLTTLGRPMEDDLDMMDRLQLPIKVLNKVI"
FT   CDS_pept        104161..104400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53054"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA11"
FT                   /protein_id="BAF53054.1"
FT                   /translation="MNDDLQMAMILADTPIFHPNTGKPFDGEHKLSPSARAGLEAPRYC
FT                   QLCGRRMKVQVRPDGWDALCSRHGFVDSSYLGRR"
FT   CDS_pept        104352..104693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53055"
FT                   /db_xref="GOA:A4QA12"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA12"
FT                   /protein_id="BAF53055.1"
FT                   /translation="MLPPRFRRLLLSRASIMRGHLIDGDGRCIHYHGPFDVVGNKCATC
FT                   NEWWACHRCHEEIANHPFGKMLIDAPSSLQCGHCGELMAYGVQKCPRCGHNFNPGCSLH
FT                   TPLYYEMPS"
FT   CDS_pept        complement(110791..112242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53056"
FT                   /db_xref="GOA:A4QA13"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA13"
FT                   /protein_id="BAF53056.1"
FT                   /translation="MSNASFKGDDKGLIGIVLSVLTFWLFAQSTLNIGPDMATDLGMSD
FT                   GTMNIAVVAAALFCGTFIVAAGGIADVFGRVRIMMIGNILNILGSLLIATATTSLATQM
FT                   VITGRVLQGLAAAAIMSASLALVKTYWLGTDRQRAVSIWSIGSWGGTGFCALFAGLVVA
FT                   SPFGWRGIFALCAIVSIVAVALTRHIPESRPAQSIGMHLDWSGIIVLALSVLSLELFIT
FT                   QGESLGWTHWITWTLLAVSLTFLAVFVFIERVASWPVLDFNLFKDHAFSGATITNFIMS
FT                   ATGGVVAVVMWVQQMGWGISPTISGLTSIGFAAFVILFIRVGEKAMQKVGARAVIITAG
FT                   ILVATATALLMITAVSESTYIVISLAGFSLYGLGLGLFATPVTDTALGTLPKDRTGAGA
FT                   GVFKMSSSLGAALGIAISTSVFLALRDGTSINSDVALAGTVALGINVVFAATATITAAV
FT                   LIPKAAGKVSQTSITLPEPAIAVKI"
FT   CDS_pept        complement(112362..113609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53057"
FT                   /db_xref="GOA:A4QA14"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA14"
FT                   /protein_id="BAF53057.1"
FT                   /translation="MRITNAQVKNYTELVDITIEGEKISSITPSSIRSEEDHRTDDYDA
FT                   AGRLVTPQFAEAHIHLDYANTAGIPRENSSGTLFEAIEIWADRKTQGFHIKEDIKAKAL
FT                   QAARRAAEHGVGFIRTHVDVTDPTFAGFEAIAELRDEVREWCDIQIVAFPQNGIYAYEG
FT                   GQKLISDAMSAGADVVGGIPHLEPTRDDGVESVKWLFDLAEKHSASIDIHTDEIDDPHS
FT                   RFVEVLAAEAAKRDMGAQTVVSHSVAMAYYSPGYMARLLPKLAASKVRFAVCPNENLHL
FT                   QGLGFQGPVPRGVAPVKQLTEWGIPVSFCQDSLNDPFYPMGDGDLLRILDSGLHVSHML
FT                   TASHLKNALSFITTNPAGNLGLDNYDIAENSPANLLVLDASSEKEAVQRKASVLLSIHR
FT                   GKKVLSREPEQVDWNI"
FT   CDS_pept        complement(113853..114374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA15"
FT                   /protein_id="BAF53058.1"
FT                   /translation="MTMSFLNSAKTKTVAFTATFVGAATLATPAIASADIIDNALAALP
FT                   SGEISCSQAEKYWTTEADYNSKVAQANALAMFDSRGPQIKAALARVDEAANRCGLKGGT
FT                   VAAQAEATEAAPAAPAPATTPEVAAAVAPAINLAPAGSPAFTIEVPGVGTVQLPDLNKS
FT                   VQQFLAQFTA"
FT   CDS_pept        114466..115392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53059"
FT                   /db_xref="GOA:A4QA16"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA16"
FT                   /protein_id="BAF53059.1"
FT                   /translation="MFDELTARAHNSALRSIARVVAETVEPMGEDVARVGVVKQLKAGN
FT                   VLAVTGAGVSTDSGIPDYRGPKGSLSRHRPMTYQEFRHDPAASHRYWARSFVGWRVMDQ
FT                   ARPNRTHYAMVELEQHGFLSGVVTQNVDGLHAEAGTKNLVALHGDLAHVMCLNCGFGED
FT                   RHLFDERLEAANPGYVASIRLEPGAVNPDGDVFLDEEQVRRFTMIGCLRCGSLMLKPDV
FT                   VYFGEPVPAARKKDLKKLLDASSSLLIAGSSLAVMSGYRIVIEAQRQGKQVSVINGGPG
FT                   RADSRVDILWRTRVAPAFDDILDALDL"
FT   CDS_pept        complement(115734..116708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53060"
FT                   /db_xref="GOA:A4QA17"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA17"
FT                   /protein_id="BAF53060.1"
FT                   /translation="MVDALNDLRRELTNALRSVWKNLPTENAPQADALPDDVVEEIATN
FT                   FYRNPKNRGKLNEDKTDSLPMLARIRSRGLFEDDWRARPTEDRPWPVVLVHGTGSTKGD
FT                   WQDLGADLRRDGWAVFAPEFGQRATGSVAESSAQIGAYIDTVLLATGASKVIVVGHSQG
FT                   GVLLRYWMRVLGGASKVKHMVSLAVPNHGTTMGGIVSPLIRNNRGESVVNSVVQSWFGE
FT                   AGFEMIRGHDTINAINEGGDLDPDVTYLCIATHFDTVIQPPETCFLEARNPEELKRVQN
FT                   IWVENLDPNSVVLHEAMPYDPRVRALVRADLSKLVEISETAEN"
FT   CDS_pept        complement(116718..117620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53061"
FT                   /db_xref="GOA:A4QA18"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA18"
FT                   /protein_id="BAF53061.1"
FT                   /translation="MSQENSGLFKRAISRGVAKVRRNPREDFAEEFTQELYDHATNITL
FT                   PLTARLKPKGFFQDDWRARPSGARPWPIVLIHGSGASKGSWEEMGAELRSKGWAVFAPD
FT                   FGTRATEPIAASAAQIGAYIDAVLLVTGAAQIVLVGHSQGGVVARYWMRTYGGYMKVRH
FT                   MISISTPNHGTLMGGILNPMTKVKSGEGTIEKLMHRLFGPTGFEQLRGHDIIEFLADGG
FT                   DLDPGVTYTCVGTHFDPFIQPPEVAFLEVSEDDDPNRVHNIWVEDEHPRAMIAHNDMVR
FT                   DPRVIEIVRAELDRVARLG"
FT   CDS_pept        117791..118624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53062"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA19"
FT                   /protein_id="BAF53062.1"
FT                   /translation="MNNVQQFHRFFDDSAVYYPCFVPLDRAIGEHFDRQNKPMSRFIGT
FT                   LILPLAKLEEAAQYTGDEVLRVSAVISTDELADLRRDFYELPNIDIASVEIKLVGAALT
FT                   NTAWLGDVEKLIQQHRNTFVWVEIPTALVTADIVRKLRHMGAGLKYRTGGDREELFPTP
FT                   QDLITVLRTAIDAALPFKLTAGLHRALRYRDEKTGRLHFGFLNIAATVATLRAGKGEAE
FT                   ALSVLEGDDAAPLIHALQIGGNWRDSFRSFSTCNVVEPLNTLIDLDVLAEGDVHP"
FT   CDS_pept        complement(118634..118942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53063"
FT                   /db_xref="GOA:A4QA20"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA20"
FT                   /protein_id="BAF53063.1"
FT                   /translation="MSPLQVADKTGMKKSAISNLLKPLLAESLIVQVTAENDRRSKVLS
FT                   LSEKGTTYIQKTATRQNALESEWFGTLTDIEQDLLESLLRKLLDSNRASKVRKNRSN"
FT   CDS_pept        119349..119651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53064"
FT                   /db_xref="GOA:A4QA21"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QA21"
FT                   /protein_id="BAF53064.1"
FT                   /translation="MHITPREQEKLMIVVAADLARRRKDRGLKLNHPEAVALITYELIE
FT                   GARDGRTVADLMSWGSTILTRDDVLEGIPEMIPDIQVEATFDDGTKLVTVHNPIR"
FT   CDS_pept        119678..120154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53065"
FT                   /db_xref="GOA:A4QA22"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QA22"
FT                   /protein_id="BAF53065.1"
FT                   /translation="MIPGEYILSSESLTGNVGREAKTIEIINTGDRPVQIGSHFHFAEV
FT                   NPSISFDRSEGYGFRLDIPSGTAVRLEPGDARTVNLVAIGGDRIVAGFRDLVDGPLEDL
FT                   KVNVWEGREDDWRRSSAAGDAPQELPQVEAAERGRKLDEATDVGTEDTPEEGQN"
FT   CDS_pept        120155..121867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53066"
FT                   /db_xref="GOA:A4QA23"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA23"
FT                   /protein_id="BAF53066.1"
FT                   /translation="MSFEISRKQYTDLYGPTVGDSVRLADTELFLCVEKDYAAIGEEVA
FT                   FGGGKVIRDGMGQNGTLVRDVDIPDTVITNVIVLDYTGVYKADVALRDGKIFRIGKAGN
FT                   PNVMENVDIVIGVATDIIAGEGKILTAGGIDTHVHFLGTDQVNTALASGITTMIGGGTG
FT                   PSQASMATTVTPGQWNTYNMLSAFEGMPMNFGILGKGHGSSKSPLAEQVRAGAIGLKIH
FT                   EDWGATPSSINTALEVADDMDIQVALHSDTLNEAGFVEDTIEAIAGRVIHTFHTEGAGG
FT                   GHAPDLIRVAALPNVLPASTNPTLPYTRNTVEEHLDMVMVAHHLNPDIPEDVAFADSRI
FT                   RAETIAAEDVLHDMGIFSITSSDSQAMGRVGETITRTWQVADHMKRTRGSLTGDAPYND
FT                   NNRLRRFIAKYTINPAIAHGVDYVVGSVEEGKFADLVLWDPKFFGVKPDLVIKGGLMVN
FT                   SLMGDSNGSIPTPQPRTLRNTWGAFGQAVSRSSITFLSQDAIDANVPDLLNLRKQIRGV
FT                   RGVRNLTKRDMKLNAEMPDIRVDPETYQVFVNGELITSKPAETVPMARRYFLF"
FT   CDS_pept        121892..122365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53067"
FT                   /db_xref="GOA:A4QA24"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QA24"
FT                   /protein_id="BAF53067.1"
FT                   /translation="MIITAIDTNIYDQPEFVEGRDVIGVRFEDLVLDKRIQRVALSGGE
FT                   ELGLRLNHGHPILREGDVLKADDKTVFVVEIIPTDVLVITPSDIHQMGFVAHSLGNRHL
FT                   PAQFSKPGELTEKAAMIVQYDHTVVSFLDDHDIEYQRTELVPPIPFRHSGHTH"
FT   CDS_pept        122365..123045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53068"
FT                   /db_xref="GOA:A4QA25"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QA25"
FT                   /protein_id="BAF53068.1"
FT                   /translation="MDLDADFLLLHLSDSALPTGAFAHSFGFETYMDAERITNAEEFQD
FT                   WLKVLLKVQLTSSDALAMRMFYATPTASELKRLDERLFAGTPAREVREANARMGTRMAE
FT                   IVAETYSVPLIIEYLELIKNRELSGHPALALALATHSMGIDVDRAIHAHLTATVSSLIQ
FT                   NAVRGIPLGQMAGQRVMFAMREHIGAAVKRSAMLDAIDFCSGDPGLDISQMVHETQRAR
FT                   LFMS"
FT   CDS_pept        123062..123679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53069"
FT                   /db_xref="GOA:A4QA26"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QA26"
FT                   /protein_id="BAF53069.1"
FT                   /translation="MGPIRIGVGGPVGAGKTQLVERITRALIDEVSMAAITNDIYTIED
FT                   AKILAANGVLPEERIVGIETGGCPHTAIREDTSMNDAAIKDLVERFPDLELIFVESGGD
FT                   NLSATFSPELVDFSIYIIDVAQGEKIPRKAGQGMIKSDLFIINKTDLAPYVGANLDVMV
FT                   EDAKTFRKNKPFCLTNLRTDDGLDKVLEWIRHEVMMQDLQEA"
FT   CDS_pept        123680..124531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53070"
FT                   /db_xref="GOA:A4QA27"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QA27"
FT                   /protein_id="BAF53070.1"
FT                   /translation="MTQTQPVGTLRLTIDDQGPQGQSRAVEQFHQGALRVIRPHYLDDS
FT                   GQVSYTIIAIGGGYLGGDVYEQQFTVKDNAKALITTQSATKIYRTPQGPVTQYTEINVG
FT                   ENAVLEYLADQTIAYRESTYHQFTKVTLHPTSTFVMSEQITPGWHPDGKHFAYDEMRLH
FT                   TEITDSTTGRLVLLDNLLLRPDSREGSFGWTEQYTHSGQMIVMGEGVDKQLVAELNEQL
FT                   AAHPDVYGAVNFLSAPGTLLRGFIARTLSNRTEELINLHEHIASLLRGRWRGQEPVNLR
FT                   KY"
FT   CDS_pept        complement(124535..125689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53071"
FT                   /db_xref="GOA:A4QA28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA28"
FT                   /protein_id="BAF53071.1"
FT                   /translation="MRSGNANRVFIGVTLLLFTAGWAANHFASVLVLIREQLDVSSVLV
FT                   NGAFGIYALGLLPSLLAGGVLADRFGARMVVLTGGVLSALGNLSLLAFHDGPSLLVGRF
FT                   IVGLGVGLVVSAGTAWAGRLRGASGVTLAGIILTAGFMMGPIVTSGLGMASTSIITPFA
FT                   ISVALSLIAVVVGFALGDARSTPSALGASSGIKHERSMKKALAVSLPMAIWVFSCITTS
FT                   LIVMSARIDATFGNAILLPGIGAAIAFSAGLIAQFLGRKFAWGRGSGIVGALCALAGFA
FT                   LAAFGGDSIPVWLFVIASILLGTAYGLCLREGLLGIETYTPLNRRGTGIGIYYVFTYLG
FT                   FGLPVLLDVLLPHLGASIPLYALAALALGSAVIRGVQIKRGYVV"
FT   CDS_pept        complement(126024..128801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53072"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA29"
FT                   /protein_id="BAF53072.1"
FT                   /translation="MDYAFEQSATALLDRAIDMPMNDEQMEAFQLALSVAQETEDQDTE
FT                   FKARLFLATLGNINEDHTSMLTHFSAAVGMHDRDPARFPGQGDGSYPDLFWLYKNALNL
FT                   VISSVLFTREQMDNMLDQMDEHFTRAGIPRIAIDIERRDDALMNGSLERALELQELIDA
FT                   SQHDDPFDDCPTCQIAGKAALAMAADDYDETQNLVSQIISYGSIGCVMEPETTLAAFML
FT                   RVLKSGDADYARYLQDVSAKANPEFQSLDSVGRHLEFLGITGNHSRGLGFLTRYQHRLI
FT                   TDPLATLGHFQFYLGAYTLLSSTERAGFGDLVVSGTGEVFGHDEDLNVEKLKERCLELA
FT                   RNLAREYDARNGNDNFMKRFEASIANSTLDIPVGLGGSNLLLKAQTATPSEPANAQDKL
FT                   YRFCIANGKRAFSDAQRFLLNADELAELSDYERLAYAITLLDQHGKEAEGRELFLSELR
FT                   RQGYRAVDFLESQTVDQLNNPDVQTYLTEAELIRDDLRSWAVLNQMALDNIDLVPYSEE
FT                   NEEPLAIARKIIEETASHPELRFENLEAQFSEFTILLAQSPENLDVARYQEIRTQGNFV
FT                   QELALDSIFGQHAVVQDTGNGEAILDETIGYMIGAGMRETTARTASQFAQLYSFVGRQE
FT                   RSIEMARLAFEELQAAGLPHREEELRLGMQLAQVEPIEAREILEKLLLPKFEQNLTLDE
FT                   LETEALLPLGATVAIHDPQAAAAILRHARENAAGFGNFELAVQAMTMITDVLYTQDMHE
FT                   QLLEELNHSLPYAQMLDDQHQAELKLLDSIAIVQADLGSTEALETLGTAMGLAETTAQK
FT                   LYVQESLNRAYFTFARPEDCISGAAKASALAMQNDDPSNAAAQLEQCAQYLFQLGHETD
FT                   GASLLESAFRVEGIPTEQALYYANALSSIYEDFGDSAKSQYWEQQAQEKQQLLE"
FT   CDS_pept        complement(128828..130654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53073"
FT                   /db_xref="GOA:A4QA30"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA30"
FT                   /protein_id="BAF53073.1"
FT                   /translation="MQESSRDNFQVDLGGVVDLLSRHIYSGPRVYVRELLQNAVDACTA
FT                   RSEQGEEGYEPSIRIRPVTKDRATFSLVDNGTGLTAQEARELLATVGRTSKRDEFGLQR
FT                   EGRLGQFGIGLLSCFMVADEITMVSHAEGASAIRWTGHADGTFNLEILGDDATDVIPVG
FT                   TTVHLTPRPDERTLLTENSVVTIASNYGRYLPIPIVVQGEKNTTITTSPVFAKDTDQQH
FT                   RLYAGRERLGKTPFDVIDLTGPGIEGVAYVLPEAQAPHMSRRHSIYVNRMLVSDGPSTV
FT                   LPNWAFFVECEINSTDLEPTASREALMDDTAFAATREHIGECIKSWLINLAMTKPHRVR
FT                   EFTAIHDLALRELCLSDADLAETMLGLLTLETSRGRISIGEITTLSITEDVSLQLATTL
FT                   DDFRQLNTIARPDTLIINGGYIHDSDLARLIPVHYPPLTVSTADLRESMDLMELPPLQD
FT                   VEKAKALDAQVTDSLKDFQIKGATRVFDPADVPAVVIIDSKAQASRDRNETQSATTDRW
FT                   ADILATVDNTLSRQTANIPQDQGLSALCLNWNNSLVRKLASTDDTAVVSRTVRLLYVQA
FT                   LLSSKRPLRVKERTLLNDSLADLVSLSLSSDI"
FT   CDS_pept        130722..132131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53074"
FT                   /db_xref="GOA:A4QA31"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA31"
FT                   /protein_id="BAF53074.1"
FT                   /translation="MEATTIDDAIAKLIDIYDTSTKLAKETLDNEDYAAYADVVYPKLT
FT                   VDVLEWKPIDRTEPFGYVDRAGRYSAILSKPRVIERYLREQLERLTSNYPCKIYVSESD
FT                   IRIPPEYIRGAPSATEARRAGDVADIIPRPTLDEVHDAIIDGDWHAFNGPELPLFHFGP
FT                   QRFDIACARIEHYTGINVEHVQKYILFTNYAMHTTEFVHFAMSELTSEDSRYVGLSLPN
FT                   GQVIDRETATSLGTETLDLTSRFQMPRYDLITEAGDGITIINIGVGPSNAKTITDCLAV
FT                   LRPEAWVMIGHCAGMDARMRIGDLILGNAYQREDHILDKRISLGNPIPAIPEIQKALEA
FT                   SVDEIYGSDNSLMRTGTVLSTDDRNWEWHTPEDLWNWLKGSTAAAVDMESSTLATNGYR
FT                   YRIPYGTLLSVSDLPLHAVPKLPAQAQAFYSNSKEAHVMCAVRAMEYLAVDPERLRTRK
FT                   LRRTLGEVPFR"
FT   CDS_pept        complement(132809..133987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53075"
FT                   /db_xref="GOA:A4QIG7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QIG7"
FT                   /protein_id="BAF53075.1"
FT                   /translation="MKALTWQASNTVNVEEVPDPQIQEPTDAVIRVTSTAICGSDLHLY
FT                   EVLTPFMDKGDIIGHEPMGIVEEIGSAVTHIKPGDRVVIPFNISCGHCFMCRQGLQSQC
FT                   ETTQVREYGTGAQFLGYSRLYGSVPGGQAEYLRVPHADYGAIKVPNVGEDERYLFLSDV
FT                   VPTAWQAVDYAAVPDGGTLAVLGLGPIGQMSARIGKHLGYRVIATDAVPERRAMAERYG
FT                   IETLDSSEDGVAEQLKDLTDGRGPNSVVDAVGMEAHGSPVASAVQAAVGKLPSPLDRKA
FT                   MERAGVDRMSALYTAIDSVRRGGTISISGVYGGMKDPMPMLTMFDKQIQLRMGQCNVRS
FT                   WTETLLPLVDDPSDPLGVLDLKTHTAPLEEAPAMYEKFQKKQDGCIKVVLKP"
FT   CDS_pept        complement(134356..135357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53076"
FT                   /db_xref="GOA:A4QIG8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4QIG8"
FT                   /protein_id="BAF53076.1"
FT                   /translation="MPTSRDVARAAGVSQATVSRALNRPETVSQKTRERVQAAVQTLGY
FT                   HPHSGAIAMKTQRTKTIGVVVSELSNPFFQEIFETLSQEFAKAGSRVIVWDSALHERDA
FT                   IRALQERSVDGVIMSAWDEDAQEMRDILETGLPVVLLNRTAPKGSFDSVTSDNHNGGQL
FT                   VADYLHQHGKHHLVFIQGNPHTSTSMERLNGFRAGLHALNQPSPTVLNGEFSFEKSFAV
FT                   TRDFLDQHGAPDAFFCANDYMAFGVLNAVKAAGMSVPEDVWVIGYDNVSQSDWPILDLT
FT                   TVRQGSRQMAQLGAQKLLNRIENPTTPAVKTILPVQLEIRGSSENAPFNHEN"
FT   CDS_pept        135615..136841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53077"
FT                   /db_xref="GOA:A4QA32"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA32"
FT                   /protein_id="BAF53077.1"
FT                   /translation="MIADIRARGDEAVREYSLKFDNYGPDSFLVQGEQLQEILDRVPEQ
FT                   VIEDIKFVQDQVRKVAQAQLQSMGEFEIETLPGVHIGQKNVPIDSAGAYVPGGKYPLLA
FT                   SAHMTILTAKVAGVKRVVACTPLIQGEVPDATVAAMHLAGADEIYLLGGIQAIAAMAIG
FT                   TETIKPVSIIAGPGNAFVAEAKRQLFGEVGIDLLAGPTETLIVADETTDPFIAAVDLLS
FT                   QAEHGPDSPAVLISTDRAVAEQVIDHINELLPEMPTKDYAEVAWRDWGEVHVVESIEDA
FT                   FSLADKFASEHVQILTASPRRALDEMKHYGALFLGEGTCVSYGDKVIGTNHVLPTRGAA
FT                   RYTGGLWVGKYVRTITYQEVTNEDSSAFFGELCGRAARVERFEGHARSGDVRAAKYAGA
FT                   ALTWTDHSF"
FT   CDS_pept        136868..138187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53078"
FT                   /db_xref="GOA:A4QA33"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA33"
FT                   /protein_id="BAF53078.1"
FT                   /translation="MIGFLGLLASLILLIVLTMRGMNLLIAAPLSALVLAVISGLPLFP
FT                   QLVGSDEDSFVSTYMAGFSGFVASWFLMFLLGAIFGKVMEDSKSAASVSAWLTKKFGAK
FT                   YALAAVIVACAVLTYGGVSLFIVGFTVFPIALSLFKLANYPRRFIPAALAFGSVTFTMT
FT                   SAGSPEIQNWIPMEYLGTTPYAGWEVSLIVASVMAVGGYFLLHYLVKRAISRGEEFESR
FT                   PGDPKEYDGPLPNPALSLLPLLTVLILSFIFHDSLGTSALIVALTGGVVLTWLLNHKYM
FT                   SSFWRAASEGTTGALLAIANTAAVVGFGAIARTTPAFQDAVDVMTSVPGDPLIGGAIAI
FT                   IVIVALTGSASGGLTIALPILGPQYMDAGVNPEALHRVATLSSGALDSLPHGGYTVTTI
FT                   RVICGETHKTAYSPVFWVTVVVPTVGVILAVALFSLGVGI"
FT   CDS_pept        complement(138656..139357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53079"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA34"
FT                   /protein_id="BAF53079.1"
FT                   /translation="MTSEGRAGRSHHDSHRWVQKYAPELDKHTRWYRQAPDWQASSWRV
FT                   DETYIRVGGRWCYLYRAITAGGQTLDFYLSPKRNVAAAKRFLAKTLRSNASAGFPRVIN
FT                   TDKAPSLAKAISELKEEGICPPTVEHRQVKYLNNVLEGDHGRLKRILGPKGAFKNLDIC
FT                   ISDAEGDGSDALLAERSGDDVCLRATEPGRGDRQPGLRDGLRTLSRRDHGEMKLGRSWP
FT                   LHPTLQQHPSS"
FT   CDS_pept        139439..139597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53080"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA35"
FT                   /protein_id="BAF53080.1"
FT                   /translation="MTTGEDTYGCDYFTSLFLLPQLCNSTEQATRVTAVSTAATAMAAL
FT                   RGVLGMD"
FT   CDS_pept        complement(139741..141222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53081"
FT                   /db_xref="GOA:A4QA36"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA36"
FT                   /protein_id="BAF53081.1"
FT                   /translation="MTSSFSRRQFLLGGLVLAGTGAVAACTSDPGPAASAPGPSLRPTP
FT                   TPTALGEPTVRRTLTARPLSLDIGGIEAKTWGYVSDTGDAAIEATAGDVLQVDITNELP
FT                   ESTSIHWHGIALHNAADGVPGMTQDPIEPGESFSYVFEVPHAGTYFYHSHTGLQLDRGL
FT                   HAPLIIRDPQDAEDQDVEWTIVLDDWVDGIQGTPDDELDKLTGMGSGDHNGRMGMGGHG
FT                   QMMHGTPDRVLGGDVGDVMYPHYLINGRIPRAHRTFEARPGDKARLRFINSGGDTIFKV
FT                   ALGGHRMTVTHTDGFPVQPWETESIYLSMGERVDVEVILGDGIFPLTALAVGKDDRAFA
FT                   VIRTAGGQAPRPDVDFPELSSTGLLLSSLKPADRALLPEGTPDREVSIDLGGQMMPYEW
FT                   SILTDGQSSSATVQEGQRLRMVMRNRTMMPHPMHIHGHTWALPGSGGLRKDTVLLRHGE
FT                   TMIADLIADNPGEWAFHCHNAYHMETGMVSSLRYE"
FT   CDS_pept        complement(141293..141868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53082"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA37"
FT                   /protein_id="BAF53082.1"
FT                   /translation="MKRAAIAAAALALALTGCSAADPEPTADGTVSQDTFLTTHGLAAM
FT                   DAVEIIDHLDRQKVTERPTDLIASVRADELLLSSDDQEVVVDLPDNQTYVSVAPYITST
FT                   HDCFYHSLTTCLGELDNEDIQVTITDEATGEVLIDEQTTTFDNGFVGFWLPDDATGTIE
FT                   ITHQGRTGVTEFSTTEDGATCVTDLRLT"
FT   CDS_pept        142272..142994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53083"
FT                   /db_xref="GOA:A4QA38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA38"
FT                   /protein_id="BAF53083.1"
FT                   /translation="MADRTPTTATPPGRVLVVDDEQPLAQMVASYLIRAGFDTRQAHTG
FT                   TQAVDEARRFSPDVVVLDLGLPELDGLEVCRRIRTFSDCYILMLTARGSEDDKISGLTL
FT                   GADDYITKPFSVRELVTRVHAVLRRPRTSTTPPQVTTPLIVGDLILDPVAHQVWVGETT
FT                   VELTRTEFELLVALALRPGQVLTRHDLVTEVWDTTWVGDERIVDVHIGNLRRKLGTDTR
FT                   GRGFIDTVRGVGYRVGQP"
FT   CDS_pept        142991..144190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53084"
FT                   /db_xref="GOA:A4QA39"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA39"
FT                   /protein_id="BAF53084.1"
FT                   /translation="MNHGPGLTFRFLTAQVLVVVISLLVAAAVATMVGPTLFHDHMLMT
FT                   GREDPSLELFHAEQAYRDANLITLAVALPTALISALLASLWLSRRLRTPLQDLTRAATS
FT                   LTAGNYRIRVPAGEAGPEVTTLAHAFNTMADRLEHTEQVRRQMLSDLAHEMGTPLSVLT
FT                   VYFDGLQDGVVDWNNATHTIMADQLTRLTRLMEDIDDVSRAQEHRIDLDLAEEGLGDLL
FT                   HTAAAAAGEAYADKGVDLQVETITDTVRVLVDRQRFGQVMSNLLSNALRHTPAGGQVRI
FT                   SVRRQGASTALIHVADDGEGIPPGQLGHIFERFYRGDAARSRDNGGAGIGLTISKALIE
FT                   AHGGTLTATSPGPGAGSVFTIRLPLHQENVSLMLGDPTPGDNNSDDLGSDPYQPLDNTP
FT                   "
FT   CDS_pept        144249..144581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53085"
FT                   /db_xref="GOA:A4QA40"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA40"
FT                   /protein_id="BAF53085.1"
FT                   /translation="MTTPTSPLLPLASDGCGCCAPSTPSATVSAPAVAAATDATPEGPT
FT                   TYQVTGMTCGHCAGNVTEAVSALPQVDDVQVDLIAGGVSIVTVTGSVPLETVHRAIEEA
FT                   GYTVLS"
FT   CDS_pept        144632..146854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53086"
FT                   /db_xref="GOA:A4QA41"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA41"
FT                   /protein_id="BAF53086.1"
FT                   /translation="MSTPHHHGDHPAPETDHTHHPNHAGHEHHADAATHGQAMPHDHPH
FT                   STVDEEHQVHSHGEHAGHSAAMFRDRFWWSLILSVPVVFFSPMFADLLGYNIPEIPGAY
FT                   WIPPVLGTIIFLYGGTPFLKGAMTELKSRQPGMMLLIAMAITVAFIASWVTTLGLGGFH
FT                   LDFWWELALLVTIMLLGHWLEMRALGAASSALDALAALLPDEAEKVVDGTTRTVAISEL
FT                   AVDDVVLVRAGARVPADGTIIDGAAEFDEAMITGESRPVYRDTGETVVAGTVATDNTVR
FT                   IRVEATGGDTALAGIQRMVADAQASSSRAQALADRAAAFLFWFALIAALITAVVWTIIG
FT                   SPDDAVVRAVTVLIIACPHALGLAIPLVIAISSERAAKSGVLIKDRMALEHMRTIDVVL
FT                   FDKTGTLTEGAHAVTGVAPATGIAEGELLALAATAEADSEHPVARAIVTAAAAHPEASQ
FT                   RQLRATGFTAASGRGIRATVDGAEILVGGPNMLREFNLTTPGELADITGSWAQRGAGVL
FT                   HVVRDGEIIGAVAVEDKIRPESRAAVRALQARGVKVAMITGDATQVAQAVGKDLGIDEV
FT                   FAEVLPQDKDTKVTQLQERGLSVAMVGDGVNDAPALARAEVGIAIGAGTDVAMESAGVV
FT                   LASDDPRAVLSMIELSHASYRKMVQNLVWATGYNIVAVPLAAGVLAPIGVLLPPAAAAI
FT                   LMSLSTIIVALNAQLLRRIDLDPAHLAPTDGKEEHSGSISPVTVTD"
FT   CDS_pept        146902..147516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53087"
FT                   /db_xref="InterPro:IPR011438"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA42"
FT                   /protein_id="BAF53087.1"
FT                   /translation="MKRSITLAALVLTSTLALTACSDATDNSDDADTTSTTTATAETNE
FT                   THQEDTTTADDGGHDMEHPEDGGPPPEGITEATDPTYPVGSEVMLTADHMPGMDGAQAT
FT                   ISGAFDTTTYSVSYTPTDGGEPVTDHRWVVHEELVDPGEAPLPGGTEVVLNAEHMPGMQ
FT                   GATATIDYSTQETVYMVDIDTGEMTMINHKWVTESEIQPAE"
FT   CDS_pept        complement(147872..148357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53088"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA43"
FT                   /protein_id="BAF53088.1"
FT                   /translation="MAVIISRRSSYCPNFATAPINTGRCDHAEQGHRGQGGRGSEHVSG
FT                   ADQADASQWHIVATRAHVLPSLLGKGEQAFLGIQIRPQARDTANDFVHKALALPETLAL
FT                   YNVSGNEDYLVHVAVSDSTALQALIIDKFLALPQVAHCRTQLIFGDPWVAPLQHSPE"
FT   CDS_pept        148521..148640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6005"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21067"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VIC2"
FT                   /protein_id="BAQ21067.1"
FT                   /translation="MPLSWTSTLGGTGRYLIGRLSSWRVDETYIRVGGRWCYL"
FT   CDS_pept        148597..149076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53089"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA44"
FT                   /protein_id="BAF53089.1"
FT                   /translation="MRPISGSAAGGATSDLAITAGGHTLDFYLSPKRNVAAAKRFLAKA
FT                   LRSNASAGFPRVINTDKAPSLARAIAELKSEGICPQTVEHRQVKYLNNILEGDHGRLKR
FT                   ILGPKGAFKNLDICISDVEREGGDALIAERARHDVCPHGQPNPDAVIVNQVFETA"
FT   CDS_pept        complement(149259..151136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53090"
FT                   /db_xref="GOA:A4QA45"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA45"
FT                   /protein_id="BAF53090.1"
FT                   /translation="MKTWKTWGVVAVSGLLIILSWLTPAGWLSDGFMIAAAVVAGWQIA
FT                   VSAVQALRIRMISIDLLVIVAAIGALFINNYWESAAVTFLFALGKALEKATMNRTRKAL
FT                   SDLVDAAPETATVLRDGEPETVEIWELAPGNVVLVKNGEQIPVDGRVLSGHGGVDEATI
FT                   TGESVPAEKAEDSEVFAGTWLRSGVLRIEAIGIGSDSTLAKIIHRVEDAQDDKAKTQTF
FT                   LEKFSKYYTPGVMVAALAVGLITLNVELALTLLVIACPGALVISIPVSIVAGIGRSAKD
FT                   GVLIKGGEYLETSAKVDTVVVDKTGTLTNGRPELTNVDVLDPAYSDDEVLTLAARAETA
FT                   SEHPLAEAIIRGAENKGLTIEMVEKAKPVTGKGIIAKVDDHTVAVGSADLLDHAPDTTR
FT                   ILELNDQGKTAMYVGVDGKAVGIVAVADTIRDDAPAAIRSLHDKGIRVVMATGDAERVA
FT                   RNVAAELGVDEVRAELMPEDKLEIVKELQAQGRVVAMVGDGVNDTPALAQADIGVAMGA
FT                   AGSPAAIETADIALMADKLPRLPYALGLAQRTVRTMRVNIAIALATVAILLVGVLLGGV
FT                   TMSIGMLVHEASVLIVIAIAMLLLRPTLKEDKDKADVSTADAAKETLSA"
FT   CDS_pept        151173..151325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5000"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53091"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA46"
FT                   /protein_id="BAF53091.1"
FT                   /translation="MTLIKLGQFRRNFLDLDQLPTHLRPDEVEQKSMPRGVDHAPFPGT
FT                   RIGGV"
FT   CDS_pept        complement(151322..151591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53092"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA47"
FT                   /protein_id="BAF53092.1"
FT                   /translation="MPYATATPAYHSVAALYRVSRPAGQDDTIHLGHLKETRDAYQRRV
FT                   DDDLTLFPSLAAPDPHDRHPIREWLSTHTGPLMDAGCTAKPSAY"
FT   CDS_pept        complement(151712..152029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53093"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA48"
FT                   /protein_id="BAF53093.1"
FT                   /translation="MAEVTFASLHEKMNFLLKDHGVENFDESDLDLESVSSLHAKANAL
FT                   CAAHGGDPSRMANDTLAQLHPKLDFLMKGHGVDTDTARLDLSTLEAVDAKVNAVVNAHD
FT                   H"
FT   CDS_pept        complement(152234..152470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53094"
FT                   /db_xref="GOA:A4QA49"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA49"
FT                   /protein_id="BAF53094.1"
FT                   /translation="MTAPATLKNTTLRSDEFTCPSCVAKIENKLNGLDGVENAEVKFSS
FT                   GRILITHDPQKVSVRDLVTAVAEVGYTAKPSAI"
FT   CDS_pept        complement(152626..152898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53095"
FT                   /db_xref="GOA:A4QA50"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA50"
FT                   /protein_id="BAF53095.1"
FT                   /translation="MQQHPTSTVEQRVAAALQHLDAKLGQIRQDGSSLLQVRLRRDDVA
FT                   GMAGTTVESASRAMARMKKTGVIDSGREWIAITNHQALADLVAGL"
FT   CDS_pept        153048..153215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53096"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA51"
FT                   /protein_id="BAF53096.1"
FT                   /translation="MAYLLSTIEPGTSWPRQLAELVEQFPTTEQIGIESMGLPPNWKDL
FT                   TLWAQTSPPS"
FT   CDS_pept        complement(153413..154030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53097"
FT                   /db_xref="GOA:A4QA52"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA52"
FT                   /protein_id="BAF53097.1"
FT                   /translation="MALIGYMWVSKADGSQTTDLQRDALIKAGVDPDHMYEDNASGKKE
FT                   DRPELASCLKALRAGDTLLVWKLDRLGRNLRHLVNVVHDLTARGVGLKVLTGQGAAIDT
FT                   TSAQGKLVFGIFAALAEFERELISERTKAGLESARARGRKGGRPFKMTPAKVRLAMASM
FT                   GQTETSVAALCKELGITRQTLYRHVSPTGELREDGRKLLTGS"
FT   CDS_pept        154523..154765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53098"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA53"
FT                   /protein_id="BAF53098.1"
FT                   /translation="MHFTPTYSSWINQVERLFAEVTRDLLQRSEHRSVQALEKDLRNWV
FT                   KAWKGDPRLLILDQDIRGDPCIIARYLKRINGAGH"
FT   CDS_pept        complement(155013..155615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53099"
FT                   /db_xref="GOA:A4QA54"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA54"
FT                   /protein_id="BAF53099.1"
FT                   /translation="MTDHRGLPVFVRHRPFALLMLVTGAIGWVASAILVLERLALYEDT
FT                   GYVTSCDINPWVSCGKVMDTWQSAVFGFPNPLIGIVAFAIVITTAMAALSGARFSPWYW
FT                   LGLQVGVSMGLLFVFWLWYQALFVIHVLCLYCMVVWAVMIPLFILLTARNLVYGIIPAP
FT                   GPVVRFVPTWAGTLITVVYVAVAVSVFSRFFTVFTGL"
FT   CDS_pept        complement(155671..156354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53100"
FT                   /db_xref="GOA:A4QA55"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA55"
FT                   /protein_id="BAF53100.1"
FT                   /translation="MITPSSANSHRAKIIVWTVLAIIVIAGIVIFVVNRSDSSQSATPE
FT                   TMASDAGQIVRENSRVLSQAPNEKAVLVEFLDFECEACRAAYPLVEELREEHSDTVTFV
FT                   NRYFPLPGHRNSLTAATAVEAAAQQGQYEAMYQKMFETQDQWGESAEDKSAVFRGFAQE
FT                   LGLDMAAYDTAVADPATEERIRLDVADGTALGVSGTPTFFLDGQPLLPESLEQFRAEVA
FT                   AAATD"
FT   CDS_pept        complement(156396..156719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53101"
FT                   /db_xref="GOA:A4QA56"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA56"
FT                   /protein_id="BAF53101.1"
FT                   /translation="MTVTHTSALSRIGHALYDDTRMAILLALRNGAARPSELAQQLGVS
FT                   KQVMSNQLSCLRGCGLVTSTPEGRHVWYTLADPRLRDALGDLLIPVLTIDPDCCSPEGC
FT                   TCA"
FT   CDS_pept        complement(156873..157622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53102"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA57"
FT                   /protein_id="BAF53102.1"
FT                   /translation="MRTTTRQSTPGRHRKITASPTRKGRIALVAVAAGTISSAGAGGAA
FT                   AATLQTPDETPASAESTVGDIELATSDTALSSSAVELVPQILTIAEYKPVDNLDEQLIK
FT                   AVEYNNERAEAEQAARAPSVVKPTEGTFTSGYGVRWGSVHKGLDVANVVGTPILAAMGG
FT                   TVIDSGPASGFGQWIRIQHDDGSIAVYGHMETLDVTVGEQVTAGQKIAGMGNRGFSTGS
FT                   HLHFELYPAGSDAVDPAPWFAEHGITF"
FT   CDS_pept        complement(157789..158430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53103"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA58"
FT                   /protein_id="BAF53103.1"
FT                   /translation="MSNDHNRLTERPDHGFGRSRGGLSTKTHALVDGQCLPLVTLIGPG
FT                   HAGDNPQAVPLLEGIRVPRPVGRPRTVPDELRGDKAYSSREVRTWCRKRRVKVTIPEPA
FT                   DRVRNRKRKGSKGGRPPAFDEQSYKGRNVVERRFYEFKQWRGVATRYDKLSVVFRAGVM
FT                   CKAHGHLAEAFIKHTLGDHPHCGDGLNVTVISRWGGTGVIDQPETSARPL"
FT   CDS_pept        complement(158420..158788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53104"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA59"
FT                   /protein_id="BAF53104.1"
FT                   /translation="MSRFQLLTDDQWALISDKLPHRIGKKGRPFSDPRLMLEGIIYRLR
FT                   CGIPWRDLPECFGSWHTVYHWYNRMAKDGIFDEIVTTLIAAADHQGLVDWSVSIDSTIS
FT                   RAHQHATNITRHTGGFVE"
FT   CDS_pept        complement(158905..160926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53105"
FT                   /db_xref="GOA:A4QA60"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA60"
FT                   /protein_id="BAF53105.1"
FT                   /translation="MTHPVNNTPTATDTTAGTTPTIGSRPQERVHPTWPLYLLFFTVAG
FT                   AIGGTVAYSFLGESLAALGIPNPGIATTFGLPFFRAVGWMLAALSAGSFLFAAFLISPR
FT                   LPGGDHDRLHQASLSVDGHLASRTGAVAAICFGLIALLMIPLVLSDVSGTPLAQTLGLE
FT                   TLTVAVEQVAMAQVWLIVALIALVTGGTGLMSRAWITQPLLLLGSILMIIPLGLTGHSS
FT                   SGGNHDHGTNSYLWHLVFLVLWVGGLMALLAHGRRLGPDLDIALRRYSTIALVSIIVMA
FT                   VSGLVNAAIRIELTDLLTTRYGLIIVAKTIGVIILGVFGWIHRAWVIPQVQANPADRRL
FT                   FRQVAIVEVLVMAAVTGIAITMGRTPPPPPRIPNLSQMATKLGYELSEKPTILNVWGMW
FT                   RFDLLFGALALLLAVGYLSAVWRTRQTGHTWSSTPTAWWLAGCVTLLVTMSSGIGLNMP
FT                   AVFSVHMVGHIILSLVIPIFLVMGAPLTLLMTAFAPGAPGRPNIHDWVRAFTRSRLVGV
FT                   ITHPVVNTLQFLVFFYVMYLFIPLYELLISKYAGQLIMNTVLLVSGSIYFWGLMEPDPV
FT                   PHRRPAPVRLAWLLASLPVHVGFGVYLSQLTTVMGEEFYRSLLLPWDIDLLADQHAAVT
FT                   AWAIGGIPLLLAIILLIRQWRDIRRRPHDQAPLAVPAE"
FT   CDS_pept        161224..161808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53106"
FT                   /db_xref="GOA:A4QA61"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA61"
FT                   /protein_id="BAF53106.1"
FT                   /translation="MIISPMLPRRVLATVVAVGALTVVATPVALAHDSVIGGNPADGDV
FT                   VEEFPRSIELEFSGLPQEGFSTVAITDQDSGDLLFSGEPTIDGRLVTLDLPADVSGGPG
FT                   DYTVGFQILSSDGHATRSATTFTVAGDAQTTATPTGADAKPVEETTAVENTAEGDTSIV
FT                   SNPIVLTLAGLALFGVIAGAIVLAVRNRDRR"
FT   CDS_pept        161985..162350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53107"
FT                   /db_xref="GOA:A4QA62"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA62"
FT                   /protein_id="BAF53107.1"
FT                   /translation="MLTIASRLDVMNRLGRAMADPTRSRILLSLLESPGYPAQLAETLG
FT                   LTRTNVSNHLACLRDCGIVVAEPEGRRTRYEIVDAHLARALNALVEITLAVDEDAPCLD
FT                   PACPVAGCCDTEGGQQS"
FT   CDS_pept        162347..164317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53108"
FT                   /db_xref="GOA:A4QA63"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA63"
FT                   /protein_id="BAF53108.1"
FT                   /translation="MTSACGCEPSAPMAREEEHTPWWRDRAILLPVASGVSLLVGLILE
FT                   WFVPNAGMIALVLFWASLLLGASQFVPGALKGLFTRGKLGIGLLMTISATGAVLLGFIE
FT                   EAAALAFLYSIAEALEDKAMDKARSGLRSLLALIPSTATILVRGSTRTVPVEDLAPGDV
FT                   LRLAAGDRLATDGIIRSGHSSLDVSAITGESIPVEVGPGDAVLAGSINTTGALEVEATA
FT                   GGTDNSLTTVVALVEQAQSEKGQRARIADRLARPLVPGVLILAIFVAVIGSLFGDPGVW
FT                   IERALVVLVAASPCALAISVPVTVVSAIGAASKFGVVIKSGAAFERLGGIRHLALDKTG
FT                   TLTRNQPTVAEVLTIDGISRADVLGWAAALEDHSTHPLAAAITAAAPQAPTAQQVDETA
FT                   GQGITGVIDGTQIKVGSPRWLSPGPLVGQVETLESQGMTVVIVYRDDHPVGAVGVRDEL
FT                   RPEAPEVIRTLTDKGFGVTMLTGDNTRTATALAREAGITDVRAELRPEDKATAVAGLGT
FT                   RGPVAMIGDGINDAPALARADIGIAMGAKGSDAAIESADVAFTGDDLRLIPRALHHARR
FT                   GRAIINQNIVLSLAIIIVLLPLAITGVLGLAAVVLVHEVAEVIVIANGLRAARTQHPDL
FT                   KPVEATTVTADEDAYGRSRVS"
FT   CDS_pept        164347..165420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53109"
FT                   /db_xref="GOA:A4QA64"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA64"
FT                   /protein_id="BAF53109.1"
FT                   /translation="MYFPPDGAVDFMAVSSTHERRYGRAPQKKGWRTFLRPGWVFGVLA
FT                   IIAFSYVAFTFLAPWQLSRDSTIVERNEQIEAAFEVELVPAEEIFDAQGSIEPGKEWAR
FT                   VILQGHYLPEDEVLMRNRPVDSSPAFHALTPFQLNSGEIILVNRGFNPPLEGGVPPMDT
FT                   APAGEQSIVGHARFTEQTPMSPPIEDQGYRQVYGINTAQISEVIGMDLAEDYVQLAEGQ
FT                   AGEINAIPVPMLDRGSHLSYAFQWIAFGIMAPLGLGYFIWAELKERRRVRREEAELADG
FT                   SASSQQTGDSQDEETDSDPVGALRTIHPENDTQGLAHAQATTSASSGARARMLHDRYGD
FT                   SQPNHSRKFTNRRHERF"
FT   CDS_pept        165544..167631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53110"
FT                   /db_xref="GOA:A4QA65"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA65"
FT                   /protein_id="BAF53110.1"
FT                   /translation="MSEHQHDHDPGHRTAPNGSPTTLPPTSAATHTQDHAHGSARWELW
FT                   FAIAAGVTYTGGMIAEFALGLPMVGWPLAFFLATYFFGGFFTIRTAISSTLRGKFEVDF
FT                   LMLVAAVGAALIGRWAEGAVLLFLFSLGHALEEYALSRASKSIEALAELAPRSALVRRG
FT                   ETEPVEVPVEELVVGDIVVIRPNSRIPSDGFVISGMSAVDQSAVTGESIPVEKEPVSDP
FT                   TRTMHTVGTLPATNRVFAGTVNGSGLLEIEVTATAADSTLSKVVELVRTADQAASPTQQ
FT                   FIDRFQRWYVPAVILGVIATLLVSMFAFAQPFRDAFYLAMTVLVAASPCALAIATPAAV
FT                   LAGVARAARAGVLVKGGAPLETLGRVEAIAFDKTGTLTWGAPRVTSLVPADDTSESELI
FT                   PTLVSVESLSDHPLAAAIVRDLAPRVPETGRLVATDLSALTGRGITATIDGERVEIGNL
FT                   RMFDEQQLELPSSLAKAYAEARDSGQTLMIVRRGDRFLGVVGVMDASRAESAQVLNALR
FT                   DTGVGHLVMISGDNQRVADAVGQEVGVDTAIGELLPEDKVTHITSLAKTYRPIAMIGDG
FT                   VNDAPAMARADVGIAMGAAGSTVALETCDIALMSDDLGRIPFAVRLSRAASRIIRQNLI
FT                   ASLAIVVFLIIATFLGLNIGAVVLIHEGSTLIVVANALRLLNFQKGQEHAGIDHEEKPT
FT                   H"
FT   CDS_pept        167920..169011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53111"
FT                   /db_xref="GOA:A4QA66"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA66"
FT                   /protein_id="BAF53111.1"
FT                   /translation="MAHRGPALAPLTLTDDERDQLQRWVRRRKTTQDLALRSRIVLECA
FT                   TGASNSEVARRLGISLPTVGKWRARFIDKRLDGLVDEPRPGRPATIGIDRVEQVIIDTL
FT                   ESTPANATHWSRASMAEKSGLSKSTVGRIWKAFGLKPHLEEGLKLSNDPFFTEKIYDIV
FT                   GLYLNPPESAVVLCVDEKSQVQALQRSQPAFPMMPGTPERRAHDYVRHGTTSLFAALNV
FT                   ADGTVISQVHRKHRSVEFRKFLVKIDKTVPEGLDVHVICDNYATHKHPTIQTWLGKHPR
FT                   FHMHFTPTYSSWINQVERVFAEVTRELLQRSDHRSVQALEKDLRDWVRAWNENPKPFIW
FT                   TKTAEDILDSIARSLQRINGAGH"
FT   CDS_pept        complement(169111..169341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53112"
FT                   /db_xref="GOA:A4QA67"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA67"
FT                   /protein_id="BAF53112.1"
FT                   /translation="MSTLPETTPIEQLVRLGKIRWRIEHDYRELKHGLGLDHFEGRHWL
FT                   GWHHHTTPVTAAHLFITMKRLAAGPKALPAA"
FT   CDS_pept        complement(169439..169759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53113"
FT                   /db_xref="GOA:A4QIG9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A4QIG9"
FT                   /protein_id="BAF53113.1"
FT                   /translation="MKFTENLALQGITPSIGSVGDAYDNALMESSNGLDKTECIGSRIF
FT                   TAQNLESIVDVELATMAWVQWHNHHRLHSTLGMVPPAEYEESYWAREATIPGSPATAAH
FT                   PI"
FT   CDS_pept        complement(169746..170393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53114"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A4QIH0"
FT                   /protein_id="BAF53114.1"
FT                   /translation="MIVAFIDQMKKEGFAVESARHVLREQGVQVAARTYHHWKKVPATR
FT                   TMTDAQILNALYELRDAPESLYGRRKMVAHLRRQGHARAHCTVGRLMRLAGMNGIFRRR
FT                   TTVRTTIPGSGDRAPDLLNRNFTAEASNRVWVADFTYARTGSGWVYVAFIVDVYSQRIV
FT                   GWHAQTSRGVELVRIPRYPALWERDRTQRPVVRGELTHHSDAGSKSHRGEIH"
FT   CDS_pept        complement(170447..171598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53115"
FT                   /db_xref="GOA:A4QA68"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA68"
FT                   /protein_id="BAF53115.1"
FT                   /translation="MAKIGRPGLPQDQRQKVWDLWKTGSSISDISRDVGSPPGSIFSIL
FT                   LPRGGIYLPAQKHHPGTLTLAEREEISRGLSVGLSYRAIARLTGRSASTISREVTRNRG
FT                   RTAYRAIDADDRSWRQARRPQRCKLAKNPVLRGYVAARLREDWSPEQIAGRLKITYACT
FT                   SRMQISHESIYKSLFIQSRGVLPKDLQKHLRSRRPIRKARSNTTSGQWRSQIKDAVSIS
FT                   KRPKEAEARVQVGHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRE
FT                   LGQLPDQAKRSLTWDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYF
FT                   PKKTSMKGFSQTDLDQVADKLNNRPRKVLGFRTPAEQYEALLR"
FT   CDS_pept        complement(171688..171885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53116"
FT                   /db_xref="GOA:A4QA69"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA69"
FT                   /protein_id="BAF53116.1"
FT                   /translation="MVQQHREDYRSLTVTCTAVGDELGVSRETLRNWVRQAEVDAGHVP
FT                   GVSTEENEEMTRLRKENKRL"
FT   CDS_pept        complement(171947..172573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53117"
FT                   /db_xref="GOA:A4QA70"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA70"
FT                   /protein_id="BAF53117.1"
FT                   /translation="MVSGLLSAIGLFLATNIDDIIVLSLFFARGAGQKGATARILVGQY
FT                   LGFVGILGAAVLVTLGAEAFLPEQAIPYFGLIPLLLGLWAAWQAWRSDDDDDDAGKVAG
FT                   KKVGILTVAGVTFANGGDNIGVYVPVFLNVGTATVITYCVVFLVLVAVLVLLAKFVATR
FT                   PPIAEVLERWEHVLFPIVLIGLGIFILVGGGAFGLNRHGFLAAFQ"
FT   CDS_pept        complement(172573..172932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53118"
FT                   /db_xref="GOA:A4QA71"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA71"
FT                   /protein_id="BAF53118.1"
FT                   /translation="MLTIASCLDVMNRLGRAMADPTRSRILLSLLEAPGYPAQLARELE
FT                   LTRPNVSNHLACLRDCGIIVAEPEGRQTRYEIVDAHLAQALNALLDVTLAVDEHAPCLD
FT                   SGCDVPGCVTGQEGM"
FT   CDS_pept        complement(173112..173810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53119"
FT                   /db_xref="GOA:A4QA72"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA72"
FT                   /protein_id="BAF53119.1"
FT                   /translation="MDLSEITPVAQDYLKVIWAATEWGGPPITATALAARMGTTTPNVS
FT                   DTVKRLAAQGLVEYQPYKPVMLTERGEKYAIAMVRRHRLLETFLATTLGYPWEEVHDEA
FT                   ERLEHAASETMIERIDALLGNPATDPHGDPIPTATGHISRSIDAIRLTHVVPGDYVIIR
FT                   ISDADSSQLAGFRRQEIVPGAIVNVAGADPRQDRVLLKGADGKEVILTTEQANAIWVAP
FT                   SPGLRGSTSL"
FT   CDS_pept        complement(173840..175054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53120"
FT                   /db_xref="GOA:A4QA73"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA73"
FT                   /protein_id="BAF53120.1"
FT                   /translation="MSRQPLPWLLGPAFVAAVAYVDPGNVAANITAGAQYGYLLVWVLV
FT                   VANVMAMLVQYLSAKLGLVTGYSLPELLGQRLPRGRRLMFWAQAETVAAATDLAEVIGG
FT                   AIALHILFGLPLLIGGLLIGLVSMLLLAIQSRHGQHPFEFVIVGLLVIITAGFLTGMFI
FT                   GTVSWGEALAGVIPRFEGTPTVVLAASMLGATVMPHAIYAHSSLARDRHGDTIAPEALP
FT                   RLLRVTRWDVLLSLLVAGSVNIAMLLLAAGNLNGIPGTDSIEGAHAVITDTLGPVVGVA
FT                   FGVGLLASGLASTSVGCYAGSTIMGGLLHRQIPQVVRRAVTLIPALIVIAAGVEPTWAL
FT                   VLSQVVLSLGIPFALIPLVVLSSDQTLMGGFAIRVPLQVASWVVVALIVSLNLALIGLL
FT                   VTGRG"
FT   CDS_pept        complement(175421..176038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53121"
FT                   /db_xref="GOA:A4QA74"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA74"
FT                   /protein_id="BAF53121.1"
FT                   /translation="MALIGYMRVSKSDGSQTTDLQRDALIAAGVDPGHLYEDRASGKQE
FT                   DRPHLDACLKALRPGDTLLVWKLDRLGRNLWHLVNIVHDLTAREVGLKVLTGQGAAIDT
FT                   TSAQGKLVFGIFAALAEFERELISERTKAGLESARARGRKGGRPFKMTPAKVRLAMAAM
FT                   GQPETSVAALCKELGITRQTLYRHVSPTGELREDGRKLLSGS"
FT   CDS_pept        complement(176226..176858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53122"
FT                   /db_xref="GOA:A4QA75"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA75"
FT                   /protein_id="BAF53122.1"
FT                   /translation="MVMDIGYARVSTAKQDLDRQIDALRKEGVADKYIYVDKKSGSTTN
FT                   RPGLQQALEQARAGDVIVVHTLDRLGRTVRDTLNLIHDLQEREVGVRTLADPIKVDSSN
FT                   PNDPMAQLAVVILSLFGQMERTYAVERAAHARAVAEAKGKRVGRPSVVDPDKLRYAEHL
FT                   RNEGYSMSKIVEKTGITRSSLYRHLPPRPVETHTAADIPDASHPTLG"
FT   CDS_pept        177202..177561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53123"
FT                   /db_xref="GOA:A4QA76"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA76"
FT                   /protein_id="BAF53123.1"
FT                   /translation="MLTIASRLDVMNRLGRAMADPTRSRILLALLEGPAYPAALAQDLE
FT                   LTRSNVSNHLACLRDCGIVVAEPQGRQTRYEIVDAHLVQALNALLDITLAVDDNAECID
FT                   AGCAVPGCVTGQESA"
FT   CDS_pept        177561..178154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53124"
FT                   /db_xref="GOA:A4QA77"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA77"
FT                   /protein_id="BAF53124.1"
FT                   /translation="MVTGLLSAIGLFIATNIDDIIVLSLFFARGAGQKGTTLRILAGQY
FT                   LGFMGILAAAVLVTLGAGAFLPAEAIPYFGLIPLALGLWAAWQAWRSDDDDDDAKIAGK
FT                   KVGVLTVAGVTFANGGDNIGVYVPVFLNVDTAAVIIYCIVFLVLVAGLVLLAKFVATRP
FT                   PIAEVLERWEHVLFPIVLIALGIFILVSGGAFGL"
FT   CDS_pept        complement(178413..179834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53125"
FT                   /db_xref="GOA:A4QA78"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA78"
FT                   /protein_id="BAF53125.1"
FT                   /translation="MPTKYDLAIIGSGGGAFAAAIRASTLGKSVVMIERGTLGGTCVNT
FT                   GCVPSKALIAAAGARHVAVDAATRFPGIATTADPVDMPALIAGKQALVESLRGEKYADV
FT                   ADSYGWQVLRGDASFVGTPDAPVLDVAGADRSVETIEAHHYLVATGSRPWAPPIDGLEE
FT                   TGYLTSTTAMELTEVPESLLVLGGGYVALEQAQLFARLGSQVTLLVRSRLASKEEPEVS
FT                   KALQEVFADEGIRVVSRAVPTRVSRGTGGEAVVTAAVSGGSQEFRADQVLVALGRRPVT
FT                   DGLNLDAVGVKTGDSGEVVVSDRLQSSNPRIWAAGDVTGHPEFVYVAAHHGTLVAENAF
FT                   ADADRSVDYARLPRVTFTGPAIGAVGMTEKDVLAAGIRCDCRVLPLHHVPRALVNRDTR
FT                   GFIKIVVNAETNEILGLTAVAKDAGELAAAGVHVLGRTVAEVADAWAPYLTMAEGIRIA
FT                   AKAFTTDPSLLSCCA"
FT   CDS_pept        179933..180322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53126"
FT                   /db_xref="GOA:A4QA79"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA79"
FT                   /protein_id="BAF53126.1"
FT                   /translation="MRIGELAERAGTTAKTLRFYEEQGLLPPTERTPSGYRDYAPETVA
FT                   RIDFVHRGQAAGLTLAQIRQILDIRDGGHAPCEHVRDLLDVRLAEIEQQIAQLSVLRDT
FT                   IADLRQDAAHPDPETCSTDQVCRYL"
FT   CDS_pept        complement(180427..180819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6006"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK05"
FT                   /protein_id="BAQ21068.1"
FT                   /translation="MVKVSQAMADSFQQALSSNKYSSDRLYDSFDKTKSILTQVISDPN
FT                   SSEESRRDAFDRLERLDDKLMEHDVNNKRFNLQSLQINKEAFIIGSVLVASAVVATINP
FT                   EAKNFLAQNAPKVLSSTAKMLLPGKK"
FT   CDS_pept        181086..182033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53127"
FT                   /db_xref="GOA:A4QA80"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA80"
FT                   /protein_id="BAF53127.1"
FT                   /translation="MNLHSDAREFLKSRRDRVTPQAAGLPSYGRNRRVPGLRREEVALL
FT                   AGVSVDYYTRLERGNLSGVSEEVLAAVAGALQLDEAERSHLFDLAKATNSQSLRRRNTR
FT                   GATRAQEKVRPEVQRILDAMADTPAFILTDRADMLTTNQLGRALFAPLYDSPVSPGTSG
FT                   QAETVNIARFTFLDPVAREFFPHWEHNAADLAASLRSTAGRHPHDTVFSNLIGELATRS
FT                   QDFAQLWADHNVRLHRVGRKTLHHPIVGDLELDFETLILPADPDQSLIVYSAAPGSDAA
FT                   QNLRLLASWTVTGTDKTGTDRAFHPADDVPSLEE"
FT   CDS_pept        182030..182380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53128"
FT                   /db_xref="GOA:A4QA81"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA81"
FT                   /protein_id="BAF53128.1"
FT                   /translation="MTPQSAPSHPVPTIELNNNVSMPALGFGVFQTPPADTMTAVTTAL
FT                   GTGYRHIDTAAAYGNEREVGQAIATSGLSRQEVFIETKVWITDYGYDKTLHAFDKSAGK
FT                   LGVDTIDLLILH"
FT   CDS_pept        182480..182938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53129"
FT                   /db_xref="GOA:A4QA82"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA82"
FT                   /protein_id="BAF53129.1"
FT                   /translation="MVPHLDRLMDRATVAPAVNQLEIHPYFQQREVLARNAELGIISQA
FT                   WSPIGGITFYRDSGHGSTLEDPTIGEIAADHAKTPAQVMLRWHLQQGRQVIPKSVTPSR
FT                   IRENFAVFDFELSSDELASIDALDTGVRGGPEPEQVTLASFGIEIPEA"
FT   CDS_pept        183403..184170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53130"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA83"
FT                   /protein_id="BAF53130.1"
FT                   /translation="MDTDDSAHMPDAVIKASRQPANIEIAHQVGEVIAHMLGDGQSVID
FT                   PTETIWTAEAAEDLRARIGDNPILGSDKGQWDKLDHQLDGAPRAVVLLAAELVFLREHA
FT                   LYVALPTTRLAHVERVLAHLDPPVAIKDPMATWLSRPVRTAGFDPGSWYNGALWRHLIW
FT                   AATFVRHWKELPEDKRETAKNNPWAFQQVMLASGTDRSDIRNALQFLAFPQAFEPISAA
FT                   SMKTEIRNGLAHLIGGATGSTPAAIDSDLLAIR"
FT   CDS_pept        184222..185643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53131"
FT                   /db_xref="GOA:A4QA84"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA84"
FT                   /protein_id="BAF53131.1"
FT                   /translation="MERWNNKPQPEASEDSEDLELAEPRPRHYWLYSPGPQASEWDEFS
FT                   SESIMAIGWDDLDDLSTYPSREAIRQALNVDGAGGSQTNATLALWQFQNDMTVGDIVYA
FT                   KEGRQKIVGRGEITSNARFEPERESYRHVRSVKWTHIGKWDHPGDAVTKTLTDITKDHD
FT                   YVEKLEALITDEVDTEQLVSPSTAPIYDKAAFLSEVYLSETRYVRLRSLLGRKKNVILA
FT                   GPPGVGKTYAAKRLAYSIMGTKDPSRVQMIQFHQSYSYEDFMMGYRPTENGGFIISEGP
FT                   FYRFCEKARADDADRPYFFIIDEINRGNISKIFGELLMLIESDKRGQELRLLYKNETFS
FT                   IPANVHIIGMMNTADRSLAVLDYALRRRFGFFELAPAYESAGFAQWIQSADNPMLNRLV
FT                   SVILDLNREIIDDPTLGQGFAIGHSFLSQPVGNADEAWLYSVVEDEIIPLLNEYWFDEP
FT                   VKAEQWADKLRAVVA"
FT   CDS_pept        186192..186713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53132"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA85"
FT                   /protein_id="BAF53132.1"
FT                   /translation="MKLASWLSDDVMSSLYERFLREYYRFHHPDLSPKGSVLSWHYDHG
FT                   SAFGAEQLPVMRTDLTLRKAGRTLIIDAKYYSQSMQSGMSGKETVHSAHLYQILAYAKN
FT                   ADVDQNGSVSGLLLYARTEAVKQPDLDVVIQGNRIGARTLDLNCPWSEISAELESIVRW
FT                   LEDGAEYSRS"
FT   CDS_pept        complement(187252..187968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53133"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA86"
FT                   /protein_id="BAF53133.1"
FT                   /translation="MTSEGRAGRSHHDSHRWVQKYAPELDKHTRWYRQAPDWQASSWRV
FT                   DETYIRVGGRWCYLYRAITAGGQTLDFYLSPKRNVAAAKRFLAKTLRSNASAGFPRVIN
FT                   TDKAPSLAKAISELKEEGICPPTVEHRQVKYLNNVLEGDHGRLKRILGPKGAFKNLDIC
FT                   ISDAEGDGSDALLAERSGDDVCLRATEPGRGDRQPGLRDGLRTLSRRDHGEMKLGRSWP
FT                   LHPTLQQHLITHVNEE"
FT   CDS_pept        complement(188307..188969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53134"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA87"
FT                   /protein_id="BAF53134.1"
FT                   /translation="MLKAQRTRFPLSLLIPPFCHLKQPLIFISYSLHRVEYMKNAKLFL
FT                   ALISAPLILAGCSSTDTGTAESTISSETASAVDATTSTSSSTATSAVIDDDPVFDIIDI
FT                   VLAQYPDGITTDIDREDSSDQYEVDVVVGQEVLELDVTTSGQIHTDDRDNDDDDDIREA
FT                   HAATVTAAQAIGLALDQYPDGIIDSVELDEDDGQLRWKIDLDDTSGNDLADVEIAAV"
FT   CDS_pept        189118..192576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53135"
FT                   /db_xref="GOA:A4QA88"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA88"
FT                   /protein_id="BAF53135.1"
FT                   /translation="MTSMNLPIELATLSDQAVNKVRSWLEYSKKESVPNADAKRLAAVL
FT                   QDPNGLEFTVGFVDRVVRTEDREAAAHALYELGKIAPSTMSFLDRAQIQAGSLVGRALP
FT                   KVVVPAARARIRQMVGHMIVDARDKQFAKAVAEIQSDGHRLNINLLGEAVLGRKEAAKH
FT                   LDDTVRLLRRPDVEYVSIKVSSVASQISMWGFEDTVNYVVEQLTPLYIEAARAPQGTKF
FT                   INLDMEEYRDLRLTMEVFKRLLSNPELHELEAGIVLQAYLPDALGAIQDLAEFGRERVK
FT                   TGGAGVKVRLVKGANLPMEHVHAQITGWPVATEPSKQATDANYKRVLYWTMRKENMEGL
FT                   RLGVAGHNLFDIAFAHLLSVERGVADRVEFEMLQGMASDQARAVSVDVGELLLYVPAVR
FT                   PQEFDVAISYLVRRLEENAASENFMSAIFDLDADNPSFKREESRFRASISDLATLIDVP
FT                   APGPNHTQDRSKETLLDAPLVPFINEPDTNPALIQNQQWATKALATAAEPGWLEKQTKP
FT                   EVLEEGDVDKLINDVRDAAEAWAARPARERAEILYKTAEILRVRRGHLISVAAAEVGKA
FT                   VEQTDPEISEAIDFARYYAHLALELDDVDNAKFTPDRVVVVTPPWNFPIAIPAGSTFAA
FT                   LAAGAGVIHKPSKPSQHCSAAVVEALWEAGVPREVLHCIYPANRDVGRALISHEHVDRV
FT                   ILTGSSETAAMFSSWRPELTINGETSGKNAIVVTPSADRDLAVADLVKSAFGHAGQKCS
FT                   AASLGILVGSVYESERFRKQLVDAASSLIVDWPTNPSATVGPLTELPSDKLHHALTTLE
FT                   EGESWLLKPRQLDDTGRLWSPGIKEGVKPGTFFHLTEVFGPVLGLMKATDLNEAIEFQN
FT                   GNDFGLTGGLQSLDADEVRTWLDHVDVGNAYVNRGITGAIVQRQSFGGWKKSSVGLGSK
FT                   AGGPNYVMLMGTWADAPSHHAPRETNPLISKLDLSGEDIEWLEKANASDETAWNTEFGS
FT                   PRDPSGLDVEANIFRYRPAEVVLRLDDSATPRETARVLLAARRAGVTPRVLQTPGVSEQ
FT                   VREVLSAAGVSAETVDDSVFISNVLRGEYDDNSSVRVRYLGKVSETVRERLAVRPEVVL
FT                   LDDAVTASGRVELRYWLKEQAISMTLHRFGNPVAAFHELAEELKR"
FT   CDS_pept        complement(192648..192887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5001"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53136"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA89"
FT                   /protein_id="BAF53136.1"
FT                   /translation="MNSPTPLPDWLGSTTNCSDRSKRGGSLQVQRPILHESTTDPRFPL
FT                   KRGGSLPCKLPGFTTAPMAPNSTPSRIASKSLQN"
FT   CDS_pept        193058..194005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53137"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA90"
FT                   /protein_id="BAF53137.1"
FT                   /translation="MEHGVTVIKGTEFDVFPLNLGGNTFGWTSNREQTFAVLDAFVAAG
FT                   GNFVDTADSYSAWVEGNEGGESERELGAWIKERGADKLIIATKSGALEPVAGRSREATF
FT                   KAVEGSLERLGVESIDIFYYHYDDEAVSIDEQVAIANDLIAQGKIKHLALSNYSAERLA
FT                   EFFEKSVGTPAQPVALQPHYNLVSRKDYEENVQPLAEKHGVAVFPYFALAAGLLTGKYT
FT                   SKEDISGKARAGQLDRYASDEAFAVVTELRAVADELGVAPTTVALAWLVAHGVTAPIAS
FT                   VSKVEQLKDLMAVKDVELSAEQLARLDKVSEPFA"
FT   CDS_pept        194153..195769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53138"
FT                   /db_xref="GOA:A4QA91"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA91"
FT                   /protein_id="BAF53138.1"
FT                   /translation="MSSTTSKTSERQQPDAPTSKLGKWSDKFLNGVETLGNKLPTPFTL
FT                   FLILFLITALASSIMAWMNVSVIVPGSDEELFVKGLFTGEGLTWLTTNLGANYIGFPPL
FT                   LTVLPILLAVGVAERSGMLAALIRKLFGSAKKIVLPYAVGVIGVTASIMADAAFVVVPP
FT                   LAAMVFKAAGRHPVAGLLGSFAAVGAGYSTAIVPTSLDALFAGITNAVMETLPGIATTE
FT                   VNPVSNYYFNIASSIVLGLLCGFLIDKVLEPRMWRQDIATEYAESVEPISGTGDEEISA
FT                   TLTVQENRALAISMWTTLVTAIVVLVVVLIPGSPWRNEDGGFLPTSPLLSSVVFIVFLF
FT                   FMVMGLAYGMVVGTIKNMDDVVNMMGEAIKDMIGFLVLAFILGQFVALFNWTGIGTWTA
FT                   VQGAAGLEAIGLTGFPAIIAFIILASCLNLLIISGSAMWTLMAAVFVPMFALLGYEPSF
FT                   IQAAFRVGDSATQVITPLNPYMIVILGLLRRYEPDAGLGTLMSRLIPFVIPFWLAWATL
FT                   LAIWFYADLPLGPGSAIFLEG"
FT   CDS_pept        195776..197164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53139"
FT                   /db_xref="GOA:A4QA92"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA92"
FT                   /protein_id="BAF53139.1"
FT                   /translation="MSTDNFSPQVPSTVYLDYMEQGIAARKAEAESNASTQGESPDYPG
FT                   QQVIWRLIQESGESLRDELRTLAFMLHDHPEEAFEEVFATEEITKLLQNHGFEVQSGVY
FT                   GVKTALETSFETPGYDPAQHPSIAILAEYDALPEIGHACGHNIIAAAGVGAFLAVTNMI
FT                   KTAEVKGVDHLDFEGRIVLLGTPAEEGHSGKEYMIRNGAFDGIDASIMMHPFGFDLAEH
FT                   VWVGRRTMTATFHGVSAHASSQPFMGKNALDAASLAYQGFGVLRQQMPPSDRLHAIITE
FT                   GGNRPSIIPDTATMSLYVRSLLPEALKDISKRVDDVLDGAALMAGVGVEKQWDVHPASL
FT                   PVRNNHVLARRWAKTQNLRGRTALSEGILPDTLAASTDFGNVSHLIPGIHPMVKISPEN
FT                   VALHTKEFAAYARTEEAIDAAVDAAIGLAQVAVDALADPKMLIDATLEFTNSGGVLKAG
FT                   DYLA"
FT   CDS_pept        197261..197629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53140"
FT                   /db_xref="GOA:A4QA93"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA93"
FT                   /protein_id="BAF53140.1"
FT                   /translation="MDERSRFARSVFPDGEEPDPRFTLANERTFLAWTRTSLAFLAGGI
FT                   AFEAFQISGLSDTVRTTIAVFIIAVGMIIAAGAAVRWMNVERAMRKQKPLPVPAIIPFL
FT                   SIAALVASAAVLVLIIVQ"
FT   CDS_pept        197632..197949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53141"
FT                   /db_xref="GOA:A4QA94"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA94"
FT                   /protein_id="BAF53141.1"
FT                   /translation="MRIHEDPGLQPERTVLAWNRTTVSLAVCSAILLRWTNFYGIFALL
FT                   PVVILSGMAIFILFTQRVRYERQAIGLADNKLPPNIVGVVSLTVTLLAFGAAGIVFVFI
FT                   D"
FT   CDS_pept        complement(198201..198542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53142"
FT                   /db_xref="GOA:A4QA95"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA95"
FT                   /protein_id="BAF53142.1"
FT                   /translation="MTPLPDLHRRRPGNRENIDRIKAGMYSDAKAYRLRTLREESGLTQ
FT                   ESLAKKIGVGQNRISQIEHGHLTSARVSTVQKYVAALGGSLELTVKRADGSTVTLPAEE
FT                   DLEDLADSK"
FT   CDS_pept        complement(198539..198811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6007"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21069"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VM97"
FT                   /protein_id="BAQ21069.1"
FT                   /translation="MKELRPREKSRAKNIRIVFGFDPHRHAIFLVAGDKTSQWDKWYSK
FT                   HIPEQMKDLATTSNNSRKATNSYLLRENPLIETGTTHPQSLRRTP"
FT   CDS_pept        complement(198981..199769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53143"
FT                   /db_xref="GOA:A4QA96"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA96"
FT                   /protein_id="BAF53143.1"
FT                   /translation="MADSDHMEREQRHKVIMRTVDRPGITRIDALTELTGVSAVTIRRD
FT                   LADLEQAGFLARTHGGAKRVLKRGAPQPFAVRRAEDRAAKHILAQATARLIADDEAVII
FT                   DNGTTCQAVAQELAGRPITALCLSLHSAVALGSRAGTHIFIPGGPVENDTLALSGPAVI
FT                   TAVRDFSADAVILGSCSTSLSHGLATTTYDDAENKRAAINAATRRILVVAARKLNHVST
FT                   FRFADVTDLHQLVTTSDAPREILAEIRDLGVQVITVPAPD"
FT   CDS_pept        199956..200084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53144"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA97"
FT                   /protein_id="BAF53144.1"
FT                   /translation="MVARTATGEKVVPTSPLAQWWAMRWEWFKRTGLQVTGAVLEG"
FT   CDS_pept        200081..200854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53145"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA98"
FT                   /protein_id="BAF53145.1"
FT                   /translation="MKIAAFDFDGTILFPNGIDDRTVEVIHAWQDAGHLAVAATGKSLS
FT                   AAHYALQEVDLVFDYSVLFTGAVVTDRDGTVLHSRSLETGTVRRIVEDLIEIEGAAVFA
FT                   TMLQGRDVRFSSTVLPEVETSILQDFREITTEEIDDYEFIGIPIWVPGNEELKMRIHDW
FT                   LRNTYDVGCVINQDFVDIVPTGTTKGAGLEWLWHYLGRKRCEVEIYTFGDSWNDLPMHD
FT                   LADRSFSFPWSPPGVRVTTDEVIDSVADVLPRLLG"
FT   CDS_pept        201053..201442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53146"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA99"
FT                   /protein_id="BAF53146.1"
FT                   /translation="MRIEITSVFVDDQAKALDFYTTKLGFELKNDVSAGEYRWLTVVDP
FT                   ENPNGVQLLLEPNQHPDATTYQAGIKRDGIPATQFFVDDLEAEFDRLKAAGVEFTMEPT
FT                   DIGPSIIAMLDDTVGNLIQIVQLKK"
FT   CDS_pept        complement(201445..201957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53147"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAA0"
FT                   /protein_id="BAF53147.1"
FT                   /translation="MSPTHRLVILRHAKSSWSTGVLDHKRPLNERGLRDGVAAGQWLAG
FT                   NIGEIDHVLCSDATRTQLTWERVQLGGATAKGSSFHNDIYENQVSEFEHLITGLPEEVG
FT                   TALLIGHWPGVEELANHFGIRDSHPGWNQMDEKFPTSAIAVLEFHVPWSELVENSAKLK
FT                   DFVIPRG"
FT   CDS_pept        complement(201983..203494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53148"
FT                   /db_xref="GOA:A4QAA1"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAA1"
FT                   /protein_id="BAF53148.1"
FT                   /translation="MNTPLQLNTENLQEIASTSGVQIPVFNRADVTPGIVHFGVGGFHR
FT                   AHQAMYLNELMNEGKALDWGIIGMGVMPSDVRMRDALASQDHLYTLTTKAPDGTLDQKI
FT                   IGSIIDYVFAPEDPARAVATLAQDSIRIVSLTVTEGGYNIDPATEDFDHTNPRIVADRE
FT                   ALQAGDTSTLQTFFGLITAALIARKESGSAPFTIMSCDNIQGNGDLAKRFFLAFAHSVS
FT                   SELGEWVENNVAFPNSMVDRITPETTDGDRDDIKEIGYIDAWPVVSEDFTQWVLEDAFT
FT                   QGRPAYEEVGVQVVSDVEPYELMKLRLLNASHQGLCYFGHLAGHHMVHDVMADTRFQDF
FT                   LLAYMEREATPTLKELPGVDLDAYRRQLIARFGNAAVKDTVPRLCAESSDRIPKWLLPV
FT                   VRENLAAGRDVTLSAAIVASWARYAEGTDEQGNPIKIVDRLSERVQENASGNRTDILSF
FT                   IRDRGIFGDLVDAEPFTKAYSETLSSLHDRGAEATIDALLTQVTV"
FT   CDS_pept        complement(203539..204876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53149"
FT                   /db_xref="GOA:A4QAA2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAA2"
FT                   /protein_id="BAF53149.1"
FT                   /translation="MSVQQSGLLERLGIPRPLIFGFIGLTIFMIGDGVETNILEPFLSS
FT                   EHGFSVSLAGTLVTVYGVAVAIAAFFAAALSDLWGPRKVMILGASIWIVFELIFLTVAL
FT                   TTDHTWLIFLAYGLRGFGYPFFAYGFLVWITATASPKQLGTGVGWFYVAFSAGLPTLGA
FT                   LVATISMQYVNLTFYETLWVSLVLVVIGSLIALLGVKERRGRHPLVANPDDVKQTLGQG
FT                   FKLLRNDRRARFVTYIRTINSIPTYAMAVFFPSFFTDDLKWQLSWFLILTTVIYAVNLP
FT                   FNPFFGSFGDRHGWARTVFWSGSIGGAVTLALVYFIPMFGVQAGMSNGVVFGITIAAGA
FT                   LFGVSLAGFVPLSAIAVSLDPKHPGAAMATYNLGVGGAVAVGPLLVAVFHPLIGPTGLI
FT                   LVMIALYLLSGWMTLQLRGTQPGFDGVPALAEDAHIEDLADVNANA"
FT   CDS_pept        205156..206004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53150"
FT                   /db_xref="GOA:A4QAA3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAA3"
FT                   /protein_id="BAF53150.1"
FT                   /translation="MSQVIPASSQEKRRERIVSYVTRHGFARVEALAELFEVSAMTIHR
FT                   DLEALAADTLVERIRGGARSVSPSMSELAVEQRRHLHRTVKEALCTAAARLIPEGAVVA
FT                   IDDSTTLESLVEKLPQRSPSALITHSLKTMADHRVRAGMSDIRLIACAGLYFAETDSFL
FT                   GKATSAQLNELSADISFVSTTAVRATGEAPALFHPDMEAADTKRALIGIGSVRVLVVDS
FT                   SKFGSAGVFKVASIEEFDHIIIDQQCTREQRDLLRNSRAQIHVIDHNGDEILDTPTEED
FT                   F"
FT   CDS_pept        206006..207388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53151"
FT                   /db_xref="GOA:Q1JUZ0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1JUZ0"
FT                   /protein_id="BAF53151.1"
FT                   /translation="MALVLGIDSSTQSCKALLVDAATGQVIDEGRASHPSGSEVDPRAW
FT                   IAALDQATEGLLERADAVSIAGQQHGMVALDENDEIVRPALLWNDTRSAQAALDLNEEI
FT                   GGDQAAVDATGSVYVASLTATKMRWMRDHEPENAARTASVMLPHDFLTWHLMGRGRKVT
FT                   DHGDASGTGYYSTRDRAWRTDLAAWALGHEVELPELLAPNAIAGTTPGGVKVAAGTGDN
FT                   AAAALGLDLQPGDVSVSIGTSGVAGMTVQNSVHDTSGLVTGFADATGAYFPLACTLNGA
FT                   PVLEFGRRILGVEWEEFDALALAAQPGSGGVTLQPYLEGERTPNRPAARGVLAGLNSAT
FT                   TREDFARATVEGLLLALDDAVTALVEATGVPVQRIQLIGGGARSQAVREIAPEIFGHEI
FT                   VVPEPAEYVALGAARQAAWALSGEATPPQWPTPGSDPHRAPKNTELSTRYAKLRAATQG
FT                   WY"
FT   CDS_pept        complement(207385..208224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53152"
FT                   /db_xref="GOA:A4QAA5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAA5"
FT                   /protein_id="BAF53152.1"
FT                   /translation="MQVATTKKALIDALLHHKSVGLVPTMGALHSGHASLVKAARAEND
FT                   TVVASIFVNPLQFEALGDCDDYRNYPRQLDADLALLEEAGVDIVFAPDVEEMYPGGLPL
FT                   VWARTGSIGTKLEGASRPGHFDGVATVVAKLFNLVRPDRAYFGQKDAQQVAVIRRLVAD
FT                   LDIPVEIRPVPIIRSADGLAESSRNQRLSADQRAQALVLPQVLSGLQRRKAAGEALDIQ
FT                   GARDTLASADGVRLDHLEIVDPATLEPLEIDGLLTQPALVVAAIFVGPVRLIDNIEL"
FT   CDS_pept        complement(208224..209039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53153"
FT                   /db_xref="GOA:A4QAA6"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAA6"
FT                   /protein_id="BAF53153.1"
FT                   /translation="MPMSGIDAKKIRTRHFREAKVNGQKVSVLTSYDALSARIFDEAGV
FT                   DMLLVGDSAANVVLGRDTTLSITLDEMIVLAKAVTIATKRALVVVDLPFGTYEVSPNQA
FT                   VESAIRIMRETGAAAVKIEGGVEIAQTIRRIVDAGIPVVGHIGYTPQSEHSLGGHVVQG
FT                   RGASSGKLIADARAVEQAGAFAVVLEMVPAEAAREVTEDLSITTIGIGAGNGTDGQVLV
FT                   WQDAFGLNRGKKPRFVREYATLGDSLHDAAQAYIADIHAGTFPGEAESF"
FT   CDS_pept        complement(209131..210369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53154"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAA7"
FT                   /protein_id="BAF53154.1"
FT                   /translation="MLIKDFDMDYRTLEKEHYALHQSAAETLYQSRFNSEAALKWEFKV
FT                   KNNPLFCLITPEVYRLTERSHNLERTILYYWSRLPPGVIRHYYRSLTIDEVISTNEIEN
FT                   IHSTRRDIEIALDESSTSEPKRFSEISHLYLALAEGKISFPESPSELRELYDHLMHGEL
FT                   GRENELDGEIFRQGPVEIRDSRQKVIHSGFSPESQIIEGINAIIKLAHSEEESNLVGIM
FT                   MSHFMFESIHPFYDGNGRTGRYLLGIQLSKILSPATALTMSSAINQFRNKYYKAFHAVE
FT                   HRLNRGDGTPFVFSMLELLIAAQEGLIENIKQRIDLLASLEEAIKTLRGTNSFKKHQIN
FT                   LLYILGQIQLFGKDETLSLESAAKFLKVSKATATRYFRTLQEMDLVHEVSKRPLRFALT
FT                   DKGREMVGLEVKI"
FT   CDS_pept        complement(210522..211154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53155"
FT                   /db_xref="GOA:A4QAA8"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAA8"
FT                   /protein_id="BAF53155.1"
FT                   /translation="MYALVTLAWWDFRTVRPRIGAMPIDFLQPAEIVAPQLLGCTLTHG
FT                   GVGIRITEVEAYLDSTDEAAHTYRGKTPRNAAMFGPGGHMYVYISYGIHRAGNIVCGPE
FT                   GTGQGVLLRAGEVVSGESIAQNRRGERIPHARLAQGPGNFGQALGLEVSDNHASVFGPS
FT                   FLISDGVETPEIVRGPRIGISKNTEALLRFWIPNDPTVSGRRGYPKE"
FT   CDS_pept        211181..211681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53156"
FT                   /db_xref="GOA:A4QAA9"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAA9"
FT                   /protein_id="BAF53156.1"
FT                   /translation="MSTSFESIPGVTISARKALSTAGFKDLESLAGTNYEEVAGLSGIG
FT                   ARTLERLQAALMERGLSFGGEVPEAEQRTATWTALDSAAPEATETTESPEHFIQNLDSP
FT                   RRITHGQLLLEIFNRATGQKPFVAGSSIVGYGRVHYRYATGREGITIRVGLVPERQRFH
FT                   FMD"
FT   CDS_pept        211717..211836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6008"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VPP1"
FT                   /protein_id="BAQ21070.1"
FT                   /translation="MGKHSVGVSCLYINKPEDVDLEVLEEMIRISWEVEPGEC"
FT   CDS_pept        complement(211847..212764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53157"
FT                   /db_xref="GOA:A4QAB0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB0"
FT                   /protein_id="BAF53157.1"
FT                   /translation="MFLHPDAQFYIDTLSTLSAEEQVNFGKDAVGSGVDATHSAADQDI
FT                   AGVPVRVYTPLSGAGDFPCLVYFHGGGWSGGTLDMIDATVRSLVVGLPIIAISVDYRLA
FT                   PAHPFPAAIDDAFVVASAVLDGVSGLSIDTSRVAIGGDSAGGNIAAVTAQQLRERAVDS
FT                   VSVSGLATALARQVLIFPVTDVSTTDTPSYLTFGKDCYLTKDAMERYIEQYADGHDRTD
FT                   PRLSPLLASDLSGLPPTTIVYGECDVLAHEVRAYGQALLEAGNSVTITEFMGQIHAFIN
FT                   LGGISSDARAARRLIRAELEAALC"
FT   CDS_pept        212876..213481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53158"
FT                   /db_xref="GOA:A4QAB1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB1"
FT                   /protein_id="BAF53158.1"
FT                   /translation="MSKTRTFLFDLYGVLIKEHGAAQFERVARAVGEPSKNDKLHEVYE
FT                   SLRLDLDAGRVSEVNYWNQIKLLVGLEFLDIQEVIAADYKGLYERDQDMVDYVLSLKAK
FT                   GHRIGILSNIPEGLAKLLKEHNSEWLDQLDAVTLSCDIGAAKPEPKSFHVALEALGEKA
FT                   EDVTFIDDRLRNIEAAREEGLSTIHFTGLDSLKESIQE"
FT   CDS_pept        213478..214038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53159"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB2"
FT                   /protein_id="BAF53159.1"
FT                   /translation="MTPQPLILPFGDKVPRIHESAWIAPNATIIGDVEIGPDASIFYGV
FT                   VLRGDVNKIAIGARTNVQDNCVLHVDGDAPCTLGDDVTVGHMALVHGATVGNGTLVGMK
FT                   SALLSGSHVGAGALIAAGAVVLEGQEIPAKALAAGVPAKVRRLLDDAQSQSFIPHAGRY
FT                   VETSKAQASIAEALSLDEVRVRG"
FT   CDS_pept        complement(214022..215167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53160"
FT                   /db_xref="GOA:A4QAB3"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB3"
FT                   /protein_id="BAF53160.1"
FT                   /translation="MPNQAHFSASFARPSTPAAKCMHHIRLGQQLIRNELVEATGLSQP
FT                   TVTRAVTALMQAGLVRERPDLTLSSGPGRPNIPLELAPSPWIHAGVAIGTKSSYVALFD
FT                   TKGRTLRDAMLEISAADLDPDTFIEHLIAGVNRLTTGLDLPLVGIGVATSGKVTNAGVV
FT                   TASNLGWDGVDIAGRLNYQFSVPATVASAIPAIAASELQASPLPHPEQPTPITLTFYAD
FT                   DSVGAAYSNDLGVHVIGPLATTRGSGLDTLGMAAEDALSTQGFLSRVSDQGIFANSLGE
FT                   LVTIAKDNETARAFLNDRATLLAHTAAEAAETVKPSTLVLSGSAFSEDPQGRSVFASQL
FT                   KKEYDADIELRLIPTHRENVRAAARAVALDRLLNEPLTLVP"
FT   CDS_pept        complement(215258..216532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53161"
FT                   /db_xref="GOA:A4QAB4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB4"
FT                   /protein_id="BAF53161.1"
FT                   /translation="MSFRDIFADTRPLKEPAFKRLWLGNVATVIGAQLTVVAVPVQIYQ
FT                   MTGSSGYVGLTGLFGLIPLVIFGLYGGSIADAFDKRIVLICTTIGMCVTTAGFWVLTIL
FT                   GNENIWLLLINFSLQQAFFAVNQPTRTAILRSILPIDQLASATSLNMLLMQTGAIVGPL
FT                   IAGALIPLIGFGWLYFLDVVSIIPTLWAVWSLPSIKPSGKVMKAGFASVVDGLKYLAGQ
FT                   PVLLMVMVLDLIAMIFGMPRALYPEIAEVNFGGGDAGATMLAFMYSSMAVGAVLGGVLS
FT                   GWVARISRQGVAVYWCIIAWGAAVALGGVAIVVSPGAVTAWAWMFIIMMVIGGMADMFS
FT                   SAVRNAILQQSAAEHVQGRIQGVWIIVVVGGPRLADVLHGWAAEPLGAGWTVLWGGVAV
FT                   VVLTAICMVAVPKFWKYEKPKITGI"
FT   CDS_pept        complement(216569..217033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53162"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB5"
FT                   /protein_id="BAF53162.1"
FT                   /translation="MSSRALKASSTHSTTSIFAPPSTVTPDNAWYQFRVGKHLGRDAFA
FT                   EIVMCLGHVFCHHVPQVWSTTCASQDADPTTMLIEAEAAGALAIARVGGPTRRGGSFFG
FT                   DALLKEGTPLPAGFRLDVVLHAASEIEDLLRGDTTAVVSGAWSVEDRRGY"
FT   CDS_pept        complement(216816..217217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53163"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB6"
FT                   /protein_id="BAF53163.1"
FT                   /translation="MNHPETATVLRSISDMVSTETNPRRKSRLEQLIYTTASAWPHYPI
FT                   AHAAQAAVQLARPMRVFELQSFEGVKHALHHIDLRPALDCHAGQRLVPVSRRQASWSRC
FT                   VRGNRHVPWPRVLPSCPPGMVDNLRISGR"
FT   CDS_pept        217513..219456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53164"
FT                   /db_xref="GOA:A4QAB7"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB7"
FT                   /protein_id="BAF53164.1"
FT                   /translation="MKIKSVFLSTALSASLLLGITPPVLGATINPSLPLSALSSSDDIA
FT                   VPNFAKELPLAFDVPAGTVPQSLSGTLQIPAEFSGGVVEFYDGDRLFHTLRLEVSDSRA
FT                   HIEVPLQSVPVEDGRATFWLRAMLDPVNNQWCYEEQEVRFLDGNVTFEGATINPAVVAD
FT                   YFPSVLRALTIYVPENPSEAVQEATLEVATSLDSVYRRSGLDVNVETLPTGTDAPPARP
FT                   QDFERQIVLVDEATESNTQKTELVNPGQDNAFLRLNGNADELYDQARLLTDATLPLAVD
FT                   TEVTASGFGDVPNLSTDVATLQELGITQLTSESVARTSVTLGIERSRLRTYLQSMDLHI
FT                   TGTYTPLPPQNAGQITFSIGDTVLDSLTTDDTGIIDREFNVPGDLVNRYTAIVVEFTST
FT                   GDVNCGVTQPVGLNIDSDSLVTSQHSDVPVLNGFRSLPQSFQPRVDVAFADPSVQELSR
FT                   AVSVVLGIQSMSSQRIRPHLVNWDEAVASERPTIFIDAAGAKTDEVPSYLAQQGQTLEI
FT                   TSKNDQNADGEQLTRSLQTNAALVVGSIQAVWDADKKRTVIVASSQDNPADLDALISWM
FT                   GEDRERWSDLNGDLIVKVRDREPVQLTTVEASEQPGRSATVFIAIGVSLVVIALIVAAV
FT                   VSVSRRSQKGYK"
FT   CDS_pept        219500..221050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53165"
FT                   /db_xref="GOA:A4QAB8"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB8"
FT                   /protein_id="BAF53165.1"
FT                   /translation="MSNPSLEPLEPLEPIELSDGTEIEVPDVDPEPQAGNAQMEVPSLR
FT                   TYVFRGIIAIACLVIGFYESFVLLWQNLRIGVANYSLLVVLMAIVLFIGLDRKRARALN
FT                   IHDREVDYIIGVIAVLIAITIKSQLLPRFVDWETLLRLDMFALLFFAFGISGLVFGMRS
FT                   TFSFAPGWILLFGYNAVAHLIISVIFGGGFWGPVMANIIGLSLAVLVSSNRDLVQATYL
FT                   ALMTVLFGVIFAIIVWALTDGSKFLTLVPAVLATITVVLVSSRWRLGQWKIRRRQPTVE
FT                   KAGPALIAVVVATALLAWIPTPYVERVNNLPGLQMLAKPAPGVIAPIGWHIDDVQYYNW
FT                   ASRYFGPGSSLLRQTMTADHYNEAWDPDGLDRTVVVDTLQSAERFQQHAFGDETLYSTL
FT                   RGRKSDTVQVDLGYGVVGRAYTVLDETDFLTYTKLVFEWQTTNNTVEKISVIAVDDHRA
FT                   EAKFPELAPSVTRMFIQVVTILFRGNGVTIDTNTQLKDLDLVSQVGRQIVAEQQVGRS"
FT   CDS_pept        221047..222510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53166"
FT                   /db_xref="GOA:A4QAB9"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB9"
FT                   /protein_id="BAF53166.1"
FT                   /translation="MMEQDLSYREILPLNASEEQKKAALIDAIEGLRVRDPLLSASIAF
FT                   TRGQKVAFIAVVVGFILMLIFARQAALIGLAATCTFMYLITLLDRFIMFSRGIRAESII
FT                   QVSDEDALAFPEDKLKTYTVLVPAYGEPEVIAQLLASMRAFDYPKHLLQVLLMLEEDDL
FT                   PTIAAAEEAGVDQVATIIKVPPAQPRTKPKACNYGLHFATGDIVTIFDAEDMPDPLQLR
FT                   RVVVAFERSASNTVCVQSRLSYRNARQNLLTAWFTIEYDVWFNFLLPGVMRMNAPVPLG
FT                   GTSNHLLTGVLKDLGAWDPFNVTEDADLGVRIAAKGYSTAVLDSVTWEEANSDTINWLR
FT                   QRSRWYKGYLQTWLVYMRRPKWLVQELGIIPAVRFTFLMAGTPIIAVLNLLFWYLSLAW
FT                   ILGQPGTIEQMFPPAVYYPALVCLVVGNTATIFMNLIGCREGRDPLLLIAVLTFPLYWL
FT                   LMSIAALKGTWQLITRPSYWEKTAHGLEA"
FT   CDS_pept        222514..224247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53167"
FT                   /db_xref="GOA:A4QAC0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC0"
FT                   /protein_id="BAF53167.1"
FT                   /translation="MPIVKPMPALPRRAPVLASSQIEGFEHRRGWRRQANFWFAASLAL
FT                   YWCAALWIALDVGYFWGDALSRTQGALSALYSRNPTLSAIGYVFTPLTTVVQIPLVALS
FT                   PWVPEFTRAGLAGALVSSVFMAASVRQLWLIASERNIRYWLAVVGLLLYALNPMIILYG
FT                   ATGMSEAPFIYATLWAVRRLIRWTSTDDVHDLITCGFALALAFLARYDALIMAFVAMWT
FT                   VGFMTWRARYRRGFRDRIGFALVDMLLLVWPIGFAFVAWTGASWLTTGELFAQFTSTDG
FT                   NAAIIAASGGGATGPQALFDASVRTFLISPALLLVAVVAVFFAYRRRDPEPIIPLALIG
FT                   SVVFFQIITYSLGSTFGLLRFFLTALPLTIILLFQIIPPRHRFPSLRPGACYRDRVTGK
FT                   YAPKKITGVLVLAIFGGTGITLYGMSSANWAPQEYAIQELVFNMESPSQDAVHTLNTFS
FT                   TEMDVADFVDSLNLGDGEVLLSTTYGFAVLTASNNQKQFIIPSDEDFITTLNEPAEHGV
FT                   KYILALPREGRGATDPINLRYPDMYETGSHIATMEIEFINQGQGQPNWRLYRVLTTPEQ
FT                   S"
FT   CDS_pept        224293..225360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53168"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC1"
FT                   /protein_id="BAF53168.1"
FT                   /translation="MARKLKDKLPRNFDKIVESGDFGAFKEVFTERALDAKNRHGNTAL
FT                   HMRGVPEEFKIWMLDQGLDVDIRNEDGDTPLHVHSHDWNLSPDFLLKRGADVCAVNNEG
FT                   ESVAYSAAFFPENLKKLIDAGADPYARANDGTTPLMRVIRSANTGQIIELAEITKLLSG
FT                   TEFTDAEFRETQERIIAMGERFEDVREVYNEESVDQASADMIWLYDRFDIPEELRANTP
FT                   ILHDGVSPIELPGDTWQEQFIEGYDLLVPAMGKAKSLQGEAIRIAGRVSNEFHGNGGVN
FT                   WDKDFKRMAKSLNHICEQGVPLGEPELEELAAAVKSVRKGEPNEEEIDTLPRLATKWVA
FT                   QNPQPLPLGEVDYKR"
FT   CDS_pept        complement(225357..226034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53169"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC2"
FT                   /protein_id="BAF53169.1"
FT                   /translation="MTVRRDIAALEESGQVVSIKGGVKLSEGISTPVPLDRASRLALEL
FT                   HRKEAIAREAADRVTDGMTIFLDAGTTLQALVPYLEPRQNLTVITNDLFVATTLFNYPH
FT                   IRTIQTGGTIDPEIGACQGHLAARSVEIFNFDIAFISSSGWSLNRGLTAPAEEKRLLKR
FT                   KVMEVSTTSTLLADTTKYGVISMVTVCPLDEIDAIITDWGLDSQTIERIHELGVNLTVA
FT                   QEI"
FT   CDS_pept        226353..226940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53170"
FT                   /db_xref="GOA:A4QAC3"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC3"
FT                   /protein_id="BAF53170.1"
FT                   /translation="MLIIRTPDADSAYQVARAAIEGGIRCLEIPFGVPGALQAIEKIAT
FT                   EYGDQGVYVGAGTVLDAQSAYAAVNAGSSLLVSPNVNDGVLEIAQRYQVVSMPGAFTPT
FT                   EIQTALEKGADVVKLFPAELHGPKYLKSLRTPLEHAPIAPTGGVDLDTVGDWFDAGAFS
FT                   VGVSSYICKAGSAEAITANAASLLQKIADVRS"
FT   CDS_pept        226943..228262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53171"
FT                   /db_xref="GOA:A4QAC4"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC4"
FT                   /protein_id="BAF53171.1"
FT                   /translation="MSTQATPRSQKASSSWDFTTIKKMRWFFIALIVIAGVINYLDRST
FT                   LSIGNSTIAEELSLTTVQMGLLLSAFSWPYALANLPAGYLIDKFGVKKMFLVAAVGWSI
FT                   VAVGTAFANTFLALYIARVLLGIAESPFFAAGLKASQMWFSKRERSLPVSIVNTGSQIG
FT                   NAIAPPLLTFLLLGFGWRWMFAIVGVAGLIIAAVWWFSYRDPKPEEDALIHNEVGDDLV
FT                   TESENEIEKASWFSLLAKPNTWFMIIGAFGIFYTVWVYLTWLPRYLEESRGFSLAATGW
FT                   VAALPFMCGIAGVLLGGVVSKKLIDGGMKAVTARKIPIVGGAILAAIAVAPVAYIENTT
FT                   LNILLLCIGYFAAQIPIGCIWTLASDIAEPHQVASLGAIQNFGGFLGAAVAPIATGYIL
FT                   EVTGTFNWVFILAGLLLLVGAFSYGVLVKDRREASLQATA"
FT   CDS_pept        228259..228891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53172"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC5"
FT                   /protein_id="BAF53172.1"
FT                   /translation="MSLGLGEDAIPAVFVIGTAGSGKSTVAKSIASAMGASYLDKDTVA
FT                   NIFTGAMLEANGESPAARDDSEFYTGTIRPLEYSTLLAIGSENLRLGNPIVLDAPFGAY
FT                   FQQTDYISAIAAEHQWSPQVFPFVVRVSSSEAVTKQRLRSRGLDRDLWKLNNWDHFWSE
FT                   VGKAHPEWDSVQIVDFTNDADLPAPELASVILQEIEKSLSGKDLATP"
FT   CDS_pept        228948..229706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53173"
FT                   /db_xref="GOA:A4QAC6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC6"
FT                   /protein_id="BAF53173.1"
FT                   /translation="MIVLTIAIVLLASVLIGALLQRMTGLGVGLVTGPVLTSLLGPLAG
FT                   VTMVNGLSIINAVNNAWSVRKRTDWAKFRILAGALVLGSVPAVAVVYFLNGPWLLIFVG
FT                   AMVLLALGVSLFPTEKFALKQEAKLPMVIFGMIGGFMSTVAGIAGPSLTVYARLSRWDY
FT                   RDFVATLHPVLLVANTVSFLLKVILIGGLDFGGAPAWLWIGAVAMIFVGAWLGEIVNAK
FT                   VSTPMAKRIATLLAAAGAAVVLFRGIMELV"
FT   CDS_pept        complement(229749..230630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53174"
FT                   /db_xref="GOA:A4QAC7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC7"
FT                   /protein_id="BAF53174.1"
FT                   /translation="MATNRTSSAGVIMSVLASALFGAIFFISGAIEAKAETLVAWRVLL
FT                   TAACYLIALLHPAGRKVFKEFWDTLRSQPRQILYFICLVALIALQLWLFSWSPKSHALD
FT                   ASLGYLLLPIFLVIVGRFFFADYITRLQWIAVGIALIAVTLKFVTSAQLSWVTFAIAAG
FT                   YALYFALRKYSGLNNAFAYGAEVLALSPLAFFMLATVEDPLSNAMLSMVILAGLAGALA
FT                   MALYLAASTLLSMPMFGLLSYGEPILLFVAALLLGETLNLSDAIVYSLLACALALLGFD
FT                   GMRRSRKNLESD"
FT   CDS_pept        230756..231475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53175"
FT                   /db_xref="GOA:A4QAC8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC8"
FT                   /protein_id="BAF53175.1"
FT                   /translation="MDLALAQVDSTVSGLYDALDLIGVLLNGIIGGTIARQRGYDIIGF
FT                   LFLALFSALGGGMIRDMLIQQGTVAAIDNQIYLALAFSGALIAMAVNFKGRVWELFKVH
FT                   GDAIVLGVWAVTGSVKAMNAGVAPLPSIFMGVLTAVGGGMVRDVVTGQTPTIFGGGTLY
FT                   AVPATLSATSMVIFHSFDQVILGMIISPFLGIALAVTAYWCGWVIPVNTDFAPVNLTVS
FT                   QLRAMLSKAERKDKDQK"
FT   CDS_pept        231472..231807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53176"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAC9"
FT                   /protein_id="BAF53176.1"
FT                   /translation="MKTYPVLIAVAGLALAGCSSSAPGIWRATEPADAYLEIADDGTLS
FT                   GSDGCNRLFGGWEKDGSTITFGAIGMTEMYCEGVNDWLSQMHTATVTDATMTIFNEAGS
FT                   NIGELKR"
FT   CDS_pept        complement(231804..232214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53177"
FT                   /db_xref="GOA:A4QAD0"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAD0"
FT                   /protein_id="BAF53177.1"
FT                   /translation="MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVA
FT                   IVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPK
FT                   IVHVDADNRIVALGNDLAEALPGSGLLTSRSI"
FT   CDS_pept        232356..234017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53178"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD1"
FT                   /protein_id="BAF53178.1"
FT                   /translation="MTLQSSDKRSPSLLDASSEVFVHDLAALSPTDATAWGISGFEGEL
FT                   QDFSPDYWNAIAERNRDMVADVDAFDDGTDDNDDEEDFDDVDRVTADVLRDRVCLDLAL
FT                   HHQGETLANLNNIDSPVQTIRDTFLIMPRETDDDVENLRERLSRVPDALHGYCESLAEA
FT                   ASQGHVAAVRQVEEVVSQCEDLADEDSVLQHLGLDEHDPVVVEAQEAFARVAGWLAEQL
FT                   APHAPHVDAVGRDRYEMFSHLHVGEFVDLDEAYQWSLEQLRDIDAQQLQVAQQLYGPGT
FT                   TIREAMKKLNADERYLIRGTDALQEWMQKTADQAIADLDGVSFNIPEQARQVECLIDPA
FT                   GTGGIFYTPPSDDFSRPGRMWWSVPKTQEVFHTWQELTTVFHEGVPGHHLQISQTLVEK
FT                   DLNLWRRVACWNSGHGEGWALYAESLMKELGYHEDPGNLMGYLDAQRLRAARVAIDIGI
FT                   HLNKRNPECTGLWDASYARSFLRENTSMNEDALYFELNRYLGWPGQAASYAIGQRLWLN
FT                   LRDEAISQGQTLAQFHSKALSYGSIPMGILRDQVLN"
FT   CDS_pept        complement(234025..235164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53179"
FT                   /db_xref="GOA:A4QAD2"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD2"
FT                   /protein_id="BAF53179.1"
FT                   /translation="MSDKEPDPHEQIPEKPSRKVIALRWCIVAPLSLAVGWLFTMWGVP
FT                   AAWILGAILVAGVCALTTGQDLPMAKGVHVFGRSIVAMLAALPLISASGSELIRFLIPG
FT                   LVISFFTIAVGIVGGLLLARSRPEILPETGVLSMLAGGASVMPILARELGADFRYVALT
FT                   QYLRLLVVSMTLPLVTHFFVPGGTDLGSPPEKWLDVLSLGEFGTSISVLSLLVLFGIVL
FT                   AGEPLGRLLRLPAPAVMGPLILTVLVSFVIPDDLSLQPPTVFKIIAFMAIGWMCGGALN
FT                   MTALKVFSKQLPATFLFIFALLAVCAGAAGLLTWWLDISFFEAYLATSPGALETVLALS
FT                   SEGSAGPVVVTIQIIRLLAILTIAGLIPTLLRRILRRDR"
FT   CDS_pept        complement(235197..235763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53180"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD3"
FT                   /protein_id="BAF53180.1"
FT                   /translation="MPVEVPFSRISMGNTSSSGRLRMIHMRNQTIAAVAALVLLTAATP
FT                   AIAATPATAGNGLYSIDMGDEQKLTCVLFDEPSTEAHVVASCAATFPVTWKLLDGAHEQ
FT                   AAKLEITQTQDGELSVTASKEPLITTMIVPTSITKPTTVNRLVVVPGENEVHFFATDPD
FT                   VLPVLITPDSYEVLTDSAAKVKATL"
FT   CDS_pept        235825..236607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53181"
FT                   /db_xref="GOA:A4QAD4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD4"
FT                   /protein_id="BAF53181.1"
FT                   /translation="MGLELAASGWGILIAGAAVAGWIDAVIGGGGLVLIPLILAVMPQL
FT                   APVTALASNKLAAVTGTASAAFTLVRRVKPDKKLLPLYVLVAAVCSGAGALAASLIDKQ
FT                   IMRPMIIVLMLVVGLIVVFKPNFGTGESKTLPTGWKRWAAIVAVGFIAAYDGIFGPGTG
FT                   MFLIMAFTALLSQNFLSSAAMAKVVNTATNLGALIVFIIGGHMWWTLGLVLAVANVAGA
FT                   QLGARTVLGGGTRLIRYALLTLVVVMSVYLTWQQIQGM"
FT   CDS_pept        236675..237052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53182"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD5"
FT                   /protein_id="BAF53182.1"
FT                   /translation="MTKTKLESISERNSDDPLSYPELTLAPVSTTVTVVVAEDAPNDNF
FT                   SELLLGAAESTRLLGLDELHIIAPSVHLPALAVAAADIAHHLPEKFQFCEAETCSHLHP
FT                   DDDTYLTAESVAQLGTKLKSA"
FT   CDS_pept        complement(237461..239989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53183"
FT                   /db_xref="GOA:A4QAD6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD6"
FT                   /protein_id="BAF53183.1"
FT                   /translation="MGISASPRRKNYFPQPARKHIIALGFSVEVRKKMCSPSRFLMYRQ
FT                   LMSSRIGNFLINRISTGLPVENIIPHLQEAFSAGPKNLVIQAPPGTGKTTLLPPLVANI
FT                   LCNEGAGNATPTKVLVTAPRRVAVRAAARRLAQLDGSQLGTKVGFSVRGEHIPGTHVQF
FT                   MTPGVLIRQLLNDPELPGIGAVIIDEVHERQLDSDLLTGMLAELSQLRDDFSLIAMSAT
FT                   LDSETFADLLDAQVLRAEAPIFPLDISYAPARTPRLNAKGVDWNFLDHMAQKTHEAIAH
FT                   SEHSALVFVPGVREIDRVINTLKSLGHNNVFPLHGQLSPAEQDCALTPSAQQRIIVSTP
FT                   VAESSLTVPGVRIVVDSGLSRSPKRDSARGMTGLITSSCAQASAGQRAGRAGREGPGQV
FT                   IRCYSEADFSHFPRFVAPEIGSANLTQAALWLAQWGTSPADLPLLDQPPHAAWSAAQQT
FT                   LRHIGALEGDAITSLGHRLSTLPLSPQLSASLLRFGEQSAKILAVVSENPQGDVEKQQP
FT                   DKREVERLRRLAPASAEKASAGQIVGAAFPQLIGRKIDNGEYLLASGTRARLIDPDLKD
FT                   AEWLSVAAINRSQNSAIIRAAAHISEADALEIIGVTEETRAVFVDGKVQARKVKAAGAI
FT                   ELSSTPTKPTPAEASEAIATALAKGGIDLFHFSDKAASLRDRLKFIHEHRGEPWPDIET
FT                   ADPHLWLSPEIEALSHGTRLNNIDMYPALQRLLPWPEATNFEEFAPPHLAAPSGNQHRL
FT                   DYSSGRPVVRVKLQECFGLEESPQLCGIPVQFHLLSPAGRPLAVTDDLRSFWSGPYSQV
FT                   RAEMRGRYPKHPWPEDPWTAPATARTKNRM"
FT   CDS_pept        complement(240083..240493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53184"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD7"
FT                   /protein_id="BAF53184.1"
FT                   /translation="MIAGSNVRSYLKAFPWMRWGFFLQNHLGCQKILPKNIKYAGTKKN
FT                   AKLRLMPVSSGFFAMIPVIAPEIPKIKGQITWCKIHGLEEPWKTTKAKIATTIQPREIS
FT                   AVGGHLVFCFDKSLVKSCFSAQPTMTSLLSIP"
FT   CDS_pept        240090..240407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6009"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21071"
FT                   /db_xref="GOA:A0A0B6VR85"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR85"
FT                   /protein_id="BAQ21071.1"
FT                   /translation="MESREVIVGCAEKQDFTKLLSKQKTRWPPTALISLGCIVVAILAL
FT                   VVFHGSSRPCILHQVICPLILGISGAITGIIAKKPLLTGINLSFAFFLVPAYLIFFGNI
FT                   F"
FT   CDS_pept        complement(240381..241058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53185"
FT                   /db_xref="GOA:A4QAD8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD8"
FT                   /protein_id="BAF53185.1"
FT                   /translation="MDKDFESIEKMTSGDWYVATGAEREEVAQKTALLFHEYNQIGPTD
FT                   PARTDEILKTVLNPASGTCTIKAPAIIEYGFNTTIGEHVFINFGLTILDIAPVRIGARS
FT                   MLGPNCQLFTAGHPVDDWEMRSGGWENGAPISIGEDTWLGGNVTVVGGVSIGDRCVIGA
FT                   GAVVTKDIPDDSIAVGNPARVVRKRDDSRLERSQLPEGVSVDALGILPTKSPRLSENIA
FT                   EKY"
FT   CDS_pept        241085..241777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53186"
FT                   /db_xref="GOA:A4QAD9"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD9"
FT                   /protein_id="BAF53186.1"
FT                   /translation="MPTLFDDPLHQLPRPPRRVAAGVVHLPNFLGLAEQKALVAQARDL
FT                   AREVVGTPLAMVRPKLKSGQMSVHMLHLGKYWASNPYRYVDVVDGFPVPPLPDSFVDLA
FT                   HRALLSAGSLSNSLQSWSEAYRAEAALVNYYSPDASMGMHQDANEESEAPVISLSIGDT
FT                   GIFRLGGTLNRNKPWTDIPLMSGDLIVFGGANRRAFHGIPFIEANTAPAGCGLKEGRIN
FT                   ITIRQLAL"
FT   CDS_pept        241821..242378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53187"
FT                   /db_xref="GOA:A4QAE0"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE0"
FT                   /protein_id="BAF53187.1"
FT                   /translation="MSHAQIMVRTMTTNKANPNELVICADEKSRPRWASRSELCWEYFD
FT                   NEWGRPPVDLNTLFEILTLVVFQVGVTWHAVLSKREGFRKAFAQFDVAKVAAFNENDVE
FT                   RLLDDLQIFRNRRKINAAITNAKALLELTDETGTFDSIIADRSTDATAMVKHLKALGFT
FT                   HIGLTSLSILQQAIGVTELKAA"
FT   CDS_pept        242391..243071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53188"
FT                   /db_xref="GOA:A4QAE1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE1"
FT                   /protein_id="BAF53188.1"
FT                   /translation="MTTAQFLALFLVWIAAIASPGPDLFQIIRLGAKNRRDGVLTAVGI
FT                   MVGNSIWIIASLLGLSALISTHPAILNLLQLVGGGYLTWMGIGAVRSWWTKRSTQQAAA
FT                   DSQAVENTLVTATAASVGVWPAIRSGIATNLSNPKAVLFFGSVFAQFVRPDMGIGWSIF
FT                   IGVFLTLTGLLWFVGFAVLVRKLAVGITRNGAIIDLLTGVIFIGLGMFMIFEGVVGIGG
FT                   RVVG"
FT   CDS_pept        243106..243399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53189"
FT                   /db_xref="GOA:A4QAE2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE2"
FT                   /protein_id="BAF53189.1"
FT                   /translation="MQPEEVHIKDETIKLGQFIKLANLVESGGAAKDAIANGDVTVNGE
FT                   VDTRRGKTLRDGDVVCIGEVCAQVSTGDAADDDYFDEATANDDFDPEKWRNM"
FT   CDS_pept        243399..244253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53190"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE3"
FT                   /protein_id="BAF53190.1"
FT                   /translation="MPAFEAMPGMPYWIDLSTSDIAKSAHFYGNVLGWEIEEVNDGYRM
FT                   ARLQGLPVAGLIDQRGESSIPDTWITYFLSYDLDATAKKIAELGGRILAEPTDVHLGRM
FT                   ILAVDTAGALFGVIEPGSEESFVAAGEPGTSVWHELTTVSKYSEAIDFYGELFTWTTSE
FT                   MASAEDDSFRYTTALADGSAFAGIFDAKGHFPPQVPSFWQSYLGVLNADDAAAKAKEFG
FT                   GDVIRKPWDSEFGRMVLISDSTGATITLCEVEEYVEEAAEGDDLFDIDLSAFEEQFRKQ
FT                   EGQ"
FT   CDS_pept        244266..244610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53191"
FT                   /db_xref="GOA:A4QAE4"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE4"
FT                   /protein_id="BAF53191.1"
FT                   /translation="MEELEFDELTSMVLDCADLIPQGKVASYGDIAKIVGTGPRQVGRI
FT                   MATAGQFTSWWRVVRSDGGSQVAGTARSKWAEENIAFSELSAPKVRMQQHRLSEEELET
FT                   IAGKLQQIAD"
FT   CDS_pept        244707..245600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53192"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE5"
FT                   /protein_id="BAF53192.1"
FT                   /translation="MKTPRLLKFLSAMVAVTGLLIPTVVPMAAADAAELSDNVPDRTQI
FT                   AIINPDGSVQESDNAEESRPALSLAKLYLGYYVLAQGAEEDIELVPDMIRYSDDFTADY
FT                   LESEYPEAIPEVIDAFDLEDTEWAGFWGNATTSAVDIATFVAALIDDPTAQPLLDAMSD
FT                   TAEYAADGYAQNFGTFTLSDVTGTKFGWSDSLDVHSSVSFGPGFVIAANTYGDAETLTE
FT                   DVQDSVSSLYPEEVTTAIEEQVDQLYECAAETTHLGMHTGAELKAQLEGTIYGKTLSFL
FT                   PNSAPVPAFIYNLLAR"
FT   CDS_pept        complement(245597..246505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53193"
FT                   /db_xref="GOA:A4QAE6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE6"
FT                   /protein_id="BAF53193.1"
FT                   /translation="MAENNTPQETEQDQEARFREEFEVGGQDRQLSEEEQLEQLGSYID
FT                   AHYPVPDFTPPWAGGAGDPDPADRYIAHLPDRTTHTAMIMLGSGLDHSMPGVAFIGDVS
FT                   VDNIPEVGGAIFHPSNPTGRWAVSFHSGGWWRGSGDALEFQWRPEVAAAAELSGTTILD
FT                   LDYPLAPGHNLHDMNEVVGKAVGYARHHNPVSITGWGYSSGAALAAINASLFDALVLTF
FT                   PDLGSVEKLPAEIRGDAVVPAAAAWPTTFVQIAAQDEIAERPEELGDATVKEYVSRHRI
FT                   STPKVAREKITDVAEFLKTVG"
FT   CDS_pept        246784..247098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53194"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE7"
FT                   /protein_id="BAF53194.1"
FT                   /translation="MHISGMVAFDSDANIVGEGDIEAQTEQVFRNLQAVVEEAGGTINN
FT                   IVSTTTYLADVTDAPVVNAARSRYFTGEVLPTHTVIGVAALARPQLLVEISAVAYLGDL
FT                   "
FT   CDS_pept        247285..247518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6010"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21072"
FT                   /db_xref="GOA:A0A0B6VIC4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VIC4"
FT                   /protein_id="BAQ21072.1"
FT                   /translation="MSFVSNENRGTETSRVKKYFGGSGIIVLLIAAIVIMVSLVIDATT
FT                   EIDSPRYVAIGAAIFFVVSTIVRAIAAGRKDN"
FT   CDS_pept        248008..249012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6011"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6011"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21073"
FT                   /db_xref="GOA:A0A0B6VK08"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK08"
FT                   /protein_id="BAQ21073.1"
FT                   /translation="MREWVLFLSISVMFILLAFFPKTSAVGLAILYLSLIPFDLRAGLL
FT                   ILLAPVSVGILAFWNKLFWALVLVISALIAGLYSVAEQKFSFEPISLLIALIMFVLPLF
FT                   GGLWVGKLARTHQLAVSTAREQREELSMALHDDIATDLSSVVVRLEVLAMKHEELAPKL
FT                   SVDLWESVQSIRGTLLSLRVLIENLTLSLENNRQVNRLGLAQYILIKAKFLRKHGFDVQ
FT                   CRIDNSVKVQLTQNSASLESALNEAFANVIKHGNLDEKVEISVESIAEKKLITNENYYI
FT                   SGESRGGSNLLGLDGMQKALIADSGELRIVDDGSRWTLSILVSPSLITSPVSN"
FT   CDS_pept        249120..249842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6012"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6012"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21074"
FT                   /db_xref="GOA:A0A0B6VMA4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VMA4"
FT                   /protein_id="BAQ21074.1"
FT                   /translation="MIALAARENLLTSGVNKLEKLKTRLLLVDDDFYIRRDLPNYFSST
FT                   EDLVVVGTAANGQEALDKMKSLHCEVILSDLRMPVMGGSELLLEVQKLEDSPIFIAMTG
FT                   FDTDQAMLDVLASGGVGYIVKSDPPSTILSAVRAAVKGGTALSPSCTSRLVNATVREGK
FT                   NRRPRHSGQIIEVDLTKSEVQVVELLCRGMTNLQIAQTLHYSEAGVKKKISSMLRKFQV
FT                   DSRVGLAMKAGPLVGYPR"
FT   CDS_pept        250011..250634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53195"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE8"
FT                   /protein_id="BAF53195.1"
FT                   /translation="MSGTAIMYDTTVVPSKKEIAQAWTGYVDLQGSYRLVDTVDGEVGV
FT                   EVLISKDREGRLLQIPFSYRSAEINPEQTLSTLEHGVLGKRWVTNALGDPVAVREFIRT
FT                   ILTGDDGAARSDGVKGYLDIKGSGDAESVDLQDVKLTEVTRQRAIGSVTINGERKQFSL
FT                   RLPQLLKNFRKTAAGHTATTLRMVAAHPEKDDVELLVAEFNWIE"
FT   CDS_pept        complement(250702..252771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53196"
FT                   /db_xref="GOA:A4QAE9"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAE9"
FT                   /protein_id="BAF53196.1"
FT                   /translation="MRFQLVLALDYAHTDRLPSGVDMIPNAQPTCGTNHKPCAGKSPRV
FT                   GHMKDLYRFVNGPWLDTHIIPDDRAVDGTFHKLRDDAEEDVHEIVKEDTGRAGTLYASF
FT                   MDTDTINAAGVAPLDADLNRLSVANSSFFAAALGELDREGVGAPVGFWVEKDSSSNESV
FT                   AYVIQSGLGLPDEAYYREEAHAETLAAYKEHVERMLGYLDNSRLFGLSAASAAARIVAL
FT                   ETEIAAGHWDVVKTRDAVATYNPTELGALPPKVRTLLSSAGLPDQRLVSMMPSYLDHLN
FT                   GLLVDDRLPDWQLWATWHILRSRAGLLTEEISQANFDFYGTKLSGATEQKDRWKRAVGL
FT                   AERMVGEEIGQRFVEKHFPASSKEHMLELVDYLVAAYRDRISNLEWMTPATRERALEKL
FT                   GKFNAKIGYPDKWRSYEGLEFGSDLVDNSRKGSAFLHDYELSKIGKPADRDEWVTTPQT
FT                   VNAFYNPVVNDITFPAAILRAPFFDPEAEAAENFGAIGAVIGHEIGHGFDDQGSQYDGD
FT                   GNLNSWWTDEDRSAFEQLTSRLVTQFSGLVPAVLTSEGVDTDGVNGEFTLGENIGDLGG
FT                   LGIAVVAYEKYLADRGQTFETSPVQKFEAEGAEEGLAEQEFNGLQRLFLSWARVWRTKI
FT                   RPQMAVQYLAIDPHSPAEFRCNVIAGNVAEFYEAFDVPEDAPVYIKPEERLAIW"
FT   CDS_pept        252733..253476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53197"
FT                   /db_xref="GOA:A4QAF0"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF0"
FT                   /protein_id="BAF53197.1"
FT                   /translation="MSVIEGKYQLKPQGRGGLWWSIVGVAVVLLLLPTLINLVVPDKAN
FT                   DYKQLEIDLLGVDWSVPITTEESAAVLCEETSDEITQKYWDCNGDTTVVTMIVEGVKDP
FT                   SNTLRRMVGSSLITSVDDSLEAVSSEDGRAHALYVPGQQEGSVWTLPIVALSVQGSGDY
FT                   EDLTAIAIINGTSLDYYSTHIWSSMAADRGLPYQQDFPLMLEEQPWQDTPSGDLPFELP
FT                   NDFFDQYPDLFGRDSVIPNLEGESL"
FT   CDS_pept        253473..254438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53198"
FT                   /db_xref="GOA:A4QAF1"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF1"
FT                   /protein_id="BAF53198.1"
FT                   /translation="MSRMFSITLWVAILLSTPALFLSLATFIFVDGISVLVNIVFAVLY
FT                   LVVIVFLLSRTPLWPRFKGSGSKKGGGFAWAASSLLWGAFVGFGIVMLFAGPVMDLTDK
FT                   LGWDFVAMSFTGAYPEEIAKALGVAIILLSFRQLNRPWHGFITGALVGLGFEVNENLLY
FT                   GATGAIMDPNADLDGVLMMWQYRTMLGPLIHTLLTGFAGYGIALAFFRARKTVAWRWGV
FT                   AIGWTLIAFALHFSWNLMWENVIGSYVTIIVVSVVMYGLAIYIIWSNWAEARDDSSYAF
FT                   VPGIITNTKDLSLLDAPIPVGTEVPEPRIPQQIEEPKAEN"
FT   CDS_pept        complement(254853..255614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53199"
FT                   /db_xref="GOA:A4QAF2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF2"
FT                   /protein_id="BAF53199.1"
FT                   /translation="MTTEAPIWPAELFEDLDRNGPIPLYFQVAQRLEDGIRSGVLPPGA
FT                   RLENEISVAKHLNVSRPTVRRAIQEVVDKGLLVRRRGVGTQVVQSHVTRPVELTSFFND
FT                   LKNANLDPKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIPVAILENYLPP
FT                   AFNDVSLDELEKGGLYDALRSRGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVER
FT                   VALDNSGQVIELGSHCYRPDMYNFETTLVAR"
FT   CDS_pept        256033..257013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53200"
FT                   /db_xref="GOA:A4QAF3"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF3"
FT                   /protein_id="BAF53200.1"
FT                   /translation="MSEGLHRHMTNLTSTHEVLAIGRLGVDIYPLQSGVGLADVQSFGK
FT                   YLGGSAANVSVAAARHGHNSALLSRVGNDPFGEYLLAELERLGVDNQYVATDQTFKTPV
FT                   TFCEIFPPDDFPLYFYREPKAPDLNIESADVSLDDVREADILWFTLTGFSEEPSRGTHR
FT                   EILTTRANRRHTIFDLDYRPMFWESPEEATKQAEWALQHSTVAVGNKEECEIAVGETEP
FT                   ERAGRALLERGVELAIVKQGPKGVMAMTKDETVEVPPFFVDVINGLGAGDAFGGALCHG
FT                   LLSEWPLEKVLRFANTAGALVASRLECSTAMPTTDEVEASLNQKV"
FT   CDS_pept        256928..257938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53201"
FT                   /db_xref="GOA:A4QAF4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF4"
FT                   /protein_id="BAF53201.1"
FT                   /translation="MRLWRPVLNAPPQCLLPMRWKPPSTRKSDMTPPIISPESFEALRR
FT                   MRAAEPTMVAERFKQRRKRELLGEDGKLFIVAADHPARGALAVGDNETAMANRYELLER
FT                   MAIALSRPGVDGVLGTPDIIDDLAALGLLDDKIVVGSMNRGGLRGASFEMDDRYTGYNV
FT                   SSMVDRGVDFAKTLVRINLSDAGTAPTLEATAHAVNEAAAAQLPIMLEPFMSNWVNGKV
FT                   VNDLSTDAVIQSVAIAAGLGNDSSYTWMKLPVVEEMERVMESTTMPTLLLGGEGGNDPD
FT                   ATFASWEHALTLPGVRGLTVGRTLLYPQDGDVAAAVDTAARLVHTDIQQFTSQSI"
FT   CDS_pept        257952..259466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53202"
FT                   /db_xref="GOA:A4QAF5"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF5"
FT                   /protein_id="BAF53202.1"
FT                   /translation="MSEPQTISHWIDGAISPSTSGKTAPVYNPATGQVTANVALASQEE
FT                   IDATIASATKAAKTWGNLSIAKRQAVLFNFRELLNARKGELAEIITAEHGKVLSDAMGE
FT                   ILRGQEVVELATGFPHLLKGAFNENVSTGIDVYSLKQPLGVVGIISPFNFPAMVPMWFF
FT                   PIAIAAGNAVILKPSEKDPSAALWMAQIWKEAGLPDGVFNVLQGDKLAVDGLLNSPEVS
FT                   AISFVGSTPIAKYIYETSAKNGKRVQALGGAKNHMLVLPDADLDLVADQAINAGYGAAG
FT                   ERCMAVSVVLAIESVADELIEKIKERIDTLRIGNGAGDEQGEPHLGPLITDVHREKVAS
FT                   YVDIAEADGAKIIVDGRNCAVDGHEEGFFFGPTLIDDIPLTSRAYTEEIFGPVLSVVRV
FT                   ASFDEAIELINSGEFGNGTAIFTNDGGAARRFQHEIEVGMIGINVPIPVPVAYHSFGGW
FT                   KNSLFGDAKAYGTQGFDFFTREKAITSRWLDPATHGGINLGFPQND"
FT   CDS_pept        259487..260377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53203"
FT                   /db_xref="GOA:A4QAF6"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF6"
FT                   /protein_id="BAF53203.1"
FT                   /translation="MRWFHKKGELARDGWQSVVDATTPGWEYTGIRIAELGSGESLELN
FT                   DTGVERIFIPLQGSFDVAHHDQVTHLHGRKSVFDGPTDVLYLPTGQTATLSGQGRVAVA
FT                   EAPTQEPKEWKYIAPAETPVELRGAGRSSRQVHNFGTPEALDAARLIVCEVITPGENWS
FT                   SYPPHKHDEHIPGHESKLEEIYYFESAPSRVGGRAEAAEGAFGMFSTYSSPAGEIDINA
FT                   MVYSGDIALVPFGYHGPAVAAPGYDLYYLNVMAGPDPERIWLINDDPAHAWVRDTWTGQ
FT                   AFDDRLPYENANKEG"
FT   CDS_pept        260384..262297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53204"
FT                   /db_xref="GOA:A4QAF7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF7"
FT                   /protein_id="BAF53204.1"
FT                   /translation="MAETKRMTVSQALVEFLGHQWTVDGDIRERTIPGMFGIFGHGNVA
FT                   GIGQALKQYNVEQPELMPYYQARNEQAMVHQSVGYARMHRRRGTYASAASVGPGATNLL
FT                   TGAALATTNRLPALLLPSDTFATRVADPVLQQLEQPWDIGLTVNDAFRPVSKFFDRVQR
FT                   PEQLFSIALAAMRVLTDPAETGAVTIALPEDVQAEMLDVPVEFLQDREWHIRRPRPERA
FT                   ALARAIEVIKNAKNPMIIAGGGVLYSDAETQLQALVEQTGIPVGTSQAGGGVLAWDHAQ
FT                   NLGGVGATGTLAANRIAGDADVIIGIGTRYSDFTTASRTAFQNPDVTFININIASFDAY
FT                   KHGTQLPVIADAREAIVELAEALQGFTVSQDFAQRIAEEKAAWDAEVDKSFAPSGLALP
FT                   GQPEIIGAVQASTSEKDVIVQAAGSLPGDLHKLWRVRDALGYHVEYAFSCMGYEIAGGI
FT                   GAKRGLDAAGDDRDVVIMVGDGSYLMLNTELVTAVAEGIKVIVVLIQNHGYASIGHLSE
FT                   TVGSQRFGTWYREYDADAKNFQGEQILPVDLAMNARSYGMDVIEVEPSANAIEDLKAAM
FT                   ATAKASKKSTFIHINSDPLIYAPDGAGWWDVPVSETSTLDSTNAAREDYLKNQALQRPL
FT                   LG"
FT   CDS_pept        262338..263294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53205"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF8"
FT                   /protein_id="BAF53205.1"
FT                   /translation="MTTSVPASTKAPSVAGENPGLRIGTAPDSWGVWFPEDPKQIPWER
FT                   FLDEVVKAGYTWIELGPYGYLPTDANQLEDELGKRGLKLSAGTVFTGFHKGEEQWKRAW
FT                   DQALDVAGLASKLGAEHLVVIPDLWRSDATNEVLEARTLDDEKWAKLAAGHDRLGKALL
FT                   EEFGMKQQFHSHADSHIGTTREVLRFLEETDARYTNLCLDTGHFAYYGGDNVKLIEQHP
FT                   ERIGYLHLKQVDPTLLFDVLKNDTPFAEAVTQGIMIEPPHGIPDLAPIIEAVSKIDSEI
FT                   FAIVEQDMYGCDIDYPFPIAERTRKHIFGCTHFARVN"
FT   CDS_pept        263327..264340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53206"
FT                   /db_xref="GOA:A4QAF9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR023794"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAF9"
FT                   /protein_id="BAF53206.1"
FT                   /translation="MSKSLRVGVVGAGAMGADHIDRINNRTSGAHISAIIEPDAARAAA
FT                   AAENAPGAQAFTRIEDAIAADAVDAVLIAVPGQFHEPVLVPALEAGLPILCEKPLTPDS
FT                   ESSLRIVELEQKLDKPHIQVGFMRRFDPEYNNLRKLVESGEAGELLMLRGLHRNPSVGE
FT                   NYTQSMLITDSVVHEFDVIPWLAGSRVVSVEVKYPKTSSLAHSGLKEPILVIMELENGV
FT                   LVDVEMNVNIQFGYQVATEAVFEKGLARIGQPSGMQRWRDGEFLINEHTDFTTRFATAY
FT                   DRQIQSWVDAVHEGTLVAGPNAWDGYLVALSCEAGVKAFDGGVIPVDAAPRPDFYA"
FT   CDS_pept        264353..265225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53207"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG0"
FT                   /protein_id="BAF53207.1"
FT                   /translation="MVRIALDPTPFHHDYDLLDFPDVTARLGYEYMQLTPHVDFGPFFR
FT                   HPKADDDLVAALKKRAKDAGVTIPALLPVQRISWPEETQRVAAVRNIKRIIQLAVDLEV
FT                   DTLNTEFSGRPERSEDSEDAFYRSMEELLPILEKEGIKFNIDPHPDDFVENGIEAWRVI
FT                   RGLNSKQVGFVYVAPHSFHMGDQAEAILPAVGERLGAVYLSDTFDHHKSHGLRYITNPP
FT                   GNAVRVHQHLKIGDGDVNFEEIFGLLRSTGYLDREDALLVSNVFAEDEAADEVSRYQLE
FT                   KIRSLIENA"
FT   CDS_pept        265319..266680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53208"
FT                   /db_xref="GOA:A4QAG1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG1"
FT                   /protein_id="BAF53208.1"
FT                   /translation="MRNDRSFSVPIALLAAGALFLEILDGTILTTAVPAIARDFGIDAV
FT                   DVSIALVAYLAAAAAGIPAAGWLADRFGVRKVLLLALAVFTAASLVCAVAPGLTVLTGA
FT                   RVIQGLGGALLVPVGRLAVIRGTDPKDLLDAIAFLTWPALVAPVIAPLLGGLIADTIGW
FT                   RWIFLLNVPLGIVAIIAGLFILPKHTAVEVKRFDLPGFLGAMLVMVGLTVAAELISRGS
FT                   PAELVVAGCLIFSAAIVCGFVVRWLRVPGRLFDLSIMRIPGFRVGNSSGSVYRLVITAA
FT                   PFMFTLLFQVAFGWSATLAGAMVVALFAGNVAIKPFTTPIIKRWNFKPVLVFSNAAGAL
FT                   VLASFLFVRVDTPLVLIALLLFVSGALRSLGFSAYNTLQFVDISPEQTSNANVLSATLH
FT                   QLGMSLGIAVAVIAMSLAPTANWAFPLAAALFLIPLIGALSLPRDGGARAFSSS"
FT   CDS_pept        266708..267733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53209"
FT                   /db_xref="GOA:A4QAG2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG2"
FT                   /protein_id="BAF53209.1"
FT                   /translation="MTIRIGLVGYGVGGRLFHTPYIQASTHCELVGVVARSEGTKAAVA
FT                   EDLPDVAIVGSLTELLELGVDAVVISTPPATRRELALEAINAGVAVVADKPFAPSAADA
FT                   MELVEAAEKAGVLLNVFHNRRNDTHIVTALGIQEELGAMRGLDLRLDLIEPDSLEAGPE
FT                   GGLLRDLGSHVVDQTLVLMGPATSVTAQLGSIDLPEGPTNARFRIVLEHESGAVSHISA
FT                   SKIDRLESWEIRLVGERGSYVSNYTDVQTVAIKQGLRPINDREHWGYESEERWGTLVTD
FT                   EGSKVIPSAQGDYTRFYDAFALAVENGGAGPVPAREGVAVLKVLDAVSQSAAEKRTIEL
FT                   S"
FT   CDS_pept        267861..268319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53210"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG3"
FT                   /protein_id="BAF53210.1"
FT                   /translation="MSKIVDLRYRTRRSSELSKRSAEVFAEAEEHPITVTRRDGEALVL
FT                   MSQREADGRARLLELAAQLITVATDHQGTLAERMAKVFPWMLALSVADREACAREILDA
FT                   ARASFATEQPHLALTELTSWKETAAAVAAGLSNTDLQWYDDPHLVERP"
FT   CDS_pept        268283..268669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53211"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG4"
FT                   /protein_id="BAF53211.1"
FT                   /translation="MVRRSASGGASLSVAGKKSELVPRPRKKNEFEIRFATTHAAKGWR
FT                   DLVASIRNHMAETWDFFTVTPLLTTPTNYRLKGELGIVHHNGKAHDRWQHKPTAKGSAR
FT                   IWFYVEKNTVFLEQVHTHHPNETK"
FT   CDS_pept        complement(268703..269701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53212"
FT                   /db_xref="GOA:A4QAG5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG5"
FT                   /protein_id="BAF53212.1"
FT                   /translation="MSTSRPTIYDVAKAAGVSKSLVSLVLRGSTNVSKESEAAVKTAIK
FT                   KLNYQPNRAASDLAAKRTQLIAVLIDDYSNPWFIDLIQSLSDVLTPKGYRLSVIDSLTS
FT                   QAGTDPITSALSMRPDGIIIAQDIPDFTVPDSLPPFVIAGTRITQASTHYSVANDDFRG
FT                   AEIATKHLIDLGHTHIAHLRVGSGAGLRRFESFEETMRAHGLEPLSNDYLGPAVEHAGY
FT                   TETLALLKEHPEVTAIFSSNDITAIGALGAARELGLRVPEDLSIIGYDNTPLAQTRLIN
FT                   LTTIDDNSIGVGYNAALLLLSMLDPEAPHPEIMHTLQPSLIERGTCAPRGG"
FT   CDS_pept        269842..271071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53213"
FT                   /db_xref="GOA:A4QAG6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG6"
FT                   /protein_id="BAF53213.1"
FT                   /translation="MTQQELRVAVIGAGMAGKAHAAGYRTASSIYSTTLPNIRLVSIAD
FT                   ANVQLAEETAARFGFERFDTSWQAIVEADDIDVVSVVVANFLHREIVEALLASGKHVLC
FT                   EKPLSDTIEDAEAMIEAAGRAATNGTIARIGLTYRRSPGVAHIRDLVQSGELGKVLHVT
FT                   GHYWTDYGSNAQAPISWRYKGPNGSGALADVGSHLTYLAEFVAGSDFADVRGGQLSTVI
FT                   TERPKPLGAIVGHEGGAVSDEYEAVENDDIASFSGSFISGGTATLQVGRISQGHPNTLG
FT                   FEVFCEKGSVLFDFRNSGEFKIFTPATSGDISQEAGYRTITIGPKHPYWRGGLAMDAPG
FT                   VGIGQNEGFVFQARAFLEEIAGIPEEESLPRCATLEEGLHNMQLIDAVAQSAAADGATV
FT                   AVPVLAPVQN"
FT   CDS_pept        271087..272100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53214"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG7"
FT                   /protein_id="BAF53214.1"
FT                   /translation="MKLGLYNAIFHDRTLPEALAAIKAAGLTGIELNTGGFLPATHIPT
FT                   IDDILVSDDARDEFLGVFEGTGVDIYGLNCNGNPLHPNKAIGDKHAEDIRRSIRLAERL
FT                   GQTRVVTMSGLPGGEPGAKYTNWVVNAWNSAALDVLDYQWDIAADFWRETDRLAADHGV
FT                   KVALELHPQNIVFNSADVHKLIDLTGATHVGVELDASHLFWQQMDPVAVIDHLGELIFH
FT                   AAAKDVRVNKEWAQLNGVLDNSFRRLDPSENRTNLGGDEWANEWPKNSAWDFVALGRGH
FT                   DVAYWTEFLRALHRVDPNMLVNIEHEDVSLGREEGVNEAAKVLIEANKALEESLVS"
FT   CDS_pept        272458..272661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53215"
FT                   /db_xref="GOA:A4QAG8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG8"
FT                   /protein_id="BAF53215.1"
FT                   /translation="MAQGTVKWFNGEKGFGFIAPNDGSADLFVHYSEIQGSGFRNLEEN
FT                   QLVEFEVGEGAKGPQAQQVRAI"
FT   CDS_pept        273087..274805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53216"
FT                   /db_xref="GOA:A4QAG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG9"
FT                   /protein_id="BAF53216.1"
FT                   /translation="MMAALFVYIMAIPVIMMIKDAVTVQPADGVKTGQGPGELTSYYLW
FT                   RTLRSPVSVDLFWRPLGNTLSIALVVIFLTLIFGTFLALLVQKSNVYGRKWFATALIIP
FT                   YVLPSWTFALAWQTIFTNRTTGGQSGWLENAGLNPPDWLAYGRIPMIIIFTLHYGPLVF
FT                   LLISNSLSRIDSRNEEAALNAGADRLTVLWKITLPLLRPAILSASTLVLAKSIGEFGAA
FT                   YVIGLPVNFSVLSTSLYQSINTRQTGVAAVLAGALILIGAIGLFADYLFLRNARKYVTI
FT                   TGKGNSSRVNPLGSWRIPATALVGLAFATSVLLPLGTLLLSTIMRYPGNFELSNFTLDY
FT                   WIGHNLPTQAFRDGLLINSKLWSALWNTVWIAAIAAAAAALMGMLTGYAVTRTTSSPLA
FT                   NLLKQLAFIPYLVPGISFAVAYLSLFAVQRGPIPPLYGTTFILILILAADEVPFASRSG
FT                   ISSMMQLGKESEEASLNAGASWGRTIAMIVLPIQKSALAAAFVLPFISATQALSPVIIL
FT                   ATSETNLLTTLSMNLVDYGYTHAANGVTLMICLVALLGMVITRKVLKVDMGKGIS"
FT   CDS_pept        274917..276086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53217"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH0"
FT                   /protein_id="BAF53217.1"
FT                   /translation="MKAKYLITTAAFAVSAIALTACTPSTAEADSESSQTSIANAAAVE
FT                   TVIEDVDLDALLEAAKDEPALQVYDGTSKIEKIAENFAEHYGLEITGSKADSSEVTEMM
FT                   IREHAAGNVQGDVFALSDLAAVNNELLANGSATAWLPADIAKNMDDSAINPPVVINDPS
FT                   LFTYNAEVNDVCPADNIWEFTDAASGQRLAFQDPLNDSGTLDWFSQMSQFASDELESSY
FT                   ASYFGEEFTGDDITEEFVAKLASNNPLLTKSSEEASEAVGAPGQTEPPMGLISSAKFRN
FT                   NDELGYKLAACDTLEPFVGYANPKAIVMASGTDSPNAAKLFIHWMYTQEGIEPQIADGK
FT                   ISTNSEIVQPEDPANVGELTDRIFTFDGSGVDTDWANREDWSDLWRMNS"
FT   CDS_pept        276131..277231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53218"
FT                   /db_xref="GOA:A4QAH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH1"
FT                   /protein_id="BAF53218.1"
FT                   /translation="MPTIELSRLTKTYQRGQPPAVDGIDLRIEDTELLCLLGPSGCGKT
FT                   TTLRMLAGLESITSGSITVGDQVWDDSDKGITVPANRRQAPLVFQSYALWPHLSVAENV
FT                   AFGLKTVGVPAAERSTRVRDVLSTLSINQYADRFPADLSGGQQQRVALARALALRPEVM
FT                   LLDEPLSNLDSQLRLRMRAELLDLHKDSGTTMVMVTHDQWEAMTLSTRIAVMNNGHIAQ
FT                   VGTPQEIYANPQTKFIAQFIGNPPINMVDLDGDGPLAAELRSYLEARWGHGVVSQVASV
FT                   GIRPEDIRLGSHAMPGALELDASVVSAAPTGGSWIVETQLGRGAENRLLSSALHAPEAR
FT                   VNDQVTLTIEDSRILLFNSNDNRITA"
FT   CDS_pept        277238..278038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53219"
FT                   /db_xref="GOA:A4QAH2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH2"
FT                   /protein_id="BAF53219.1"
FT                   /translation="MPTTTNLTTPKALLLDFGGVIATTVSVPGWEESIALKVIDLLSSA
FT                   GLNPPELSRVVADIQAGRVADNHWKNSMSRFRAPKELTYEEFWCEFVACDWEEATRDVL
FT                   REHSSNLCLEMGRVRQKRELRPGIVELLEYCTAHNIPVAIASNALSGEVHREFLAAHDL
FT                   SHFFVAECYSDELAVRKPNPALLEAAAQACDVPIGECWYVGDTLDRDVVAGQRAGIGAS
FT                   VTMEVFTVGKPLYPSLTWLKPDVTVADPHALLSLLQTQIGTVRL"
FT   CDS_pept        278035..279012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53220"
FT                   /db_xref="GOA:A4QAH3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH3"
FT                   /protein_id="BAF53220.1"
FT                   /translation="MNPRVTIIDVAKAAGVSKSTVSAALTNNPTVNTKTRDKVLAVAAE
FT                   LGYRPNRLARSLVRKNSGVIGVVVRNLRNPYYVDVVGGIEDACESLGLMPIISHSRDKV
FT                   EVASSAIDQLLELQVQGIIVISSRISMQTVRTAAKAVPVAVIGRFSDDDGEIFNIVGDD
FT                   FAGGSIGTAHLADLGHERIAYATTSVRLASTYRQSGYEQELNNRGLLPFTVNADNPRDT
FT                   ITALLQNGVTGVVAHNDVTAVALINAAHEQGIELPKALSIVGYDDTSLCDSARPTLTSI
FT                   NQPQKEMGRLAVEHLWSASHGENVGLQRIELKPSLHLRKSTIAI"
FT   CDS_pept        279035..279607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53221"
FT                   /db_xref="GOA:A4QAH4"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH4"
FT                   /protein_id="BAF53221.1"
FT                   /translation="MTPDLAAFLDQLYADGRDFDAGQPDRLDRRRNLEPESAALLRSLI
FT                   DGLTPKSVLELGTSNGYSTIWMADVTNLTTVDNDPGRSLDAAANLRAAGVEEKVQRIVA
FT                   DGATVLTDSADEQWDFIFLDAERSLYVNWWPDLQRVLANGGLLVVDNVLSHADQVVSFR
FT                   EHVDQTEGLRSLVLPIGAGLLIIAKQS"
FT   CDS_pept        complement(279645..280073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53222"
FT                   /db_xref="GOA:A4QAH5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH5"
FT                   /protein_id="BAF53222.1"
FT                   /translation="MKIEIFSPEALQSAEFAHLLWLASGYSAAQLDHTITHEISQMTTI
FT                   GIFEDASPIAFASYFNEPTRAVVEYIAVLESHQGMGLGSQLLKVVATSFPEIYLETDDD
FT                   AVDFYRKLGFVISPKERDPRWPDRERYACVWKRAEERV"
FT   CDS_pept        complement(280092..281084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53223"
FT                   /db_xref="GOA:A4QAH6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH6"
FT                   /protein_id="BAF53223.1"
FT                   /translation="MNVKLTHVAREAGVGYGTASRAISGRGSVDAATRDKVLAAAEKLG
FT                   NRTNAMARALRENKTRTVGLIVPDIINEFYTESAAVLQNELDKSGYQLVVSTIGNDAEK
FT                   ERRAIESMLNRQVDAVVHVPVNPQAKFPKGFKVVELNRRSDLNRPTVTSDDATGLKELA
FT                   LHILDQGYRDIGIIVGPAELSTARDRKAGFINALETEATQRGIREELRFRVVHSRYSPT
FT                   GGYEAFAEFRDDLPQIVVPLSTQLTLGVLKATQENGIKIPDDLALACYGVAEWLAVWGP
FT                   DITVFAPDLPAMGAAAATQVLTLLDAAPLPENHLSIPGQLIVRGTTPKV"
FT   CDS_pept        281268..281672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5002"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53224"
FT                   /db_xref="GOA:A4QAH7"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH7"
FT                   /protein_id="BAF53224.1"
FT                   /translation="MTRKFRRLHDLGYFIIPFVEFLSIVAGYFLIKTAADEFGKLNFIG
FT                   TILVVRGVVSLFTGWPLLFARVNDFRWDAVYLVGGAVFLAFLFLGPKEMTVLGLVAMFA
FT                   GPGMLIAGFSYLSRRIIAYFVELRRLQPSD"
FT   CDS_pept        complement(282048..283523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53225"
FT                   /db_xref="GOA:A4QAH8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH8"
FT                   /protein_id="BAF53225.1"
FT                   /translation="MASTFIQADSPEKSKKLPPLTEGPYRKRLFYVALVATFGGLLFGY
FT                   DTGVINGALNPMTRELGLTAFTEGVVTSSLLFGAAAGAMFFGRISDNWGRRKTIISLAV
FT                   AFFVGTMICVFAPSFAVMVVGRVLLGLAVGGASTVVPVYLAELAPFEIRGSLAGRNELM
FT                   IVVGQLAAFVINAIIGNVFGHHDGVWRYMLAIAAIPAIALFFGMLRVPESPRWLVERGR
FT                   IDEARAVLETIRPLERAHAEVADVEHLAKEEHAISEKSMGLREILSSKWLVRILLVGIG
FT                   LGVAQQLTGINSIMYYGQVVLIEAGFSENAALIANVAPGVIAVVGAFIALWMMDRINRR
FT                   TTLITGYSLTTISHVLIGIASVAFSVGDPLRPYVILTLVVIFVGSMQTFLNVATWVMLS
FT                   ELFPLAMRGFAIGISVFFLWIANAFLGLFFPTIMEAVGLTGTFFMFAGIGVVALIFIYT
FT                   QVPETRGRTLEEIDEDVTSGVIFNKDIRKGKVH"
FT   CDS_pept        complement(284310..284747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53226"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAH9"
FT                   /protein_id="BAF53226.1"
FT                   /translation="MVDFDTIAARLVTETEEAIIYATRDGIIRLWNGGSEKLFGYTAGE
FT                   ALGKSLDIIIPEKHRKAHWDGWDRVMESGKTRYGSEPLNVPGIRADGSKMSLEFSITIL
FT                   KDDSGKIEGVAAFLRDVTANWDEKKALRIRIKELERQIEGQ"
FT   CDS_pept        284949..289481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53227"
FT                   /db_xref="GOA:A4QAI0"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI0"
FT                   /protein_id="BAF53227.1"
FT                   /translation="MKPQGLYNPAHEHDACGVAFIADIHGRPSRSIVDRALEALRNIDH
FT                   RGAAGAEKNTGDGAGILMQIPDGFYREVSGIELPEAGEYATGIAFLPRGRMAMMDAQKE
FT                   IERIAKQEGADVLGWRMVPFDSRELGSMAEEAMPSFAQIFLTVPGKSGEDLDRVMFFIR
FT                   KRCERELGTTNGRDTVYFPSLSSRTIIYKGMLTTLQLEGFFEDLGDARLESAIAIVHSR
FT                   FSTNTFPSWPLAHPYRFVAHNGEINTVRGNENWMRAREALIKNDKLGNLSSVLPICTPE
FT                   GSDTARFDEALELLHLGGYSLPHAVAMMIPQAWEHNKTLSPELRDFYEYHSCLMEPWDG
FT                   PAALAFTDGRFVGAVLDRNGLRPGRITITDSGLVVMASESGVLDLREESVVKRTRVQPG
FT                   RMFLVDTAEGRIVEDEEIKQKLSEAQPYGEWIRDNFVHLDRLPQTRYNYMAHSRAVLRQ
FT                   RVFGITEEDVDLLLLPMARQGAEAIGSMGSDTPIAALSQRPRMLYDFFAQRFAQVTNPP
FT                   LDSIREKPVTSMYTLLGAQSDVLNPGPDAARRIRLESPIIDNHELATLINANAHGEWDS
FT                   FGAAVISGLYPVAHHGAGMKAAIARVRREVSEAIRNGKTLIVLSDRESDERMAPIPALL
FT                   LTSAVHQYLVQQRTRTQCSLVVESGDAREVHHLAMLIGFGADAINPYMAFETIDELRMK
FT                   GQLDDLSLDEASRNYIKAATTGVLKVMSKMGIATVSSYRGAQLADVTGLHQDLLDNYFG
FT                   GIASPISGIGLDEVAADVEARHRSAFLPRPEEHAHRELDLGGEYKWRREGEYHLFNPET
FT                   IFKLQHATRSGSYEIFKDYTRKVDDQSTRLGTIRGLFEFSTDRKPISVSEVEPVSEIVK
FT                   RFSTGAMSYGSISAEAHEVLAIAMNRLGGMSNSGEGGEDARRFDVEPNGDWKRSAIKQV
FT                   ASGRFGVTSHYLNNCTDIQIKMAQGAKPGEGGQLPPNKVYPWVAEVRITTPGVGLISPP
FT                   PHHDIYSIEDLAQLIHDLKNANPRARIHVKLVAEQGVGTVAAGVSKAHADVVLISGHDG
FT                   GTGASPLTSLKHAGGPWELGLAETQQTLLLNGLRDRIRVQCDGQLKTGRDVVIAALLGA
FT                   EEFGFATAPLVVEGCIMMRVCHLDTCPVGIATQNPDLRSKFTGKAEHVVNFFTFIAQEV
FT                   REYLAQLGFRSIDEAVGQAQVLRKRSGIPADSRAAHLDLSPIFHRPETPHFPTQDVRCT
FT                   KTQEHSLEKALDNAFIDKASDTITRAAAGVETSIVIDSSISNVNRSVGTMLGSAVSRVA
FT                   GAQGLPDGTITLNLQGCAGNSFGAFIPRGITINLTGDANDFVGKGLSGGKIVIKPSAQA
FT                   PKQLKNNPNIIAGNVLGYGATSGELFIRGQVGERFCVRNSGATAVVEGIGNHGCEYMTG
FT                   GRVLVLGPVGENFGAGMSGGIAYLANSPDLNQKINGELVDVVPLSADDLTWADELIARH
FT                   RELTGSETKLRAQDLVKIMPRDFQKVLNIIETAHAEGQDPAIKIMEAVS"
FT   CDS_pept        289481..291001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53228"
FT                   /db_xref="GOA:A4QAI1"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI1"
FT                   /protein_id="BAF53228.1"
FT                   /translation="MADPQGFIKYSRREPAHRPVPLRLMDYSEVYEKAPAGQIEEQAAR
FT                   CMDCGVPFCHEGCPLGNIIPEWNDLVRQGRWKEAYDRLHATNNFPEFTGRLCPAPCEGA
FT                   CVLGINDDSVTIKNVELEIVEKAFREGWVQPVIPSMSTGLSVAVVGSGPAGLAAAQQLT
FT                   RAGHSVTVFERDDRLGGLMRYGVPEYKMENRWIDRRIEQMEAEGTTFQVGTSPRAAELA
FT                   LFDAILLATGTPVARELSVPGDDLNGIHAAMDYLTAQNRINEGDGDVSPINAKGKKVVI
FT                   IGGGDTGTDCFGTALRQGAESVTQFDIRPRAPFQRADSTPWPMYPNLFRTATAHEEGEY
FT                   IITGDESADEIAALGLAERAAGSTLGERKFAVNTVEFHGNNGHVTGLTGNQIRVVNGKR
FT                   EPIEGTEFPFEADLVLVALGFTGAEQGGLAHELGVGFDDRGRILRDSEYRSPTNSRVYI
FT                   AGDNGRGQSLIVWAIAEGRACAAAIDADLMGETALPVAVAPQDVPLAV"
FT   CDS_pept        complement(291121..292608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53229"
FT                   /db_xref="GOA:A4QAI2"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI2"
FT                   /protein_id="BAF53229.1"
FT                   /translation="MGESVSTDRYTPQQRTRYRQLLMEDLEIFDRHLQHSDFEDQGSIG
FT                   LELELNLVDKHMQPALAGHAVLSHLDDEYQSEIGNFNVEMNHPPLSVKGDALRRLEQGI
FT                   TSRLGRVRAAATSENVNVAMIGTLPTITPEFLEDPAWMTQENRYRALSNAVMESRGELV
FT                   HINIADREQIIHDFTDLAPESTCTSIQLHLQLAPNKFAAAWNASQAIAGVQAALSANSP
FT                   LFLGRRVWHESRIPVFQQAIDTRTPELVNQGVRPRVWFGERWITSVFDLFEENVRYFSP
FT                   LIAESRALSGTPMMKGKSPALHYLNLHNGTVWRWNRPIYAPGEERSHLRLENRLLPAGP
FT                   TPIDITADAAFYYGLVKYLAEENRPVWSRLLFPDAEKNFQSGARSGLFARMTWPTLGQV
FT                   NVADLVQEHLIPQARIGLERLEVNKDLIDEYLGIITERARSRQNGATWQLRTLNKLEAH
FT                   GSMPGSDARKAGLAAMLQEYLRNQETGNPVHTWSIGN"
FT   CDS_pept        complement(292902..296375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53230"
FT                   /db_xref="GOA:A4QAI3"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI3"
FT                   /protein_id="BAF53230.1"
FT                   /translation="MSNSSPNDPSPMRQVGGNGGHQLDSINVSDVVESKKLKGSAQEPP
FT                   QVAPGWLKKLAISSGLLGLLMFVLLPFLPVNQVQSSLSWPQNGELSSVNAPLISYAPQS
FT                   MDASIPVSALDSLNDNQSLVMGTLPLDSTDATNRGLFVRTIDGNLDVIVRGEVLLDLSP
FT                   TEVNRLPDDAILEISSTEETTSAEITGTAFSGETEGDERPQVTGVYTELVDDPSTASAL
FT                   ASAGLKVDIEINSRFTSSPSLLKYAAIFIGLASVLVSLWALHRMDILDGRKAHRFLPAN
FT                   WYKLKPLDGVVVAILVFWHFIGANTSDDGFIMNMARVSQNADYMANYYRWFGVPESPFG
FT                   APYYDLLALMAYVSTSSIWLRLPALLAGLIMWFVITREVMPRFGSLVNGRRVAHWSAAM
FT                   VFLAFWLPYNNGTRPEPIIAMGALLAWVSFERAIATSRLLPAAIGVIIATISLASGPTG
FT                   LMAVAALLVSLSALIRILYRRLPLIGAPRGASKSKVFGASMAMLSPFLASGTAILIAVF
FT                   GDQTLSTVMESISVRSAKGPSLTWYHEYVRYQTVMEQTVDGSFTRRFAVLILMACLAIV
FT                   VIAILRYGRIPGAAKGPSLRLMMVIFGTMFFMMFTPTKWTHHFGVYAGLAGALAGLAAV
FT                   GLSYVAVKSPRMRTISIGAFLFLLALALAGVNGFWYTSSYSVPWWDKTIQIKGIEASTV
FT                   VLVIAVIVLIIGVIQSFVHDVKTAQAETNHSMGELVAEDEAKRERASRFTGLAASPIAG
FT                   VSALVVLITCASMGKGFVDQYPAYSVGLGNLRSLTGNTCGLASDAMLETNSNDSFLTPV
FT                   NSTLGESLESEDIRGFSASGIPPSISQDQANLSQVGAIANTDDSTETGGSDESSGQSTG
FT                   NTGGVRGSEGINGSNARLPFNLDYTQVPVVGSWSAGTQNPANITTDWYEIPEATEEAPI
FT                   IVVSAAGRIEHYDINGVHQSGQSVVLEYGRLRDNGDVEDLGEAMMYDIGPEPSWRNLRY
FT                   PLDQLPEEADVVRIVATDVNLDEDQWVALTPPRVPNLDSLNNVIGSETPGLLDWAVGLQ
FT                   FPCQRTFDHYAGVTEIPEYRISPDHGGKSTLSPFQDWAGGGSMGTAEAVNNAYEIPSYL
FT                   RNDWGRDWGSIERYSLRTNSNGDAPKVADINLETIQRSGLWNPGHMKVDE"
FT   CDS_pept        complement(296368..298401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53231"
FT                   /db_xref="GOA:A4QAI4"
FT                   /db_xref="InterPro:IPR020959"
FT                   /db_xref="InterPro:IPR020963"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI4"
FT                   /protein_id="BAF53231.1"
FT                   /translation="MINTSEDEGAVVVHEDLNPYGPSRVPEGEVYRPDRLNRKATLAAI
FT                   VGAAILAFAFALVLWMGLKQTNLPAFGPSNVTRAVASATIAAVLIVTGFLTWLWLRDEH
FT                   QSNPRWELEDVKPRPKWRTALTYLASYLSPAALVVAVLAIPLSATRLYLDGISVDQGFR
FT                   TQFLTRMADDISLSDMNYIDMPTFYPAGWFWLGGRLANLLGLPGWEAFQPWAIVSMAVA
FT                   ASVLVPVWQRITGSLPVATGIALVTTCIILAMNSEEPYAAIVAMGIPAMLVLASRIAKG
FT                   DKFALASGIIYLGVSATFYTLFTGAIALSAVAVCIVMAAIVQRSIKPLLWLAVLGGGSI
FT                   VIALISWGPYLLASINGAERSGDSATHYLPLEGTQFPVPFLASSVVGLLCLVGLIYLVV
FT                   RFHNNEVRAMWVGIAVFYAWMGMSMAITLLGNTLLGFRLDTVLVLIFATAGVLGIADFR
FT                   LASVYQLYPTQITERTANYLTNFIVILVLLGGLYYAQDLPQKNARAIDLAYTDTDGYGE
FT                   RADLYPAGAARYYKDINDHLLDQGFEPSETVVLTDELDFMSYYPYRGYQAFTSHYANPL
FT                   GEFGNRNAFIEDLAIRSWDELADPQQFSNALNTSPWTIPEVFIFRGSIDDPDAGWKYDV
FT                   AEDLYPNNPNVRFRGVYFNPESFDQMWQTKQVGPFVVVTHNE"
FT   CDS_pept        complement(298571..299332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53232"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI5"
FT                   /protein_id="BAF53232.1"
FT                   /translation="MLNAVGKAQNILLLGGTSEIGISIVSRFLKQGPSHVTLAARKDSP
FT                   RVDAAVAEIKAAGAASVTVVNFDALDTESHPAAIDAAFENGDVDVAIVAFGILGDNEAQ
FT                   WRDQALAVEATTVNYTAGVSVGVLLGQKFEQQGHGTIVALSSVAGQRVRRSNFVYGSAK
FT                   AGFDGFYTQLGEALHGSGANVLVVRPGQVRTKMSADGGEAPLTVNREDVADAVYDAVVN
FT                   KKDIIFVHPLFQYVSFAFQFIPRAIFRKLPF"
FT   CDS_pept        complement(299353..300819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53233"
FT                   /db_xref="GOA:A4QAI6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI6"
FT                   /protein_id="BAF53233.1"
FT                   /translation="MNSSHGTSSSGASAGAHGALPLEAQKLNGWGRTAPTTAEVLSTPD
FT                   LDIIVDAVRQVAEQNDSKPDYLKRGVIARGMGRSYGDPAQNAGGLVIDMQPLNKIHSID
FT                   PDSAIVDVDGGVTLDQLMKAALPYGLWVPVLPGTRQVTIGGAIGPDIHGKNHHSAGSFG
FT                   DHVVSMELLVADGRILHLEPEGTAEDPQGDLFWATVGGMGLTGIIVRARIRMTKTETAY
FT                   FIADTDRTNNLEETVAFHSDGSEHNYTYSSAWFDVISPEPKLGRSTISRGSLATLAQLE
FT                   ELAPKLAKDPLKFNAPQLMKVPDIFPSWTLNKLTLSAVGVAYYAMGAPAKNQVKNLTQF
FT                   YQPLDLIGEWNRGYGSKGFLQYQFVVPTEAVEPFKDIIRDMQKSGHYSALNVFKLFGPG
FT                   NRAPLSYPMPGWNVCVDFPIRPGLGAFLDDLDKRVMEFGGRLYLAKESRTSAENFHAMY
FT                   PGMEGWLKTRNEIDPTGVFASDMSRRLELS"
FT   CDS_pept        complement(300896..301123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53234"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI7"
FT                   /protein_id="BAF53234.1"
FT                   /translation="MFERFKKAKAPEVHIAAERTNLPLNDFMTRLFAQELPLLDSTSRS
FT                   EVYRLLREYDGPTISSQEEIPAEIRELMDL"
FT   CDS_pept        301141..301650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53235"
FT                   /db_xref="GOA:A4QAI8"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI8"
FT                   /protein_id="BAF53235.1"
FT                   /translation="MSSLGNMDTRMRLQVAAGSALIGAGVAVNDYVQSPVRRAISYGAL
FT                   ALSGATVIAMGQDPTGERSIIAKDSATMVDQIRQEIGDLGVTPGPESDVDAITERGPLV
FT                   TWLLLAVFVVAFFTLAYFSIRMDVAVMRRIAKFFEKRGASRPFTCTGMVYAAFIYAICE
FT                   LEARTK"
FT   CDS_pept        301647..302102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53236"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAI9"
FT                   /protein_id="BAF53236.1"
FT                   /translation="MTYPVLSVLDNSGDHNIIWHVQTYPAALPTGAWIADEQQLTDLLK
FT                   DTVVFLTPGSTAPENSPVATIEGVRVGVDKQVAEYNKHGIRLPSLGARTVEAQYRGEPE
FT                   AEAAWRTALELAEIASGWLEIEAKRRARKALAEAFGAEVQPLPLDTE"
FT   CDS_pept        302089..303024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53237"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ0"
FT                   /protein_id="BAF53237.1"
FT                   /translation="MTPNRTNGSILGRMPTNYARDNVISLASAREQRSGKPEPKPELTL
FT                   IVRATNVQADGEVHRQIGLNSAMSLDELHNVLNIVFGVGGEQSPWRFEDQFHQPSAPDT
FT                   NLGELLPEPGDFLFYFWGLWQFNLQCVEMYPRDNGTPRALCIGGSGGLGDDFDQATINA
FT                   ELTGTDTIRDVLSGVRPEVIDLVDRTGVFDFIPLLQALDLKREPLIDATRHHTCRMLPV
FT                   ENSAEASDAFWSCVLALSCLGNDELFIEVIESTMSTLGWVADDGSPLRAPEIISACEAS
FT                   LKILAEIGGYGPEQLAPVDRLDIYRELLCF"
FT   CDS_pept        303040..303474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53238"
FT                   /db_xref="GOA:A4QAJ1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ1"
FT                   /protein_id="BAF53238.1"
FT                   /translation="MPENPDVTIVRPMSLKTQAFRFILTGGLSAIVDLGLLSLLQLVFG
FT                   LPVPVARTISFIAGTTTAYMINRRWTFQAESSTSRFLAVVALYGVTFLINIGLQTLCSA
FT                   LFENWGWNEAVAMVCAFVIAQGTGTVINFIVQRTIIFRVK"
FT   CDS_pept        303485..303889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53239"
FT                   /db_xref="GOA:A4QAJ2"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ2"
FT                   /protein_id="BAF53239.1"
FT                   /translation="MKTFNPTMIAGLIGVLYFVLLTLIFSIQDMELAAEIAFGIVTIVG
FT                   LIAVWDNFRDRNNSTWKTWTGLVGGLLIAVPGICLLVGNLVLLAVDGNPSTMVNTLLSV
FT                   AGIGAIFLLPIGIIMCLIAGFNRFYAALKV"
FT   CDS_pept        303891..304526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53240"
FT                   /db_xref="GOA:A4QAJ3"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ3"
FT                   /protein_id="BAF53240.1"
FT                   /translation="MPGLVLSTNVAHIQQDPGGDDRISGINKLPVATGIDVFIPGPNYG
FT                   DGSGVVGDAIGDSLHHGGAHKAIYAYSREELDFFDPTYRNGYFGENLTTSGIVLEDLLI
FT                   NQQVRIGTTLLEVSIPRRPCRTFAHWLDIKGWLKTFTQRGLPGSYFRVIEEGHINPGDP
FT                   IEVLQAPDHDITMSMAFRAKMGNKDLARRVVAANCLPARYHEELLKLI"
FT   CDS_pept        complement(304523..305464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53241"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ4"
FT                   /protein_id="BAF53241.1"
FT                   /translation="MYAMAKTGTHLQHGIDVAAVIVTHNRVELLRHSLEVVANQTYPVK
FT                   HIVVVDNGADPDVEKLVLEVAGDRAVYTPSRTNLGGGGGFAFGFLTALALGADAVWCAD
FT                   DDGRPEGPEVLKTLIDAASRHNLEEVSPVVCNADDPERLAFPLRRGLEWRRMRSELIDP
FT                   ANPEDDLLPGIASLFNGALISAYAMEHIGVPDYRLFIRGDEVEYHRRLVRSGLPFGTCL
FT                   TTAYLHPDGSDEFKPILGGRMHTQYPDNDFKRFFTYRNRGYLMSQPGMRKLLPQEYARF
FT                   AWFFLVQKRDVKGFREWLRLHKLGRDEKFNRP"
FT   CDS_pept        complement(305477..306076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53242"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ5"
FT                   /protein_id="BAF53242.1"
FT                   /translation="MGTQIDHIVIAAPNLEDLVSRFEKLTGVKAVAGGRHDTGTANALV
FT                   PLKEPKGSYLELIGPDPEADAVTQDNFAIATTQSTEPRVAAWCVRPDDLEALAAKRGTQ
FT                   SQLMSRHTPEGRTLTWRLILPEPGVDFAPVPFAIDWLGSPHPSKVTEPQVSVHSFTVHG
FT                   HSEPDELPEPAVFQEGKPLLELVLESPKGRVNLSDL"
FT   CDS_pept        complement(306649..307440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53243"
FT                   /db_xref="GOA:A4QAJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ6"
FT                   /protein_id="BAF53243.1"
FT                   /translation="MVSIDTYNACVDFPIFDAKSRSMKKAFLGAAGGAIGRNQDNVVVV
FT                   EALRDINLHLREGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGSADIRGRVAPVFDLGVG
FT                   MDPEISGYENIIIRGLFLGQTRKQMKAKMEEIADFTELGEYLSMPLRTYSTGMRIRLAL
FT                   GVVTSIEPEILLLDEGIGAVDAAFMAKARDRLQALVERSGILVFASHSNDFLAQLCNTA
FT                   LWVDHGQIRDAGLVPDIVESYEGKGAGDHVRRLLTRMEEEK"
FT   CDS_pept        complement(307451..308347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53244"
FT                   /db_xref="GOA:A4QAJ7"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ7"
FT                   /protein_id="BAF53244.1"
FT                   /translation="MQEQSKQKDLQADIARITAVKSDTVPNSQSMTFGAAWNDIVRGFK
FT                   QHELWLQLGWQDIKQRYRRSVLGPLWITIATGVMALALGLLYSVLFKIPIAEFLPHVTV
FT                   GLIIWNFISGCIKEGSDIFIDNEGLIKQLPSALSVHVYRLVWKQALFLAHNLVIWVILM
FT                   MIFPRPLGWDVLLIIPAMFLLVINGVWVVMFFGIIATRYRDVSPLLEAGTQLLFYVTPI
FT                   VWMTSTLQSQSAEIGNRARLAELNPLYHYLEIVRAPMIGADLPAYHWWIVLAFTFVGLG
FT                   LALLAMKQWRFRVSYWV"
FT   CDS_pept        308490..309665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53245"
FT                   /db_xref="GOA:A4QAJ8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ8"
FT                   /protein_id="BAF53245.1"
FT                   /translation="MGFDVARVRGLYTSLGDGWTYLNSHQIPQVPERVASGVAAAFRTH
FT                   AQISEVTSRPIAVDQLEAAREAVASLAGVDPDCVVLGPTRQFLAHTLARGLGGFVRRKA
FT                   GVVLSRADADWLTAPFRSLDGVFSWAEPDLGTGMLPDWQYEKLVDGSTRLVVLSAAHPL
FT                   LGTVAPVGKIVDKVRARSRAWVLVDATTYAAYRPLRLDEWEADIVMLDLGELGGPQISA
FT                   LIFRDTSMFPRLDRTVPLELPASSLPHGLLGGVPNLVRHLGNLDENAPSVVEAMGEMAK
FT                   FHKGLFEHLVESLEGLHAVHIVGISGDAAGQDAAFLDRVPRLTFTVEGVPADMVYRRLV
FT                   DNRLVTTVSPADPLLDAMGVTEAGGSITIGLSPFSTHYEVDQLTRVLASLA"
FT   CDS_pept        complement(309662..310618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53246"
FT                   /db_xref="GOA:A4QAJ9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAJ9"
FT                   /protein_id="BAF53246.1"
FT                   /translation="MQAIVQTEEKVTASLELQEVPVPTLKPGEVLVEVKAAGVNRADLL
FT                   QTQGNYPVPAGASEILGLECAGVIVDAGDTGQTVGQEVACLLTGGGYAEYVAVPEGQLM
FT                   PIPEGYSFVEAASIVEVACTVWSNIGMLAGLQKEDTFLIHGGAGGIGTFAIQMGKALGV
FT                   TVAVTAGSTEKLKTCKNLGADILINYKEEDFAEVLKNKADVILDIIGAKYLSQNVKAMA
FT                   KDAHMVVIGMQGGVKGELNLGHLLAKRGTISATALRGRDEADKARIVSSTVENIWPLLQ
FT                   SKEITPHIDHTLPLAEAAAALQKIQDGTITGKLVLTV"
FT   CDS_pept        complement(310639..311223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53247"
FT                   /db_xref="GOA:A4QAK0"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK0"
FT                   /protein_id="BAF53247.1"
FT                   /translation="MKSYPIVSNILNHLIRGNYMDLLKIAIIAAVMIGVPVLVVFLIVF
FT                   AVHKLAKEVPQSGRRPGIGLGLLLGFVAGLIVWFVWLSWGGYYENEFGQMQGPYRPWQV
FT                   VACGVTMVAVTVILGLWTRWTASGPFYSALGGTSGFSFAWAMDALPQDETGLSAFGLVM
FT                   VIVGVGAGLNVVATLTSIGATIWNNRLPSNA"
FT   CDS_pept        311608..311721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53248"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK1"
FT                   /protein_id="BAF53248.1"
FT                   /translation="MLNNEVLSNYEIVSENQVLACQTIRDADGPYHCSFDD"
FT   CDS_pept        complement(311718..313205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53249"
FT                   /db_xref="GOA:A4QAK2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK2"
FT                   /protein_id="BAF53249.1"
FT                   /translation="MELLETFITDVINDNLWMILPFLLVAAGLYFGGRTLLVQIRMIPE
FT                   MFKAVVEKPAKDGEFADKQDISAFKAFTISAASRVGTANVAGVALAITLGGPGAVFWMW
FT                   IIALVGGATSFIESTLGQLWKVKDGDSYRGGPAYYMTLGLNARWLAVVFGVAITLTFGF
FT                   VYNALQSNAVVEAITVSLGTPSTTAKAFVGLGMAGLSALVIFGGVQRIANVTQWMVPFM
FT                   AGAYIIVGVVVIVINIQQVPTMINDIIAGAFGFRPVATASVWGAFWLAFMNGMRRGLFS
FT                   NEAGEGSVPNAAATATVSHPVKQGLVQTLGVYFDTLLVCSITAFVILLSGVEYATGDIQ
FT                   SSSLTQSALASVVGGWGTHFITAVMFFLAFSSVLGNYYLAQANIQYFTDSKTVMTVFRL
FT                   LVLLSVFSGAVASVPLIWALGDTFAGIMVLINLAAIIPLSGVAVKLLKNYTTQKKAGLD
FT                   PVFHRDMMPEVRNIACWNGKDAATSNYHEAMEVIKKN"
FT   CDS_pept        complement(313300..313548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6013"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21075"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VPP5"
FT                   /protein_id="BAQ21075.1"
FT                   /translation="MQPFGRLICPVSRAWIPARAKQGGFLDGKGYPRPKPALIDPPRAQ
FT                   QGKLARRSDHPELKPALFAPQRAKPGRLPSGAAHPGS"
FT   CDS_pept        313925..314758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53250"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK3"
FT                   /protein_id="BAF53250.1"
FT                   /translation="MKEGKLHRVLRGVYSLDPPSGEVVWSSIRLVRPSALLDGKSAVEV
FT                   YQGVPLSLPVRVRVSTSNVLRGSRNVVARRSQRTDGIAHRGFRVVSLVDAVATCLDEGS
FT                   VHPSDLRRLVEERYKSGSGVKQMAHDLKLLRTRRKAQLREFLEECIYGLDSGLEKVMVQ
FT                   ELRAAGFRTRQNVVVEGYRWDIQVVGVALIDVDSRKYHQANGRNFIIDRWKSNEAAVQG
FT                   HVPLRFTDDCVNYATREIIKLVKQVAEFKRKHPRRRVKTQGVGPVFRWHNALVLP"
FT   CDS_pept        complement(314750..315835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53251"
FT                   /db_xref="GOA:A4QAK4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK4"
FT                   /protein_id="BAF53251.1"
FT                   /translation="MGRPVKNLDIARYRRQIMLGEIGQQKQQSLFDAKVSVIGAGGLGS
FT                   PALLYLAGAGVGHIHIIDDDLVDLSNLHRQVIHTTAGVGTPKAESAREAMLALNPSVKV
FT                   TVSVRRLDWSNALSELADSDVILDGSDNFDTRHLASWAAAKLGIPHVWASILGFDAQLS
FT                   VFHAGHGPIYEDLFPTPPPPGSVPSCSQAGVLGPVVGVMGSAMAMEALKIITGVGIPLI
FT                   GKLGYYSSLDGTWEYIPVVGSPEVLERVLGSAGVSGISGGFGEVLDVPRVSALVDGVSL
FT                   IDVREPSEFSAYSIPGAHNTPLSAIREGAIPPDVSAGKEVIVYCAAGVRSAQAIAILES
FT                   AGYTGMSSLDGGIEGWLDSLG"
FT   CDS_pept        complement(315820..316278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53252"
FT                   /db_xref="GOA:A4QAK5"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK5"
FT                   /protein_id="BAF53252.1"
FT                   /translation="MNTDPAYVAEQTGKLIDAFLTTDPLEPLLDAAKTDVCTEAMGALV
FT                   TFEGIVRDHDGGARVTSLTYTAHPTAPQVLSAVADSIVEKHPRTRLWTAHRTGALKIRD
FT                   AAFLVVAASAHRADAFAACSDLADAVKAQVPIWKEQTRLDGSTDWVGL"
FT   CDS_pept        complement(316268..316729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53253"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK6"
FT                   /protein_id="BAF53253.1"
FT                   /translation="MTALVIVASTRAAAGVYEDRSGPILVSWLRAKGFDTPDPVIVADA
FT                   DLPAFLDELKFPQVVLISGGTGLTPDDITVDTLIPRLDKEIPGIAHAFWNYSMDAVPTA
FT                   VLSRTVAGTIGSSFIMALPGSTGAARDATAVLDPLIDHITGTLQGHHEH"
FT   CDS_pept        complement(316726..317196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53254"
FT                   /db_xref="GOA:A4QAK7"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAK7"
FT                   /protein_id="BAF53254.1"
FT                   /translation="MSKLTHVREDGSAHMVDVTGKNETSRTAVAEGFVKMRGDVVKQLF
FT                   SAGLPKGDALPVARIAGIMGAKKTPDIIPLCHPLPLGKITVDFFELADGVRIEASVKTR
FT                   GVTGVEMEALTAVSTAALTVYDMIKAVDKMAVIDGIRVLSKTGGKSGDWSVQ"
FT   CDS_pept        complement(317211..318398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53255"
FT                   /db_xref="GOA:A4QAK8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK8"
FT                   /protein_id="BAF53255.1"
FT                   /translation="MMSRSPEQHLAEISALLPPQKSTFVNLREALGRRTFTAVTAQWDS
FT                   PRFDNSQMDGFALGPSHLNGGTFAVGPTIPAGHDPDQWYPRGIEKDIAPIMTGARLPKN
FT                   TAAIIPVEKTTPGNFDAPQVEIPATPQGQFIRLQGSDITAGDEIIPGGTELNSMHIGVL
FT                   ASQSIKSIEVAAKPRVLIITGGSEISEQHGPATIPDANGPLLRSLCARNNIEVIAGLHT
FT                   NDDPERLRFELDNAIDQYQPDAIITSGGISHGKFEVFRQILEGSPNSWFGHVDQQPGGP
FT                   QGISTFAETPVISLPGNPISTLVSFTLFVAPALNRQPLRHLDAHITAPVQGLQDNREQF
FT                   LRGTINYANGKVLATPLLGTSSHLLVQAATANCLIRIPARTTVEENDIVKIYPFN"
FT   CDS_pept        complement(318399..319250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53256"
FT                   /db_xref="GOA:A4QAK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAK9"
FT                   /protein_id="BAF53256.1"
FT                   /translation="MVLAQTKAPKTKTRRSENHILPGWLLIPATLAMLLIIGPIFALLL
FT                   QIPWDRSWELLTAPESLETARLSIGTALFSTALCAIVGFPLALALHLYERSHPRVTSVL
FT                   TVLVYAPLVLSPVVSGLALTFLWGRRGLLGSWFDQVGLPIAFTTTAVVFAQVFVALPFF
FT                   ISTVTTALRGIPKQFEEIAATEGATRWEIMHKMIIPLAMPGIFTGMILGFARALGEYGA
FT                   TLTFAGNIAGATRTIPLHIELGLSSNDMDKALGAVIMLLAVYVLIIGAIGALRLFSKVR
FT                   KV"
FT   CDS_pept        complement(319231..320037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53257"
FT                   /db_xref="GOA:A4QAL0"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL0"
FT                   /protein_id="BAF53257.1"
FT                   /translation="MNKSIRRALYSFITISAGISLVACSSSDTASTTTQNASATEAARV
FT                   SGTASVFAAASLTNVAEDLAAAFHEDNPDTKLEFNFAGSSALVRQISEGAPSDLFISAD
FT                   IANMDDALALPEFAGATSKVIATNKLVLVTADGNPGEISELADVKDSLVAICAPEVPCG
FT                   TITHEALDYADIELNTSSEEANVADVATKISTGAVDAGFVYQTDAQSLAKTQDNTVIEL
FT                   EGIDANEYPMALTTSGEDNEVAKAFAEFLSSDRAKEILASYGFGTN"
FT   CDS_pept        320065..320454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53258"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL1"
FT                   /protein_id="BAF53258.1"
FT                   /translation="MLNQHNCGVGNFQWDWVEIKRSLFKYCAFPTISSVLNPEGNFNNM
FT                   DIHYFAAARAARGVAQETVAPSELTLSDLLKQLGEQHTETTAAGMTLAQVFDRCTFLID
FT                   GRSADSSASLSGASRVDVLPPFAGG"
FT   CDS_pept        complement(320451..321365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53259"
FT                   /db_xref="GOA:A4QAL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL2"
FT                   /protein_id="BAF53259.1"
FT                   /translation="MADLSIEHVSRFFGDATALNDVSLTVPSGSITAIIGPSGSGKTTL
FT                   LRLLAGLDSPDEGTVSIGNKIAKLGDTALCFQDSPLYPHLNVWENVAFPLKLKATNTAD
FT                   EVVKKRVSDVLEMLEIAPLARRKITELSGGQKQRVGIARALVRDVEVYLFDEPMAHLDQ
FT                   ALARDIVADLRKIQQSLGLTFVYVTHSKSEAFALADQIVVLVDGQVAQVGEAEELVDKP
FT                   KTLEIAEFLSPTELNVRRRGDAVEAWRPEDTQLTRGGTATVEAVTYLGREWLVQTTEGH
FT                   AVSEEKFDVGESVTLTQKKVFSF"
FT   CDS_pept        complement(321368..321790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53260"
FT                   /db_xref="GOA:A4QAL3"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL3"
FT                   /protein_id="BAF53260.1"
FT                   /translation="MLGSLWRFAVRTAAGAVALWVVIKLIDGISLSFPTTPLYQDGQHD
FT                   NLLTFLAVAAIIVVLNATVKPVLKLLGLPLTIITLGLFSLVINAVIMLLAEYVSDLIGF
FT                   GLHIETFGAAFWGAIVLALVNWVLGPITGLLGAKKD"
FT   CDS_pept        complement(321780..322805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53261"
FT                   /db_xref="GOA:A4QAL4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAL4"
FT                   /protein_id="BAF53261.1"
FT                   /translation="MIRADLATIPTYVPGRRLNNATKLSSNEVSFSPLPAAVDAVTEAT
FT                   QGANRYPDMGAVELREALAEHLEVEFDQVTVGCGSSALCQQLVQATCAQGDEVIFPWRS
FT                   FEAYPIFAQVAGATPVAIPLTADQNHDLDAMAAAITDKTRLIFICNPNNPSGTTITQAQ
FT                   FDNFMEKVPNDVVVGLDEAYFEFNRADDTPVATEEIHRHDNVIGLRTFSKAYGLAGLRV
FT                   GYAFGNAEIIAAMNKVAIPFAVNSAAQAAALASLNSADELMERVEETVEKRDAVVAALG
FT                   TAPTQANFVWLPGEGAAELAAKLAEHGIVIRAFPEGARISVTNAEETDKLLRAWEAINA
FT                   G"
FT   CDS_pept        323698..325008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53262"
FT                   /db_xref="GOA:A4QAL5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL5"
FT                   /protein_id="BAF53262.1"
FT                   /translation="MKELDLGEAHGVAATLEAMPIQEVIDQVERTPIAEGAVLLRLLSK
FT                   DRSLLVFDALNPRLQADLIGAFQDAEVLDYFADLDPDDRVSLLDELPASIADELLRSLD
FT                   PQAKQVTELVLGYAKRSVGRWMSPQVLLLYDDMSVAEVLDYVRNHAAEAETIYALPIVN
FT                   RARQVVGVVSLRKLFIADPALKVSEVMVRPVSVLASADAEETARWFLQLDLVAMPVVDE
FT                   SDMLVGVLTFDDAQDIVEQAESEDSARSGGSEPLQQPYLSTPIRKLVKSRIVWLLVLAV
FT                   SAILTVQVLDVFEATLAEAVVLALFIPLLTGTGGNTGNQAATTVTRALALGDIRKSDVF
FT                   RVLGREIRVGLMLGALLGGVGFVIASLVYGMPVGTVIGLTLLAVCTMAASVGGVMPIIA
FT                   KAIGADPAVFSNPFISTFCDATGLIIYFAIAKLVLGI"
FT   CDS_pept        325415..326998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53263"
FT                   /db_xref="GOA:A4QAL6"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL6"
FT                   /protein_id="BAF53263.1"
FT                   /translation="MSTPDIKEGSAESPGEVMVVGDRREWRRQATGIIAGLVLAALVYL
FT                   LFPSNSVETVMQSSGVDPETEYTNNAMRLTAAVTILMAVWWMTEAIPLAATALIPLVAF
FT                   PAFQVVDFGKAAAPYANPTIFLFLGGFLMALGLQKWNLHRRMALAVVLAVGTKPKQLVL
FT                   GFMVATGFLSMWVSNTATAVVMLPIGMSVLALTAETVGGMKNQKKFATGLMLSIAYSAS
FT                   IGSLGTLIGTPPNALLAAYMSESHDIHIGFGQWMILGVPIAVVFTIIAWLVLTTVFKPE
FT                   MKEIPGGRELIKREIAEMGPWTAPQVTVGVIFAAAALAWVFIPLTLDWTGSQLSINDSL
FT                   IGIAAGLLMFIVPANFKTGERILDWRTAGELPWDVLLLFGGGLSLSAMFTSTGLSLWIG
FT                   ELAKGLDALPIFILIFAIAVLVLFLTEFTSNTATAATFLPIMGGVAVGIGLTAGGEQNV
FT                   LLLTIPVALSATCAFMLPVATPPNAIAFGSGYIKIGEMVKGGLWLNIIAVILISISTYF
FT                   VAIPLFGIML"
FT   CDS_pept        complement(327359..328381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53264"
FT                   /db_xref="GOA:A4QAL7"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL7"
FT                   /protein_id="BAF53264.1"
FT                   /translation="MTTKDISRPVCILGLGLIGGSLLRDLHAANHSVFGYNRSRSGAKS
FT                   AVDEGFDVSADLEATLQRAAAEDALIVLAVPMTAIDSLLDAIHTHAPNNGFTDVVSVKT
FT                   AVYDAVKARNMQHRYVGSHPMAGTANSGWSASMDGLFKRAVWVVTFDQLFDGTDINSTW
FT                   ISIWKDVVQMALAVGAEVVPSRVGPHDAAAARVSHLTHILAETLAIVGDNGGALSLSLA
FT                   AGSYRDSTRVAGTDPGLVRAMCESNAGPLIKALDEALAILHEAREGLTAEQPNIEQLAD
FT                   NGYRSRIRYEARSGQRRAKESVSPTITSSRPVLRLHPGTPNWEKQLIHAETLGARIEVF
FT                   "
FT   CDS_pept        328389..328913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53265"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL8"
FT                   /protein_id="BAF53265.1"
FT                   /translation="MWHIPTTVISMNTEEDGLSFAVTATLVEGKWQVREFEDHFSKLST
FT                   SINAVRSLRSEGPAFALLCVDDEYFVMVRPTPSRVFLFLSDAPMAVDDDFAAAVMDELD
FT                   ADLPDINPDDLDDIDPWPEGDFDILADLGLSEEVLSVICDDMDLDPSEQLLRIAEELGF
FT                   DNDLARVVGFD"
FT   CDS_pept        328913..329392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53266"
FT                   /db_xref="GOA:A4QAL9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAL9"
FT                   /protein_id="BAF53266.1"
FT                   /translation="MGVLPVQARIKDDERRMRHALDIARQTPEGDVPVGAVIYAPTGEI
FT                   LATATNRREADRDPTAHAEIIALRRAARRFSDGWRLSDCTAVVTLEPCSMCAGALVGAR
FT                   IGRIVFGAFEPRTGACGSVFDVVRDPAVLHKVEVSGGILEPECAALMTEFFELHR"
FT   CDS_pept        329494..329697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53267"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM0"
FT                   /protein_id="BAF53267.1"
FT                   /translation="MSDFSNKAEDLTGKAKEGFGEATDNESLADEGRADQAKADIKDAA
FT                   ENAGEKVKDAANKVLGAFKKDD"
FT   CDS_pept        329967..330320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53268"
FT                   /db_xref="GOA:A4QAM1"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM1"
FT                   /protein_id="BAF53268.1"
FT                   /translation="MLYSVVMNLALFFAIAVTGLVGVSLLRKQASEERVFPWFWVFFPL
FT                   TLMSISGIFMKLELRTSFDFGWTMYEPSIYSSEFQPDFFDLYNATTISIIIYIVTLIVG
FT                   VIGSVIAWKKRRI"
FT   CDS_pept        330412..332817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53269"
FT                   /db_xref="GOA:A4QAM2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM2"
FT                   /protein_id="BAF53269.1"
FT                   /translation="MAKLLFRLGRWSYNRKWIVISAWLLILAIVGGLALTMQKGFSNSF
FT                   TIEDTPSIDATVSLVENFPDQTNPVTAAGVNVVFQSPEGTTLDDPSMMTAMDAVVDYIE
FT                   DNLPDFGGGERFGNPVEVSPALEEMVIEQMTSMGLPEETAAKDAANLAVLSEDKTIGYT
FT                   SFNINVEAAEYVEQKHRDVINEAMAIGDDLGVRVEAGGPAFGDPIQIETTSEIIGIGIA
FT                   FIVLIFTFGSLIAAGLPLITAVIGVGIGALAIVLATAFTDLNNVTPVLAVMIGLAVGID
FT                   YALFILSRYRAEYKRMPRADAAGMAVGTAGSAVVFAGATVIIALVALIIADIGFLTAMG
FT                   ISAAFTVFVAVLIALTFIPALLGVFGGHAFKGKIPGIGGNPTPKQTWEQALNRRSKGRS
FT                   WVKLVQKAPGLVVAVVVLGLGALTIPAMNLQLSLPSDSTSNIDTTQRQSADLMAEGFGA
FT                   GVNAPFLVIVDTHEVNADSTALQPLIEAQEPEEGEFDREQAARFATYMYVTQTYNSNID
FT                   VKNAQIISVNDDFTAAQILVTPYTGPADKETPELMHVLRAQEAQIEDVTGTELGTTGFT
FT                   AVQLDITEQLEDAMPVYLAVVVGLAIFLLILVFRSLLVPLVAGLGFLLSVGAAFGATVL
FT                   FWQEGFGGFVNTPGPLISFMPIFLIGVTFGLAMDYQVFLVTRMREHYTHHDGKGQPGSK
FT                   YSPVEQSVIEGFTQGSRVVTAAALIMIAVFVAFIDQPLPFIKIFGFALGAGVFFDAFFI
FT                   RMGLVPASMFLMGKATWWMPKWLDRILPSLDIEGTALEKEWEEKQAAR"
FT   CDS_pept        332820..334085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53270"
FT                   /db_xref="GOA:A4QAM3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM3"
FT                   /protein_id="BAF53270.1"
FT                   /translation="MAPMSDLSFTLNNKLADDAPGKHGRTGVIHTPHGDIATPAFIPVA
FT                   TKATVKTLTPEQIRETGAQAILSNAYHLYLQPGPDIVDEAGGVSAFENWHGPTYTDSGG
FT                   FQVMSLGSGFKKVLAMDTTNLTRNDIKAAKKERMALVDEDGVDFKSVIDGSKHRFTPEV
FT                   SMQIQHQLGADIIFAFDELTTLVDTYDYQVESVERTRRWAQRCLLEHERLTQERVGKPL
FT                   QSLWGVVQGAQFEDLRRQAVKGLLDLDRQAADEGRRGFGGFGIGGALEKENLGTIVGWV
FT                   CDELPDEKPRHLLGISEPDDLFVAVEAGADTFDCVAPTRLGRRGGVYTLDGRMNLTGAR
FT                   FKRDFKGIDEEVGGYASENYSRAYIHHLLKAKEFLAGTLCTMHNLYFMITLVDKIRASI
FT                   DDGTYYEFKEEFLGRYYASKVS"
FT   CDS_pept        complement(334064..334816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53271"
FT                   /db_xref="GOA:A4QAM4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM4"
FT                   /protein_id="BAF53271.1"
FT                   /translation="MVVDVQNQSHTPETQPQPGQGAAKKTPVASGNSTFIHIQPSLYPI
FT                   LLALFVAVFLISNITATKGVEIGPLVTDGAFFLFPISYVLGDVLAECYGFKSTRRAILT
FT                   GFGITILAAISFYISIWLPGASFWEGQEAFEATLGLVPQIIVASLAGYIVGQLLNAKVL
FT                   VAIKKRTGEKSLWARLIGSTVVGEFADTLLFCAIAAPVIGIATAPDFINYVVVGFVWKT
FT                   LLEVILMPITYAVIRWVKRREGYETFDA"
FT   CDS_pept        334938..336020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53272"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM5"
FT                   /protein_id="BAF53272.1"
FT                   /translation="MTIALEHPVLHSTAIALPARFQASYTTRLVAVGVDKRPSDFWLET
FT                   AGAPQAGDVVIARVTAINNHKRVETPESRKAILFEGALVMLAYGHRYAADQFLAHVPED
FT                   LEPCHLVAAGGIAGVVTALHDQMDEPTEIEPLGLLTNARGTVNVRDFAAFDNPLKVEAP
FT                   KKRAQVIAVLGTSMNSGKSTTLACLVNGLAAAGQKVAAGKITGTGAGNDRMIYHDAGAH
FT                   SVIDFTDFGYPTTFKLNFAEIRALSVNMINVLADSGADTVIVEIADGIYQGETSRLLRD
FT                   QVFQESVDHVVFSAVDALGAKAGVQELQAAGLHVAAASGVMTASPLATAEAAAVLEVPV
FT                   VPTFDLTNPEIVTAVLTDHA"
FT   CDS_pept        336013..337452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53273"
FT                   /db_xref="GOA:A4QAM6"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM6"
FT                   /protein_id="BAF53273.1"
FT                   /translation="MPRLWRARRRLLLITLGVLGVLQAALAIIMSLSVSAVLSGDRGLI
FT                   ALLLATTLGLGAAQWIQKVVAEDLGQHYVHEVRRELVGAALVPGNANSLGVTVTRASND
FT                   LTAVRNWVTLGIVSLATGVPLIAIVLAALFVHDIRTGIAVAVPLLMCVAVLPVVARWTL
FT                   KRARELRKKRGRMAARIADSVMAGELLHATGAIDRELNAVTRDSDRVVIAAVRRSWATG
FT                   FSRALMAMAASLGTVSIVISGHLEVSEVAGIMMLLGVLATPVAELGRVVEYRQNYKAAT
FT                   RILIPLLQRGSEFKRSQQKLPGLQATEGIPGVYVKGISALPGERIYLHGSADATRKWVT
FT                   SLSAMEEGTDAIVNGQRLSQLPLKQRRALIGIASAHHHLSRGSVSRLVGLRVPDATVEE
FT                   IEQALEQVGLNNTGKQRLKNGGHPWSTSQINKLKIASATLRTPPLLVLEGITPENLLNY
FT                   PGVIISTVQENPSETWRQVNI"
FT   CDS_pept        337462..338343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53274"
FT                   /db_xref="GOA:A4QAM7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM7"
FT                   /protein_id="BAF53274.1"
FT                   /translation="MAGRYAPSPSGDLHFGNLRTALLAWLFARSEGKQFLMRVEDIDEQ
FT                   RSSKESAESQLADLSALGLDWDGDVLYQSTRYDAYRAALEKLDTYECYCSRRDIQEASR
FT                   APHAAPGVYPGTCRELKEEERVEKRASLAAQNRHPAIRLRAQVTSFDFYDRLRGPQTGP
FT                   VDDFILLRGGQEPGWAYNLAVVVDDAYQGVDQVVRGDDLLDSAARQAYLGSLLGTPAPE
FT                   YIHVPLVLNAHGQRLAKRDGAVTLKEMLIDATLPTIFSRLAHSLGYEEVDSAPQLLEVF
FT                   DPTNLSREPFIY"
FT   CDS_pept        complement(338337..339344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53275"
FT                   /db_xref="GOA:A4QAM8"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM8"
FT                   /protein_id="BAF53275.1"
FT                   /translation="MAEQLRQFEGRVLPNQSEDLEDQGLGFDLGTVFSRRKVLGFIGVG
FT                   GAGVALAACSPSGSSAASSTSSASSSAAATSSAAAETLTEMKSETAGPYPGDGSNGPDV
FT                   LEVSGVERQDITKSIDTDTVAEGVPLTLTMTILDMNNNNQPMEGAAVYIWHCDAPGRYS
FT                   MYDDELLEETYLRGVQITDKYGQVTFDTIFPGCYAGRWVHIHFEVFPDRESISDSTNNI
FT                   LTSQIALDEASAASVYALDVYGDSLTNLNNITLESDNVFSDGWDQQMANLTGDATSGFI
FT                   ASIDVPIDPTTEQDQSMNMPSGGGMGGGPSGGGMGGPGEGMTPPDGMTPPSEPQ"
FT   CDS_pept        340573..341853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53276"
FT                   /db_xref="GOA:A4QAM9"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAM9"
FT                   /protein_id="BAF53276.1"
FT                   /translation="MSSVSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSE
FT                   QLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASS
FT                   LNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNE
FT                   DGPDMDAVEELVKDPQVKGMWVVPVFSNPTGFTVSEDVAKRLSTMETAAPDFRVVWDNA
FT                   YAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFMTSAENRKWYS
FT                   GHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGV
FT                   AQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSL
FT                   PPVEELEVAMDGVATCVLLAAAEHYAS"
FT   CDS_pept        341855..342487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53277"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN0"
FT                   /protein_id="BAF53277.1"
FT                   /translation="MNTAETAHWINRLLPGQPEFHQVGAFKVAGYTLDDESIACSVDFG
FT                   RVNTGLVTETGAETVDVRSEILSLARADVSVPGRAVGAAATMLLDASLSFKSATDSSVT
FT                   PMHAQPGQILPCVGIMANLPQEGFSVVHGILADPRIWGPEIPYVREEAGQVNVEAPDEA
FT                   GDLARLTLPLQLILLTEEEFAIALNEGSDVMFERMAEQEVDLLDLKR"
FT   CDS_pept        342566..344791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53278"
FT                   /db_xref="GOA:A4QAN1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN1"
FT                   /protein_id="BAF53278.1"
FT                   /translation="MTDPLSAALDSGRINHAYLFSGPRGCGKTSSARILARSLNCVEGP
FT                   TSTPCGVCNSCVALAPGGPGTLDVTELDAASNNGVDDMRELRERANYAPAESRYRVFII
FT                   DEAHMISTQGFNALLKIVEEPPAHLIFIFATTEPDKMIGTIRSRTHNYPFRLLTPGDMR
FT                   KVLKNAVDGEGVHVDDSVYPLVIRAGGGSPRDSLSILDQLIAGSGPEGLTYERALPLLG
FT                   VTSFTLIDDSIHALASKDNASMFTTIDNVIEEGLEPRRFTIDLLDRLRDLMVLQAVPEA
FT                   LNLGLVDAPTDRADVLIEQSTLFKGNELANLASMVNSGLDDMRGATSPRLLLEILCARL
FT                   LLASNTVAVPVASSSSEATPAASPGGLTGIAAARAKAREYGQKKAAPTPAPAPEPTPAP
FT                   EPTPQPAPEPEPAREPVVEVREASVEKQPASSDPLETIRSHWSELRSIVEKQSVRTSIM
FT                   LTEARVLGLRGDTLVLGHSTGALAARLNAADHNGILVKVLAEETGLQLKVECIVGTNPA
FT                   EAGFTAQPAVQKSSWNPNHDSKPATPSAPAQPQTPKQESVPTEPEEPESSAETSGWGQP
FT                   VKIGGPEPEAQTPTPPPAPVVPATPAAPAAGSAKPAWKERVEQAAANAAQQRQHRQGSS
FT                   EPFERGVPLPPEPDLPPDPYGYPADEGFPERNQGFQQQPAPPVEQPAPAPVVEPVPAVA
FT                   PEPEVSQLSEEEQLIREADEEPGEMDRRDAKTIAMELLAQELGAKPL"
FT   CDS_pept        344900..345211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53279"
FT                   /db_xref="GOA:A4QAN2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAN2"
FT                   /protein_id="BAF53279.1"
FT                   /translation="MTQPDMSQILAQAQQMQAQLQAAQQEILATTVVGNAGNGLVTVTM
FT                   AGNGEVSAVTVDPKVVDPEDVETLQDLLLGAFKDAHNKVANVAEEKMGPLSQGMGGLF"
FT   CDS_pept        345315..345971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53280"
FT                   /db_xref="GOA:A4QAN3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAN3"
FT                   /protein_id="BAF53280.1"
FT                   /translation="MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLNVDPTDITRLQEA
FT                   LGGVRDGVQFCRICCNISREEVCRICSDSGRDGGTICVVEEPKDIQVIERTGEFSGRYH
FT                   VLGGALDPLANIGPRELNISTLLQRIGGVLPDRELADSTPENKLFDATPTVREVILATD
FT                   PNTEGEATASYLGRLLKDFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLQI"
FT   CDS_pept        346716..347705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53281"
FT                   /db_xref="GOA:A4QAN4"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN4"
FT                   /protein_id="BAF53281.1"
FT                   /translation="MWIGEEKLRRPKRSVRTLSVLVIVTVLALVALVIPFVVSEDDGFD
FT                   SAADCTAYGIPAGDPLATADPVMHSTSSGLFSIFSKDEEETSWYTNPWDTEDYVEAEGV
FT                   ALGRSFGERHDRSNYHLFTRGVDFTEPVGLLVRLHGDGAEEYLSPEGLSACLALVAETY
FT                   NMITLVPRTPDERSMTWWRNLEENVDWLNSLVAQISAEYSLDAESVWWMGYSGGAELIS
FT                   YGLIPYSAESVTGGAILLGGGGAPERNRLDVAASLRERMPLYWVTGQRDDGTDPAEPFN
FT                   AIEAATEGAQWYRNHGFARVHTDFPAEYDHFTLPHAAILQEVLLTEIK"
FT   CDS_pept        348307..352272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53282"
FT                   /db_xref="GOA:A4QAN5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR012728"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN5"
FT                   /protein_id="BAF53282.1"
FT                   /translation="MSTQDHPKYAVYGVEAPPPECTLIDIVDATVAMYPEVRGLEGTNG
FT                   TLTYSELRDTIEVEVSRLRSAGVGRGDRVGIRVPSGTVDLYVAILATLYAGAAYVPVDW
FT                   DESDSRAQTVWEEADVAVVYGLSLSIDVRRHEPNTDHSRATLDDDAWIIFTSGTTGKPK
FT                   GVAITHRSAAALVESERLLYLVDAPLGPQDRVMGGLSVAFDASCEEMWLAWRNGSTLVA
FT                   APRDLVRSGEELGQWIVDEKITAVSTVPTLAAMWDPDSLTAVRLLIFGGEACPLPLIEK
FT                   LFVPGRELWNTYGPTETTVIVSGQLMTPEPPVRIGRPIVGWELAVVNEDGIPVNWGETG
FT                   ELVVGGIGLGRYLDEEKDRESYRALPALGWNRSYHTGDLVKAEPEGLIFAGRVDDQIKI
FT                   GGRRLELGEVDGYLNDIPGVDAAAAAVRTTESGNDVLVGYLSGADPDAIDLQQARKLVA
FT                   EKMPKGVVPLLCVLDELPMKTSGKVDRKALPWPLATQQDTGGLPERYAALGELWIEQLG
FT                   PVSLTSDSNFFELGGGSVAVARLAARIRETHPGAEIGELYQNPFLGRMSHYLESLVSDS
FT                   EERPMPKRIPRIGVLFQGFWVLFLYLINALRYVTGVLIVVWLLERFFDAGWVPGISGFP
FT                   LLIAWLVLYSLPGKVMITALITRPLTFRMKAGRYRRGGWTHLRLWASQRTLTFMQLENL
FT                   NGTPFAPMMHRLLGTKVGRNTSLSHSPSVTGLLTIEKGATVEFEADLEGYWIDGDTLIV
FT                   DTITIGENVRVGARSIIQPGVRIAPGAEILPGTNVDRDIEGPETWSGSPMTYQGPAGET
FT                   WPATTPSNTRETPVMGRLRSGLTYGGGLLVLRILQVAALVPGFMLVFPFVSRLEFYELV
FT                   FPILIVWVPVFTILMVFTWLLGVVIVIRILSVFIRPGYFPQRSFTGFAVWLTHTLMQRT
FT                   LISTYPIYASSFTPLWFRLLGARVGKNVEISTVETIPHLTWIRSGSFLADHALANSTRM
FT                   CRGWLHVGTTVIGEGSFVGNSAIVGPDRDVSDGALMAVLSTAPYHPEAGSSWLGRHPMQ
FT                   ITRQRVKGEDSLTYKPPFQRKVLRAGVELCRIIPAMISNWMDLLSVYILTSIYMYYWLG
FT                   GETQLDSLMFASLWSWPVLVASGSLAALVALIAKWLLVGRFRERSVPLFSSLVWRGELA
FT                   DVFIESLAIPGFVRMSLGTPMLNLWHRCLGVKIGRSVWCETWWLPEFDLIRISDLASVN
FT                   RGTVLQTHLFHDRVMSMEPVVLEDGATLGPNSFVLPGAVIGECTTVRTGSLVQRQEALP
FT                   DNSEWAGNPVRYLGSTSSNAGRAETGQETLVMEGEDQ"
FT   CDS_pept        352269..353720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53283"
FT                   /db_xref="GOA:A4QAN6"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN6"
FT                   /protein_id="BAF53283.1"
FT                   /translation="MTSHLEEKQVRVLEGDLPVDVRPHSGWSEERSVWTGHGDEAQPIK
FT                   FGTTAVGTYRAEEEYGAERQWSKGRIIGINVARGLALFGMFSVHTLDPWNEEAERVTVL
FT                   WMMTAGNAAALFAVLAGVGIALSTGGSKGLRPERRINARVQLFVRALLILFIGLLSNLW
FT                   LDPPVFNILPYYAVLFLLASLFLGVRKRTLCTWALLMMLAGPIAQYFVRSAEPYERILS
FT                   PVPADLISNPADVLGTLLFTGTYPVTTWSAYMLVGLALGRMQLNRIQVQLGLFGFGAFA
FT                   AVSGWLMSRMAVNFLGGYEGMLYSEVRITQEMVEAFLTEGPDEDLPTSSFWWLTVAGPH
FT                   TNTFFSLLLSTGVAVSVLGATFLICRVFPRLLWPLAAAGSMTLTLYVCHMAFLHFYAIG
FT                   DYSTDQELNLALAIQILGVLIISGLWSLLFRRGPLEWLVGELSKRIADPRRKSAETGGA
FT                   LKSGSRGMTGSGWWRHRAVSGRHRM"
FT   CDS_pept        complement(353841..354593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53284"
FT                   /db_xref="GOA:A4QAN7"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN7"
FT                   /protein_id="BAF53284.1"
FT                   /translation="MTTLNIGLILPDVLGTYGDDGNALVLRQRARMRGINAEIQRVTLD
FT                   DAVPSTLDLYCLGGGEDTAQILATEHLTKHNGLQTAAAAGRPIFAVCAGLQVLGDSFRA
FT                   AGRVIDGLGLIDATTVSLQKRAIGEVETTPTRAGFTAELTERLTGFENHMGATLLGPDA
FT                   EPLGRVVRGEGNTDVWAASENTDDQRQQFAEGAVQGSIIATYMHGPALARNPQLADLML
FT                   AKAMGVALKDLEPLDIDVIDRLRAERLA"
FT   CDS_pept        complement(354593..355864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53285"
FT                   /db_xref="GOA:A4QAN8"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN8"
FT                   /protein_id="BAF53285.1"
FT                   /translation="MKLSLPAPLRRLRSTAAIVSAKVATSASKATGRGSGGMIGGLVAS
FT                   KVDPDIMSNLINNRPTVLVTGTNGKSTTTRMLAAAMRSTYTVATNEGGDNMDAGIISAL
FT                   LAGRNASHVVLEVDELHVPAAIERLKPDALVLLNLSRDQLDRVGEINKIERVLRDAVRS
FT                   RPEMTVIANCDDVLVTSVAFDAENVIWVGAGTGWQGESVTCPRTESRILHDGRHWSAEK
FT                   TLLDGRTFARPTPSWEVDGDTIHSPSGDLTLDLNLPGQANRGNAAQAIAASTVFNVPVS
FT                   SALPAVNSVNNVAGRYSTITVGEHKVHLLLAKNPAGWQEALSMVDRTADGLVIVVNGQV
FT                   ADGEDLSWLWDVRFEDFENLSVKASGERGTDLAVRLTYAEINHELISNPVDAIAACPPG
FT                   RIEVLANYTAFRDLKKALEKGTEQ"
FT   CDS_pept        complement(355894..356976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53286"
FT                   /db_xref="GOA:A4QAN9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAN9"
FT                   /protein_id="BAF53286.1"
FT                   /translation="MSTTSESQDHAARVEAERQEAIKAAPFVSVTIQSSGIHPSTSRMV
FT                   TIDLVTLSPTLEPVETFHAVLDSKTDPGPFHLHGVTEEEFAGAKKFGQILKSLDRLIDG
FT                   RTLLIHNSARTWGFIVSEAKRAMNDAARANRNNNRGNRRGGRGRRRQRVGHIPKPLVIV
FT                   DTLASARRQAIALDDVRIRGVAHTLGLGAPAAEASVERAQVPHRQLCREETLLVAKLFS
FT                   SLRESGPLAEIDPQTVRADKFGLQRSIVRVQAQEATPTLVNPGTYEPGKTLIAGMEVVV
FT                   APEIEMDPDIIIQASVDADLAYSEKLTRQTSVVVCNQTRDIDGKAMHAQRKGIPLLSDV
FT                   AFLAAVKRVKEGKKVDVEKH"
FT   CDS_pept        complement(357357..359207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53287"
FT                   /db_xref="GOA:A4QAP0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QAP0"
FT                   /protein_id="BAF53287.1"
FT                   /translation="MSPNDAFISAPAKIETPVGPRNEGQPAWNKQRGSSMPVNRYMPFE
FT                   VEVEDISLPDRTWPDKKITVAPQWCAVDLRDGNQALIDPMSPERKRRMFELLVQMGFKE
FT                   IEVGFPSASQTDFDFVREIIEKDMIPDDVTIQVLVQAREHLIRRTFEACEGAKNVIVHF
FT                   YNSTSILQRNVVFRMDKDQVKKLATDAAELIKTIAQDYPDTNWRWQYSPESFTGTEVEY
FT                   AKEVVDAVVEVMDPTPENPMIINLPSTVEMITPNVYADSIEWMHRNVNRRDSIILSLHP
FT                   HNDRGTGVGAAELGYMAGADRIEGCLFGNGERTGNVCLVTLALNMLTQGVDPQLDFTDI
FT                   RQIRSTVEYCNQLRVPERHPYAGDLVFTAFSGSHQDAVNKGLDAMAAKVKPGANSTDVS
FT                   WEELRDTEWEVPYLPIDPKDVGRDYEAVIRVNSQSGKGGVAYIMKTDHGLQIPRSMQVE
FT                   FSAVVQNVTDAEGGEVNSKAMWDIFATEYLERTAPVEQIALRVENAQTENEDASITAEL
FT                   IHNGKDVTVDGHGNGPLAAYANALEKLGIDVEIQEYNQHARTSGDDAEAAAYVLAEVNG
FT                   RKVWGVGIAGSITYASLKAVTSAVNRALDVNHEAVLAGGV"
FT   CDS_pept        359851..365052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53288"
FT                   /db_xref="GOA:A4QAP1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041100"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP1"
FT                   /protein_id="BAF53288.1"
FT                   /translation="MVELSTRINPNERRFVVFIAAFLAMILVASGLATPAYAQQENAFV
FT                   VTLPSASSHNGKPVYESGKKLRVEVGYGVMDDGYTGVITVPEQIDPSSIVADLSGNTAL
FT                   ESVTPNGDGTITFQFTDPFPAGIQQGLFWLDVELKEFETSGEQELKWEFPDGSTQTIDI
FT                   VVKSKDDEFKTVSDYENKAISSDPWLEATVENGVVSVDSAAFLGAEIEYRININTAEGG
FT                   TFKIKDNLDEGLVFIDGSFNATRKTWDSNGMNKEEATVSFPQQSGSSFTESIDLPANSE
FT                   FVLLYKAQIKDQSAVDAIVDKLQSEYERKREEAGDDEFATIYFSTSFVNSATINDGSEK
FT                   AASFAINGSESGRVGPEVNGVFSKTSDFAFAEIEDPETNDFEEVDLTYTLKVDLTPYAG
FT                   FENTSKGLGGNVVIVDTLPSDIKWRDGESDFLVADGMVLTRENSSEPLTAQQFESDEYV
FT                   GKYYVDGKNLFINIGQDTTTIVSIDVKATITGVNEVWRSGGNSPMEEARYWGPDNTAVL
FT                   TYPNDKIIRTAKHSFAVMKDGSSGINDPQKFSKTTTNNGPIEITQGEPALIEFKFTIGA
FT                   GIGDARKSIIVDKIDHDVFDVSEETLAAIKASITGNYHWNYPIDGDTMDVTIDGDGNLV
FT                   FAPNDQFPKAANWGAEASAPFTETFTFAVTIPTHPLYGKQTLQVENKASYRGSDFETVF
FT                   DSGTEATATSYGNEMELRKRVYNEDSKTFVSQLRVELNEDGELINDEFIYAVELIPHGQ
FT                   FKNMVLDVEDFLPAEVDFVGFINANDFNSGNLDRVTTDPVTLTNTNAKATYVAGERKVH
FT                   IGRDVLTSGQTSTLYFKVKLTDFEKDQPIANVIGNAEATIVPSNDYPLNIVKVDTSNEE
FT                   NKITDTNAIFQIKKGDDVVVDNVYVVNGNLVVSGDNGAHKPVAVKEPGEYTIVEVKAPA
FT                   GFLLTDQEFNVSITEQGVQTPDQVRINNQPGQDVADPVIGTSVAVEGSDVKVLPVSGGT
FT                   VIDTVTYEGLTVGQKYILEGELFTKAGVATGIKGSREFIAEAADGSVAVAFEISADQIA
FT                   EYAGEKLVAFESLFELNDDVKSEDPVAEHRDVEDEAQTFTVDELPVADPVIGTSVAVEG
FT                   SDVKVLPVSGGTVIDTVTYEGLTVGQKYILEGELFTKAGVATGIKGSREFIAEAADGSV
FT                   AVAFEISADQIAEYAGEKLVAFESLFELNDDVKSEDPVAEHRDVEDEAQTFTVDELPVA
FT                   DPAIGTTAKVTGTTDKVLPLTGGQVIDSVAYKDLQPNTKYVLQGVIQHVATDGTVTSTD
FT                   VVASTVFTTGDAPAGEFFVSGNAEVKFNIDQATAAEYAGERLVVFEQLWLADDNGNKTG
FT                   DEPVAVHEDPTDEAQTFYAGEKPDAIPGIGTTAKVTGSADKVLPLTGGEIVDTVAYKDL
FT                   QPNTEYVLNGEIQHVAEDGTVTSTGVIATATFTTGAAKSGEFYVSGTTTVTFDIDEQTA
FT                   IKYAGEKLVVFETLYTAGNPETPVASHVDPEDEAQSFTVAPQPEADVVVEKTVTGPKGA
FT                   QVEADENALFQITATWTDELGRNFSKTFNVVPGKPVSLEGLPTNTEIYLSETGATTDVK
FT                   NVKWGDVIWTGEGVVDETGTSKGATVTFTGEGPFEIGLENKTSSNGMIIIPIPIPLFPI
FT                   DGGSSTNPIQPDPTQPDPKESVDPTNPTPSEGSEAGTSPSKDKGAEQPETVKPRTPSEK
FT                   VGLAQTGANVAWVAGIAILLLLAGAALIVRGRRKDA"
FT   CDS_pept        365122..365259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53289"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP2"
FT                   /protein_id="BAF53289.1"
FT                   /translation="MLSIPLIFTVENIETTGSSVVDFLGSISIWLYDIFGDTGSATIEA
FT                   "
FT   CDS_pept        complement(365345..365953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53290"
FT                   /db_xref="GOA:A4QAP3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP3"
FT                   /protein_id="BAF53290.1"
FT                   /translation="MPEGKPRRLGRPRNENLDSKILQATRNIIEKDERVSIEAIVQESG
FT                   ASRASVYRRWPSLNNLIANALDEGRKSEVLIDLSGTVKDGFIAMFFGDLSVAHGEDYTM
FT                   ERFRKRMELAMSDPKVQQVYWSSYVEKRRKYPLQALQLAKDRGEIREDVDIDAALDSIY
FT                   GALYYQFLIRGQDITSKDCRGRARAAFELIWRGMETQEK"
FT   CDS_pept        complement(366355..367074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53291"
FT                   /db_xref="GOA:A4QAP4"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP4"
FT                   /protein_id="BAF53291.1"
FT                   /translation="MWWAGMSTAMLAYFLQTVALGFGTLLVVQPVLVLSLMFTLPLSAR
FT                   FNGYRLRRTEIFWATLLTVAVGIMIVLGRPLPGNPHPPLDRWIPALLVGVAVMGGMWLL
FT                   AEYVLKKDKALILGLVTGALFGYVAVMSKAAVDLFVHQGITGLILNWEGYGLILTALLG
FT                   TVVQQYSFNAGELQKSLPAMTIAEPIVAFSLGYLVLGEKFQVVDWEWIAMGIALLVMIV
FT                   STIALSRTSTMPAGSKK"
FT   CDS_pept        367471..368736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53292"
FT                   /db_xref="GOA:A4QAP5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP5"
FT                   /protein_id="BAF53292.1"
FT                   /translation="MALVVQKYGGSSLESAERIRNVAERIVATKKAGNDVVVVCSAMGD
FT                   TTDELLELAAAVNPVPPAREMDMLLTAGERISNALVAMAIESLGAEAQSFTGSQAGVLT
FT                   TERHGNARIVDVTPGRVREALDEGKICIVAGFQGVNKETRDVTTLGRGGSDTTAVALAA
FT                   ALNADVCEIYSDVDGVYTADPRIVPNAQKLEKLSFEEMLELAAVGSKILVLRSVEYARA
FT                   FNVPLRVRSSYSNDPGTLIAGSMEDIPVEEAVLTGVATDKSEAKVTVLGISDKPGEAAK
FT                   VFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGNWTNVLY
FT                   DDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAAR
FT                   ALHEQFQLGGEDEAVVYAGTGR"
FT   CDS_pept        368760..369794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53293"
FT                   /db_xref="GOA:A4QAP6"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP6"
FT                   /protein_id="BAF53293.1"
FT                   /translation="MTTIAVVGATGQVGQVMRTLLEERNFPADTVRFFASPRSAGRKIE
FT                   FRGTEIEVEDITQATEESLKGIDVALFSAGGTASKQYAPLFAAAGATVVDNSSAWRKDD
FT                   EVPLIVSEVNPSDKDSLVKGIIANPNCTTMAAMPVLKPLHDAAGLVKLHVSSYQAVSGS
FT                   GLAGVETLAKQVAAVGDHNVEFVHDGQAADAGDVGPYVSPIAYNVLPFAGNLVDDGTFE
FT                   TDEEQKLRNESRKILGLPDLKVSGTCVRVPVFTGHTLTIHAEFDKAITVEQAQEILGAA
FT                   SGVKLVDVPTPLAAAGIDESLVGRIRQDSTVDDNRGLVLVVSGDNLRKGAALNTIQIAE
FT                   LLVK"
FT   CDS_pept        369874..371295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53294"
FT                   /db_xref="GOA:A4QAP7"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP7"
FT                   /protein_id="BAF53294.1"
FT                   /translation="MKWNFLQVLSFFSRENTADSTSDKEHENATELAAEALADVIFQWK
FT                   NWVYRRVDSVHPSEGARGRLRHSMDCEPPPDPRLAYNEVERRYNDINDVKGQLMVPLAF
FT                   IEKGPMRHLDVWRNDGTSIPVLGSEETGELMVAVLMLFLKKNGIERTSELEDAMRALVI
FT                   SREKGNLAKATNLIESGMWEGKTLWDSNDPAVRFDVGTKDLLLNLSTDFLLIGLLPAET
FT                   SGIRQVLKFSYHWVVELPDRGLLRSLWGSVCVAFRAAPMQIELPTHMPTDAKSYHLEFH
FT                   TPPELDTQELSLPVDSKNKGHRVGYPTDSSRTPIAHVHSHFSEIMTTNAKVKLEVPKRG
FT                   IWVTALLSNALTAGIFILALLLPNVTDALRSVGGNAAALMLAAPAVFVSFLIFPKEHIF
FT                   VSSMLNPLRIVVGICALLLFMMAGSLVGGLERPFLILLWSFGAGFSLLVVSALVLGPLL
FT                   GKFFERLHLRPSTKN"
FT   CDS_pept        complement(371643..372224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53295"
FT                   /db_xref="GOA:A4QAP8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP8"
FT                   /protein_id="BAF53295.1"
FT                   /translation="MKSKERNDAHVTELALAAGRGDRAALTDFIRETQDDVWRLLAHLG
FT                   GHEIADDLTQETYLRVMGALPRFAARSSARTWLLSLARRVWVDNIRHDMARPRKSIVEY
FT                   EDTGATDASNAGIWSEWIDVRTLIDALPPERREALILTQVLGYTYEEAAKIADVRVGTI
FT                   RSRVARARADLIAATATGDSSAEDGKSAQG"
FT   CDS_pept        372428..373978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53296"
FT                   /db_xref="GOA:A4QAP9"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAP9"
FT                   /protein_id="BAF53296.1"
FT                   /translation="MSEKSAADQIVDRGMRPKLSGNTTRHNGAPVPSENISATAGPQGP
FT                   NVLNDIHLIEKLAHFNRENVPERIPHAKGHGAFGELHITEDVSEYTKADLFQPGKVTPL
FT                   AVRFSTVAGEQGSPDTWRDVHGFALRFYTEEGNYDIVGNNTPTFFLRDGMKFPDFIHSQ
FT                   KRLNKNGLRDADMQWDFWTRAPESAHQVTYLMGDRGTPKTSRHQDGFGSHTFQWINAEG
FT                   KPVWVKYHFKTRQGWDCFTDAEAAKVAGENADYQREDLYNAIENGDFPIWDVKVQIMPF
FT                   EDAENYRWNPFDLTKTWSQKDYPLIPVGYFILNRNPRNFFAQIEQLALDPGNIVPGVGL
FT                   SPDRMLQARVFAYADQQRYRIGANYRDLPVNRPINEVNTYSREGSMQYIFDAEGEPSYS
FT                   PNRYDKGAGYLDNGTDSSSNHTSYGQADDIYVNPDPHGTDLVRAAYVKHQDDDDFIQPG
FT                   ILYREVLDEGEKERLADNISNAMQGISEATEPRVYDYWNNVDENLGARVKELYLQKKA"
FT   CDS_pept        373995..374339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53297"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ0"
FT                   /protein_id="BAF53297.1"
FT                   /translation="MRAYPPMVDRPSFDFEAIERKLARQQIRNSQGHCSGTNGGGAESN
FT                   GKETSGALNCSFDLRSLSSRQEAQQIGDFLWKLDPRAEVGGTSSRASFLCASDSSATSQ
FT                   GGGSDCNCCD"
FT   CDS_pept        complement(374058..374351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6014"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR87"
FT                   /protein_id="BAQ21076.1"
FT                   /translation="MRMKSIAAIAIATAALAGGTGVASAQEAGSTAGSSNLSSGIQLPQ
FT                   EVTDLLSFLPAAQAAQVEGAIQSTAGFFAVGLGSTAIGSTAVTLGIADLLSS"
FT   CDS_pept        complement(374403..374867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53298"
FT                   /db_xref="GOA:A4QAQ1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ1"
FT                   /protein_id="BAF53298.1"
FT                   /translation="MQYMKLDSIDRAIIAELSANARISNLALADKVHLTPGPCLRRVQR
FT                   LEAEGIILGYSADIHPAVMNRGFEVTVDVTLSNFDRSTVDNFESSVAQHDEVLELHRLF
FT                   GSPDYFVRIGVADLEAYEQFLSNHIQTVPGIAKISSRFAMKVVKPARPQV"
FT   CDS_pept        374885..375688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53299"
FT                   /db_xref="GOA:A4QAQ2"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ2"
FT                   /protein_id="BAF53299.1"
FT                   /translation="MQTGNKTIRQLCDDCSVQKTQEIHSSLEVSPSKAALGPGDKGYPR
FT                   YEIAQGLKTSLAAGLGMYPIGIAFGLLVIQYGYEWWAAPLFSGLIFAGSTEMLVIALVV
FT                   GAAPLGAIALTTLLVNFRHVFYAFSFPLHVVKNPIARFYSVFALIDEAYAVTAARPAGW
FT                   SAWRLISMQIAFHSYWVFGGLTGVAIAELIPFEIKGLEFALCALFVTLTLDSCRTKKQI
FT                   PSLLLAGLSFTIALVVIPGQALFAALLIFLGLLTIRYFFLGKAAK"
FT   CDS_pept        375685..376011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53300"
FT                   /db_xref="GOA:A4QAQ3"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ3"
FT                   /protein_id="BAF53300.1"
FT                   /translation="MTTDFSYILLVVAVCAVITFALRAVPFLILKPLRESQFVGKMAMW
FT                   MPAGILAILTASTFRSNAIDLKTLTFGLIAVAITVAAHLLGSRRTLLSVGAGTIVFVGL
FT                   VNLF"
FT   CDS_pept        complement(376086..376379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53301"
FT                   /db_xref="GOA:A4QAQ4"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ4"
FT                   /protein_id="BAF53301.1"
FT                   /translation="MRFKSVAAIALSTAVIMGGTASVANAQQVSPSSMIEIPQEFVQTV
FT                   QNFVPGMSYADAESAIQSTAGSVALNSTAGIILPIVLPFLGLGAAGSAVLSA"
FT   CDS_pept        complement(376486..376761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53302"
FT                   /db_xref="GOA:A4QAQ5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ5"
FT                   /protein_id="BAF53302.1"
FT                   /translation="MDDAERYAEIFKVLGEPVRLRILSHLAAEGCTPTTVNELTEIMGL
FT                   SQPTISHHLKKMTDAGLLARIPEGRTVFHQVQPETFTSLRTILQIG"
FT   CDS_pept        376815..377996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53303"
FT                   /db_xref="GOA:A4QAQ6"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ6"
FT                   /protein_id="BAF53303.1"
FT                   /translation="MDGRGHVRHYILTYIDIEGIFISTNINMIESWLMTLTKEHSTPRA
FT                   AGSMSFLDRWLAAWIFLAMAAGLLIGKVFPGIGALLSAVEIGGISIPIAIGLIVMMYPT
FT                   LAKVRYDKTKEITTDRTLMVVSIMLNWIVGPALMFSLAWLFLPDQPELRTGLIIVGLAR
FT                   CIAMVLVWSDLACGDREATAVLVAINSVFQILMFGVLGWFYLQILPSWLGLDTTSVTFS
FT                   VVSIVTSVLVFLGMPLVAGVLSRVIGEKIKGRRWYEDTFLPKISPLALIGLLYTIVLLF
FT                   SLQGDEITAQPWTVARLALPLLMYFAGMFFISLVVSKLSGLTYERAASVSFTAAGNNFD
FT                   LAIAVSIGTFGATSPQALAGTIGPLIEVPVLVGLVYAMLWLGPKIFKKENAGS"
FT   CDS_pept        377993..378127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53304"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ7"
FT                   /protein_id="BAF53304.1"
FT                   /translation="MKSVLFVCVGNGGKSQMAASLAQKYASDSVEIHSAGTKPAQGLN"
FT   CDS_pept        378128..378382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53305"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ8"
FT                   /protein_id="BAF53305.1"
FT                   /translation="MSVESIAEVGADMSQGIPKAIDPELLRTVDRVVILGDDAQVDMPE
FT                   SAQGALERWSIEEPDAQGMERMRIVRDQIDNRVQALLAE"
FT   CDS_pept        complement(378446..378766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53306"
FT                   /db_xref="GOA:A4QAQ9"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAQ9"
FT                   /protein_id="BAF53306.1"
FT                   /translation="MTIPEIIVSILVILAGLFSLGTAIALWRAPDPLTRANLLGPTVGV
FT                   SIPLLIIALLIHTWSVDGFNPNNFIRAIIAIIGVWVIGSVGSYYMGRAIYGVTVVDNRR
FT                   SK"
FT   CDS_pept        complement(378767..379039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53307"
FT                   /db_xref="GOA:A4QAR0"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR0"
FT                   /protein_id="BAF53307.1"
FT                   /translation="MTAFGIVTTVGICMFALSLLSALVLILRTKDFLTRVVLSDMVFYS
FT                   MIAIYLIWVLNNPTSIAFEIALLAAVLGGVLPTLSMARIISKGRR"
FT   CDS_pept        complement(379046..379501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53308"
FT                   /db_xref="GOA:A4QAR1"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR1"
FT                   /protein_id="BAF53308.1"
FT                   /translation="MLNALKFIPWLIGQIFIAGFSVITAAVKKDTGFNPVVIRYPLRVT
FT                   TDFQIAALSTCITATPSTLSLGLREPRKPGDPTILLIQAVFGSDPVEVFESIADMEQRL
FT                   VPSVASIDHGVPGQGPYKEIRPGDAEWPSSEIADTAQNTVSQDKREF"
FT   CDS_pept        complement(379501..381033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53309"
FT                   /db_xref="GOA:A4QAR2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR2"
FT                   /protein_id="BAF53309.1"
FT                   /translation="MAMDILLPIFVAVPLAASAIAVLLPWRLIRDILHIIVPFAGIFAG
FT                   IWLFAHTAEHGPIAHNVGLYVGGVAIPFAADTFSAIMLITTSIVAVAANWFATIVGETR
FT                   ARFYPALTLMLITGVNGALLTADLFNFFVFIEVMLLPSYGLIAMTGTWARLASGRIFVL
FT                   VNLSASTLLVAGVGIVYGVIGSVNIAALQDVVEGNPLVASAMGIVVIAIAVKAGVFPVH
FT                   TWLPRTYPGTSAAVMGLFSGLHTKVAVYMLYRIWVHIFDMDPTWNWLIVAFMVISMLVG
FT                   GFAGLAENSIRRVLAYQMVNGMPFILIMMAFTSDDPQRALAAGLLYTLHHMITIAALVL
FT                   TSGAIEETYGTGMLSKLSGLARREPVVAAVFAAGAFSVVGFPPFSGMWGKALILLEIAR
FT                   VGNIAAWIAIAAIIIASLGALLSMIRVWREVFWGGTMHQRGVSPQLRISAAKIAPALSL
FT                   IILSVGMFIFAGLLIDATLTATDGLLNTDAYQQAVLGENAIGVPSPSYQGGN"
FT   CDS_pept        complement(381034..381417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53310"
FT                   /db_xref="GOA:A4QAR3"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR3"
FT                   /protein_id="BAF53310.1"
FT                   /translation="MILALTVAILFGGGVYLIQQRGMVRIVFGMSLIGHAANLTILYAG
FT                   VPTWRGEAFPDRTPLTDAADPLPQAFVLTAIVIAMATTTIMLALAALGRSDDTRSIEPD
FT                   DDQSPLTTSARSVTNPTDQEDRA"
FT   CDS_pept        complement(381414..384308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53311"
FT                   /db_xref="GOA:A4QAR4"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR4"
FT                   /protein_id="BAF53311.1"
FT                   /translation="MSLLFVVALAVISVFLAPISVKVIDRKAGWPLAVIFAVAAYFLVR
FT                   EAGPILDGQALTWDITWVRDILGSGVDVKFALRADALSLFFALLALVIGAVVFVYSAEY
FT                   LPRKKGNTSFYTIMTAFTAAILLLVLADDVFVLFVGWELVSLASFMLIARSGSSGESGS
FT                   IRTLILTFFGGLTLLTAVAIAATQAGTTSLDGILHSDFWAEKPVLTGVIAVLIAMSAFT
FT                   KSAQFPFHFWLPEAMAAATPVSAFLHAAAAVKAGIYLLLRFSIVFHDVAVWNWLLIIVG
FT                   MGTAIMSAYFAVQKTDLKKLTAYSTVSHLGWIVATIGVGTPFALGAAIVHTLSHALFKS
FT                   SLFMLIGVIDHQTGTRDIRRLGFLVKQMPFTFVSVLIGALSMASVPPLLGFVSKEGMIT
FT                   AFMDAPIGNSYVVLLLVGAAIGAVLTFTYSAKLVLGAFVDGPRDMSHVKEAPVSLWLPA
FT                   ALPGLMSLPLVLVLSLFDAPLSAAATSAAGETAHMHLALWHGINTPLLISLGVLVAGIL
FT                   GVLFRKELWKIAETSPFPIATGNDILSMLVYRANLLGKFFGRMADSMSPRRHLVSLIVL
FT                   LWALAAFATIHPSVQLAPKQPGIDRWIDLIPLAIITLSVFGLVTTRNRLSAAVLVGTVG
FT                   VGVSFQMLLLGAPDVALTQFLVEGLVVVIIMMVVRHQPANFKRIKHSRRRSTVLVAVLA
FT                   AFAAFMAVWGLLGRHERSELAMWYLNQGPEITSGANVVNTILVEFRALDTLGELSVLGM
FT                   AAVVIGAMVASMPRHPFAKGTHPRPFGQSQLNSIPLRMLLKVLVPALCFLSFIVFMRGH
FT                   NDPGGGFIAALIAGGALMFLYLSKAKDGRIFRPNVPFILTGAGILMAVFSGVLGLTHGS
FT                   FLYAIHFNFAGQHWTTSMIFDLGVYLAVLGMVSMAINGLGGYLRPGTDIADLDYARRSG
FT                   PLPATPTVEPEPEGDEDWPEPINPASDNKEEANR"
FT   CDS_pept        384473..385948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53312"
FT                   /db_xref="GOA:A4QAR5"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR5"
FT                   /protein_id="BAF53312.1"
FT                   /translation="MHTMSAAASRSRKILTALLLLVPLIAGTIYASAMGLDVSRAWSSA
FT                   DEVTGAPAASVATNNQELIEARRAAGEAGAQAGFLTSGTEELTSGTQELIDGAAPLEEG
FT                   VSAAADGAAQLHDGLIQLQAGTGQMGTGATEIADGVQNAVEQLGGLVVVQQQLLGALNE
FT                   ADKQLASSKIPEAEDLRKQITEVRGHLENFGISVEMTDQLDQLRSGTRDLANQLAVPGY
FT                   GFHDGIYSATNGAAELSAGLQELEAGVGTAVEGFTALDEGANRLDSMATLNEEKTAAVQ
FT                   RALPVPQVPAGTIEGTADEERTSALAPMYAFLISALVMLAGAALGWATLKNKWLMAFAV
FT                   IGVTAIGGIILFTVALGMSVVALFGALGILLLATVVAGILSRVLLDVLGTTGAIVVSVL
FT                   GWVAQAAVIGHVWSVTAVSDIALVWRVVAGMMPLHYPTFAVTSIGNGGSAAAIWMSVAV
FT                   LLAMGVIGMVALRKPKAVETISTEEESHDEVEG"
FT   CDS_pept        complement(385910..386671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53313"
FT                   /db_xref="GOA:A4QAR6"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR6"
FT                   /protein_id="BAF53313.1"
FT                   /translation="MDIVNEIIQKNGLVFAFACVGALMLVSNFISRKATKGRLHGSAIA
FT                   ITLALVLAFFAGNYTGGTKGISDIAAFSGMAILGGSMLRDFAIVSTAYGVDVREIKRAG
FT                   AAGVIALFIGIFGSFAIGAIIAFAFGYRDPESLATVGAGAATYIVGPVTGTAIGASSEI
FT                   IALSVAIGLVKSVLVMVGTPLAAKYIGLNNPKSAMAFGGLMGTTSGVAGGLAATDQRLV
FT                   PYGAMTATFYTGLGCLLAPSAFYFVMRLFFG"
FT   CDS_pept        complement(386681..387121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53314"
FT                   /db_xref="GOA:A4QAR7"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR7"
FT                   /protein_id="BAF53314.1"
FT                   /translation="MILYGTAALAICMLIGQILGTFLGNLLGVDADIGGVGFAMVMLIF
FT                   VTSWLRKKGLMPEPTKQGILFWSSMYIPIVVGMSSIQNVAGAIDGGVMALVTGVVTAVG
FT                   CAGMVPILSKIGKPSEPLPPLHQEDAQLEVEKPLVSNSAEKN"
FT   CDS_pept        387519..388280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53315"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR8"
FT                   /protein_id="BAF53315.1"
FT                   /translation="MRLVERRGRGIELTAEGAALADAAIEALSVFQPALENLLGDRNLR
FT                   PVRLGTLRSIAGELGPLIGRSSLPTNVSITEGSSDDLLRLIERGEIDAAIIGPKPTDTR
FT                   FTWQFIRDQEIVLVVPKDHRLSHHDAVELKEVEGEHFVAMTNKYTTRDLADQLCAEAGI
FT                   SPTISVESDSSYTLRTYVASGLGLCILPEIMADLDPNIATVQVRRPNGELATREIGLVK
FT                   MAGRPLPTQVNATLRMLLARPIKAFRRPPSQ"
FT   CDS_pept        complement(388249..389175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53316"
FT                   /db_xref="GOA:A4QAR9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAR9"
FT                   /protein_id="BAF53316.1"
FT                   /translation="MVLTLLFGGQGSQKIGMLHSWLALEKVKECVTIASAVLGEDALLI
FT                   DREESLANTRGVQLSLLILQSGMALELQQRGLVPQFGAGHSLGAWSAAVAAGSLNFEDA
FT                   VRLVDIRARTMHDAAPGDYGMSAVIGLNRVALSKAVDSLRAEGEEIWLSNLNSAEQSTV
FT                   SGSHAALEKMEAIGAGLGARKIKRLKVAVPAHSELMSPARFAVAKAMEDITVESPRYPL
FT                   LANSSSRMIRTGPQVKNDLIEVIDQPVQWGPGIASLAERGVTDWIQVSPGNTLIGLLRG
FT                   LDTDYTGWCVDNVGVEETIAKVGVEKL"
FT   CDS_pept        complement(389178..389807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53317"
FT                   /db_xref="GOA:A4QAS0"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS0"
FT                   /protein_id="BAF53317.1"
FT                   /translation="MVKTPRVHDLVCLHPDAIPQVVYQARTENNAWLENSGDKASWAVV
FT                   RRAHPTTSGHVAVGFRGSSRNQRWGTEIPAEYITAVTAPYEISSKVLPDGAAFQAFNAF
FT                   DEMPYKFGPGGSVGFELASGIQSTHPDSDLDLVIYADSPLSVQDIRTIRHFHQRAAVFA
FT                   TVDILIETPLGGVAFSELERAMSYSPMPSMMLRTHQGPELSNIIWR"
FT   CDS_pept        complement(389801..390568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53318"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS1"
FT                   /protein_id="BAF53318.1"
FT                   /translation="MTTTLNSAELGTTWFNTLSTQITSTEGSLRTGTMPLNGQTAAVAA
FT                   IVPDPESPFPRARHGEVGIKESLELAAWLKTLEDPKQPIILIIDVPSQAYGYFEELFGI
FT                   NFALATSVNALAEARLDGHPLVSLIVGNAISGAFLATGLQSNRILMLDSDAVQVQVMSK
FT                   KAAARITQRSIEELDKAAESIPAMAFDGRSFVTLGAIHEVITDDSTTGVIRALERALSD
FT                   ISDKKIISRLQSAEAQKTRAQSILIRTAVNDQW"
FT   CDS_pept        complement(390578..391705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53319"
FT                   /db_xref="GOA:A4QAS2"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS2"
FT                   /protein_id="BAF53319.1"
FT                   /translation="MQIINETFPATIPFQHDIHVGVVGSGDMEILISAPRNAGKTTVKV
FT                   ATSVDGFDTVWRNVLKRFFGRNPLEADITINDFGATPGMAMLRLTQAFEQATSPQTIEI
FT                   SDSSPFTELSARQRVQSLLDPGTFRELLDPFQEIQSPHLEPQGIVPQLDDGAVLGRGTI
FT                   NGDSAIVVGLEGKFQGGGIGEVSGAKIAAALERALVDAKAGHNIRVVLLLETGGIRLQE
FT                   ANLGLLAIAEIHSAIVELQRYTPVVCVVAGMVGCFGGMGIAAGLCDHIIMTREGRLALN
FT                   GPEVIETEAGVQELNASDRPAIWKMIGGEQRVATGRAEVLSDDTVESIRAAVVAAPVMA
FT                   YTYHRANNLDSFNAQLENLNPSARPTAEELRTVSV"
FT   CDS_pept        complement(391692..392549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53320"
FT                   /db_xref="GOA:A4QAS3"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS3"
FT                   /protein_id="BAF53320.1"
FT                   /translation="MHNTVKVQQAPIGRLATQALLAEVNLPHKPGLVGPDGSRGHQDMD
FT                   IELMRKSAKVLEPTFSELAEAGKTIELGQELRDEIGKIGRRGEATMMNATGGVNTHRGA
FT                   IWNVGLLVTAASGLMTQEDQPFTAFSITQRAGSLASIPDSFIDSSPRPGATARKKYKVG
FT                   GAVSEAASGFPHVIAILQAMGFYAGNFTPSRELQIKGLITCMSSLDDTCILHRGGAEAL
FT                   AFVHGWATDLLVESPPNEGLDVEKLSAFDQHLTNRNLSPGGSADLLAGALFLTSIFGES
FT                   HANH"
FT   CDS_pept        complement(392555..393967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53321"
FT                   /db_xref="GOA:A4QAS4"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS4"
FT                   /protein_id="BAF53321.1"
FT                   /translation="MLFPSISRPEHLDLFEDGIASKVDFAFSGQQSARTAQLVEDGTMQ
FT                   VGAIHTYLELYSRMFLDLAPRVSLVAAVSADKDGNLFTGPNTEDTPTISEATAYRSGIV
FT                   IAQVNEIVDSLPRVDIPGSWVDFVVEADKPFEVEALFTRDPRQLTDVHVLLAMLTIRGV
FT                   YEKHQVTSLNHGVGLDTAAIELLLPTYAERYGLKGKICTHWALNPHPNLIPAIETGWVQ
FT                   RISAFGGEVGMSDYVAARPDIFATGPDGSLRSNRMAAQSAGLYATDMFVGSTLQIDPYG
FT                   NSSTVTAGRLAGFGGAPNLGSDPRGRRHSSPAWLDMAQGEGQLGIQRGQKLVVQIAETF
FT                   NAGSDPKFVEQLDAVAVGKKAGMEIAPVMIYGDDVTHLVSEEGVAYLYKAQSLEERRLA
FT                   VSAISGVSPLGGIANADDIAELRRNGLVGFPEDIGVNPSEASRTLLAAHSMESLVEWSG
FT                   GLYEPPAKFKSR"
FT   CDS_pept        393968..394081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53322"
FT                   /db_xref="InterPro:IPR002861"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS5"
FT                   /protein_id="BAF53322.1"
FT                   /translation="MQIMDAFWIDPGQRSREEICLFLIVAFERYAITWLDE"
FT   CDS_pept        complement(394298..394966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53323"
FT                   /db_xref="GOA:A4QAS6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS6"
FT                   /protein_id="BAF53323.1"
FT                   /translation="MSKILLAEDDAGIADFIVRGLIREGFECEITESGAEAFARAHSGD
FT                   FDLMVLDLGLPHMDGTDILEQLRNLQVTLPIIVLTARTNIEDRLRTLEGGADDYMPKPF
FT                   QFAELLARIKLRLAKHTAQESPTDARVLRNGDVELDLRTQRVLIDGSWHDLSRREVDLL
FT                   ETLMRHPGQILSRAQLLRLVWDMDWDPGSNVVDVYVRALRKKIGAHRIETVRGSGYRLR
FT                   "
FT   CDS_pept        complement(394944..396413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53324"
FT                   /db_xref="GOA:A4QAS7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS7"
FT                   /protein_id="BAF53324.1"
FT                   /translation="MAKSTPLSASLRWRIVLWMTAVVFLTLASVVIITRSVLLSEVTNT
FT                   ANSAVEQEIEEFRRFAAEGIDPTTAQPFESGHRLMEVYLSRQIPDENEAIVGIFPGELI
FT                   QVDYSQLSGAHPLPLEHSDPLISEIRQTTLNSGVFSDLERGTTHWGKVNFQTASGEADG
FT                   EFVVAFFADNLKDQVNGQIQILILIGTGGLIASILIAWLIAGQIIAPIRKLSSVSAKIS
FT                   NSDLTWRVPVEGRDEIAQLARTFNAMLDRIEIAYNDQRQFVDDAGHELRTPITVVRGQL
FT                   ELLATTPPEEQARSIELATTELDRMSRMVNDLLTLAVADSGTFIHAHPTDVTDLTIDIE
FT                   DKARTISDRILLVDAAEGLVSLDEQRVTEAVLELFGNALRYSDDVVELGSDFRGSGPDR
FT                   VFRIWVRDKGNGVDMDEQEALFDRFSRGSQKNSRRPGGAGLGLSIVKAIGEAHGGRAFV
FT                   NSTPGLGSIFGLEIPAPQQSKEYTHEQDPAR"
FT   CDS_pept        complement(396440..396760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53325"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS8"
FT                   /protein_id="BAF53325.1"
FT                   /translation="MKSLPRFTPLITILALLVLVAIGGSALANNRATPNVGSEPATVNQ
FT                   RSTPTTSAYEPPATEAPEEPTTQIQESPVQPPIPAPAQIPQAPQVPLNYQYYDDDWDDD
FT                   DD"
FT   CDS_pept        complement(396757..396975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6015"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VIC5"
FT                   /protein_id="BAQ21077.1"
FT                   /translation="MFPPNSPTDHSMGIPLIKKSLNEPILMINPGNSLMIPPQTTTSRT
FT                   WSENSHLHFILVPNNGIQIELIKENPQ"
FT   CDS_pept        396942..397562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53326"
FT                   /db_xref="GOA:A4QAS9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAS9"
FT                   /protein_id="BAF53326.1"
FT                   /translation="MNDQLVSWVETLMTASVFYPVLSVVVLIDCILPLIPSETVLALAG
FT                   AWSGARGTPNLWLVISVATFAAILGDNLCYFFGTRLINMVNRIPGESRRGKALEWARKN
FT                   LNERDVSTIIIARFIPWARWFVTIILGSVGYSWSRFIVWDSIGALIWATQATLLGYVGG
FT                   WLFQEQPLIGLVVGAALGIFFGFFLQWLNKMWERRRLAKVAAE"
FT   CDS_pept        complement(397736..398653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53327"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT0"
FT                   /protein_id="BAF53327.1"
FT                   /translation="MNKVSTIAKTLTFSSAALLGAGIATAAWGYSELKKFELKTVELPI
FT                   LKPGTLRGKKEFRLLHISDLHMIPGQETKKAWVSALDSLSPDLVINTGDNLSDEKAVPD
FT                   VLRALGPLMNRPGAFVFGTNDYWAPRPVNPFGYLFGKKREVSHIDLPWRAMRAAFIEHG
FT                   WQDANQKRLEFQVGSVRLAISGVDDPHHDLDDFSEIAGAPNVDADLSIALLHAPEPRVL
FT                   AQFEADGYQLSLSGHTHGGQLCLPGSKPIVTNCGIDRTRATGLNKFGDMWMHVSNGLGT
FT                   SKYVPFRIFCRPSATLIKITEQAL"
FT   CDS_pept        398681..399136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53328"
FT                   /db_xref="GOA:A4QAT1"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT1"
FT                   /protein_id="BAF53328.1"
FT                   /translation="MSELKDKIRADLTTAMKARDKDTTGTLRMLLSALTQEETSGTKHE
FT                   LNDEEVLKVIAREIKKRRESAEVYTENGRQELADVELKEAAILEGYQPEQLDDDQLNAL
FT                   IDEAIAEVGGEADMKKMGQIMKAATAKAAGRADGKRLSTAVKSRLSN"
FT   CDS_pept        complement(399143..401530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53329"
FT                   /db_xref="GOA:A4QAT2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT2"
FT                   /protein_id="BAF53329.1"
FT                   /translation="MSTTNSLTKLVASTVAAGVLGALALVPFASLSGVAVARTNDTMQT
FT                   NLSDLTDGRGPGVTTITDSTDQPIAYIYAQRRFEVGGDQISTSMKDAIVSIEDRRFYEH
FT                   DGVDLQGFGRAILTNLVAGGVEQGASTINQQYVKNFLLLVEADDEAEQAAAVETSIPRK
FT                   LREMKMASDLEKTLSKDEILTRYLNIVPFGNGAYGVEAAARTYFGTSAAELTIPQSAML
FT                   AGIVQSSSYLNPYTNHDAVFERRNTVLGAMADAGAISPEEASAFQQEPLGVLETPQGLS
FT                   NGCIGAGDRGFFCDYALQYLSEQGITQDMLAKDSYTIKLTLDPDVQDAAHNAVSSHVDP
FT                   TTPGVAEVVNVIEPGENSRDILAITSSRNYGLDLDAGETMLPQATSRVGNGAGSIFKIF
FT                   TAAAAIQQGAGLDTMLDVPSRYEVKGMGSGGAANCPANTYCVENAGSYAPRMTLQDALA
FT                   QSPNTAFVEMIEQVGVDTVVDLSVKLGLRSYTDEGSFDGESSIADYMKDNNLGSYTLGP
FT                   TAVNPLELSNVAATIASGGMWCEPNPIASVHDREGNEVYIDRPACERAIDAETASALAV
FT                   GMSKDTVSGTAASAASMYGWSLPTAAKTGTTESNQSSSFMGFNSNFAAAPYIYNDGTST
FT                   TPLCSGPVRQCSSGNLFGGNEPAQTWFNMASNVPAASQGTLPSSSDSFRLGTSGELLNQ
FT                   VVGQSEASARRTLEAKGYKVTTRSVSGAGSARGTVVSATPQGAVLIDGGTVILNISDGT
FT                   SPAPAATNNDDSDDGDTPAPSTNNRGTTIEDAINDAINQFFR"
FT   CDS_pept        402219..402779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53330"
FT                   /db_xref="GOA:A4QAT3"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT3"
FT                   /protein_id="BAF53330.1"
FT                   /translation="MTSVIPEQRNNPFYRDSATIASSDHTERGEWVTQAKCRNGDPDAL
FT                   FVRGAAQRRAAAICRHCPVAMQCCADALDNKVEFGVWGGLTERQRRALLRKNPHITNWA
FT                   EYLAQGGRDRRGLVNFKGWPLTWSAFLIQGAPQRTPAHHRRTPAHPSAHQPSTRANASV
FT                   RHASKGASKKHAPEALEMRSPVG"
FT   CDS_pept        402776..402940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53331"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT4"
FT                   /protein_id="BAF53331.1"
FT                   /translation="MIAMTKWEYATVPLITHATKQILDTWGEDGWELVSVMPGMNPENL
FT                   VAYMKREVA"
FT   CDS_pept        402946..403407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53332"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT5"
FT                   /protein_id="BAF53332.1"
FT                   /translation="MASNSERLAELGISLPSVAAPVAAYVPAIQTGNQVWTSGQLPFVD
FT                   GQLPATGKVGAEVSAEDAEKLARAAALNALAAIDALVGIDKVTRVLKIVGFVASADDFS
FT                   GQPAVVNGASNLMGEVFGEAGAHARSAVGVAELPLNSPVEVEVIVEIAQ"
FT   CDS_pept        complement(403483..404838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53333"
FT                   /db_xref="GOA:A4QAT6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT6"
FT                   /protein_id="BAF53333.1"
FT                   /translation="MTTSSTASPIAELQNLSPKQRKSESRRAIISSYLGSTIEFYDFLL
FT                   YAAASATVFPAVFFTNLDPLAGTIAAYGTFAAGYLARPLGGAIFGHFGDRLGRKKMLVL
FT                   SMLIMGVASTCIGLVPSAEMIGSMGAVILIMLRICQGIAVGGEWGGAALMALEHSDSKK
FT                   RGFAASFTNAGAPTGAALGTFALGTASAVLTQEQFLSWGWRIPFLLSFVLLIVGLVIRA
FT                   KVSESPLFAAAAAAEKAKPTERKVPLLQVLRRPKALILTMLGGASGFGLQVLLSTFSIS
FT                   YATQSGIERSSVLYAFAVASVFSVFFVILFGRVSDLFGRRPVMIIALVLFVAYLPAFFR
FT                   MLTSDNWFILLSAFTIALALHAMLYGPLAAFISEQFGTSARYTGASLGYQLATLIGAGF
FT                   TPTILASLYAGPGGGTSVTPVIVFLATMSLVSIIAIAITRESKDHDLSTYEH"
FT   CDS_pept        complement(404877..406415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53334"
FT                   /db_xref="GOA:A4QAT7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT7"
FT                   /protein_id="BAF53334.1"
FT                   /translation="MKVNLGIGSYPRRRATVRPESTAIEFEGTSITYGEFSKRINRLGH
FT                   ALLDLGVVHQDRVAYVGFNHPALLEVFFSTNLIGATPVLVNPRLSANEIDYIIQDSGAS
FT                   IVFYGIDLIEHATYLQELHPEIIMVAVEGDEGPGLRRKALIEAASDADIDLEVSDDDIA
FT                   LLMYTSGTTGRPKGAMLSHRNLFFNYFNALLSQEIEQGAVLLSTAPLFHIAGLNMTTIP
FT                   VMMKGGKVIIHREFRAEHVLDEIERSKVSESFMVPAMIDMLSNHPSFAERDLSSLRAIM
FT                   VGGSPLSERALRIWQGRDVKIVQGFGMTETAPGACLLEATDTSTHLGTAGRAHFFTDIK
FT                   LVDPKTGEEVPTGEAGEVLIRGPHVMTGYWNRPEDTASALQNGWYHSGDIAIKDADGYY
FT                   TIKDRIKDMYISGGENIYPAEVEQALQELEAVLDAAVIGVPDERWGETGIAFVSLRESH
FT                   LANPPTGPELRELLGSVLARYKLPREIHIIEELPRNATGKIQKNILRDFTIPVS"
FT   CDS_pept        complement(406663..407190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53335"
FT                   /db_xref="GOA:A4QAT8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT8"
FT                   /protein_id="BAF53335.1"
FT                   /translation="MHVQMIEDRNYFSASSHGATMTTSNPTAEIIGGPERFLEAELSQQ
FT                   IQFLTARARAKGSAKGNEALVDLGLKVRQYSTLSLAASGLKPTQRELGAFLDLDPSQIV
FT                   ALVDFLEKRGLVVREVDPRDRRSKIIVATEEGLAVHDEATKRLLIAEGESLKNLTSDEQ
FT                   EQLRELLLKIAF"
FT   CDS_pept        407321..408256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53336"
FT                   /db_xref="GOA:A4QAT9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAT9"
FT                   /protein_id="BAF53336.1"
FT                   /translation="MSLNGKVAIVTGSGAGLGRSFAQELARQGASVIVNDVNQAAADET
FT                   VAAITEAGGKAAAVIAPVGPSESAALLVREAVDKFGSLDILVTNAGILRDRSLLKMTDD
FT                   DFDAVINVHLKGTFTCVREAFGYFKENGIAGRIVTIGSPTGQRGNFGQSNYAAAKAGIV
FT                   GMVRTWALEMKRAGVTINAIIPEAATDMTKTVPYFQKAVEADERGEAMPAFFRETLGFG
FT                   TPQDVAGLVAFLSSDEAANISGQAIGAGGDRMQVWKHPEPAVTEFNPGGWTYEALQERG
FT                   KNIIEDNLQSVGVVFPELPAELQPQIPVKA"
FT   CDS_pept        408287..409231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53337"
FT                   /db_xref="GOA:A4QAU0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU0"
FT                   /protein_id="BAF53337.1"
FT                   /translation="MSNNVVKYECAVDADNIVAVDMHVHLEVDSCGHESMPADIMEASS
FT                   KYFKAAERTPSADAIADIYREHKMAAVVFTIDARTQMGHLPNSIDDLVASCARNNDVLI
FT                   PFGSVDPRTGEDALVEARRQVEELGVRGFKFHPSVQGFDPSAPEFYPLWELLESFGLPC
FT                   VFHTGQNGMGAGLPGGRGIKLRFSNPLLLDDIAADFPNLTIIMAHPSVPWQDEANSIAT
FT                   HKANVFIDLSGWSPKYFPESLVRQSNNVLSKKVLFGTDFPLITPEKWLAAFANLPLKDE
FT                   VRPGILKDNAVKVLGLAASTERGSQAEKAVQHA"
FT   CDS_pept        409224..410420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53338"
FT                   /db_xref="GOA:A4QAU1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU1"
FT                   /protein_id="BAF53338.1"
FT                   /translation="MRDPIQGAVIPSDLFGFAEVLTEAERAVLLETRRVLEEEVKPYIN
FT                   EAWDKAVFPNAIMQPLQDLQLLDPPALREAGESVRDIFTGFRNFELARCDINVGTYYNA
FT                   SAGLFRTACMVGGSPEQAQRLDAQIKSGEVKGVFALTEPDHGSDIAGGLATTATKDADT
FT                   GEWIINGEKRWIGGASTADLIATFARDTADNQVKCFLVAPQAEGVSMEIIDRKASLRIM
FT                   QNAHITYNNVRVSEDARLHNINSFKDVSECLRRMRSDVAWMAVGAQAGAYEAAVKYVRS
FT                   REQFGRPIAGFQLIQEKLALMLGNLTASLGMMVKLTEQQQAGIFKEENSALAKMFTSLK
FT                   LRETASWAREICGGNGIILDNDVARFHADAEAVYSYEGTHEINALIVGRAITGVSAFI"
FT   CDS_pept        410442..410915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53339"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU2"
FT                   /protein_id="BAF53339.1"
FT                   /translation="MTTSTTPNTIISFEDAPTLTGQDLGFSQWRTVTQEMVNTFADATD
FT                   DQQWIHTDPERAKDGPFGGAIAHGFLTLSMIIPFWGELLDVTGVTTKVNYGLDKVRFTS
FT                   PVKVGSRIRMGAVVREISEVKGNGLHLVADGTIEIEGQERPAVVATFLTRFYA"
FT   CDS_pept        411012..411857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53340"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU3"
FT                   /protein_id="BAF53340.1"
FT                   /translation="MTKLERMEHPAYSQLRPVTPSASVVLCPNPGYSSLEGTNSWVIRA
FT                   PEDPRSIVIDPGPEDEGHLNVLHSKAEEVGLILLTHRHYDHADGAQRFRQLTNAPVRAM
FT                   DPTYCAGAEEIHDGEIITIDGVTPQIEVVATPGHTRDSVSYFIWSGVPHESTLEGIVSG
FT                   DTIAGRHTTMISETDGDLGEYLNSLAILEERGKDIPLLPGHGPDGQDVSSFARKYIERR
FT                   ELRLNQIREVWETRGRDVSMKDLIDAIYDDVDPVLRGAAEQSTHVAIRYLQAQEASASN
FT                   "
FT   CDS_pept        complement(411933..412616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53341"
FT                   /db_xref="GOA:A4QAU4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU4"
FT                   /protein_id="BAF53341.1"
FT                   /translation="MEGVQEILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGE
FT                   PGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHA
FT                   ATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANR
FT                   FGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHL
FT                   ARRAR"
FT   CDS_pept        complement(412878..413063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53342"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU5"
FT                   /protein_id="BAF53342.1"
FT                   /translation="MTGLLVVIIPLLLMLFAFAMERIESSFLHSNTPQSTEVKLAKDAI
FT                   GAENLNDDDVQEASAA"
FT   CDS_pept        413109..413891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53343"
FT                   /db_xref="GOA:A4QAU6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU6"
FT                   /protein_id="BAF53343.1"
FT                   /translation="MGSITPQKRPRVGSHIANKGQETDIGRKRRARRINRTLTVAYPDA
FT                   HCELDFTNPLELTVATILSAQCTDVRVNQVTPALFKRYPTAADYANADRTELEEFIRPT
FT                   GFYRNKATSLIGLGEALISLHDGQVPGTLEQLVELPGVGRKTANVVLGNAFGVPGITVD
FT                   THFGRLVRRLKLTDEEDPVKVEKVMNELIEKPEWTMFSHRLIFHGRRICHSRRAACGAC
FT                   MLAADCPSFGLEGPSDPFEAQKLIKSDDREHLLKMAGM"
FT   CDS_pept        413899..414459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53344"
FT                   /db_xref="GOA:A4QAU7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU7"
FT                   /protein_id="BAF53344.1"
FT                   /translation="MTSSAKWSIVGVVAILAVIVALIPQLVGGESAEEAQGETSTSKIT
FT                   TRPDCVASGAAGVDLPCLGGANGVGNELATVVNLWAWWCEPCRAELPIFDEFATTHPEL
FT                   NVIGVHADQNAANGAALLEDLGVNLASYQDDSNLFAGALGLPGVVPITIVVSPDGNVVD
FT                   TFPQPFETIDDLETAVAGALQNA"
FT   CDS_pept        414452..415195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53345"
FT                   /db_xref="GOA:A4QAU8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU8"
FT                   /protein_id="BAF53345.1"
FT                   /translation="MRNYPDLPHDFPGQNTELTPAKAPVWMHRLIDRIHAGHMANPLDG
FT                   AEPLGDTDSEKRAAVLMLFSGSETSFDLPNDASVLLTHRTPTMRSHAGQIAFPGGRIDT
FT                   TDTNAVDCAFREAWEETGLDRRTATPLAQLNEVHIRATGYPVYPILGHWHTPSPVAVAS
FT                   PHETDEVFDAPLYDLIDPKNRLMVGWREWHGPAFRINDYIIWGFTGGLLSAILDTAGWA
FT                   TEWDTDRIFDLENTLSTSRNNERMR"
FT   CDS_pept        415286..416482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53346"
FT                   /db_xref="GOA:A4QAU9"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAU9"
FT                   /protein_id="BAF53346.1"
FT                   /translation="MLSPSLVVDAVIVLVMAFALWGGWRQGAFTSLLSTVGVVSGLVVG
FT                   AAAAPFVMGLTDSTALRFLLAIGTVVLLVGLGNLIGAHLGAAIRDNIKFRSSRTLDSGL
FT                   GAIFQVLATLIVVWLVAIPLATGLPGTVASGIRDSRILGFVDKYTPQGLDTLPSKIAAM
FT                   LSESGLPPLISPFTGGSSVEVDAPEINVTNVDLVEAMRPSVIHVMGDAQECSRRLMGSG
FT                   FVASPDYVVTNAHVVAGTSTVSLDTMIGTRSAEVVFYDPNLDIAVLYSPDLGLDPLPWA
FT                   STPLDTGDEAIVMGFPQSGPFNASPARVRERIMITGSNIYANGQHEREAYSVRGSIQSG
FT                   NSGGPMANEMGEVVGVVFGAAIDGSDTGYVLTAEEVQERIGDITSLTQPVDTMQCAVS"
FT   CDS_pept        complement(417049..418044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53347"
FT                   /db_xref="GOA:A4QAV0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV0"
FT                   /protein_id="BAF53347.1"
FT                   /translation="MAFFSFSTSPLTRLIPGSRSKATGAKRRLNSTIASIERSPGIIAL
FT                   DGPFTHDHVSVRGIRLHLAEAGSPTKPLVLLIHGAFGGWYDYREVIGPLADAGFHVAAI
FT                   DLRGYGMSDKPPTGYDLRHAAGELSSVIAALGHDDAFLVGSDTGASIAWAIASMYPERV
FT                   RGLISLGAIHPLDMRRAIRRKPHLHVSDLSRLAPFRLPSFLHNLFQFGITRAARREIVN
FT                   NTSSSYQRSNAFTEAVLLRKKALSIDHTITPIIRTNRYLVGSIPSKTVSAPVWLLRTNS
FT                   RRWEHLANTARTRTTGPFTTIAIPGGYELPYLENPSEFAATIAEFARTTF"
FT   CDS_pept        complement(418059..418610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53348"
FT                   /db_xref="GOA:A4QAV1"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV1"
FT                   /protein_id="BAF53348.1"
FT                   /translation="MSNKDGLFTDGSSTFAPKVDSIPLSDVDTSVSGEASIGTLISNAT
FT                   SQMSSLFRAEVELAKTELAGEAKKAAIGGGAFSVAGVIALYSSFFFFFFVAALLSEWIK
FT                   PWAAFLIVFLFMLVIAAALALFGWRKVKKMGAPKNTIQSVNQLKNLVPGQASEKLEKAN
FT                   KRGLYTSASFHSPGAITGDH"
FT   CDS_pept        complement(418775..419752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53349"
FT                   /db_xref="GOA:A4QAV2"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV2"
FT                   /protein_id="BAF53349.1"
FT                   /translation="MWQMTLPARLLHSQCATPARHFNLIGNFSFSLSLGKLPKSAKLCG
FT                   VKHPDPAQKVEGTTATTPTKVAAFFDLDKTIIAMSSTYAYGREFMNSGLISPVEALQLS
FT                   LAQATYMFAGHTSEQMDNTRDQLTAMIHGWEVQQVRSIAEETMHSVVTPTIYAEARELI
FT                   EHHQELGHDVIIISASVKELVEPIARELGVHKTVTTVLEAHDGMYTGEVLFYCKGDAKA
FT                   QSILDLAEANNYDLSLSFAYSDSFTDLPMLEAVGNPAAVNPDRALKKIALEQGWKILSF
FT                   KNPEPLFQMPSTRDVGIGTGVVAGIAAVAAGSIWWMKRARRGSA"
FT   CDS_pept        420097..421158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53350"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV3"
FT                   /protein_id="BAF53350.1"
FT                   /translation="MNTTTHQAILIAVEDPVLHPEAMHVAAATGRPVIETTNLMDISRH
FT                   FHRASAVLIDTSMASQLSPGKRRDRVFLLDSDPGPSDWKTAMKIHAEQAMLLPAQAGEL
FT                   LSALGRDDKQLPVASGHVIGVAGVVGGTGASTFAAALAKRRAESATTVLIDADPSSGGI
FT                   DLLLGIEDVPGARWPDVGLRRGTVQAADVLKALPSTPDEVVVLSTARSNVLDPFALSES
FT                   DVSAAIDCFLSADRSVDVVVDLPHARVHPDIAERLSHLVLVIPAEVRAVAAARARYMEL
FT                   QQLHVSITCVLRHRGWSGLDVAEVEEILGADITAEVGSIQRLAKSVEMHGLTGSLPRVL
FT                   SSACDAVIGEVAA"
FT   CDS_pept        421155..422288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53351"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV4"
FT                   /protein_id="BAF53351.1"
FT                   /translation="MTDIDLVVENVQRIIATKATPPTSAEIASLIREQAGVISNEDIVM
FT                   VLRRLRSDSVGVGPLESLLALPGVTDVLVNAHDSVWIDRGQGVEKVDMDLGSEEAVRRL
FT                   ATRLALTCGRRLDDAQPFADGRITRDDGSVLRIHAVLAPLAESGTCISVRVLRQARLSL
FT                   DDLINSGTVPEDIAPALRNIINQRRSFLVVGGTGTGKTTLLSAMLTEVPADQRIICIED
FT                   TAELHPGHPSIINLVSRQANVEGAGAVSMADLLKQSLRMRPDRIVVGEIRGAEVVDLLA
FT                   AMNTGHDGGAGTIHANSISEVPARMEALAATGGLDRMALHSQLAAAVDIVLVMKHTPFG
FT                   RRLAQLGVLCGNPVTTQVVWDLDHGMHEGSEEAWFMP"
FT   CDS_pept        422273..423049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53352"
FT                   /db_xref="GOA:A4QAV5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV5"
FT                   /protein_id="BAF53352.1"
FT                   /translation="MVYALGLLSVAVLISGSRGPGARTRPPTPGNGVHLFALIALFCLA
FT                   TVLFIVVDAYTMIAGIIIATTLFWYLRQTHAAAQRTKQSLQLASFLSLCAGNLRAGVTM
FT                   VDAMDYALDNTTPDKFLSPTLQTAARQARSGGSGPRVLIDASLPDLQRLGHLWETSERH
FT                   GIPLVALIDQMRSRISSKQRHGESTRAALQGPQATAVILTVLPLAGLLMGTAMGANPLG
FT                   ILTGGGIGGLLLVIGVGLDAAGFVVTHKILQSASPS"
FT   CDS_pept        423046..423621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53353"
FT                   /db_xref="GOA:A4QAV6"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV6"
FT                   /protein_id="BAF53353.1"
FT                   /translation="MITALVIAAVAMFLGSPNPGVRGGLISPKSGKSLRIRAGPKKLGN
FT                   ADPVDVSADIELFSACLDAGLNTRDAAQVVAHVAAKTHRELWTHVVALLSIGVSAPQAF
FT                   ALMAGVDGLDELANLATVSHRSGSALSDGCRNISTSLLASAGDKRTAAAERAGVFIAMP
FT                   LALCFLPAFMIVGLAPVVLSLGTQLINF"
FT   CDS_pept        423645..423845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53354"
FT                   /db_xref="GOA:A4QAV7"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV7"
FT                   /protein_id="BAF53354.1"
FT                   /translation="MSNNLELLRLRTRAILAQDDGLTTVEYALGTLAAAALAAVLYMVV
FT                   NSDAVSSAFESIISDALSARP"
FT   CDS_pept        423849..424169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53355"
FT                   /db_xref="GOA:A4QAV8"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV8"
FT                   /protein_id="BAF53355.1"
FT                   /translation="MRTKQQREPPELCSDDGSVSIEAALALSSLVIVCGLIIAAMATLA
FT                   AYLAAVDAAGAAARAHAIGESFEPARGHVDMHEAGGMLTATATIPAPIGQVSASAVFPV
FT                   EN"
FT   CDS_pept        424144..424491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53356"
FT                   /db_xref="GOA:A4QAV9"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAV9"
FT                   /protein_id="BAF53356.1"
FT                   /translation="MRCSRWKTSCANDEGYMTIASAGVASILISLLVVLAWQAGNLVAR
FT                   EQAQVAADVSAVAGAYAFARGELPDAACATAKHTAEANNAQLENCATEGEDLTLTVTVR
FT                   GQEAHAKAGPL"
FT   CDS_pept        complement(424486..426843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53357"
FT                   /db_xref="GOA:A4QAW0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW0"
FT                   /protein_id="BAF53357.1"
FT                   /translation="MRPSFGEELAAIVSKRYSESTLTHMVTLPASKAKYVDWPSWVPAS
FT                   LRDALVNRGINKLFSHQEQTAHLAWNGQHVVVATGTSSGKSLGYQLPILSALGTDPTAC
FT                   ALYLTPTKALGSDQLTSTSTLLRDIPDFHPINPAPYDGDTPSEARSGIRDLSRFVFTNP
FT                   DMVHASMLANHSRWARLLRHLKFIVIDECHAYRGVFGANVSMVLRRLLRLAAFYGSHPT
FT                   VILASATSSDPEIHASRLLGAPVKAVTEDGAPTGERTVLLWEPGFIEGAEGENGAPVRR
FT                   AASTEAANIMATLISEGARTLTFVRSRRQAEIVALRAQEELSTLGRPDFARRVASYRAG
FT                   YLAEDRRRLERLLDDGTLLGVASTNALELGIDVGGLDAVVTAGFPGTVASFWQQAGRAG
FT                   RRGQGSLVVLVARDEPMDTYLVHHPAALLEKPVEAAVFDPTNPHVIRGHVYCAAVEKPL
FT                   TEVEVAAFGAQKVVEKLEIEGLLRKRPRGWFAVEKPMSEDPDELIPDSAHQQVSLRGGS
FT                   GSEFMIVDISDGRLLGTIDSAKAMSQTHPGAVYLHQGESFVIDELDLEENLALARPELP
FT                   DYTTYARSDTDIRITSAPLEDEVFDAGGGLWVANVEVQVTDRVTGYVTRLSDGTTLDAT
FT                   PLYLPPQILQTRAVAYTIDPLALEAMGIPAADIPGALHAAEHAAIGMLPLLATCDRWDI
FT                   GGVSTALHADTGYPTVFVYDGMDGGAGFADTGFRRFAQWIEATFEVVRSCSCESGCPSC
FT                   VQSPKCGNGNNPLDKAGAIKLLGAMVTLLGTS"
FT   CDS_pept        427160..427363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53358"
FT                   /db_xref="GOA:A4QAW1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW1"
FT                   /protein_id="BAF53358.1"
FT                   /translation="MAQGTVKWFNPEKGFGFIAPSDGSADVFVHYSEIQGNGFRTLEEN
FT                   QLVEFEIGEGAKGLQAQAVRAI"
FT   CDS_pept        428027..431041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53359"
FT                   /db_xref="GOA:A4QAW2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW2"
FT                   /protein_id="BAF53359.1"
FT                   /translation="MADTAGTTGTAGSKKKYLVIVESATKAKKIQPYLGNDYIVEASVG
FT                   HIRDLPRGAADIPAKYKKEPWARLGVDTDRGFAPLYVVSPDKKKKVADLKAKLKLVDEL
FT                   LLATDPDREGEAIAWHLLEVLKPTVPVRRMVFNEITKPAILAAAENTRELDENLVDAQE
FT                   TRRILDRLYGYEVSPVLWKKVMPRLSAGRVQSVATRVIVERERERMAFVSADYWDLSAE
FT                   FNAGESGKADSDNPSSFTARLSTIDGNRVAQGRDFNDRGELTSEAVVVDKQRAEALAEA
FT                   LEGQEMAVVGVEEKPYTRRPYAPFMTSTLQQESGRKLHYTSERTMRIAQRLYENGHITY
FT                   MRTDSTSLSEQGMKAARDQALELYGAEYVSPSPRTYDRKVKNSQEAHEAIRPAGETFAT
FT                   PGQLHGQLDAEEFKLYELIWQRTVASQMADAKGTSMKVTIGGTAKTGEKTEFNATGRTL
FT                   TFPGFLRAYVETTRTADGRDVADNAEKRLPLLSEGDLLKVLGIEADGHSTNPPARYTEA
FT                   SLVKKMEDLGIGRPSTYASIIKTIQDRGYVYSRGNALVPSWVAFAVVGLLEANFTSLVD
FT                   YDFTSSMEDELDNIAAGREGRTEWLNGFYFGDAEADQSMAESVARQGGLKALVDANLEH
FT                   IDARSVNSLKLFDDAEGRAVNVRVGRYGPYIERIVGTTAEGEPEFQRANLPEETTPDEL
FT                   TLEVAEKLFATPQGGRELGINPANGRMVVAKEGRFGPYVIEQVTDSERAGAEAQAEEVV
FT                   AAERKAEDEQRAADGMRPKNWETKTAANQKEKRINQLVEENLKPATASLFSGMEPATVT
FT                   LEEALKLLSLPREVGVDPSDNEVITAQNGRYGPYLKKGSDSRSLNSEEQIFTVTLDEAR
FT                   RIYAEPKRRGRAAAQPPLKQLGDNDVSGKPMTVKDGRFGPYVTDGTTNASLRKGDVPES
FT                   LTDARANELLSERRAKEAADGGAPAKKTSTKKTAAKKTTAKKTTAKKTTAKKTVRKAPP
FT                   KTTKNVVKAGARKKS"
FT   CDS_pept        431045..431758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53360"
FT                   /db_xref="GOA:A4QAW3"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW3"
FT                   /protein_id="BAF53360.1"
FT                   /translation="MLNGFVTKTRQGASALVKAVSKSVSEPERAAYVAAAGAHVCASLM
FT                   GVSKVKTLSKPALMPLLAGRVLRSSCAPLEKGLGLVGLAGGWAGDLVLMKPDSLPKGAA
FT                   GFAINHAAYIALLLRGGARPSAVRAGIRAVPLLGAAGFAAIREPKMLPIVLGYGGLLAT
FT                   TSMLADDSKLHDSSNLASFGMGHGGNLFLISDAVLFARELFLEDGTVAAQLADGAVMGT
FT                   YTIAQLLLVDGLFSD"
FT   CDS_pept        complement(431833..433338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53361"
FT                   /db_xref="GOA:A4QAW4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW4"
FT                   /protein_id="BAF53361.1"
FT                   /translation="MKWLWGTSWPLYAATVLGTNVFGALAVMLFVRFLIPQPDASNFNA
FT                   EISYLPAVGFAYLAFAIVAGMLVTFLMFRPVLDWQRSPEDHDRNMVRNLVMRIPIYQAI
FT                   LCAVVWLIGIAIATLISASVSTSLALVVAFSTLMAAAIVVLLTFLEAERLVRPVAASAL
FT                   ARRFEDSTLEPPVSQRLRMTWLLTLGIPVMGILLLIWGYSQGIFGSDASGIMPAIAALA
FT                   FASLVTGYLGNRLVVSSVVDPIRELQEAINRVRRGENDVQVDIYDGSEIGVLQAGFNEM
FT                   MRGLRERQRVRDLFGRYVGAEVAKRALEERPTLGGEDRKVAVLFVDVIGSTTFAVNHTP
FT                   EEVVEALNEFFEHVVEVVHRNKGVINKFQGDAALAIFGAPLPLSDATGHALAAARELRA
FT                   ELKDLQLKAGIGVAAGHVVAGHIGGHARFEYTVIGDAVNQAARLTEIAKTTPGRTVTNA
FT                   STLREANEAEQARWTLMKSVELRGRGQMTQIARPIRPTLADRS"
FT   CDS_pept        433424..434683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53362"
FT                   /db_xref="GOA:A4QAW5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW5"
FT                   /protein_id="BAF53362.1"
FT                   /translation="MTNSSVFDSLAGSKTVSKTLFDAASSARALVRARTTERARARAEH
FT                   QNPAMIHDSGFAQSWLFTGPPGSGRSVAAKVFAATLVCSNPDVVGCGQCEDCRAAMGGS
FT                   HPDIEHIVPQQLSIGVDAAREVIKAAAVSPVAGNWRVVIFENADRLTMQAANALLKTVE
FT                   EPTESTVMILCAPTTDPRDIAITLRSRCRHLYIPTPSIAEVARILVAEGNVSQADAELA
FT                   AAASGAHIGRARYLAHNNAAQRRRASILNLAELIFHGDVAFRSVNTLVKMVETEAKDSN
FT                   KEKEEAELEAVRISLGMGAKGKGVHKAVRGGAGDFKALEDQQKLRRTRFLRDSLDLALV
FT                   DLAGIYRDAIIISSQAQVGLTHPDMEGLSQELATKVSQEGLLACLDAISKCRESFGFNV
FT                   RPIVAMDALVGRLRKAYKVS"
FT   CDS_pept        complement(434985..435434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53363"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW6"
FT                   /protein_id="BAF53363.1"
FT                   /translation="MKKFIAASTILALSLIGAPQAAAFSSGSSGSNIVQPLPEPKPTDL
FT                   NEVLRIIASGYFTHYSNRGYTYDASAENIAQMYFEGTPSQKEYLRQELAAIGAEVIVET
FT                   YPTSTYQDKYTQLVNTPRQPINGTLWGAYIGVNEYTITATLVVTH"
FT   CDS_pept        435767..436330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53364"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW7"
FT                   /protein_id="BAF53364.1"
FT                   /translation="MKTASDPIDWNPQRVAVSGVSGVGKTTLCKQIEEISGFSRVELDS
FT                   LYHGENWIPRETFVEEVQDFIKGPQWVMELQYRQVRPLIVERADTVLWLDYSTPRQMFR
FT                   LIKRTIPRSLFKTKLFNDNIEPPLWTIFKDPDHIVRWGWRTRNSLKKVTPTFEGRFAPL
FT                   TVVRLSSPKETKRWLRAYGESVKL"
FT   CDS_pept        436346..437230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53365"
FT                   /db_xref="GOA:A4QAW8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW8"
FT                   /protein_id="BAF53365.1"
FT                   /translation="MAESFIEVSAGHADRRIDKFLRAQLKGVSASLIFRQMRKGDIRVN
FT                   GRKVDPNYRLQEGDRIRMWQMDLPADLPPPVVDKHIFKAVADSVLFEDAELLVINKPAG
FT                   IPVHGGTGHGGGVIEALRQKFPQERDLELVHRLDRDTSGLLLVSKTTSVLRELQEILRD
FT                   REEEIFRGYLLKVEGAWPGDLRQIDVPLKRTETTVVPHSDGLRARTYFEVVKRLPGATL
FT                   VKAQLATGRKHQIRVHAQYAGHPIVGDPRYGSRGGRAATMHLHAAELVVPRGAGKRQKF
FT                   TAPLPKEWGMGRV"
FT   CDS_pept        437648..439684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53366"
FT                   /db_xref="GOA:A4QAW9"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAW9"
FT                   /protein_id="BAF53366.1"
FT                   /translation="MSQEQPQIGSRLSRVIEQDGLQFRDLDGDGVLAPYEDWRLTPAER
FT                   AADLVKRMNVEEKAGLMIIGSHYPGYSPLAPESEGKDAEKCEPLLNPVDMWREDNPITG
FT                   VPFTEPVLATSSTENAINLRNQRYLIVRDNLPARELATWTNAVQEVAERSRLGIPVVFA
FT                   SNPRNHVALVAQFGVNESAGVFSEWPGELGLAALRDAELMETFGTEAAKEWRAGGVHKL
FT                   YGYMADLASEPRWSRFNGTFGEDPELISDYIAAVVRGLQGPELSKNSVSTTIKHFPGGG
FT                   VRLDGHDPHFHWGQTNEYPTEDALGKYHLPPFQAAIDAGCASIMPYYARPMNNSANQLD
FT                   QQLWQNPTTQFEEVAFAYNRAFIQDLLRDAMGHRGYVNSDSGVIDAMMWGVEELSEPER
FT                   FAAAVRAGTDIFSDMANPRRLLEAVAEGHLDESELNQPVQRLLEEIFQLGLFENPYVSE
FT                   DEAEKIIGAPEVSALGNKAQLDSVTLLRNNPSVLPLDPAASLKIYPLVTGRTKIDEVQL
FT                   QLEAAIRAELPGVTLVSSESEADLAIVWARPEIALFEDDLEGVSLSVDPRANGVDVERV
FT                   QAVEAAVPTILAVNFTNPWVLSEIEPGAAAVVGTFEIKPEFLLKALTGQEGGPKGKLPL
FT                   TVPASMQAIADSPRDIPGKFLDESYTYVDSAGMAYKYGHGLNF"
FT   CDS_pept        439737..440843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53367"
FT                   /db_xref="GOA:A4QAX0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017816"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX0"
FT                   /protein_id="BAF53367.1"
FT                   /translation="MSTVVPGIVALSKGAPVEKVNVVVPDPGANDVIVKIQACGVCHTD
FT                   LAYRDGDISDEFPYLLGHEAAGIVEEVGESVTHVEVGDFVILNWRAVCGECRACKKGEP
FT                   KYCFNTHNASKKMTLEDGTELSPALGIGAFLEKTLVHEGQCTKVNPEEDPAAAGLLGCG
FT                   IMAGLGAAVNTGDIKRGESVAVFGLGGVGMAAIAGAKLAGASKIIAVDIDARKLEWAKE
FT                   FGATHTIDSSGLGGEGDASEVVAKVRELTDGFGTDVSIDAVGIMPTWQQAFYSRDHAGR
FT                   MVMVGVPNLTSRVDIPAIDFYGRGGSVRPAWYGDCLPERDFPTYVDLHLQGRFPLDKFV
FT                   SERIGLDDVEEAFNTMKAGDVLRSVVEI"
FT   CDS_pept        440844..441479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53368"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX1"
FT                   /protein_id="BAF53368.1"
FT                   /translation="MAHDGLRVENIVTSGIFALDGGEWEVDNNIWVVGNDDEVFIIDAA
FT                   HTAAPIIEAVGGRTVKGILCTHAHNDHITVAPELAKEFDAPIFVHPGDQMLWEETHGNL
FT                   AHEDLADQQKFHIAGTELIVLNTPGHSPGSSCFYLPEANELFSGDTLFQGGPGATGRKY
FT                   SSFDTIIESLKTSILDLPAETTVRTGHGDHTSVGAEAPHLEEWIKRGH"
FT   CDS_pept        441509..442180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53369"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX2"
FT                   /protein_id="BAF53369.1"
FT                   /translation="MDLKLGGQVILVVGGAGTIGSEVVKLLTEEGATAVAASRSTPLSI
FT                   DASDEASVRAGIGQVIAEHGRLDGLVVSSAPAAQTLSAETADDPDTVLAAIEGKAITFM
FT                   KAATVALEKMREAGYGRIVALSGMNSYKTLSTAASARNAALNVVVKNLADRHAGTGITV
FT                   NAISPGFVVAEPDAEVNRANGDTTVGEVAEAIAFLLSPRTASISGEIISVGHKAKGVIL
FT                   P"
FT   CDS_pept        442267..443499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53370"
FT                   /db_xref="GOA:A4QAX3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX3"
FT                   /protein_id="BAF53370.1"
FT                   /translation="MGVSAFNISDMVANKRAQRKVWLAVALSVFTVAWGGNEFTPLLVF
FT                   YRGEGFFSNLFIDLLLVFYAIGVAVGLLAAGPLSDRYGRRAVMLPAPLIAILGSALIAL
FT                   GEETAILIAIGRVLSGISVGMVMTVGGSWIKELSSSRFEPGVKTSAGAKRASMSLTGGF
FT                   ALGPALAGVMAQWLPLPGQLAYVLHIILTLILFPLLITAPETRQSAHLKTKGSFWSDVL
FT                   VPSALDKRFLFVVAPIGPWVFGAAFTAYAVLPSQLRDMVSAPVAYSALIALVTLGSGFG
FT                   IQQFGPQIMGTSKTRGPILAMFVTVIGMIGAVIVVMNPHPWWALVVCMALGLSYGLCMF
FT                   MGLAETQNIAPPVDMAGLTGIFYCLTYVGMVFPALMTWLNQWLSYPFMLGFGAVMATIC
FT                   LIIVSFSARRF"
FT   CDS_pept        443521..444456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53371"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX4"
FT                   /protein_id="BAF53371.1"
FT                   /translation="MRTVVTGGAGFIGSHLVDLLIKEGHEVVVIDNLSRGRLENLSDAE
FT                   TTGKLTFVEADLLDVDFNEFLGEHKPEVIFHLAAQIDVRHSVVDPLHDAETNILSTIRI
FT                   ADAARQHGVRKVVFTSSGGSIYGEPSEFPVAETVPVDPHSPYAASKVSGEIYLNTFRHL
FT                   YGLDCSHIAPANVYGPRQDPHGEAGVVAIFALRLLGGLDTKVFGDGGNTRDYVYVGDVV
FT                   RAFYLASGEIGGGERFNIGTSVETSDRQLHTLVATAAGSKDDPEYAPARLGDVPRSALS
FT                   FGKAKEVLGWEPEVNIEQGVAKTVEYFRTH"
FT   CDS_pept        complement(444908..445285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53372"
FT                   /db_xref="GOA:A4QAX5"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX5"
FT                   /protein_id="BAF53372.1"
FT                   /translation="MTQTTTQIIIQILLLLATAALALYFLRNRRKARAKAWVKIGFVVF
FT                   IFAAVWAVIRPDDLTQLANFVGVDRGTDLMLYALVVAFMFTTLSSYVRFREQELRCSKL
FT                   ARAVALQNVVLPEDSQDSDPA"
FT   CDS_pept        complement(445282..446118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53373"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX6"
FT                   /protein_id="BAF53373.1"
FT                   /translation="MRDCVPASCSRSMDFMTIKLSSLGSVAPNRKIGHHALGSIPIMDA
FT                   SKNSDFKDTWLVVPCYNEATVIREVLENALKTFPNIVAVNDGSPDNSAEEIHAAGAHLV
FT                   NHPVNLGQGAAIQTGIEYARKQPGAKYFVTFDADGQHQVKDVVRMVERLRAEDVDIIVG
FT                   TRFGRPRQADDQVPLIKRLVLRTVVLLSPKTRRLGLTDAHNGLRVFNQKVAQEMNIRMN
FT                   GMSHASEIVDQIDERGWRISEEPVDILYTEYSMSKGQSLLNGVNILADGFLARRLP"
FT   CDS_pept        446063..447094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53374"
FT                   /db_xref="GOA:A4QAX7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX7"
FT                   /protein_id="BAF53374.1"
FT                   /translation="MIVMKSIDLEQLAGTQSRTYQSRKITDDMVARPVHVAIALWEVPW
FT                   ESAKSGKIEGWVIAVDSPRGRFVRSGQTKNGDAVNRTVSMLKSALKGVRGKAWIVTGRR
FT                   QAALRAALVRENYLVTGSFAEQNRAGVKASAISRRAEQSALYKAKKIGEFAERAPRVKE
FT                   RQEAHWWPRLSRTQGTAGVLRLATDASTDGVFRGAMCFVASNGDYLLETQDTTASSDEL
FT                   ELESITHALIYLKSIGATQAIIESDSKAALEAIDFILNTRPRRGRWRGITARARNRFRD
FT                   AWEALIDDCVVELSRVLGHAGDPLNQAADQIAYMGMRAVIFEQKSAHPTLLKGIDKALR
FT                   KAE"
FT   CDS_pept        447133..448170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53375"
FT                   /db_xref="GOA:A4QAX8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX8"
FT                   /protein_id="BAF53375.1"
FT                   /translation="MSNKRIGVVIVSYGHEQDVANLVDTFADQLKTGDRVVVVDNRKPW
FT                   VLKDAVGERLEKHGAEIINHDNGGFAAGCNVGAAHIVDDVDLLFFLNPDTVIDDPTLFN
FT                   SLRRVDEQWAAFMPYLLLPDGTINSAGNALHISGLSWVTGLDEKPVEGSSEVTDISIAS
FT                   GACLAVRVDWWKRLGGMEELYFMYHEDTDFSARLLLAGGRIGLLHSAYVTHHYDYAKGD
FT                   YKWIYIERNRHVLLLSVLPLPLLFVLIPQILGVNLGLWAIAAKEKRVGLKMKSLRLLIR
FT                   DLPAIFKLRRSTQELAELTPSQYLAKMEWRLDNPNLGNIGSNKIVATGYKTYYKLCMSI
FT                   LKLLA"
FT   CDS_pept        448329..450395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53376"
FT                   /db_xref="GOA:A4QAX9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAX9"
FT                   /protein_id="BAF53376.1"
FT                   /translation="MKRLSRAALAVVATTAVSFGALAVPAFADEANNVELNILGVTDFH
FT                   GHIEQKAVKDDDGVITGYSEMGASGVACYVDAEREANPNTSFITVGDNIGGSPFVSSIL
FT                   KDEPTLQALNAIGVDASALGNHEFDQGYADLTDRVSLDGTGSAQFPYLGANVEGGNPAP
FT                   AKSEIIEMDGVKIAYVGAVTEETATLVSPAGIEGITFTGDIDAINAEADRVIEAGEADV
FT                   VIALLHAEAAPTDPFSNNVDVVFSGHTHFDYVAEGEARGDKQPLVVIQGHEYGKVISDA
FT                   EISYDREAGKITNIEAKNISATDVVENCETPNAEVDTIVAAAVDAAEEAGNEVVATIDN
FT                   GFFRGANEEGATGSNRGVESSLSNLIAEAGLWAVNDATILNADIGIMNAGGVRADLEAG
FT                   EVTFADAYATQNFSNTYGARDLTGAQFKEALEQQWKLTGDRPRLALGLSSNVQYSYDET
FT                   REYGDRITHITFNGEPMDMKETYRVTGSSFLLAGGDSFTAFAEGGPIAETGMVDIDLFN
FT                   NYIAAHPDAPIRANQSSVGIALSGPAVAEDGTLVPGEELTVELSSLSYTGPEEKPSTVE
FT                   VTVGSEKKTADVDNTIVPQLDQTGTASVTLTVPAGATSVEIATDNGTTFTLPVSATGMD
FT                   DSEQLSSGSSDAGSLVAVLGVLGALGGLVAFFLNSAQGAPFLAQIQAVLAQFM"
FT   CDS_pept        complement(450979..452049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53377"
FT                   /db_xref="GOA:A4QAY0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY0"
FT                   /protein_id="BAF53377.1"
FT                   /translation="MARVSIPVKALQKTGPDAPFEVKIIERRDPRADDVVIDIKAAGIC
FT                   HSDIHTIRNEWGEAHFPLTVGHEIAGVVSAVGTGVTKWKVGDRVGVGCLVNSCGECEQC
FT                   VAGFENNCLRGNVGTYNSDDVDGTITQGGYAEKVVVNERFLCSIPEELDFDVAAPLLCA
FT                   GITTYSPIARWNVKEGDKVAVMGLGGLGHMGVQIAAAKGADVTVLSRSLRKAELAKELG
FT                   AARTLATSDEDFFTEHAGEFDFILNTISASIPVDKYLSLLKPHGVMAVVGLPPEKQPLS
FT                   FGALIGGGKVLTGSNIGGIPETQEMLDFCAKHGLGAMIETVGVNDVDAAYDRVVAGDVQ
FT                   FRVVIDTASFAEVEAV"
FT   CDS_pept        452116..452964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53378"
FT                   /db_xref="GOA:A4QAY1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY1"
FT                   /protein_id="BAF53378.1"
FT                   /translation="MLELNRIIQEIEDDLEVDVDKLARRALTTEYHLRKMFGTLAGMSL
FT                   AEYIRNRRLTLAAADLKAGQAVLDVAVKYGYASSEAFARAFRRFHAVNPSQARSDSIML
FT                   SSQPRLRFHIHVKGVTDLRYRIIEKQAFYLTGFHTQVQLVFKGDNQGIVDFEKSLGKEA
FT                   KARLLSLNDIEPKGALSISDEIENQQAEGSTLDYWHAVATSNPVEEFESMEVPAGTWVM
FT                   FESEGAFPESIQQMWADAATEWFPANSYSWAPGPQLLHTEYSEDFSTASAQLWLPITRN
FT                   S"
FT   CDS_pept        complement(452968..453825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53379"
FT                   /db_xref="GOA:A4QAY2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY2"
FT                   /protein_id="BAF53379.1"
FT                   /translation="MKGIILAGGSGTRLYPITKGISKQLMPIYDKPMVYYPLTTLIQAG
FT                   IKDILIITTPEDSASFERLLGDGSSWGINLTYAVQPSPDGLAQAFIIGEDFIGDDDVAL
FT                   VLGDNIFDGAQLGRALKQCSNPDGGIVFAYEVSDPERYGVVEFDAANKAVSIEEKPTAP
FT                   KSNFAVVGLYFYDNRVVDIAKSIKPSSRGELEITSINDAYLQQGALTVQRLDRGDVWLD
FT                   TGTIDSMSEASSYVEVLQKRTGNIIGSPEVAAYREGFITASELTALGEELKKSGYGNYL
FT                   LRAV"
FT   CDS_pept        complement(453826..455178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53380"
FT                   /db_xref="GOA:A4QAY3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY3"
FT                   /protein_id="BAF53380.1"
FT                   /translation="MFNKELTSRDTDIEGLLVFDFPVHGDNRGWFKENWQRTKMTNLGL
FT                   PDFGPVQNNMSYNATAGTTRGMHAEPWDKFVSVAVGSVFGAWVDLRAGSSTYGNVVTQK
FT                   ITPDVGVYVPRGVANGFQALEDGTLYTYLVNDHWSPDAHYANVNLNMIDWPLPITEISE
FT                   KDKKHPTLDHATPLPARQVLVVGAGGQLGTALRAQFPDAEFVTREELDITSDLTGARAW
FT                   KQYSTIINAAAYTAVDQAEHDRAAAWAINATAVANLATIARENNLTLVHVSSDYVFDGA
FT                   AESYDENAPFSPLGVYGQSKAAGDIAAATAPRHYIVRTSWVIGDGNNFVRTMKSLDERG
FT                   IAPSVVDDQIGRLTFTEDIAAGIAHLLEVGAAYGTYNLTNTGEPASWADVARAVFSDPS
FT                   KVTGVSTAEYFADKDAAPRPLRSVLNLGKIEATGFSAPTWQTRLNNYLKEL"
FT   CDS_pept        complement(455178..456197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53381"
FT                   /db_xref="GOA:A4QAY4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY4"
FT                   /protein_id="BAF53381.1"
FT                   /translation="MTSLLVTGGAGFIGANFVRQTVEQHPEYTHITVLDKLTYAGNADN
FT                   LKGLPDSKVTLIEGDICDAELVDSLVKDHDITIHFAAESHNDNSLNDPSPFVHTNLIGT
FT                   FVLLEAVRKHNKRFHHISTDEVFGDLELDDPNRFTETTAYKPSSPYSATKAGSDHLVHA
FT                   WIRSFGIQATMSNCSNNYGPYQHIEKFIPRQITNILAGLTPKLYGTGEQVRDWIHVDDH
FT                   NDAVHLILSKGKIGETYIIGADNDHVNNKQVIELICELMGLDKNAYEHVADRPGHDMRY
FT                   AMDSTKLRTELGWAPKYTDVDSGMRKGLEQTIDWYRENEAWWRGTKDNVEATYAKQGQ"
FT   CDS_pept        complement(456235..456816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53382"
FT                   /db_xref="GOA:A4QAY5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY5"
FT                   /protein_id="BAF53382.1"
FT                   /translation="MSLSVVEAITNRRATRKYTDEAPTPELIDKIVDLALEAPSAFNAQ
FT                   QREIVVITDPAQKQKLYEASHQKQFLTAPVTFIAVARVENEPEDLEEILGAERAERVAG
FT                   FINGRSIQQAREATLRDASLAAAFLILAAQAEGLSTSPTTGWDEKKVKEAIGIGGRDDR
FT                   AIALVIATGFPNEQPEHPGRLQNRRIDNSY"
FT   CDS_pept        457571..458518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53383"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY6"
FT                   /protein_id="BAF53383.1"
FT                   /translation="MHFCLLSLARPAKVVAPLLGAALLLSSCSSTSSDEPIQPEVASTG
FT                   YSVEHAMGTTEIPETPKRVVVIDSPHLDALLALGITPVGATESGSENGFPTYLADELKD
FT                   TESVGLTSEPNLEKIAALDPDLIIGAKVRHEAIYDQLSDIAPTVMSEGSGTNWNEQAEI
FT                   TAAAVNKSDEMDKLIADLDTRAKDLGEEIGAEGQTASMVRFRPDNFRLYGPETFSGSVL
FT                   EQVGFDLGERDWNEYSMMELSPENFGQIDGDLIFYTIPGSPEATTYPQVSELWVDSPAV
FT                   QQGKTYEFEDETWMVGIGVLGANEILDDLEETLS"
FT   CDS_pept        complement(458624..459265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53384"
FT                   /db_xref="GOA:A4QAY7"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY7"
FT                   /protein_id="BAF53384.1"
FT                   /translation="MLPNRLFLRLFALIALIGVVTGGILLLIDWRNGEQTSSSTRTTVN
FT                   DSMVIRALQREEEIVLLSAGALGIHEKTVERTIRGKRIPGTQKTVHVQYSYTGKLGIDA
FT                   SDVEIKSAGDNKLSITIPEFIFIGYDDLEFKTIAEDDGWISFSTGDIDTAEVVSEIMSQ
FT                   ENFVEQVTTNREMLEDQAADFYNDLLHEFTEKLDTDRYEDPKIELEFEFE"
FT   CDS_pept        complement(459474..460736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53385"
FT                   /db_xref="GOA:A4QAY8"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY8"
FT                   /protein_id="BAF53385.1"
FT                   /translation="MRYLTLATIIAGLSGFVVIIIAAWALGDSSQLSEEFTAYWGLFFA
FT                   GTGVLTGLTQETTRAVTAGRARGGVAGVSGASGASVGFRPFLFSFVVAAIVLVVLGASA
FT                   PLWIGQLLSELQGVGVGLLAVGLASYAIQATISGILSGCQLWKEYASLISLDTGVRMVL
FT                   AVVAWLLGYQLLAFLVITVVGSISWLVIVLCFGSVRSVLGSVADVSRGVFIRQALLAMA
FT                   ASGATAVLITGFPTLLKFTNPSAVAGGVSMAAVSYAVILTRAPLLVPLQQFQSAIIVRF
FT                   VKGTSGPLKTLAGPLAIVWAVGIVGAGLAWLAGPWILDVVLQKELFAVPGWLLAMLTLG
FT                   ATTTASLMVSGCAAIAFERHGIYLTGWVVATVVAVGFLLGPFDLGVAAGLALIVGPLCG
FT                   LLVHMGAFVGGARKERAVAAS"
FT   CDS_pept        complement(460736..462118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53386"
FT                   /db_xref="GOA:A4QAY9"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAY9"
FT                   /protein_id="BAF53386.1"
FT                   /translation="MIMRRLRSTPVPGTRDSYTGIDFNLGFHIRRYELDLTYRVAPNLL
FT                   MGTATLHMDNYRALDALTLDLGGSLRVEKVTAKGTAGTHIQVARFRHAGRKLRITFRNQ
FT                   IPVDQEFSLIIRYRGNPRPLRSEWGMIGWEELDNGALVAAQPCGAPSWFPCDDTPDEKA
FT                   LFDVHFHTDNGYAAIITGDFISKNVSGSMTTWHYQSREPMATYLAAVHVGEYDTVSLGV
FT                   SESGVVVEAYVPVGDAALRGRILADFAKQVDMLDAYEKLFGPYPFRSYRVVITEDELEI
FT                   PLEAQGLSSFGANHATGEGTWERLIAHELSHQWFGNSLGLAQWNDIWLNEGFACYAEWL
FT                   WFEAAGVKSAAESALEFYRGLEALPQDILLGDPGAHDMFDDRVYKRGALTVHALRVLLG
FT                   DEAFFKAVQAYVSEGRHGLVEPRDLKRHLYAVSTDHAALDAVWHSWLRDLELPEFPSGG
FT                   LD"
FT   CDS_pept        complement(462124..464139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53387"
FT                   /db_xref="GOA:A4QAZ0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ0"
FT                   /protein_id="BAF53387.1"
FT                   /translation="MTDYTFLEDIDTPEALAWAEKWSGESVEKLKSPDKDALEARLLAA
FT                   LDTDDRIAYVSRRGEKLYNFWRDAQHPRGVWRTTTLESYYSAQPKWDVLIDVDALAEAE
FT                   GENWVWKGAVVRSPERDLALVKLSRGGADATVIREFDLATREFVGADAFELSEAKSSVT
FT                   WIDADTLLVGTDTGEGSLTDSGYPARAVTWKRGTPIEQADVFFEGAREDVATHAWRDST
FT                   PGFERIFASRSLDFYNSETYLETADGLVLLEVPTDCDVIVKNQWLFVNPRTDYAGILAG
FT                   GLGVLELDAFLGGARDFAAVFTPSASTSLQGLATTKNFLVLTLLNNVSTEIVSVPLADP
FT                   VAEPTRMELPDHVTAHVVATSPLDGDEIWVQAASFTEAPTLLRTELPGALEAVKKAPLQ
FT                   FENAGQETRQHWATSADGTKIPYFITGNFAGTSAAQRKTLVHAYGGFEVSLTPSHSPTR
FT                   GIAWLEKGYYFVEANLRGGGEFGPEWHSQATKLNRMKVWEDHRAVLADLVERGYATPEQ
FT                   IAIRGGSNGGLLTSGALTQYPEAFGAAVVQVPLADMLRYHSWSAGASWMAEYGNPDDPE
FT                   ERAVIEQYSPVQAVVGVEKRIYPPALVTTSTRDDRVHPAHARLFAQALLDAGQAVDYYE
FT                   NTEGGHAGAADNKQTAFVESLIYTWIEKTLDQQGSI"
FT   CDS_pept        complement(464210..464623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53388"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ1"
FT                   /protein_id="BAF53388.1"
FT                   /translation="MAHAELSFGSSSFGSSGLSATRDKKAVEFENALEEFFITTGRTKT
FT                   DNAEAIADDYYQRAVNGELEFMEDMFFTDYIESERLYVVANSIPPERIDDEIAIIKQNT
FT                   SFLNPDGEKDTGAIGVRVDFENGHYYSVQVYVG"
FT   CDS_pept        464839..465144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53389"
FT                   /db_xref="GOA:A4QAZ2"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ2"
FT                   /protein_id="BAF53389.1"
FT                   /translation="MTVPEKLPEQLSEQVSDQPQQRNYVAIVALTLAVVGFVLACTPSA
FT                   VLVGLIALVIAFFIAIISLCIPGGPKRQGVYALVLSVVGFAVGVVKIMVILEDMMS"
FT   CDS_pept        complement(465346..465837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ3"
FT                   /protein_id="BAF53390.1"
FT                   /translation="MQNITRKIAALAIAGTLILPATAHAQSNFSAGSSSFDFGSSGPEE
FT                   PQVEPLEVRLEVAYERLIAANGHVLHADQELEATGLLNRAFAGEFEFVDGKFYVYDEEK
FT                   LTEYWIDLLTEEQAEEILDNIEADIKWAEENPEDSDKEFGLEVGKLGDYYYIAGVETYV
FT                   "
FT   CDS_pept        complement(466051..466533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53391"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ4"
FT                   /protein_id="BAF53391.1"
FT                   /translation="MRNIVSTVAATIIASSLLLPTTAVTASAQSSFSSGTFDLGMSHDS
FT                   DPVAVQLEKAFEDYGLSRGHSLDLNAEMRAELLLRSVIKGHTITRNGRYLQLDPASNTL
FT                   SSVSTVTPKEIQDFLEGINGGERIATSYFSGAPFRFGVAVGVKSGTYYLVTTKFTN"
FT   CDS_pept        complement(466641..466745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53392"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ5"
FT                   /protein_id="BAF53392.1"
FT                   /translation="MADFGVSVAQEGDLYYVAIVQKETSGGTGPIIGG"
FT   CDS_pept        complement(466875..467156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53393"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ6"
FT                   /protein_id="BAF53393.1"
FT                   /translation="MRNLTRKFVAFAVAGALLLPTAAVANAQSSFGFGSSSFDTGSSTA
FT                   DLPTTTRLEKGFERLGEAYGQKLNQTEEDKATELLQQALNNELPIIEG"
FT   CDS_pept        complement(467311..467787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53394"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ7"
FT                   /protein_id="BAF53394.1"
FT                   /translation="MKVSNKRLISTALSLSIIFAGTQGIAHAQSSFVSGSSSVETNINR
FT                   DAKSLRYTELYKKVFLALGHELNPLAQAKADDLLQRALRGELVFENGSYVEQNSPGIHY
FT                   ASVDQISSDDLDFELSLLEIVYADLEIYPNEDLIQIGVASGKDRQYYYIVHVAL"
FT   CDS_pept        complement(468140..468706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53395"
FT                   /db_xref="GOA:A4QAZ8"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ8"
FT                   /protein_id="BAF53395.1"
FT                   /translation="MTARVKMISMRKTIITMLATTAIAFSAISPVQAQTVDTDTDASVS
FT                   SELSSGTSSGSSEDSEDSDLSNRDIIFGVAAIAAVGGLIAGGVHWAVQQRMIPNPLPGI
FT                   IPNPPALAPQAPAPAPAPAPAPQAVAPQAVAPAPAPAPVQTNRTYKNCTEVWNVLGRSI
FT                   RQGEPGYGTHLDRDRDGIGCESRPR"
FT   CDS_pept        complement(469179..470390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53396"
FT                   /db_xref="GOA:A4QAZ9"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAZ9"
FT                   /protein_id="BAF53396.1"
FT                   /translation="MCIEGSRFCHLYCLVILGSLFSTGSRIGFCETIPVEERLVAEITT
FT                   PLMEKIRSPAVQSDALQVFKSALAATITWWISVNLLHSQLPFLAPWVALMTMQFTVYHT
FT                   FISGIQTAIASAIGVGLSFVIGTYLDVNVWTFGLAMVIGLIGARVPKLRAEGIGIATTS
FT                   IFLLASGFDDQQPLLYDRILEILLGVAVAIAINLIIFPPLRDREANMVVESLDRRMGEV
FT                   LKKMADELAEKWNIDNADEWLEEIHSINNDLEKAWHSVRFARESRRVNPRKIRIRGGRP
FT                   QPTETSYESNLTRIDEGIAHLRHLARTLRDTPNIDSDWDPVFQKQWVSLMHDAGALLAD
FT                   RNQEIDPIRDRLSKLSSEMSEDQQLTSKKWPIYGSLLTSLFHLSALVDDAVTTRKAEDK
FT                   EHNS"
FT   CDS_pept        complement(470422..471519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53397"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB00"
FT                   /protein_id="BAF53397.1"
FT                   /translation="MKLLRRIAAPAIALGIAMSTIVTPSTAGAAEVTPADVAGNTPLST
FT                   ISDSAPADEASAPRWRAYVNEADDRVKEMWAYSPSMDRNVPLVVITADESAGPRPVIYL
FT                   LNGGDGGEGAANWVMQTDALDYYLDKNVNVVIPMEGKFSYYTDWVEENANLGGKQMWET
FT                   FLVKELPGPLEEKLNTDGQRAIAGMSMSATTSLIFPQHYPGFYDAAASFSGCAATSSLL
FT                   PWEYLKLTLDRGNATPEQMWGPRGGEYNIYNDALINSDKLRGTELYVSNASGLAGEWES
FT                   VDSPRFEGLNQQVQSVAMAETVITGGIIEAATNKCTHDLKAKLDSAGIAADWNLRPTGT
FT                   HSWGWWQDDLRGSWDTFARAFELEA"
FT   CDS_pept        472085..473281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53398"
FT                   /db_xref="GOA:A4QB01"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB01"
FT                   /protein_id="BAF53398.1"
FT                   /translation="MRKPKIMTVYGTRPEAIKVAPVIKALEQDERFESVAVSTGQHKEM
FT                   LDQVNEMFSIKPAYDLGLMNKVSTLSGVVSKALEGLDEIIEAENPDVIISQGDTSTAMS
FT                   AALAGFHREVKIVHLEAGLRTGNIHSPFPEEANRRIIGQVSELHLAPTEISRENLRREN
FT                   FRSADTVVVGNTVIDALLEAATWETTFEDQRLNDLVESDQRIVLVTTHRRENLTAMSEI
FT                   GGAVQQLAEAYPDVIFALPLHLNPKVRDMVLPKVDALPNVIITDPLPYDQFTKLMASST
FT                   LVLTDSGGVQEEAPAFGKPVLCMRENTERPEAVLAGTVKLVGTNQARIITETRLLLDDP
FT                   TAFSAMAQAINPYGDGKAAKRSVAAIAALLGVGERLPDFQPEKPIEPGLDEPRLSDQL"
FT   CDS_pept        474507..474755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53399"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB02"
FT                   /protein_id="BAF53399.1"
FT                   /translation="MANGIHITGVVKGETASLIKELNCGVVVDPEDPEALALSWKRLLN
FT                   DRSQLQVSDTAREWVVTQRDEVVPQELYAFLSKLGIE"
FT   CDS_pept        474752..476251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6016"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6016"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21078"
FT                   /db_xref="GOA:A0A0B6VK10"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK10"
FT                   /protein_id="BAQ21078.1"
FT                   /translation="MKRIIFLITAVISYLWLDWRGFMKKLGERARLSNLKIPKFLFPAE
FT                   SISISPAHQLVELGELSKAQEYLAAKGKLTISERKLKNRVTQTLFELGLKPVEVTEKIP
FT                   SKKGVKALYFLTNSLPFTTSGYTKRSQSLMEAVAENGVVIHAATRLGYPLTIGKWPKSS
FT                   TYLLGGIRYHNIFPWVFSRSPAKRYGKTIELLARLAVDLGVTVIHTTTNFPNAIVANRV
FT                   AAKLGLPWIYEVRGELESTWLSKLPKDKQRSAEKSEYYQLARAQETNYANAANAVVVLS
FT                   EISKSQLIRRGITPEKIFVIPNSVEQKLFDKEYDKSALREKHGIAEDAVVVGTVSSIVG
FT                   YEGLDTLLRALVSLPDQYRGLIVGDGVDRPRLENLAKSLGVNSRLDFVGNQNPQTIDEW
FT                   YKLLDIFVVPRKDTAVCRTVTPIKALTAQALGIPVITSDLPALREVTGGVESYAIPEDS
FT                   RDLMEKIIAIKPHSQGVEWAASRTWNQAAKKLVQIYRGITS"
FT   CDS_pept        476622..477506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6017"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VMA9"
FT                   /protein_id="BAQ21079.1"
FT                   /translation="MQTSGPKILIYGSCVTRDIQRISDDRFRVLDYIARQSFVSANSPS
FT                   LPDPDTSAIAGKFLARAIASDFASNAFERIISNIRKSDVLLIDLASERHGVVPYQNSLI
FT                   SRTNDLAKSGLLTPREFNKHIAFDTPEHRKKFRAAAIKLKEELMREKAFRKTLVIATPF
FT                   TDVTSDGSKMPLSRGKTAEMINNEYAYYYELLRNMGFAILTLPDELCVASPSHKWGISQ
FT                   NHYVSEAYEYLADQIELFMAEPVVAKRVFKALNSGRIFRIEVKHENLEKEILCPKMTKI
FT                   KNWIRIKKQGNLK"
FT   CDS_pept        477470..478354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6018"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6018"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21080"
FT                   /db_xref="GOA:A0A0B6VPP9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VPP9"
FT                   /protein_id="BAQ21080.1"
FT                   /translation="MDTDQKTGQPKIVTIVVDDSDLAPLDGKPRLGQYCANLWRSRSFI
FT                   RTHALTKVHKNSRDRYLGNLWVILDPIFQVSIYALIFGLILKVDRGMSNFVGFLVIGVV
FT                   FFGIFSSGITGGSNLIQNSRSLITSFTFPRIAVVTSGIVKLFLDNLVPCLLAVIIAIAF
FT                   QWGEPIHWSVIFVIPLYLLAHLFAFGTTAIIARITAFIPDFRSVVTLLSRGLFFLSGVF
FT                   FEISRFDASPLLQSIVESNPIYQFLKAFRSCIIDGSIPGISSWVFLTVWSVSIATFGFI
FT                   FFYLAEERYSVVK"
FT   CDS_pept        478344..479201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6019"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6019"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21081"
FT                   /db_xref="GOA:A0A0B6VR89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR89"
FT                   /protein_id="BAQ21081.1"
FT                   /translation="MLNKPTVMVRNLSKTYSVGKNGSERSIFQRSNRIRVEALKDVSFV
FT                   TYTGESIGILGRNGSGKTTLLNLIAGNETASNGEILVSAQPTYLGVSAALQNHLSGAAN
FT                   VRLGLLAMQLSREEVLAKEEQVLEWAELQEASDRPLRTYSSGMRARLQFAISTAVKREI
FT                   LLVDEALSTGDSTFSAKARNRMNEFLEESGTVFIVSHAPGTIERYCKRSIWLHKGEIIA
FT                   DGRTRMVTKYYRQWAEREAKGNFRGAEIVIENMKLRYEPKNLILASEEKTVFGNTELKS
FT                   SHSQ"
FT   CDS_pept        479268..481928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6020"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21082"
FT                   /db_xref="GOA:A0A0B6VIC7"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VIC7"
FT                   /protein_id="BAQ21082.1"
FT                   /translation="MNRPIPESGSLFVHYANQQASLKVTREFLSSGLVALKDSSKTDLS
FT                   NGSAWRSDVSRADGREAHSWFFARPWYSAESELTEDEKTTLSQKIEQAIDTWTEHAEDE
FT                   ASMAFHDETTAQRAMVFTALLFAFQKSFSRETKTKLLTVLNRDIDLLESDSFYAGLNNH
FT                   GMFQDVALLVAVDYGYASKKAKLLEDKAFGRLEQYFSKSFTADGIHTENNPTYHVMVAR
FT                   YLSRVIAFAETRGRSGQFKDLKNLMGKADLYAAFAVTPFGDFPPISDTNLQRLNALSAR
FT                   ATFDEGYLLGVLTNGKEGTIPTSRVYVAEDSGYGIARSGWTSTEDTYLFFNAAYNADYH
FT                   KHSDELSVYFSSRGFELLTEAGPNGYQYNDPFTKYAFSSFAHNTLVVDGEGLPRTDGNA
FT                   HLTELTDQGSSFSKLNVTGRTQRFDGVDWTRSVTLDVDSPEEGDLQISDAISSDQRHTY
FT                   KFCWHIGSEIIPYVRGSFIEFYSKNTQEKIAEMEWTGETASTIHVVNGQRHPRVQGWQF
FT                   PLMGEKTPTYSVEIEFEGRSISVEWTLRVNDFVLRNHGMNPFNPEWKTFYGEKPVHYLL
FT                   EMPDNNQNPESLAIVFSGVNSVGDFPLNYRESFASFKGAVLYVLDDFGRQGTYYLSSSR
FT                   NLAEFRAVQGLLKSVISELGITTDEVTTFGYSKGGTSALLHGVTLGVSDVFAGAPQYLI
FT                   GNFLKKSYSEVLQYISGGVSKGDIHWANKIAQNILSSAVRSTQIHVVVGLADSHYREHA
FT                   IPLIDDARSLGYQAKLLTIPGATHSEFRTCFREIIRTWIEADVSEEEFLVPYTVGFDSG
FT                   KKLFGVCLALPIGARARGQLFYGSERVGSVRAFTGSSASWEISEPGPYRIRIYVDLPNG
FT                   AERKAFGTSRRQLRW"
FT   CDS_pept        482091..483905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6021"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21083"
FT                   /db_xref="GOA:A0A0B6VK13"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK13"
FT                   /protein_id="BAQ21083.1"
FT                   /translation="MSYLAPVLSRGFVQTANASEAVVHSTTNHVAPSRGRYQVVSVQGF
FT                   ASLFGVPFTSADELALILNGRIDSPEQLVKELRGTATITLRETDTGAFYVITDMYGAGK
FT                   IFIWQDSVRWAVSSSVKDLVSFLNQNGIKAKKSIENAGLLGFVGYGGGAISSPYEDILC
FT                   VDQFKYVIVAANGKLNQRDYSFKEELVGPSAPNSSNQEDLLQSVAIEIRRNTSVFSSYK
FT                   AESYICHLTGGLDSRVVFAALVGTPYKDQYSTFTYGLEESPDMVIARRLTAEFGLTAST
FT                   YSGMRYSVVPQDPALQVLWSLNQTGGMTSLGPASIGGYPRPDSVVLAGGWGEMYRGGYP
FT                   DFVSADASHEEKIKWVVNWVLRSGSPYGPRISYDGLFSDAMVQRARDFGQLMLSEIQHL
FT                   EIGDELLAEWMYLRWSTRFNVGEITRTCLPFTHRADPLCVPEMMKLVYATPFSDRKNGN
FT                   LELDLVKALYPGMESYPYDKDYLTEDYLRTRGISDVASFDESLPLEIKWHFDDKPHYLE
FT                   AITPVARPTQAQKAEALRVKMPLRFIVRAEENRRRIQNYVRDVPEEMSQVFNLKNLKNV
FT                   TDRNPKTRPEYRRLETLNSALSWYFEQE"
FT   CDS_pept        485113..488796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53400"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB03"
FT                   /protein_id="BAF53400.1"
FT                   /translation="MYTVHSTPIFNSNGYSTRTRGVAEGMKKQGGDVVVVARSGYPWDS
FT                   SVDIKKPAQKRYSESLNGVTYVHTPGGNLNRDGLDSYVLKAADTFVREAKLLRPSVIQS
FT                   ASNHRTALPALIAARRVGVPFVYEVRGLWEITEITKRPSLKGSERFNAQVQLETLVASE
FT                   ADAVLAITEQVADELVSRGVPREKIHVVPNAVDPHEFMPLPADLEYAVSKKLDTQIPTI
FT                   GFAGSIVEYEGLDTLVQASWLLNQKKIAHQVVVAGSGESEAALKEKVAKLKLNNVHFLG
FT                   RLPQSEIPRLMSTFDIVACPRLSNEITELVSPLKPLESFASGKPTVLSDVQPNIDLAGK
FT                   EMSRARLFNSGNAEDLAEVIASLIKDRQSATEMARQARLWVVRSRQWNMIGKMMLEQHL
FT                   IAAERFAESALVGKPVHGLKVGLISDDFTAATLSGTFDVEKIGRATWRDQIQATSFDLI
FT                   FVESAWEGNDTEWHRGVGYYSDEESADLRGMLSLAKEEGIPTVFWNKEDPVHFSRFAPN
FT                   AVLFDHVATTDANLIEKYFNFPGAVLKTVSALPFYAQPSIHNPLRVEREIHNTVAYAGT
FT                   YYGERYAERSKDLEKLLNAALPHGLEIYDRQADNPDSPYKFPSRYEKSVRGAIPYQEVV
FT                   ESYKTHLAHLNVNSVTNSPTMFSRRVIEIPASGGLVLSSEGRGILESLGSTIAVSNDAD
FT                   DHKAFLHSWVTDPEARLQEIWLQMRTVYRAHTTETALTILCRTMGMPVSPSVSVTYGVS
FT                   VDYLDSKVAASILKQSVLPSIILANSVELDAVEQLHSSGIRVIDSDEEVKQEVDYLGKW
FT                   MPECHRTYFEDLLFSSAFGDWDFIRPVLGEFDPAEDFIAEEISGVIQETDLVKLSRAST
FT                   EINRGVALHLPSRTNETVKRLSVDDFDEPSKLAPGTRVLIAGHDLKFASFLIDELESHG
FT                   IQVDIDKWSGHAKHDEKVSLEKLASADVVFCEWGLGNAVWYSKHLQDHQRMVVRVHLQE
FT                   LTLPYLRKINHSKVNKYLFVGELIRQSAIVSHGIPAQLTTVIPNAVSVAKLKIPKVAAA
FT                   RFRIGIVGIVPQRKRLDSALDLLERLQKEDDRYHLRIKGKLPSDYPWMKDRKEEFAYYE
FT                   EQFNRIEAMNQNQPGSVIFDDFGPDMSDWYSKVGIVISVSDFESFHLTIADGAASGSLP
FT                   VSIAWDGADLIYPDEWLVSNIDEMAEVIRSWNGKDNGYSQFIKDNFESDLVADRILTLL
FT                   AG"
FT   CDS_pept        complement(488902..490158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53401"
FT                   /db_xref="GOA:A4QB04"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB04"
FT                   /protein_id="BAF53401.1"
FT                   /translation="MTNQTVAFVGLGYIGLPTAVVMANSGVDVTGVDVNEKNVERINRG
FT                   EVTIVEPGLEEELKQAIESGNFRATTTQVHAQTYIIAVPTPFTDDYGVDMKYIYSAAEA
FT                   IAPKLEGNELVILESTSPPLTTKKMADKILELRPDLVADGAENPEGKPVIYFAHCPERI
FT                   LPGKAMEELRTNDRIIGGQTEEATKRATAVYATFCEAELLPTNDVTAEMAKLTENSFRD
FT                   VNIAFANELSLIADNLDINVWELIELANHHPRVNILQPGPGVGGHCIAVDPWFIVSSDP
FT                   QNSRLIRTAREVNDGKPKWVIDKVAEALNGYQTGAKIATLGMAFKADIDDLRESPALNI
FT                   TKELANRFVDQTILAVEPNVSKLPTDLEGIKNITLTAYDQAIADADIVVLLVDHHEFKG
FT                   VSAAQLKDKTIIDTKGLWV"
FT   CDS_pept        490598..490711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53402"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB05"
FT                   /protein_id="BAF53402.1"
FT                   /translation="MYQIFEQILFAINEILGYGLHAGSSASSNLSHGLGLF"
FT   CDS_pept        490847..492256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53403"
FT                   /db_xref="GOA:A4QB06"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB06"
FT                   /protein_id="BAF53403.1"
FT                   /translation="MTEHYDVVVLGAGPGGYVSAIRAAQLGKKVAVIEKQYWGGICLNV
FT                   GCIPSKSLIKNAEVAHTFTHEKKTFGINGEVTFNYEDAHKRSRGVSDKIVGGVHYLMKK
FT                   NKITEIHGLGNFKDAKTIEVTDGKDAGKTVTFDDCIIATGSVVNTLRGVEFSKNVVSFE
FT                   EQILDPVAPKKMVIVGAGAIGMEFAYVLGNYGVDVTVIEFMDRVLPNEDAEVSKVIAKA
FT                   YKKMGVKLLPGHATTAVRDNGDSVEVDYQKKGSDKTETLTVDRVMVSVGFRPRVEGFGL
FT                   ENTGVKLTERGAIDIDDYMRTNVPGIYAIGDVTAKLQLAHVAEAQGIVAAETIAGAETQ
FT                   ALGDYMMMPRATFCNPQVASFGYTEEQAKQKWPDREIKVASFPFSANGKAVGLAETDGF
FT                   AKIVADAEFGELLGGHLVGANASELINELVLAQNWDLTTEEISRSVHIHPTLSEAVKEA
FT                   AHGISGHMINF"
FT   CDS_pept        492413..493336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53404"
FT                   /db_xref="GOA:A4QB07"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB07"
FT                   /protein_id="BAF53404.1"
FT                   /translation="MSLPIDEHQNAVKTVVVPAAGMGTRFLPATKTIPKELLPVVDTPG
FT                   IELVAKEAADLGASRLAIITAPNKDGILKHFEPFPELEATLEARGKTDQLNKVRAAREL
FT                   IDTVPVVQEKPLGLGHAVGLAESVLDQDEDVVAVMLPDDLVLPFGVTERMAEVRAKFGG
FT                   SVLAAIEVAEDEVSSYGIFELGDLDAESESEGIRRVVGMVEKPAPEDAPSRFAATGRYL
FT                   LDRAIFDALRRIEPGAGGELQLTDAIALLIEEGHPVHIVVHEGKRHDLGNPAGYIPAVV
FT                   YFGLRHAEYGSRIHRAVKEILAEFES"
FT   CDS_pept        493385..493906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53405"
FT                   /db_xref="GOA:A4QB08"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB08"
FT                   /protein_id="BAF53405.1"
FT                   /translation="MQLKSGFMAKKVDTSNATPALALLTEKQIPFELDVHDVDPKSLKG
FT                   FALDASEVMGVEPEVVFKTLMADIDGEHVVAIVPASSTLNLKQLAKAGKGKHANMMDRS
FT                   RAQVVTGYVPGGISPIGQKNKHRVFLDESAILQDRIYVSAGRRGWSLIIAPDDVLLATD
FT                   GVYADIADHS"
FT   CDS_pept        complement(494025..495449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53406"
FT                   /db_xref="GOA:A4QB09"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB09"
FT                   /protein_id="BAF53406.1"
FT                   /translation="MGKTYVGSRLRQLRRERDLSQASLAATLGLSASYVNQIEHDVRPL
FT                   TVPVLLRITEAFGVDATFFSRDDDSRLLAEVQDVMLDREINPANVELQELSEMVYNHPQ
FT                   LARAMVEMHQRYRNVRDKLSIAVDNRTNTPEERRPIAEAVSMPHEEVRDFIYARQNYFD
FT                   ALDRRAEAIAAQLGWQPYDSRAMEDSIARRLQMDHDVTITSSKEESGTLHHFDPETRLL
FT                   TIHARLNPGQRAFRMATELGYLEANDLIEGIVDDGIWSTPEARTLAIRGVASYFAAAVM
FT                   LPYKIFHAEAEKSGYDIEYLGQLFGVGYETTAHRLSTLQRPNLRGIPFTFVRVDRAGNM
FT                   SKRQSATGFHFTHYGGTCPLWNVFETFTNPGQVLRQFAQMPDGRNYLWISRTVRHHEAR
FT                   FGEVDKMFAIGLGCEARHADRTVYSRGFNLQDLSTATPIGSGCRVCTRENCAQRAFPSV
FT                   HGRINIDAHESTIAPY"
FT   CDS_pept        495946..496719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53407"
FT                   /db_xref="GOA:A4QB10"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB10"
FT                   /protein_id="BAF53407.1"
FT                   /translation="MTVRNPDREAIRHGKITTEALRERPAYPTWAMKLTMAITGLIFGG
FT                   FVLVHMIGNLKIFMPDYAADSAHPGEAQVDVYGEFLREIGSPILPHGSVLWILRIILLV
FT                   ALVLHIYCAFALTGRSHQSRGKFRRTNLVGGFNSFATRSMLVTGIVLLAFIIFHILDLT
FT                   MGVAPAAPTSFEHGEVYANMVASFSRWPVAIWYIIANLVLFVHLSHGIWLAVSDLGITG
FT                   RRWRAILLAVAYIVPALVLIGNITIPFAIAVGWIA"
FT   CDS_pept        496736..498757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53408"
FT                   /db_xref="GOA:A4QB11"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB11"
FT                   /protein_id="BAF53408.1"
FT                   /translation="MSTHSETTRPEFIHPVSVLPEVSAGTVLDAAEPAGVPTKDMWEYQ
FT                   KDHMNLVSPLNRRKFRVLVVGTGLSGGAAAAALGELGYDVKAFTYHDAPRRAHSIAAQG
FT                   GVNSARGKKVDNDGAYRHVKDTVKGGDYRGRESDCWRLAVESVRVIDHMNAIGAPFARE
FT                   YGGALATRSFGGVQVSRTYYTRGQTGQQLQLSTASALQRQIHLGSVEIFTHNEMVDVIV
FT                   TERNGEKRCEGLIMRNLITGELTAHTGHAVILATGGYGNVYHMSTLAKNSNASAIMRAY
FT                   EAGAYFASPSFIQFHPTGLPVNSTWQSKTILMSESLRNDGRIWSPKEPNDNRDPNTIPE
FT                   DERDYFLERRYPAFGNLVPRDVASRAISQQINAGLGVGPLNNAAYLDFRDATERLGQDT
FT                   IRERYSNLFTMYEEAIGEDPYSSPMRIAPTCHFTMGGLWTDFNEMTSLPGLFCAGEASW
FT                   TYHGANRLGANSLLSASVDGWFTLPFTVPNYLGPLLGAERLAEDAPEAQAAIERAQARI
FT                   DRLMGNRPEWIGDNPHGPEYYHRQLGDILYFSCGVSRNVKDLQDGIDKIRALREDFWKN
FT                   MRITGSTDEMNQVLEYAARVADYIDLGELMCVDALDRDESCGAHFRDDHLSEDGEAERD
FT                   DENWCFVSAWEPGKNGTFVRHAEPLFFESVPLQTRNYK"
FT   CDS_pept        498757..499506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53409"
FT                   /db_xref="GOA:A4QB12"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB12"
FT                   /protein_id="BAF53409.1"
FT                   /translation="MKLTLEIWRQAGPTAEGKFETVRVDDAVAQMSILELLDHVNNKFI
FT                   EEGKEPFAFASDCREGICGTCGLLVNGRPHGADQNKPACAQRLVSYKEGDTLKIEPLRS
FT                   AAYPVIKDMVVDRSALDRVMEQGGYVTINAGTAPDADTLHVNHETAELALDHAACIGCG
FT                   ACVAACPNGAAHLFTGAKLVHLSLLPLGKEERGLRARKMVDEMETNFGHCSLYGECADV
FT                   CPAGIPLTAVAAVTKERARAAFRGKDD"
FT   CDS_pept        499556..499894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53410"
FT                   /db_xref="GOA:A4QB13"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB13"
FT                   /protein_id="BAF53410.1"
FT                   /translation="MNTMSSAKKKPAPERMHYIKGYVPVAYSSPHSSLERSATWLGMGF
FT                   LLTALAGVGAVLFAVGANSVGQQQEHWVLYSIIGVVFAVVCTVLGTVLIMKGRAPYNRY
FT                   VKETGRTQ"
FT   CDS_pept        500065..500946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53411"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB14"
FT                   /protein_id="BAF53411.1"
FT                   /translation="MKKYAVAALALLTLAGCSTSEEVAVSSDSAPQRIVIAQANFLDLA
FT                   LALDLEPVGTTYWGGAGGVQDYLLDSVPASMEVVGNDDEPNFETVAKLQPDLIIGDEEI
FT                   ETNLAKYEAIAPVSIIKSVDDNGSNSWRDQLTALAELTGTQEKAAAVIEEADKSVASLD
FT                   SKITSPGEKTMLLRIREEQVRQYFPDSFVGAGVPQRLQNITLVESAVPSENGQWSVIPP
FT                   ENIGLLDADRIIAFIDSPQALENAESNPLWRQLPAVKNGQLCTTENLTPWILTGPAAAE
FT                   IVTSDLEACFAA"
FT   CDS_pept        complement(501405..502448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53412"
FT                   /db_xref="GOA:A4QB15"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB15"
FT                   /protein_id="BAF53412.1"
FT                   /translation="MTAQMWGIHNDKLTHELVDQGFISIGWDGAPNLGSIPSNRETVKR
FT                   ILSSAYTEASPRSISSQAGVVYRFAHVVAINDIVIAPEKSNSTINIGVVTGEYYYEADA
FT                   PIHKHRRPVRWVKTGIPRAVFSQAALYTLGSMLTLFQINRNTEEFLTVMNSTTDDADAI
FT                   AETIDVLRAPIEEADPVDEQEPEQPRASTITQYTRDFILDILTSKITPREFEELSAALL
FT                   RAIGYEARVTQYSQDGGVDVIAHKDPLGIEPPHIKAQCKQRISTIGAPEVNQLIGTLGN
FT                   GELCLFFTLGGYSKDAQSIERLQSGLRLLTGDDIVDLIMNNYDNLPERWRRTIPLSPVL
FT                   VVADKAE"
FT   CDS_pept        complement(502499..503476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53413"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB16"
FT                   /protein_id="BAF53413.1"
FT                   /translation="MPALSLGRVRALRLISQLLAPSAALKMKPERNAVDVAKHMLASQA
FT                   QQRGSALVALDARAENADAATAVEQSLLIRSWTQRGTHQILAAEDVRWMTLLCSPRILA
FT                   ASAKRRPSLSLDSAAVQRARDALATAAEKSPVSRTQAYEIFRSADVDPGENRGQHLLRH
FT                   FGGEGDIVQGPPINGEDSFVLLDSICPLSLALTGDEALTEMTRRYFYSRGPATQKDLVW
FT                   WTGLTVRDVKKGIAAVSAEGSIAAVQGPNGEEMWIPTWAQDVTETEVNDALALELTLPA
FT                   FDEYLLSYTDRSHVMDPEHLFSIGPGKNGVFKPFKVIHGEALPV"
FT   CDS_pept        503548..504852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53414"
FT                   /db_xref="GOA:A4QB17"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB17"
FT                   /protein_id="BAF53414.1"
FT                   /translation="MGKHEVAQQTVPGPSPEMEAQRRKELRKHKAIATGLLIFAAAVYF
FT                   LCRFVETRPGETAAWVGFVRAAAEAGMIGGLADWFAVTALFRHPLWLPIPHTAIIPRKK
FT                   DQLGEALSGFVGDNFLNAQLITEKVSQAQIPERAGEWLAQPENGEKVSREVGKLTANIV
FT                   RAIDPSDAEAVIKSAVIDKLAEPTWGPPAGRLLEQLLAEGKAEPVVQELAQWLHKKALG
FT                   SEPLIDRLLNERRPIWAPKFTAQLVSGKVYGEVIKFTEAVAADPNHEARKSLRRFLNKL
FT                   AQDLQHDPGMIIKVEEIKRDIMGSGAIAQAAPTIWASASESLIESAEDESSILRRKIAE
FT                   AATSWGQRLLVDDSLRHSLDTRLTAAAAFLADNYAPEVTGIISETIERWDAEEASEKIE
FT                   LMVGKDLQYIRLNGTIVGALAGLAIYAISHILFGA"
FT   CDS_pept        504868..505290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53415"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB18"
FT                   /protein_id="BAF53415.1"
FT                   /translation="MSDAKDDSILSKWSNAASELSGAVSGVAKKLREELSEKETFSKLK
FT                   TEASEAVDQAKSGSYLDAGKEFARDAGSIIKDAAKTVKGAVSDSDKNDVKSAFGDAVEA
FT                   SRDKFDDTLEKHKAKKDSPEPGDDDIIDGEVIPPQN"
FT   CDS_pept        505309..505614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53416"
FT                   /db_xref="GOA:A4QB19"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB19"
FT                   /protein_id="BAF53416.1"
FT                   /translation="MDISMLNVITSYTVWAIFAIIGICGFVGAFLAATTREDAFEVADR
FT                   QKKIVWVAILIASGFVLTVLGPSIPILPWVAIIMIGLYWFDVRPQIKSILEGAGGW"
FT   CDS_pept        505767..506420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53417"
FT                   /db_xref="GOA:A4QB20"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB20"
FT                   /protein_id="BAF53417.1"
FT                   /translation="MDIEEQPSLRETKRQKTLEAIEDNATRLILERGFDNVTVEDICAE
FT                   AGISKRTFFNYVESKESVAIGHTAKLPTDEEREGFLATRHENIIDTVFDLVINLFGNHD
FT                   NSKSGVAGDIMRRRKEIRVKHPELAVQHFARFHQAREGLEHLIVEYFEKWPGSQHLDEP
FT                   ADREAIAIVGLLISVMLQGSREWHDMPQGTQADFQACCRKAIKNTFLLRGGFSE"
FT   CDS_pept        506417..508066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53418"
FT                   /db_xref="GOA:A4QB21"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB21"
FT                   /protein_id="BAF53418.1"
FT                   /translation="MTSQVKPEDERPVTTISKSGAPSAHTSAPYGEAATKEAVEEKTTG
FT                   RVGFIIAALMLAMLLSSLGQTIFGSALPTIVGELGGVNHMTWVITAFLLGQTISLPIFG
FT                   KLGDQFGRKYLFMFAIALFVVGSIIGALAQNMTTLIVARALQGIAGGGLMILSQAITAD
FT                   VTTARERAKYMGIMGSVFGLSSILGPLLGGWFTDGPGWRWGLWLNVPIGIIALVAIAVL
FT                   LKLPARERGKVSVDWLGSIFMAIATTAFVLAVTWGGNEYEWASPMIIGLFITTLVAAIV
FT                   FVFVEKRAVDPLVPMGLFSNRNFVLTAVAGIGVGLFMMGTIAYMPTYLQMVHGLNPTQA
FT                   GLMLIPMMIGLIGTSTVVGNIVSKTGKYKWYPFIGMLIMILALVLLSTLTPSASLALIG
FT                   LYFFVFGFGLGCAMQILVLIVQNSFPITMVGTATGSNNFFRQIGGSVGSALIGGLFISN
FT                   LSDRFTENVPAAVASMGEEGAQYASAMSDFSGASNLTPHLVESLPQALREAIQLSYNDA
FT                   LTPIFLALTPIAVVAAILLFFIREDHLKETHE"
FT   CDS_pept        508066..509700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53419"
FT                   /db_xref="GOA:A4QB22"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB22"
FT                   /protein_id="BAF53419.1"
FT                   /translation="MTHETSVPGPADAQVAGDTKLRKGRAKKEKTPSSMTPEQQKKVWW
FT                   VLSALMVAMMMASLDQMIFGTALPTIVGELGGVDHMMWVITAYLLAETIMLPIYGKLGD
FT                   LVGRKGLFIGALGIFLIGSVIGGLAGNMTWLIVGRAVQGIGGGGLMILSQAIIADVVPA
FT                   RERGRYMGVMGGVFGLSAVLGPLLGGWFTEGPGWRWAFWMNIPLGIIAIGVAIYFLDIP
FT                   KKSVKFRWDYLGTFFMIVAATSLILFTTWGGSQYEWSDPIIIGLIITTIVAAALLVVVE
FT                   LRAADPLVPMSFFQNRNFTLTTIAGLILGIAMFGIIGYLPTYLQMVHGINATEAGYMLI
FT                   PMMVGMMGTSIWTGIRISNTGKYKLFPPIGMIVTFVALIFFARMEVSTTLWQIGIYLFV
FT                   LGVGLGLAMQVLVLIVQNTLPTAVVGSATAVNNFFRQIGSSLGSALVGGMFVGNLGTLM
FT                   EERMPAAMAQLSPEEQAAMAAQGGLDSNELTPAIVNQLPTALHDAFAGSYNDALIPVFY
FT                   VMMPLIGIALLLLLFIKQEKLRETTTD"
FT   CDS_pept        complement(509773..510687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53420"
FT                   /db_xref="GOA:A4QB23"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB23"
FT                   /protein_id="BAF53420.1"
FT                   /translation="MTPSSPEVRNRPSTAPEERQFVLTFGCPDSTGIVAKLSSFLAERG
FT                   GWITEAGYFTDPDSNWFFTRQAIRAESIDTTIEQLREEFAPLAEEFGPRAKWSFTDTAQ
FT                   VKKAVLLVSKEGHCLHDLLGRVAENDYPMEVVAVVGNHENLRYIAENHNVPFFHVPFPK
FT                   DAVGKRKAFDQVAEIVNGYDPDAIVLARFMQILPPDLCEMWAGRVLNIHHSFLPSFMGA
FT                   RPYHQAYSRGVKLIGATCHYATGDLDDGPIIEQDVIRVTHKDTPTEMQRLGRDAEKQVL
FT                   ARGLRFHLEDRVLVYGNRTVVFD"
FT   CDS_pept        510742..511416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53421"
FT                   /db_xref="GOA:A4QB24"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB24"
FT                   /protein_id="BAF53421.1"
FT                   /translation="MDMTISRATMAQILDYTLLGPEVTNSELAAFIDSAIELGVGTICV
FT                   PNSMVNLTAKAQEAGIRVATVAGFPHGKTPALVKAAEARLAVQSGASEVDVVLDIAVVK
FT                   EGDANRLLQEIVAIREAVPSPVVLKFILETAVVSDDAIVTAVNALIAAGADFAKTSTGF
FT                   HPAGGATVEAVRVMASASRGRVGIKAAGGVKTWEDAVAFVEAGATRIGTSNAGAILEGA
FT                   PE"
FT   CDS_pept        511667..512512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6022"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21084"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VMB5"
FT                   /protein_id="BAQ21084.1"
FT                   /translation="MKPVTYSELSDQMTRRQFHQKYSRVVGSIYIDKKFVDDPIAIVDA
FT                   LLRRFPEGVIRGFAGLHLRGFKLLDEGWVPEISIPQNSSNVATVIGKAIRRKAPEVYFV
FT                   KDRRTVSVQQAIKDVLVKMEFEQQIALLDFLVRQNPRLYAILEESREFKGTLEWVSHFA
FT                   ESRPESILRVRIRQAGILGFEPQVGVSVGGHMRFVDLGNAELQVGLEYLGAVHFDNAEK
FT                   RAQDSDRQNELRAVGWVLIEVTWRDLKEHARWLDLVKKLKFQIREAEKLRNARLPFRPY
FT                   "
FT   CDS_pept        complement(512499..512801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53422"
FT                   /db_xref="GOA:A4QB25"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB25"
FT                   /protein_id="BAF53422.1"
FT                   /translation="MSNSECHTHGYIEEKQRYLARLKRIEGQTRGIHRMIDEEQYCIDI
FT                   LTQISAVNSALKNVAFGLLDDHLAHCVKEAADLGGDELDAKLKEVSDAIARFSKA"
FT   CDS_pept        complement(512801..515068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53423"
FT                   /db_xref="GOA:A4QB26"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB26"
FT                   /protein_id="BAF53423.1"
FT                   /translation="MAQTPAKIPAALNFIDVDLGVTGMTCTSCSARVERKLNKLDGVEA
FT                   TVNYATESAQVSYDPSKVSPEQLIKTVEDTGYGAFTMASAAAESEEDNAPADSGQSRID
FT                   AARDHEAADLKHRVIVSALLSVPVVLVSMIPALQFNNWQWAVLTLVTPIFFWGGSPFHK
FT                   ATWANLKHGSFTMDTLVSLGTSAAYLWSLWALFIGNAGHPGMKMEMHLLPSASTMDEIY
FT                   LETVAVVITFLLLGRWFETKAKGQSSEALRKLLDMGAKDAVVLRNGAEVRVPVNQLKLG
FT                   DVFITRPGEKIATDGEVVEGSSAVDESMLTGESIPVEVTKGSKVTGATLNTSGRLMVKV
FT                   TRIGADTTLSQMAKLVTDAQSKKAPVQRLVDQISQVFVPVVIVIAIVTLIAHLVFTDAG
FT                   LAPAFTAAVAVLIIACPCALGLATPTALLVGTGRGAQLGLLIKGPEILESTKKVDTIVL
FT                   DKTGTVTTGTMSVTDVTAINYSETEILEFAAAVESASEHPIAQAIAKATDHEQVTDFQN
FT                   TAGQGVTGVVRGHEVRVGRPSSTLIDALLHPFQHAQKIGGTPVVVTIDGVDSGIITVRD
FT                   TVKDTSAEAIRGLKELGLTPILLTGDNEGAAKSVAAEVGIDQVIANVLPHEKVQNIEAL
FT                   QAQGKNVAMVGDGVNDAAALAQADLGLAMGAGTDVAIEASDITLMNNDLRSAVDAIRLS
FT                   RKTLGTIKGNLFWAFAYNVALIPVAAIGLLNPMLAGIAMAFSSVFVVSNSLRLRGFKAR
FT                   SN"
FT   CDS_pept        complement(515117..515569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53424"
FT                   /db_xref="GOA:A4QB27"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB27"
FT                   /protein_id="BAF53424.1"
FT                   /translation="MTFQNAAFPNLYPDVDPLTPIPITFGERLAACVAAGTIAFGAASG
FT                   DLLITGVGLVLVLFATLVPASKTARRIRREARARFPQEGWIDEEITRNNRTSIFVPLIW
FT                   FLIAAISFAIYRFVDATWGSIVAAVIAMILTWFTPGLFPRRVDPYP"
FT   CDS_pept        515803..517635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53425"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB28"
FT                   /protein_id="BAF53425.1"
FT                   /translation="MKLAPRMRMRSHKTFAALASLALVIGLGQVPIAQAQTEYRTASDG
FT                   SLNWGFRQSFRNYIQTGVAKGSITLGDGASDNGGNFAFTPRTNGTTVTSDSQGTVEFNG
FT                   SVHFLGHQADDKWILDTTMSDIKMVFNGSSAQLVVDLVAREFKGTTYDDIGEYIISDDI
FT                   VLADVSLNSAADFSQDSIDLSGTTTLTAAGAQAFGGFYETGDALDPTGGSLTISSTTTA
FT                   PSTSTTSTSASTSGGTADCSSGALGVVTTGTNDGMLGTIQEVNNTFAIWNNLIVNTERM
FT                   FCNIDTLKARFDTDNSSDSVTTATSGTTASTGTTAATTAGTTGTTGTASTASGTPGTSG
FT                   TAATVAGTTPTDNGVCTASGSLGVTQASAQWGVKASFQNYIRGSIANGSWTLNGVGFDN
FT                   QQFQFSGNSGAVDAENKTGSINFPGSIHFTGHGGILDMQIANIEISFNGNSGELIADVV
FT                   SSDMEGNSTNYGRTVVGTLNFSALNVSATEASGSASVSLSQSGSQAFADFYTPGTQLDP
FT                   ISFSATLGGDASCATESTSTTGAAATANTDNTEGVAGEESTTPANQNSQFQIRQAAADS
FT                   TGLDTTTTLLLILAAFVVAGGSMTRFTVGNPTGK"
FT   CDS_pept        517644..518723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53426"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB29"
FT                   /protein_id="BAF53426.1"
FT                   /translation="MNNAFRRTLTSVVLAASLALTACASWDSPTASSNGDLIEEIQASS
FT                   TSTDPRTFTGLSIVEDIGDVVPVTDNASPALPVSLTDADGNDVVVEDVSRILPLDLYGT
FT                   YSKTIAGLGLVDNIVGRTVSSTEPALADTEVVTTGGHTLNAEAILNLHPTLVIIDHSIG
FT                   PREVIDQIRAAGVATVIMSPQRSISSIGDDIRDIASVVGLPEEGEKLAERSVAEVEEAS
FT                   TVVDELTPEDPLKMVFLYARGTGGVFFILGDAYGGRDLIEGLGGVDMAAEKGIIDLAPA
FT                   NAEALAELNPDVFVMMSGGLVSTGGIDGLMERPGIAQTTAGQNQRVLALPDGQSLAFGA
FT                   QTGELLLRASRELYVQGGE"
FT   CDS_pept        518724..519800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53427"
FT                   /db_xref="GOA:A4QB30"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB30"
FT                   /protein_id="BAF53427.1"
FT                   /translation="MVVKEVDVEKQKAGRVPGAIAKRRTVRIVLFVALGAIVIAASLWS
FT                   ILVGQYTIPIRDLPAILNAGPTGAQTMAEQVVWQIRMPRIVLGLLVGAALGVAGALLQA
FT                   VFSNPLAEPSIIGVTSGAGVGAAAVIVFNLTFLGTSTVAVGAFITAVITTILVYQLARS
FT                   RGRVQVINLILTGIAINAVSGALTSFFIYIAPTSSREEIIFWQMGSLNGSQWAHVNVVF
FT                   VIVTIGLVAAFGLGKQLDVLALGESAAGHVGLNVKKLRIIAIAVSTLLTAGAVAYAGLI
FT                   SFVGLIIPHLLRTVTGPANKILVPASALGGAALISVSDILARTLIPYADLPIGIFTALV
FT                   GGPTFFIMLRRMMKKGVH"
FT   CDS_pept        519801..520616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53428"
FT                   /db_xref="GOA:A4QB31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB31"
FT                   /protein_id="BAF53428.1"
FT                   /translation="MAIVSLDNVTVSIEGKKLLDAVSLKAYPGEVLGLIGPNGAGKSTL
FT                   LSVLSGDRLPDSGEVNVGGLDPATAAASDMARVRAVMLQDVSVAFSFLVWDVVEMGRRP
FT                   WQKVSTPEEDHEIIEAALAATSVSHLAEREITTLSGGERARVALSRVLAQQTPIVLLDE
FT                   PTAAMDISHQEQTLGTARALAAAGAAVIVVLHDLNAAAAYCDSIVCLSDGRVIASGSVD
FT                   QVYSTETLSRVYGWPIRVDHSGKYVRVEPDRSEADLPPVLRIKNTVSPA"
FT   CDS_pept        520730..521662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53429"
FT                   /db_xref="GOA:A4QB32"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB32"
FT                   /protein_id="BAF53429.1"
FT                   /translation="MNKLATRALVALTGSAIAMTGLAVVSANAAEETGECRVTTTGTAD
FT                   WALKTSFNSYLEGPIANGTAYKYKGGIEVRDGVETSGERTTRQFTWPVEGSEEGTVNLG
FT                   GGVHWTGHNHYDGDDESQVAGNFLLDLDFSNPAVKFDGNKGTLLVDFKSREFVDFTNAG
FT                   EFLTGTQAELAKITFDAPIDLNKESVTVTGQTILSELGVGVMGNFYGAGDELAPITLNL
FT                   TNEVVCEDPGTPVEPETPVDPETPVDPETPVDSEEPGDDTDGNKDDNASNSSGNGDILG
FT                   ILGTLAALGGVGALVYNFLVASGFLAAFK"
FT   CDS_pept        521663..522535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53430"
FT                   /db_xref="GOA:A4QB33"
FT                   /db_xref="InterPro:IPR007331"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB33"
FT                   /protein_id="BAF53430.1"
FT                   /translation="MTRLSSALLAASVAGAALATPATTAHAAESVCTFTGDVGWNVRDS
FT                   FNSYLLGNIANGSAYKHKGGLDVRDGVQTDGNGRTPALTWPVDSVTSSKISTSGGAHWT
FT                   GHNLYTGDDLAEVPNNFTLDLDFSNITMELNGSTGRLLVDYTSREYIDTHTLGEFQSGE
FT                   QAELATITFAQAPDLSSNSVNVTGDVALTADGVEVFGGFYTAGEELAPITLNLTADEGC
FT                   GSTPEPEDTEDPETPSTSSSDFSLGSSPDVSSSSFGDTVTQVLSIGSMVGMAGLLFTIV
FT                   NYFIQSFAP"
FT   CDS_pept        complement(522635..523447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53431"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB34"
FT                   /protein_id="BAF53431.1"
FT                   /translation="MGVAKSKKSALPKVLLTIVVILLLLVLVAEFGLRFMIGKQLKDEF
FT                   QAQAASQGISATEEPSISFGASPLLLGIARGSINEVTIDTPDSVSITNQDGVPSISGTP
FT                   ESTIQLQGLDIGDRDNPVADHLTLTTFATDDFILATIQQQMAEATGGNSTSQGFAEQLI
FT                   QELIKVTDITSDAANQTIEVEFTDGAARASLHPIVTNGQLGFEIVDSQLFGFGLPDEIS
FT                   QMLTDALQSSINEVAGGLQIQSLEVVDAGINVTLTGDNINIQTLEAAQ"
FT   CDS_pept        complement(523531..524346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53432"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB35"
FT                   /protein_id="BAF53432.1"
FT                   /translation="MADHAHNLRASFRKGANGKQKPIGVITRGTTGVNRLRRFDRWCFH
FT                   HPKIRSLLDATSLALDVGYGASHTTTVEWGRWLHRLQPDMDVIGLEINPERVLEPQNGV
FT                   SFELGGFELAGYTPQLVRAFNVLRQYDVDQVEAAWETVTSRLAPGGLFFEGTCDEIGKR
FT                   CTWITLNAEGPQELTLAWDPWGISTPSDVAERLPKILIHRNVPGEKIHSLLAAADLAWD
FT                   HSAGWEPHGPRVRWEKAREMLIDQGWPITVSRRRVGDSLLTVPWETVAP"
FT   CDS_pept        complement(524347..524850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53433"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB36"
FT                   /protein_id="BAF53433.1"
FT                   /translation="MATRTENTITINQPVGKVHQALTTEAYWAYIAENLSPEAGEVNEF
FT                   TAADGGATATLFEVLPLEVLPEAVRAMISQALKVKRVLTVPALTNNATTVEYNADVKGT
FT                   PVDFKGTIAINGDDAATTFDYSNEVSVNIPFMGPAIEPKVADALGELFANEGALTEKWI
FT                   SENL"
FT   CDS_pept        524875..525981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53434"
FT                   /db_xref="GOA:A4QB37"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB37"
FT                   /protein_id="BAF53434.1"
FT                   /translation="MLDSSLAQEIAAIDGVELDSKVTFADLTTLRIGGKPRSAVRCQTT
FT                   EALVSAIKLLDDASLPLLIVGGGSNLVVADGDLDVIAVIIETDDVSINLTDGLLTADAG
FT                   AVWDDVVHLSVDAGLGGIECLSGIPGSAGATPVQNVGAYGTEVSDVLTRVQLLDRTTHQ
FT                   VSWVDASELDLSYRYSNLKFTNRAVVLAIELQLLTDGLSAPLRFGELGRRLAISEAEPH
FT                   PRRPVRMVRDAVLELRRAKGMVVEHTDHDTWSAGSFFTNPIVDPALADAVFEKVGEPTM
FT                   PRFPAGDGKEKLSAAWLIERAGFKKGHPGAGAKASLSTKHTLALTNRGDARASDLVALA
FT                   KEIRDGVLETFGVTLVPEPVWIGISIDD"
FT   CDS_pept        525974..526612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53435"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB38"
FT                   /protein_id="BAF53435.1"
FT                   /translation="MTKFSSVPGTAAPLHRALENAGYPSLESLDGVPYKTLIALHGVGK
FT                   AGLGRIQAALLERGLSLGEETKGATITPGHTGKVASDIKTHITSVDPVEYVDGLEGRRV
FT                   AHGHQLLSIFGRVTGAEPKMWGPSMIGYGSVHYVSHTGREGDWFQCGFSPAKSKISLYG
FT                   LKDSPRGEELLQKLGKYTEGRGCVYINKPEDIDLDVLEAMISESWAGQG"
FT   CDS_pept        complement(527180..528886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53436"
FT                   /db_xref="GOA:A4QB39"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB39"
FT                   /protein_id="BAF53436.1"
FT                   /translation="MSAYETKEWLQHYPEWTPHSLEYGDTTLLDVYDNNLAINADKPAT
FT                   YFFGRSQTYGELDKEVRKTAAGLRALGVRPGDHVAIILPNCPQHIAAFYAVLKLGAVVI
FT                   EHNPLYTAHELLEPFKDHGARVAIVWDKASPTVEQLRGQTQLETIVSVNMINAMPPLQR
FT                   LALRLPIPALRKSRESLSGAAPNTVPFETLTSAAMGGDGDDVVSEPTVTKESVALILYT
FT                   SGTTGRPKGAQLTHGNLFSNLLQGKHWVPGLGDKPERMLAALPMFHAYGLTMVGTLSVF
FT                   IGGEMVLLPTPRIDLIMNVMKKHTPTWLPGVPTLYEKIVDASEKEGIPIKGVRNAFSGA
FT                   STLSQRTVERWEKHTGGRLVEGYGLTETSPIIVGNPMSDHRRQGYVGIPFPDTIVRIAN
FT                   PENLDETMPDGSEGEVLVKGPQVFKGYLNQEEATKNSFHGEWYRTGDVGVMEEDGFIRL
FT                   VARIKEVIITGGFNVYPAEVEEVLAEHPDIEDSAVVGIPREDGSENVVAAITLVEGAAL
FT                   DPDGLKEFARKNLTRYKVPRTFYHFEEMPRDQMGKIRRREVQAELLKKLGK"
FT   CDS_pept        528971..530227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53437"
FT                   /db_xref="GOA:A4QB40"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB40"
FT                   /protein_id="BAF53437.1"
FT                   /translation="MRVAMISMHTSPLQQPGTGDSGGMNVYILSTATELAKQGIEVDIY
FT                   TRATRPSQGEIVRVAENLRVINIAAGPYEGLSKEELPTQLAAFTGGMLSFTRREKVTYD
FT                   LIHSHYWLSGQVGWLLRDLWRIPLIHTAHTLAAVKNSYRDDSDTPESEARRICEQQLVD
FT                   NADVLAVNTQEEMQDLMHHYDADPDRISVVSPGADVELYSPGNDRATERSRRELGIPLH
FT                   TKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDRNLRVIICGGPSGPNATPDTYRHMAEE
FT                   LGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGL
FT                   PIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDAVEHARTFSWAATAAQLS
FT                   SLYNDAIANENVDGETHHG"
FT   CDS_pept        530270..531016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53438"
FT                   /db_xref="GOA:A4QB41"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB41"
FT                   /protein_id="BAF53438.1"
FT                   /translation="MTNGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGELL
FT                   VEAGVLPGVVYTSLLRRAIRTANIALNAADRHWIPVIRDWRLNERHYGALQGLDKAATK
FT                   EKYGDDQFMEWRRSYDTPPPELADDAEYSQANDPRYADLDVVPRTECLKDVVVRFVPYF
FT                   EEEILPRAKKGETVLIAAHGNSLRALVKHLDGISDADIAELNIPTGIPLVYEIAEDGSV
FT                   VNPGGTYLDPEAAAAGAAAVANQGNK"
FT   CDS_pept        531027..532268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53439"
FT                   /db_xref="GOA:A4QB42"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB42"
FT                   /protein_id="BAF53439.1"
FT                   /translation="MSTLLAFVLGVVLMGLALPAYTKIKDRMRRHKSAVTLSENQVTTV
FT                   GQVLHLAIQGSPTGITVVDRTGDVILSNGRAHELGIVHERSVDGNVWRVAQEAFQDQET
FT                   HSLDVHPDRNPRRPGSRITAVQAVVKPLTLIDDRFVIIYASDESENVRMESARRDFVAN
FT                   VSHELKTPVGGMALLAEALMESSDDPEQVEYFGSRLHREAHRMADMINELISLSKLQGA
FT                   ERLPDMEPVQADDIISEAIERTQLAADNANIEIIRGDRTGVWVEADRSLLVTALANLIS
FT                   NAINYSPKSVPVSVSQSIRNDVVMIRVTDRGIGIAPEDQGRVFERFFRVDKARSRQTGG
FT                   TGLGLAIVKHVMANHGGSISLWSRPGTGSTFTLELPVYHPESKEPAGSKQGPSLDSPIR
FT                   TTASKASGRRKEKS"
FT   CDS_pept        532265..532963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53440"
FT                   /db_xref="GOA:A4QB43"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB43"
FT                   /protein_id="BAF53440.1"
FT                   /translation="MTTILIVEDEESLADPLAFLLRKEGFDTIIAGDGPTALVEFSRNE
FT                   IDIVLLDLMLPGMSGTDVCKELRSVSTVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   SRELIARIRAVLRRRGVTETEAEELPLDDQILEGGRVRMDVDSHTVTVDGEPVSMPLKE
FT                   FDLLEYLLRNAGRVLTRGQLIDRIWGADYVGDTKTLDVHVKRLRSKIEEEPSRPRYLVT
FT                   VRGLGYKFEL"
FT   CDS_pept        533654..534535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53441"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB44"
FT                   /protein_id="BAF53441.1"
FT                   /translation="MDNNNSYLWPVTYDEVSHELTKWKFYKHFTKISGSVYLKNDLIDD
FT                   PVLVTQALIKRCPQGVLRGYAALNRRGYQLFDDPWMPIISISGEPRTRKTTNVGKIIRR
FT                   ETPENLRRSGEFTLVSDSQALLDVFSLHGLDSFEHQVALIDHLIRQCPDLKQEIANVPE
FT                   LRKHAEFTDEFAESPPESRLRVRLHMQGYRNFMPQVRVELEGRRFYLDLADPVWGVALE
FT                   YNGGWHYTAEQRSKDAFRKNALKNAGWDVFEVTSKTLQSQQAWDYFFQQVRVAIQRKFA
FT                   ERRRRLPMQTVS"
FT   CDS_pept        complement(534528..537098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53442"
FT                   /db_xref="GOA:A4QB45"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB45"
FT                   /protein_id="BAF53442.1"
FT                   /translation="MALTVLSVVLGTAFLCGSLLLTHSLERTFSSIVDAGVEGVDVGVI
FT                   AQQNNPDGVPFSVIAEIEQYPEVRAVNIIGDGPGMPSGTTMTGQSALILTDSDGNPLQA
FT                   GSSGTHPLAIYPQGEWVSPEPMLIDGHFPTKPDEVVVNASAAKRGGLSLGDHLTIVTPT
FT                   ERIDATLSGTFESNTDVAGWVGVGFTPQRYVELFTNGTDASQITIAVNDGADPMAVRNR
FT                   IGKNHRDLLPLLPEQIIDQTTGDTARQLEFMTYVLLAFAAIALIVGSFIIANTFAMIVA
FT                   QRTGEFALLRSIGVSTFQIGFSVIMEAVFVGLIGGFIGIAVGFGVVNALVQVLNQFGDT
FT                   LSSIDITYNAGSFIFPVLFAVTATVLSAISPAHRAGNLPPVQAFESSDARSDALGRIRF
FT                   LVAAVMLTLGISLTIAGAVVSAINGDEFKTETRLAFIGAGLLLVFFSLSLSGPALMVAT
FT                   SQTLGVAIMSPFRAVGKLAQRNTLRNPRRSATTALAVTLSVGLVACVGVIGATTRASVF
FT                   GSMESTIKSPYVLDSIGGTMIPGQPAGGSRSLSMSAAVAPEIAQTRGVGEVGTLMTGSV
FT                   QVNGWDNENTTIFDGDLSQFLDLAVRSGDAFDDETPGVMISTTYADQSDLEVGDTVTVN
FT                   PYGSDDGIRVPITGIYAETNLVGHLMVNAAATNRVLTSADTYHRSQIFVNGDGSTTNEE
FT                   LRDILVDAVAPFLIVQVKSKDEFRGSLGTQINQLLGIIYGLLALAVIIAVLGIVNTLFL
FT                   SISERTREIGILRATGVQRGQIRRMITLESVILSIHGAIHGLLLGTFIGWAIVSCLRTR
FT                   GMAPVEFPWTQIGLMLISAIIIGGIAALIPANRASRISPLEAIS"
FT   CDS_pept        complement(537216..538121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53443"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB46"
FT                   /protein_id="BAF53443.1"
FT                   /translation="MNRSNSSSVFLGFPESSPAAASIRTGEELPLDFPREWYEFTDPTD
FT                   VEHVFSIDLTWLESNWNCTFGTPDCLGIDSENADVGCCGHGAFLADETDRDQLYDAVAQ
FT                   MPAKYWQLRPASTDSFLASDDGTDIEPWLTWDELDDEDGNPEPALKTTVVNGACIFANR
FT                   AGWETGAGCALHQWGVDANEDLTVVKPEVCWQLPLRRLEAWEERPDGQEILRTTITEYN
FT                   RRGWGNGGEDFDWYCTTSPRCHTNAEPMWKTQETELRALMGPNSYEVLREYLEARSAIP
FT                   AHLRAQHPASASNNNETPRG"
FT   CDS_pept        538176..539084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53444"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB47"
FT                   /protein_id="BAF53444.1"
FT                   /translation="MGSNTVHLVAVDARPGGHPTPMSNWRTPLRLVELLDDSGAISEKG
FT                   INKLTSAVGEAADLAKTLGCAELMPFATSAVRSATNSEAVLDHVEEETGVRLSILSGED
FT                   EARQTFLAVRRWYGWSAGRITNLDIGGGSLELSSGTDESPDLAFSLDLGAGRLTHNWFD
FT                   TDPPARKKINLLRDYIDAELAEPARQMRTLGPARLAVGTSKTFRTLARLTGAAPSSAGP
FT                   HVTRTLTAPGLRQLIAFISRMTAADRAELEGISSDRSHQIVAGALVAEAAMRALDIDKV
FT                   EICPWALREGVILTRIDKGLE"
FT   CDS_pept        complement(538955..540079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53445"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB48"
FT                   /protein_id="BAF53445.1"
FT                   /translation="MVTRIFCGFMLAAIKPETKASPICPPPITAIVVMVPTLPLTTPVL
FT                   QQRGPKTTNYMTIASGPNVMTRPTIPARTMLKPSREVRKAWMMPTIPKVTPTARTATIH
FT                   LFRRSHSISKPRNTTTPRTTPTIAIMMIANTDILFSCSGSSSTSSTTAICVVSVLSTST
FT                   SAKSAFTAVSTSASFSARTTGAGLAATAGTTGNAPVVKLIGSFSSTMRSTMVSSLLGAG
FT                   RSGVSCLSTSPSTEATSTSSAGSVLGASTTSGSAGASMGTLECLDSAGFSLTAGMEPVS
FT                   SATDTPPSSMLRRLRRRGASAERPSFAARAISSATVSFSSLIFANSFPGKCYSSPLSIL
FT                   VRITPSRSAHGQISTLSISNARIAASATSAPATI"
FT   CDS_pept        539112..539918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53446"
FT                   /db_xref="GOA:A4QB49"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB49"
FT                   /protein_id="BAF53446.1"
FT                   /translation="MSEEKLTVAELMARAAKEGRSADAPRRRRRRSIEDGGVSVAELTG
FT                   SIPAVKEKPAESKHSSVPIDAPAEPEVVEAPKTEPAEEVEVASVEGDVDKQETPERPAP
FT                   SNEETMVLRIVDEKDPISLTTGAFPVVPAVAAKPAPVVRAEKDADVETAVKADFAEVEV
FT                   DNTDTTQMAVVEEVDEEPEQENKMSVFAIIMMAIVGVVLGVVVFLGFEMLWERLNKWIV
FT                   AVLAVGVTLGMVGIIHALRTSRDGFSMVLAGIVGLVMTFGPLAIVM"
FT   CDS_pept        539970..540791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53447"
FT                   /db_xref="GOA:A4QB50"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB50"
FT                   /protein_id="BAF53447.1"
FT                   /translation="MGTMTTIAVIGGGQIGEALVSGLIAANMNPQNIRVTNRSEERGQE
FT                   LRDRYGILNMTDNSQAADEADVVFLCVKPKFIVEVLSEITGTLDNNSAQSVVVSMAAGI
FT                   SIAAMEESASAGLPVVRVMPNTPMLVGKGMSTVTKGRYVDAEQLEQVKDLLSTVGDVLE
FT                   VAESDIDAVTAMSGSSPAYLFLVTEALIEAGVNLGLPRATAKKLAVASFEGAATMMKET
FT                   GKEPSELRAGVSSPAGTTVAAIRELEESGIRGAFYRAAQACADRSEELGKR"
FT   CDS_pept        541042..541233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53448"
FT                   /db_xref="GOA:A4QB51"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB51"
FT                   /protein_id="BAF53448.1"
FT                   /translation="MAREDNGTFLTVAEVAEIMRVSKMTVYRLVHSGELPAVRVGRSFR
FT                   VHEKAVNEYLDSSFYEAG"
FT   CDS_pept        complement(541193..541375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5003"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53449"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB52"
FT                   /protein_id="BAF53449.1"
FT                   /translation="MSTKNTSKTPQQNPKIIMPGEQTEKPLYVTFGGVIRELRGEVFAV
FT                   VESSQPRRRRSPGTR"
FT   CDS_pept        541557..541658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53450"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB53"
FT                   /protein_id="BAF53450.1"
FT                   /translation="MGSVIKKRRKRMSKKKHRKMLRRTRVQRRKLGK"
FT   CDS_pept        complement(541663..541905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5004"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53451"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB54"
FT                   /protein_id="BAF53451.1"
FT                   /translation="MVSFAHFVRGGEPADSDQKLVQSSAPWFNTDVFQNPSTRIAFPGS
FT                   LRPPNPQRTHKNPQRTPPKTQKSTAPEGGASLKLN"
FT   CDS_pept        541741..541860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6023"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21085"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VPQ3"
FT                   /protein_id="BAQ21085.1"
FT                   /translation="MGSLWVRGSQTPRESDSGAGVLENVRIEPRSTALDELLV"
FT   CDS_pept        complement(542074..543141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53452"
FT                   /db_xref="GOA:A4QB55"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB55"
FT                   /protein_id="BAF53452.1"
FT                   /translation="MSSEGRNHNWDYAAIGTPEDFLASWSASRGNLRRFFEDHAAAPIN
FT                   DAAQRQAGEAAATQAVAAIYGMELNEFNAGVDAVAGAIESAGAIHVSIPDPDVPQDVGA
FT                   AAFFDVDNTLIQGSSLIVFAQGLFRKKFFTIKEILPVVWKQVKFKLTGSENAEDVSRGR
FT                   EQALEFIKGRPVQELVDLCEEIVDQRMADKMWPGTKQLADMHIAAGHQVWLVSATPVQL
FT                   AQILAQRLGFTGAIGTVAEAKDGVFTGRLVGDILHGPGKRHAVAALASIEQLDLTRCTA
FT                   YSDSINDLPMLSMVGTAVAVNPDSKLRKEAETRGWDVRDFRSIRKATREYGIPALVTAA
FT                   FSVAGWRLRRRWRKQ"
FT   CDS_pept        complement(543138..543296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5005"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53453"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB56"
FT                   /protein_id="BAF53453.1"
FT                   /translation="MAHGCAHSLTFRYPSRAYPPRKLYHGYDTQWRYPLSVWRLCAHEP
FT                   GRFLFVS"
FT   CDS_pept        543207..543524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53454"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB57"
FT                   /protein_id="BAF53454.1"
FT                   /translation="MSIVSMVKLSGRIRSRRVAKCEGVGATMGHSVEIIVRDNCGSCVR
FT                   VKAQILPIVGAAGIKLTERNVDQDASLKLEFGDRVPVILVDDEEFACWEVDNDELANAL
FT                   L"
FT   CDS_pept        543610..545004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53455"
FT                   /db_xref="GOA:A4QB58"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB58"
FT                   /protein_id="BAF53455.1"
FT                   /translation="MVSVLIVGMSHRSAPVSLLERLSMDDSVRGETTQALLGRASLSEA
FT                   LIVSTCNRLEVYTVTSSFHTGVNDVVEVLHEASGVDIETLRGYLYVRYADAAAEHMLVV
FT                   TSGLDSMVLGEQQIIGQVRTAYQAANEYGSVGPALHSLTQTALHTGKRVHSETAIDDAG
FT                   ASMVSFAVDRALVQMGLDSEAEAPLSGKTALVLGAGAMSSLAATHLGRAGISKLIMANR
FT                   TLERAERLAEHSLEAGVPAEVVEYDQRASAYNRVDLVVSATGADDFTVKPEDIPEGASL
FT                   MLVDLSMPRDIDDACADLPGVDLVNIERLHKASREGGSGMAPSEEEALAIVREELDSFT
FT                   SEQRIRDIVPAVSALRRQAASVGSDELDRLRQRAPGISEVEWGEVEKTVRRVVDKLLHQ
FT                   PTVRVKELAARSGSISYDSALQELFGLESLASTAAPATTSVNASELPDAGIVAFVNAPS
FT                   ATQTRE"
FT   CDS_pept        545006..545914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53456"
FT                   /db_xref="GOA:A4QB59"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB59"
FT                   /protein_id="BAF53456.1"
FT                   /translation="MTLKIGTRGSKLATTQAGTIRDQLKYFGRDAELHIVTTPGDVNMS
FT                   PVERIGVGVFTQALRDVLHAGECDVAVHSMKDLPTAADPRFHLVVPTRADSREALIARD
FT                   GLTLAELPEGAKVGTSAPRRISQLKAIRPDLEILPLRGNIDTRMGKVTSGELDAVMLAY
FT                   AGLTRVGMQDRATEVFDADIIMPAPAQGALAIECRADDTETVRALNMLMHADTFVSAVA
FT                   ERTVLNRLEAGCTAPVAAHATLDGYSGDTMTLTAGVYALDGSDQLVFSAEGDGARPEEL
FT                   GELVAQQLIDAGAANLLGDRS"
FT   CDS_pept        546317..546691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53457"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB60"
FT                   /protein_id="BAF53457.1"
FT                   /translation="MIVVAELRINNRIVTVHLSWWEKLSARRSHLRIPRKAIRNIQVVD
FT                   NVISSVDRPIKRTGRLRIPGVFVAGTHAYVNETLSENEFSMCRKNEPGLVIELENISID
FT                   RIVISTPDAHRYADELMAAV"
FT   CDS_pept        complement(546695..547579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53458"
FT                   /db_xref="GOA:A4QB61"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB61"
FT                   /protein_id="BAF53458.1"
FT                   /translation="MHLNQLEFFITVAQHGQINRAAEELLISQPALSRQISALEKSVGA
FT                   PLFERHSRGVSLTKAGEILHEEALRTLSRMQSVVDEIQSGEHLITSINIGVPPGIPIDW
FT                   LRCQLIDLGPETRISLIESPTDDQLKLLKQRELDIALCRRQSEAFATTLVHEQELGIVV
FT                   RKNSELHQKVAGKDNATLFDLEGLRVLAHSRGEVRIQEEILKNAMLAAGVNATWIFRKF
FT                   GQYSSLIADLVQADVALTTEESARTNFPSWQWVPIEGEDASGNDLVVRTWITWNPQPTP
FT                   AVKALIQKFIDGN"
FT   CDS_pept        547855..549258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53459"
FT                   /db_xref="GOA:A4QB62"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB62"
FT                   /protein_id="BAF53459.1"
FT                   /translation="MSEQLQGVTHSESTQGKTPKRAALSSWIGSALEYYDFAVYGTAAA
FT                   LVLNHLFFPADTSPGIAILAAMGTVGVAYVVRPLGALIMGPLGDRYGRKFVLMLCLFLI
FT                   GASTFAVGCLPTFDQVGYLAPALLVLCRVIQGLSASGEQSSAISVSLEHADERHRAFTA
FT                   SWTLHGTQFGTLLATGVFIPFTLFLSEDALMSWGWRVPFWLSAAVVLVAFLIRRGLEEP
FT                   PAFRENKEAVAGAASPLAMTLRYHKAAVARVAIAAMINSVNIVFTVWALSFATNIVGLD
FT                   RSTVLLVPVVANLVALIAIPLSGMLADRIGRRPVFIMGAIGGGLAMNGYLGAIYSGNWT
FT                   MIFFMGVLMSGLLYSMGNAVWPAFYAEMFPTSVRVTGLALGTQIGFAVSGGFVPVIASA
FT                   LAGDQGDQWMKVSIFVGVVCVISALVAMTAKETKALTLDEIDALHTARGEAADLAAANK
FT                   ASEAQLAAK"
FT   CDS_pept        549294..551150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53460"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB63"
FT                   /protein_id="BAF53460.1"
FT                   /translation="MRTSIATVCLSGTLAEKLRAAADAGFDGVEIFEQDLVVSPHSAEQ
FT                   IRQRAQDLGLTLDLFQPFRDFEGVEEEQFLKNLHRLEEKFKLMNRLGIEMILLCSNVGT
FT                   ATINDDDLFVEQLHRAADLAEKYNVKIAYEALAWGKFVNDFEHAHALVEKVNHKALGTC
FT                   LDTFHILSRGWETDEVENIPAEKIFFVQLADAPKLSMDILSWSRHHRVFPGEGDFDLVK
FT                   FMVHLAKTGYDGPISLEIFNDSFRKAEVGRTAIDGLRSLRWLEDQTWHALNAEDRPSAL
FT                   ELRALPEVAEPEGVDFIEIATGRLGETIRVLHQLGFRLGGHHCSKQDYQVWTQGDVRIV
FT                   VCDRGATGAPTTISAMGFDTPDPEAAHARAELLRAQTIDRPHIEGEVDLKGVYAPDGVE
FT                   LFFAGPSPDGMPEWLPEFGVEKQEAGLIEAIDHVNFAQPWQHFDEAVLFYTALMALETV
FT                   REDEFPSPIGLVRNQVMRSPNDAVRLLLSVAPEDGEQGDFLNAAYPEHIALATADIVAV
FT                   AERARKRGLDFLPVPENYYDDVQARFDLPQEFLDTLKENHLLYDCDENGEFLHFYTRTL
FT                   GTLFFEVVERRGGFAGWGETNAPVRLAAQYREVRDLERGIPN"
FT   CDS_pept        551197..551634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53461"
FT                   /db_xref="GOA:A4QB64"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB64"
FT                   /protein_id="BAF53461.1"
FT                   /translation="MLGKILLLNGPNLNMLGKREPDIYGHDTLEDVVALATAEAAKHGL
FT                   EVEALQSNHEGELIDALHNARGTHIGCVINPGGLTHTSVALLDAVKASELPTVEVHISN
FT                   PHAREEFRHHSYISLAAVSVIAGAGIQGYRFAVDILANLKK"
FT   CDS_pept        551649..552500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53462"
FT                   /db_xref="GOA:A4QB65"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB65"
FT                   /protein_id="BAF53462.1"
FT                   /translation="MNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDTLGSR
FT                   ASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLLDEVSEQATQLGAVNTVVIDANGHT
FT                   TGHNTDVSGFGRGMEEGLPNAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLDTSR
FT                   AQALADVINNAVGREAVVGVDARGIEDVIAAADGVVNATPMGMPAHPGTAFDVSCLTKD
FT                   HWVGDVVYMPIETELLKAARALGCETLDGTRMAIHQAVDAFRLFTGLEPDVSRMRETFL
FT                   SL"
FT   CDS_pept        complement(552506..552790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5006"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53463"
FT                   /db_xref="GOA:A4QB66"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB66"
FT                   /protein_id="BAF53463.1"
FT                   /translation="MGAMFGRKDINLSALEARVAALERRLAEQDQIIAQLGGDSSTPLS
FT                   LQRPQSGLHPDVVALLQQGKKIAAIKRHRELTGAGLKEAKETVEASRFY"
FT   CDS_pept        complement(553413..554465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53464"
FT                   /db_xref="GOA:A4QB67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB67"
FT                   /protein_id="BAF53464.1"
FT                   /translation="MSSIKLRDLSVSFRDGTFGLQDINLKIEPEEFVVLIGPSGSGKTT
FT                   MLRTIAGFVEPSSGSVLIGGEDMTHVPPERRRMGMVFQQHAVWPHMSVAKNVGYPLARS
FT                   GQKGASISKRVERTLALVGLEGFGSRRPASLSGGQRQRVALARAIIADPTVLLLDEALS
FT                   ALDEPLRDALRRELVSLSRREGLTTVHVTHDRAEAISIADRIVVLGNGRIQQVATPTEL
FT                   LSAPATADVARFIVDATVLNGIVRNGRVMCPDLDTSWDLDAVQAIDDIFDGDLVDIAIP
FT                   PHSVGIGPAHHPDYIFAEITSVLFQVTSYSATAKTQSGHSFRMSITCSVPEIGETIGLS
FT                   IDNPMVYRAD"
FT   CDS_pept        complement(554466..556112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53465"
FT                   /db_xref="GOA:A4QB68"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB68"
FT                   /protein_id="BAF53465.1"
FT                   /translation="MQLSPSNTSTQRFHISALASLSFMRLGMWLIVAGLFITPLALVVG
FT                   LALGGNQFPALWDSGLGKALWNSAYTTVLSAVGATIIGTIMALTLDRTDVFGRTALRLF
FT                   LLSPLLIPPFIGAIAWLQLFGKNQGINRFFGTEVWDIYGADGVTFLLIVHSYPTVYIIV
FT                   SAALRQLPSDLEQAARIAGADTFTVLRTITLPLLKPALLSAFTLTAVANLADFGIPALL
FT                   GSPARFETLATMIYRFMESGTVSNPLQVVSTIGVVLLFLGIAAVTADYLVSLYAASKLQ
FT                   DAGTPHRFTLNKSRIPVSVITWIIALIITAAPLLGLAYRALLPAPGVPFNLDNITLNNF
FT                   EAALSNPRVIEGFGNSLMLSLGAALICGVLGWLIGVLITRTQHFANVPLTLTVLLPTAL
FT                   PGMIIGVGWLILGRYTGIYNTPWVILGAYVCAFTALVVQAVRGPLSQAPEAIEEAARIS
FT                   GAGRLRSIMDTTGAMAIPAAFAGAVLVAVTAVRELTVSILLIAPGTTTLGVQVFNLQQA
FT                   GNYNQASALSLMFAIIGIVALALTVRSQKEF"
FT   CDS_pept        complement(556120..557199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53466"
FT                   /db_xref="GOA:A4QB69"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB69"
FT                   /protein_id="BAF53466.1"
FT                   /translation="MSSKHPLKRTATTVFALGASAALLVACSEPSEDVSTAETTTASSS
FT                   ANASDAAGEKVTITVYTSEPEEKVDEINKAFMEANPDIEVEVYRAGTGDLTARIEAEKA
FT                   SGSIEADVLWAADAATFETYAAQGDLAELEDVDTSDLIEEALDAENFYVGTRIIPTVIA
FT                   YNTEVVDQAELPTSWADLTDPKYAGQLVMPDPAVSGAAAFNASVWKNDPALGEVWITAL
FT                   GENQPMIAQSNGPTSQEIAGGGHPVGIVVDYLVRDLAAAGSPIDTIYASEGSPYITEPA
FT                   GVFADSEKKEAAERYINFLLSVEGQEIAVEQAYLPVREDVGTPEGTPELADIELMTPDL
FT                   EVVTADKAAAVEFFQNAMN"
FT   CDS_pept        557927..559723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53467"
FT                   /db_xref="GOA:A4QB70"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB70"
FT                   /protein_id="BAF53467.1"
FT                   /translation="MTIAHKPEMAETTGIETNQVSETIGVESLTHGNLRPVSSFEGQHE
FT                   GQTEELLPGKVIFVGAGPGNPDLLTVRAREVLGNAVRAITDEQVLSGVRAFVATEIPVP
FT                   EDKLQAAEDEYERICIEAKENGARRKPPRPAPPTAAEITEVSEATPAQIVELVQNALSY
FT                   GGDVIRLVTGNPLSSDTTLAEISAVSEAGLEFQVVPGMSLPATVPAFAGIALGSTYTET
FT                   DVNGQNVDWDQLASAPQPLVLQARVQDLSRIAQELKARNMPLETPVSVTANGTTRLQRT
FT                   YDTTLGLLHKLDAELNGPLVVTLGKGVDDRSKYSWWENRALYGWRVLVPRAREQAASMS
FT                   ARLSSHGAIPQEVPTISVEPPRNPAQMERAIKGIVEGRYQWVVLTSVNAVKAVWEKITE
FT                   FGLDSRSFAGVRIAAVGEKTAAEIRALGITPELLPARTRQNAQGLVDVFPEYFEELDPV
FT                   GRVLLPRADIATDVLVDGLTHLGWEVEDVVAYRTVRAAPPSADIRDMIKTGGFDAVAFT
FT                   SSSTVKNLVGIAGKPHPRTIVACIGPMTAATAEELGLRVDVMPEIAEVPELIDALAEHV
FT                   ADLRAKGELPPPRKKRRRRKAS"
FT   CDS_pept        559749..560168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53468"
FT                   /db_xref="InterPro:IPR024266"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB71"
FT                   /protein_id="BAF53468.1"
FT                   /translation="MDIQQLDAETTAWKDSLLCATQEAGFHFEPPKLFEDFEAMVEQYK
FT                   QAAASDPDIDVTDIQQMWGIVVGEYLREKMGMDWVIITDDYGTDLAILATAPNGDHVYS
FT                   CPIIVVGKRFSTDYEPGQLEFFCNQFIVTSLAQLQ"
FT   CDS_pept        560257..561276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53469"
FT                   /db_xref="GOA:A4QB72"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB72"
FT                   /protein_id="BAF53469.1"
FT                   /translation="MSTSSDYSHALIRRPRRLRANPAMRELVAETALRPADLILPMFFA
FT                   DGITEAREISSMPGVYQHTEDSLLRAAHEALDAGVRCVDLFGVPMDADKDFNGSQAWSE
FT                   TGVLNRALASLRKEFGDDLLIMADTCLDEFTDHGHCGVVTEDRHGNAIVDNDATLPLYQ
FT                   QMAVAQARAGAHIVSPSGMMDGQIAAIRAALDEEGYQDVAIMAYSAKYASAFFGPFREA
FT                   VGSSLQGDRRTYQQDPANLRESLLEAELDIAEGADFIMVKPALPYLDVLTRIADTSPVP
FT                   VAAYQVSGEYAMIQAAGRNGWVDLDAVMMESLTSIKRAGANQILTYFAVDAARALRNA"
FT   CDS_pept        561306..561890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53470"
FT                   /db_xref="GOA:A4QB73"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB73"
FT                   /protein_id="BAF53470.1"
FT                   /translation="MSMLPNLTPKKSAPPSSSASAKNAGEKKEDTVKLLIQMWAVMIGL
FT                   ELLHQILNVVMSFTDPTALRTVAKEQAAAQGLSEGIVNATVIAAILVMGFFNLIVIAIL
FT                   SWMVVMVKNRSKRLPTAFLLLTIFSFFFILRVLMLFFASPGGTDVPMALFAIDGCVQIL
FT                   VGVSAGVAYALSRTEQPVKMLTDYAPEDAKR"
FT   CDS_pept        561931..562443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53471"
FT                   /db_xref="GOA:A4QB74"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB74"
FT                   /protein_id="BAF53471.1"
FT                   /translation="MPSMFPSPATGGDDINRRPLNEPNADATTIPTALKVVFWMLFATA
FT                   AFMIFTGLVMYTAGYTGPDDVDESYKAVVVNNQEFIGGINAFAGIVIAALTSQLPKGGK
FT                   NPRRLLLAIMLLVLLTDLLSFATRAGGFALAIIAVLLALEALLMFRPAVNDHIDRNHMA
FT                   RVMNREK"
FT   CDS_pept        562557..565193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53472"
FT                   /db_xref="GOA:A4QB75"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB75"
FT                   /protein_id="BAF53472.1"
FT                   /translation="MSTPDSSSVDKAVNTAISDAKTAALKAGVGLNRATAPEEEEDLSS
FT                   SIKVSLAFELEGLSNAPSLMAVEKALEKIPGVSADLIYPSQTAWITATDRVHPETLIGV
FT                   FEQFGIKAQLSNSSLLRRHQQLSAEVNREARIDRYRSRMDAKRISPRVRRHNRQEMVHA
FT                   VRARESGWIKRMNHTTSQHEDPMSGDVLFTARALITPMRLWVSLPFALIVLALSLNPSW
FT                   QFDYWQWLSAVLAIPVVVWGAWPFHRAAAGGIRRGISALDATSSIAIAAAYAWSIAMLL
FT                   FETPGNKSWRSYPSWFAFNHGTLTQNEIYFDVACGITVLLLGGRLLTRRRSQSSLLAEL
FT                   GRLQIDPQRIVTVVRKHRLKRVVQELNIPVQEVRVNDDVKVPPNTTIPVDGTVIGGGSR
FT                   IAASIIMGQDQRDVKVNDKVFAGSLNLESEIKVRVIRTGHRTRIAAVHRWVKQATLQEN
FT                   RHNRAAIRSAGNLVPITFTLAVVDFCLWALISGNINAAFTTTLAVLACVAPVALALSAP
FT                   LATRNSIEAAARHGILVRSGEIFRVLDDVDTAVFNRVGTLTDGEMTVETVTADKGEDPE
FT                   LVLRVAGALAMESHHAISKALVKASREARDTGAGGEDVPHWIEVGNVEITEAGSFQATI
FT                   ELPLIKPSGEKIMRTTEALLWRPRSMTEVREHLSPRLVAAATSGGAPLIVRWKGKDRGV
FT                   ITLSDHVRSDSSDAIIAIEEQGIETMMLSRDTYPVARRYADSLGITHVLAGIAPGKKAQ
FT                   VVRAVHTRGSTVAMIGDESVMDCLKVADVGVLMGVDRPSELRDDSDDPAADVVVMREEV
FT                   MSVPTLFKLARRYAKLVNGNIALAWIYNGVAMVVAVSGLLHPMAATVAMLASSLLIEWR
FT                   SGRARKY"
FT   CDS_pept        565309..566385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53473"
FT                   /db_xref="GOA:A4QB76"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB76"
FT                   /protein_id="BAF53473.1"
FT                   /translation="MSALTIPAARRTLNNAPIIDAANGKTPTRTPVWFMRQAGRSLPEY
FT                   KKVREGISMLDSCFMPELLAEITLQPVRRHDVDAAILFSDIVVPLRAAGVGVEIVAGRG
FT                   PVLDAPVRSREDVLNLPILEGNVPEVEQGIGIILDELSDSQALIGFAGAPFTLASYLVE
FT                   GGPSKNHEKTKAMMHGDPETWHALMARLVPTIVNSLKSQIDAGIDAMQLFDSWAGFLTE
FT                   RDYTEFVLPYSTEILEEVGKYQLPRIHFGVGTGELLGAMSKAGSEVMGVDWRVPLDKAA
FT                   ERIAAVSGPKVLQGNLDPALLFAGRAPLTKEIERIKAEAQTAIDAGHATGHIFNLGHGV
FT                   LPNTVAEDITEAVSIIHS"
FT   CDS_pept        566401..567747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53474"
FT                   /db_xref="GOA:A4QB77"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB77"
FT                   /protein_id="BAF53474.1"
FT                   /translation="MRFAIIGAGLAGLTAAYEIHKADPTAQIDVLEAGERIGGKLFTVP
FT                   FASGPTDIGAEAFLAARSDAVEFFTELGLADSLVSPSAAKSQYFAGGALHAFPAGGVMG
FT                   IPSNPPAGAQDTAFDWTPGHDISVGALVRRQYGDEIVDTVVSSLLGGVYSSTADDLGVR
FT                   ASVPALAAALDQLAEAGEPVTLSAAVKAVEAQREAAKTTSETRPVFQTFKGGYAELYEA
FT                   LAEQCGADIHLDSFVSAITKDGEGFAIKGGGEGTYDKVILAVPAPTAAVLLRDLAPTAA
FT                   PHLRAIKLASSAVVGMRFDSSEGLPDNSGVLVAVNEPGITAKAFTFSSKKWPHLEARGG
FT                   ALVRASFGRLGDEASARMDEDLLVDAALDDLLTITGFDGRAAGLGEIFVQRWFGGLPAY
FT                   GVDHIAAVSAARAEIAAVPGVEAIGAWAGGVGVPAVIADAQAAVHRLLG"
FT   CDS_pept        567846..569159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53475"
FT                   /db_xref="GOA:A4QB78"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB78"
FT                   /protein_id="BAF53475.1"
FT                   /translation="MTHMTSSNTARSAEWFEKAQKLTPGGVNSPVRAFGSVGGQARFIE
FT                   KAHGSTLIDVDGNEYVDLVCSWGPMLMGHAHPAVVEAVQKAVVDGLSFGAPTIGEVELA
FT                   QDIVKRTSVEEVRLVNSGTEATMSAVRLARGYTQRSKILKFEGCYHGHVDALLASAGSG
FT                   VATFALPDSPGITGAQTSDTIVVPYNDIEAVRNAFAEYPGEIACIIAEAAGGNMGTVAP
FT                   KDNFNDKLLAIAHADGALLILDEVMTGFRTSYRGWFGIDKVAADLVTFGKVVSGGLPAA
FT                   AFGGKAEIMNMLAPQGPVYQAGTLSGNPVAVAAGRASLKLADESLYTTINANADRLHGL
FT                   ISDALTHEGVAHHIQRASNMLSIRFAEGEGHNFSDMKAADTFRFAPFFHTLLDNGVYAP
FT                   PSVFETWFVSSALTDDDFSKIEQALKPAARAAAEAKAS"
FT   CDS_pept        569156..569764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53476"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB79"
FT                   /protein_id="BAF53476.1"
FT                   /translation="MTQTIVHLVRHGEVHNPEKILYGRMPGYRLSSRGRSQAARTAASF
FT                   EGHDVTYIAASPLQRVQETSEPFIKVTGLELITDEDLLEAGNRFEGLRTKGWRSQLWNP
FT                   VRWPLMYNPTLPSWGEHYTDILERMMAAVERARVAAEGHEAILVTHQLPIVCVQRHARG
FT                   QSLSHNPATRQCDLASVTSLVFQDDQIVGVHYNEPAQEI"
FT   CDS_pept        569771..570394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53477"
FT                   /db_xref="GOA:A4QB80"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB80"
FT                   /protein_id="BAF53477.1"
FT                   /translation="MRLTKLAATIGCVTLSGLALVACSSDSTAGTDAVAVGGTFQFHSP
FT                   DGKMEIFYDEADRQQLPDIGGDSLMEEGTQINLSDFENQVVILNAWGQWCAPCRSESDD
FT                   LQIIHEELQAAGNGDTPGGTVLGINVRDYSRDIAQDFVTDNGLDYPSIYDPPFMTAASL
FT                   GGVPASVIPTTIVLDKQHRPAAVFLREVTSKDVLDVALPLVDEA"
FT   CDS_pept        570395..571201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53478"
FT                   /db_xref="GOA:A4QB81"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB81"
FT                   /protein_id="BAF53478.1"
FT                   /translation="MSEIVVAQSIGQQFADVAASGPLFLGILAAALAGLVSFASPCVVP
FT                   LVPGYISYLAGVVGGEVEYSAQGTKVKTKRFAVGGAAMLFILGFTVVFVLATVSVFGAI
FT                   SVLTLNADTLMRIGGVVTIIMGIVFMGFIPGLQRDTRMAPKRWTTWLGAPLLGGVFALG
FT                   WTPCLGPTLAAIISISAGTEGMTAARGVILIVGYCLGLGLPFLLIALGSSKALTGVEWL
FT                   RKHSRTLQIIGGVLLILVGVALLSGSWAIFINWVRQWTVEYGATLL"
FT   CDS_pept        571238..572863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53479"
FT                   /db_xref="GOA:A4QB82"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB82"
FT                   /protein_id="BAF53479.1"
FT                   /translation="MLKTVKLYARKAWNWLTSMRTALALLFLLAIAAIPGALLPQRSLN
FT                   ESNVIEYIENNGKLAEFYDKIQLFDVFSSTWFTAIYVLLLISLVGCILPRSWEHYKAMR
FT                   APVVRAPRNLARLAHNGEGLVEKREEEVEKDARKLLKGWKITEYSAEEDRAGVRSIAAE
FT                   KGYTRELFNLIFHLGIVGMIVTAGLGRLFYYEGHVIVVTDGEQNQQNSVFCNTATANYD
FT                   SFRAGANFDGTGLTTFCFEAHDFSADYLANGQAEMFRSNISYAVGDDIQNDPETWEDYE
FT                   LRVNHPLRIEGDRVYLQGHGFAPTFTVTWPNGETRTQTVQWRPDDPTFFLSSGVVRFDP
FT                   PAGMYPDLYERRQNQLAIQGLFAPTAEWEGDNNELLTSSYPAMRDPAVAIDIYRGDNGL
FT                   DTGIGQSLFSLDSTLMHSGVLQKIERVNLQIGDTVTLDDGTTVSFDGASEFANYQISRD
FT                   PTQNWVLVTTVISLVSLVGSLMIRRRRIWVRFYPQENGTTRVETGGLARTDRAGWGGEY
FT                   EKFHRELLGLKEEDEDEEYFDHDD"
FT   CDS_pept        572923..573936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53480"
FT                   /db_xref="GOA:A4QB83"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB83"
FT                   /protein_id="BAF53480.1"
FT                   /translation="MLPVNQTYAQFSDTAFVSAYIIYVLALILSLVYYVKQQGIIDARR
FT                   EQTRVSELVGAGGSADVDTDLPDDIADGVLADEDLAKREETARKLANMTQSLMWLGVMA
FT                   HLVSVVMRALSASRFPFGNLYEYILMVTLFAMIGAVLILQRPQFRVVWPWILTPMLALL
FT                   FYGGTQLYSDAAPVVPALQSFWFPIHVSSVSIGASIGIVSGIASLLYLLRMWQPKGKEK
FT                   GFFGAVAKPLPSGKTLDNLAYKTAIWTVPIFGLGIILGAIWAEAAWGRFWGWDPKETVS
FT                   FITWVLYAGYLHARATAGWRNTNAAWINILALVTMIFNLFFINMVVSGLHSYAGLN"
FT   CDS_pept        574792..575595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53481"
FT                   /db_xref="GOA:A4QB84"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB84"
FT                   /protein_id="BAF53481.1"
FT                   /translation="MTSTAPEPVRKKPLIPRNTLVTAIKAVVGIAGLFVVWELIVLITN
FT                   PPRFLLVGPSAAFAELFNRPGYFASNAWVTLQEALAGFVLGTALGVLCGAALHYFPAVR
FT                   TFLYPALVAIDTIPKVALAPLFIVWFGFGFESKVFVAMAIAFFPLVINTFDGLSSVPHE
FT                   LKELARINRATTWQRLSKIEFIYAVPSIFSGMKISISLAVGGAVVGEFISGSKGLGYVI
FT                   LLANSQVDLASMFAAFIVLASISLALFYAVDLAAKRLVPWKTYAK"
FT   CDS_pept        575637..576674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53482"
FT                   /db_xref="GOA:A4QB85"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB85"
FT                   /protein_id="BAF53482.1"
FT                   /translation="MNMKKVAAITAALALTIPLVSSCSSNSTGDSIDVMMDVGYLPKHA
FT                   PFFAAVAEGFFDEEGLDVSLMPGSGSNNTVTSVETGRVFAGFADFGVTVMNQGRGAQVR
FT                   QVNLLQARSSYAAVADKASGIESWDDLKGKTVATEGAGAMVSMWPYALNQLGYSEGDIN
FT                   VVHASSESKIPGLLAHQWDANLALAVSDAPALAALGLEPVVLNWADIGISLYGNGMVVS
FT                   NETIENEPEKVERFNRALQKGFLWACENPEQTYKDFNAEVQGYEESTILLALEEQCALN
FT                   WQSDTTKDPFGTMTDEGVQEMIDVAQEYLGMDPSVTITPDQVYTNEFITPITQGTVIAA
FT                   PSQEK"
FT   CDS_pept        576769..577461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53483"
FT                   /db_xref="GOA:A4QB86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB86"
FT                   /protein_id="BAF53483.1"
FT                   /translation="MDFDVKPGEFVSIVGQSGSGKTTLLKTISGLQQATEGEVLVNGKP
FT                   IAEQVEDIAMVFQAPVLLPWRNNVNNVLLPLEFRGTKTRESTDRAYQLLEMAGLKGKET
FT                   RYSYELSGGMQQRVAICRALVSNPQLLLMDEPFGALDAMTRDSMNFELQKIWMREKCSV
FT                   LFVTHSISEAVWLGDRVIIVGDRPGHIVADIKIDIPRPRAKEHRFSEVFSDYVAEIESF
FT                   IGVTTGIS"
FT   CDS_pept        577493..579139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53484"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB87"
FT                   /protein_id="BAF53484.1"
FT                   /translation="MHLTSNPARLKELFNLDAQKSLLFSAIRLDSHPLVAPIIATVKDQ
FT                   DPILLVRQQEQGNIFSSGVPRNKIRFYAPWVTIDDAPLEGVEAASSLQELIKELADETP
FT                   VCFAPDIAYAHYLVAQDQVQIAVESLSPEAIDVVELEKGLVEKRFADWRRAGVEEAKKL
FT                   VSGIAHLEGLDQELDRVGADTRFELLQEIASQHALSAIYVASPPNFSEITGIAATEGAS
FT                   VLWSADTQSVFLFLPQGAPAPEGSEAVGSFGSVSEAVALLIGEDKAVGVEEEFIGTALA
FT                   LSLTEGEIIPIQTELGHWRDVRDSEDLPFQVIASRTSVTIMENTLEWTNNRLERGEEFT
FT                   ELDIYAHYLEELEDYALQFTFDVEPYFTNLHSSNRMLFPGPPVDFPINAETRCIQLDAG
FT                   IAVKKDGVVLGTSDMARSLPRTAAGQEAYEYFFKVVREGIIGQLRPGVICADVHEATLD
FT                   YLSPQLPRMIDIGMLGADTDFNTIYRKRNVGHLMGKQESFANELRPGYKHILHHGSYGA
FT                   AEIPWRYNGVAIGTEDLWYIGADKTYILSQR"
FT   CDS_pept        579150..579623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53485"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB88"
FT                   /protein_id="BAF53485.1"
FT                   /translation="MTEIAENLQRLGIELPDLPAPQYSYVPFNRQGNTLYVSGQISRTA
FT                   AGDILAGRVGEDATLEEGIHAAEAATINLLARIHQSIGLDNVAQILKLNVWVNSSDDFI
FT                   QQPQVADGASQLLEAVLGEAGKHARTALPTNTLPQGALVELDAVVAITEASEA"
FT   CDS_pept        complement(579620..579979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53486"
FT                   /db_xref="GOA:A4QB89"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB89"
FT                   /protein_id="BAF53486.1"
FT                   /translation="MTSVIPSSADSATEQRFAPLKSVPSRITDIAEEASDFYKALGDTT
FT                   RLEILYLIFTTKSSRVSANALAHTLNISAPTVTHHMKKLIAANLVNREQCGKWAYFSIN
FT                   SAHIDTVAEIFAHSS"
FT   CDS_pept        complement(580069..580371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53487"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB90"
FT                   /protein_id="BAF53487.1"
FT                   /translation="MGRLLLIILVIVAIVLLWKAFKPSTWKRNAEINQGQAPRAVKGPD
FT                   DDEEFLWNIEKNRFKQRRAEEAAQLEEEERLKRARERYAKPEASDDGTEKPTEDS"
FT   CDS_pept        580448..580801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53488"
FT                   /db_xref="GOA:A4QB91"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB91"
FT                   /protein_id="BAF53488.1"
FT                   /translation="MSRVEYVSESNTPNIQTHQAPELNPELQKAARKNVLIYGLARLLL
FT                   FVVLTLIIHGLALLISAPVPLVMSAMLALIVAFPLSMLVFSKLRMNATQAVSQWDAQRK
FT                   AHKEWVRSELADR"
FT   CDS_pept        complement(580863..581759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53489"
FT                   /db_xref="GOA:A4QB92"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB92"
FT                   /protein_id="BAF53489.1"
FT                   /translation="MSHTEPQPNSVTLSDWIQGARPHTWANAFAPVIAGSGVAAFHDGF
FT                   VWWKALLALVVAWALIIGVNYANDYSDGIRGTDEDRTGPLRLTGSGLAEPKKVKAAAFI
FT                   SFGIAGVAGTALSLLSAWWLILIGILCVLGAWFYTGGKNPYGYRGLGEIAVFIFFGLVA
FT                   VMGTQFTQTGSVSWAGLAAAVGVGSMSAGVNLANNIRDIPTDSKTGKITLAVRLGDAGA
FT                   RKLFLALISTPFIMSICLAFVAWPALIAIIIFPLALKAAGPIRNNAAGKDLIPVIGSTG
FT                   RAMALWAVLTGLALAFS"
FT   CDS_pept        581899..582765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53490"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB93"
FT                   /protein_id="BAF53490.1"
FT                   /translation="MWVGYAVRQIASVFLTLLRMLPLAARNRVARGRIPETGDVVISLT
FT                   THGKRINYVHFTIESIARGHVKAPIVLWLDKPDFDAPWPATIKRLVARGLQVRCSDGFY
FT                   GPHTKYWNQFREIHGTGVRVATVDDDMIYPEWFLQRLLFIGDLRMDAVVAYRAHRIELR
FT                   DDRMLPYVKWSAADTSKASFLHFATGVSGVLYPVTFIDYVVSQGDVFLENCKRADDVWL
FT                   HACALRSDHPIRQVYAQPRHFAVVPTTQVGALVVGNTLMGGNDEQIAKVYTDEDVAKLV
FT                   AASKNED"
FT   CDS_pept        complement(582762..583997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53491"
FT                   /db_xref="GOA:A4QB94"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB94"
FT                   /protein_id="BAF53491.1"
FT                   /translation="MAQVHGASTGFWQNARPKPSATTPNSEPSALESRNMNTRVLEALP
FT                   VDLADPTAILGDLEDAISGKKTFLPIPVQDKTRAQLLRDSQRVGLAIDPSIALVMATSG
FT                   STGTPKGAQLTPLNLVSSADATHQFLGGEGQWLLAMPAHHIAGMQVLIRSLIAGVEPLA
FT                   IDLSTGFHIDAFADAAAELKNTGDRVYTSLTPMQLLKAMDSLQGIEALKLFDVILVGGS
FT                   ALSKQARISAEQLDINIVTTYGSSETSGGCVYDGKPIPGAKVRISDEHIELGGPMIAQG
FT                   YRNAPEHPDFANEGWFTTSDSGELHDGILTVTGRVDTVIDSGGLKLHPEVLERAIADIK
FT                   GVTAACVVGIPDPRLGQAIVAAYSGSISPSEVIEGLDDLPRWQLPKRLKHLDALPSIGP
FT                   GKADRRAIAKLF"
FT   CDS_pept        complement(583945..584358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53492"
FT                   /db_xref="GOA:A4QB95"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB95"
FT                   /protein_id="BAF53492.1"
FT                   /translation="MTMSTTREIAFLIARILLGVILIAHGWDKFAITGLEGVTGFFDSL
FT                   GIPAAGIAAIAAAVVELLGGILIILGVFTRIVAAFVAIDMLFAALFAHVSSGIFVTNNG
FT                   WELTGAIGAGALLLIAVGAGAWSIDGVLAKRKA"
FT   CDS_pept        complement(584437..585999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53493"
FT                   /db_xref="GOA:A4QB96"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB96"
FT                   /protein_id="BAF53493.1"
FT                   /translation="MITATALHGCSLIDGEWVAGKNGEITGFDPRTNASLNPSYSLANR
FT                   AQLRAATTSAKRAFESYRLTTPEVRADFLDSIADNIDDLTEEIVQRASLETGLGTTRLT
FT                   GEVARTSNQLRLFAETVRSGQFHRVRIERGPRIDLRQRQVPLGPVAVFGASNFPLAFST
FT                   AGGDTASALAAGCPVVFKAHNAHPGTAELVGQAVRGAVEKHEFDAGVFNLVYGRGVEIG
FT                   QELAADPNITAIGFTGSRQGGLALSQTAFSRPVPVPVFAEMSATNPVFVFPGALADLDA
FT                   SSSLAEAFTASVTGSSGQLCTKPGLVFIPRGVAGDAFVELVAAKFKETTGQTMLTQGIA
FT                   QAWQRGVDNLAAQPSVKILAQGTPGDGENAPGPVVFESDVQALLNNAVLQEEIFGAASL
FT                   VVRYDSPDQLHQVANSLEGQLTATIHASQDDFQEVSEIIPLLEDLAGRVLYGGWPTGVE
FT                   VGHTVIHGGPYPATSNAQSTSVGTLAIERFMRPVSYQTFPAELLPDPVSEVNKWAVPRE
FT                   IDR"
FT   CDS_pept        complement(585996..586946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53494"
FT                   /db_xref="GOA:A4QB97"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QB97"
FT                   /protein_id="BAF53494.1"
FT                   /translation="MARFSPQDLADHLKDGLLSFPATAFQDDLEVDEVAYVEHIEWQSS
FT                   YPVAGLFAAGGTGEGFSLTVEENHRVTQLAVQASSPEVPVLGSATGSTKSAIANAQGAE
FT                   AAGAEGVLLLPPYLTECDAEGLYNHAAAVCESTSLGVIVYNRANAIYSPEVIARLSERY
FT                   PNFIGFKDGTGNIEHLAKITTLCGDRLFYLGGLPTAETFALPLLQMGMSTYSSAMFNFI
FT                   PDFALSFYADVRAQDSAAVKQKLSDFVLPYLDIRDRAQGYGVSIVKGGLKAVGRNAGGV
FT                   RPPLRNLSEQDIADLSDLLATSGAGSYRLPVEVKA"
FT   CDS_pept        complement(587040..587921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53495"
FT                   /db_xref="GOA:A4QB98"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB98"
FT                   /protein_id="BAF53495.1"
FT                   /translation="MFTLEQLRCFVAVANHLHFGKAAAELSMTQPPLSRQIQKLEKIVG
FT                   ATLLDRDNRKVELTTAGLAFLKDARLILNSTEKAAERARLASSGMWGQLNIGYTAAAGF
FT                   SILGPTLNQLHEKMPGVSVDLFEMVSTEQVDALESGLLDLGIGRLSSPVEGLQTRRLQA
FT                   DSLVLAAPKGHPLLDQNRPLLRKHLTGVPFLQHSPTKAKYLYDIVVRNFTINDAQVQHT
FT                   LSQITTMVSLVASGLGVALVPESAKKLNYSGVEYRHFYDLPVGLAELQAIYSTSNDNPA
FT                   LRRFIKNIDDTF"
FT   CDS_pept        complement(587937..588254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53496"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="UniProtKB/TrEMBL:A4QB99"
FT                   /protein_id="BAF53496.1"
FT                   /translation="MSHNDSPNFARRALNWLRQGYPTGVPRHDTFALFYVLERELTEAD
FT                   LNELVELLIAEGENNGLHDKPITREKIGELITHVHSQPPEDEDIDRIQKKLQAEGFPTR
FT                   N"
FT   CDS_pept        complement(588401..589153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53497"
FT                   /db_xref="GOA:A4QBA0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA0"
FT                   /protein_id="BAF53497.1"
FT                   /translation="MTKLFDSHFHIIDPNHPLTENNGYLPELFTVDDYITRVEGLNVAG
FT                   GAVVSGSFQPFDQGYLKDALAALGPGYVGVTQIPAGTSDQEILDLDKSGVKAVRFNLKR
FT                   GGSAGLDDLETLARRVYDLAGWHTELYVDARELDELESTLTSLPAVSIDHLGMHRDGLP
FT                   ALLRLVENGIKVKATGFGRVELDPAEVIKAIMAADPTALMIGTDLPSTRAKRPFEDADL
FT                   DLIAETVGEDHVDNVFWNNAAAFYLGDQ"
FT   CDS_pept        complement(589157..589576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53498"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA1"
FT                   /protein_id="BAF53498.1"
FT                   /translation="MKDTLTTGLTHQMTYAVPANRTVPNLLPEAAEFETMPDVLATGYM
FT                   VGIIEWACMELLRSHLDDGEISLGTHVNFSHSAPTVPGSTVTIDVEVAEINRRAVTFNI
FT                   TAADEFATISTGTHQRGVVNRDRFVSRLPEAPKEN"
FT   CDS_pept        complement(589573..589698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6024"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR90"
FT                   /protein_id="BAQ21086.1"
FT                   /translation="MLIHCANVRAITTGEITGIVDAKQAATKIFNIRRGTLGETS"
FT   CDS_pept        589741..590274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53499"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA2"
FT                   /protein_id="BAF53499.1"
FT                   /translation="MSDKLYERLANPGFVFGRLPRGLGDREFHRSVGKRASSETWLWVS
FT                   FDEPIKQRENATVGVGRPVVQVCGDAAFSGVTTALKNCGGQAGFGAELGVQRRFGHSGF
FT                   SHDPADSDRADPFCIEQSSGFGEEFLPACRVHANNLTYRSVKRLAFEGNLYGKASGRIK
FT                   TMAKTRPLWKRPGL"
FT   CDS_pept        complement(589864..590148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6025"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6025"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21087"
FT                   /db_xref="GOA:A0A0B6VIC9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VIC9"
FT                   /protein_id="BAQ21087.1"
FT                   /translation="MYSTSGEKFLTEATRLLYAEGISAIGVGRVVAESGVSKSTLYAQF
FT                   GTKAGLSSTVLQRRSDTRKRGITAYLDNRPPDTDSGVLALFDRFIKGYP"
FT   CDS_pept        complement(590301..590564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53500"
FT                   /db_xref="GOA:A4QBA3"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA3"
FT                   /protein_id="BAF53500.1"
FT                   /translation="MNFATIFGSIFEVTLVGILLGAGLPALFALGIRFAHGPSSEGSNA
FT                   FGKIASTICFAIIAVAIIAGILWVTKATIYQYSGFDVFGTEG"
FT   CDS_pept        complement(590564..591829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53501"
FT                   /db_xref="GOA:A4QBA4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA4"
FT                   /protein_id="BAF53501.1"
FT                   /translation="MTELIILLIVIVTALAFDFTNGFHDTGNAMATSIATGALKPKVAV
FT                   ALSAALNLVGAFLSVEVATTVAKGVVDLDQFDLSNAWDSHQLLLVVFAGLIGAIVWNLL
FT                   TWLLGIPSSSSHALFGGLIGAAIASLGFGGVVWEGVLSKMIIPALAAPVVAGLVAAIGT
FT                   FAVYSITKAVGDNEKNRYFRWGQIGSASLVSLAHGTNDAQKTMGVIFLSLVATGHLGTD
FT                   ADIPFWVKATCALAIAIGTYLGGWRVIRTLGKGLVEIDSPQGMAAETSSAAIILTSSHF
FT                   GMALSTTHVATGSIMGTGLGRKGAKVRWSVAGRMAMAWIITLPASAIVGVFCWWIAHGI
FT                   GLISSDLLGVLVAFAILVSLSGYIYARSRRVPVDPSNVNADWNEESNSVEPAAPSTPAA
FT                   PKATEAAEAPAVQDLNENEVTK"
FT   CDS_pept        592977..593129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53502"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA5"
FT                   /protein_id="BAF53502.1"
FT                   /translation="MPRKYSVELKEKAVHQIIEMVRLESCSLHRAYTEVGELWSISSHV
FT                   AGLVP"
FT   CDS_pept        593327..593443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6026"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21088"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK17"
FT                   /protein_id="BAQ21088.1"
FT                   /translation="MRWVHWWNTKRLHEALDYAILQVVETKCYLTQPINTGA"
FT   CDS_pept        594029..594808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53503"
FT                   /db_xref="GOA:A4QBA6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA6"
FT                   /protein_id="BAF53503.1"
FT                   /translation="MQRVYKNVIKASVYEGNGQWGRIDDFHPEQVLFDAGEAWPKSKTD
FT                   QLLNDTDVVPVLEDTPTPTPKTTDLGQRVGYVRVSSTDQNLARQREAIGAVDREFVDEL
FT                   SARSRAQRPSLEECIAYLRNHDELVVASIDRLARSLVDLRSIIDQITAKGASVSFIKEG
FT                   LVFSATDQDPRATLMLGILGSFAEFERSIIRERQAEGIALAKKAGKYSGRKKALSPAQI
FT                   KQARDRIDAGESKTAIAQDLGVGRATLYRYLMTDNKR"
FT   CDS_pept        complement(595033..597774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53504"
FT                   /db_xref="GOA:A4QBA7"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA7"
FT                   /protein_id="BAF53504.1"
FT                   /translation="MKGNVKDIYTIFDGTDKELIIPVYQRNYDWGEKQCERLYNDLVDV
FT                   IRKDRPKHFFGAVVGKPETGFTWVVIDGQQRLTTTSLLMLALSNSLARGILTSKDPELA
FT                   DKIRRNYLEGADSSVTKETKLKLKPVKHDLEAYRKLLADEEPIEKSTVTANYRYFMDRI
FT                   AQGELTGDELWDALCRLEAMILDLEAHDDPQRIFESLNSTGKELKESDKIRNLVLMGLP
FT                   SKTQEHLYEYFWNRLERNVHFDTDAFVRLYLVSTTRKTPRFDAVYEAFREYLETSGISV
FT                   QDVLELMRNYSEYFRDLNSASTGIARADTRLRRFNLLRHEVTMPALMPLLGDYRSGDIT
FT                   ADDFADTIELVDAYIFRRLVVGVPSNALNKIFATLYSDARRLRTEGTKITDIIAYLLLR
FT                   RAGTSGRFPTDEEFQEAFSTRNFFNFTAANRRYLFECLENTWSKDNRAIATAIERGDLS
FT                   VEHVMPQTLTKDWREELGSQAEEVHQTWLHRIGNLTITGYNSEYSNASFTTKKTTKDGF
FT                   DSSPYRLNEYIKQAVTWAEDDIRHRNKTLTQIALRYWPMIDTDFEPVREPLPTLPMGDD
FT                   TSFTNRIIVSYEFDGTTTTVKSFKDMIIFVIRQLLAEHREMMYEYATGNGLGFTLGKTG
FT                   SSRYQEELAPELWVTVSNPTNDKMNILRALFNHLDIDTDDLVFTLRPHQGEAPEAADQN
FT                   PYAELIKFAPQFESLEGTDATENDIAELRAEFGKVFNDFEIEDWQKVTNGRGYVQLAEA
FT                   PAVAELSVEEVLATIMMIKVIESMAPGIFLRTVTEGALARWLNRIAELTEPKKTAGGRN
FT                   TAAMWEKLHQLVDAIPRGKWVSYGDLAKAIKSGAQPVGNYLAANPVEKAYRVLRADGTV
FT                   SEGFSWLDENDKRSPRELLEHEGIRFDDVGRAASVQRWEIPE"
FT   CDS_pept        complement(598201..598653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53505"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA8"
FT                   /protein_id="BAF53505.1"
FT                   /translation="MRPTSGSATGGATSDLAITAGGQTLDFYLSPKRNVAAAKRFLAKT
FT                   LRSNTITGSPRVINTDKAPSLTRAIAELKSEGICPPTVEHRQVKYLNNILEGDHGRLKR
FT                   ILGPKVAFKNLDICISDVERDGGDALDSRKGQGTMFALTGNRTRTR"
FT   CDS_pept        complement(598610..598732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6027"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VMC2"
FT                   /protein_id="BAQ21089.1"
FT                   /translation="MPDRQVPDRQVPDRQVPDRQASSWRVDETYIRVGDRWCYL"
FT   CDS_pept        complement(598865..599161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53506"
FT                   /db_xref="GOA:A4QBA9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBA9"
FT                   /protein_id="BAF53506.1"
FT                   /translation="MTLGSARERLLDAARKRFYADGVHATGIDTITSEAGVAKKSLYNN
FT                   FSSKAEIVSTYIDSRHEEWLDLYRQHTAKASTARDRVIAVLLQSWGSRKIDVK"
FT   CDS_pept        599297..599968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53507"
FT                   /db_xref="InterPro:IPR019884"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB0"
FT                   /protein_id="BAF53507.1"
FT                   /translation="MALSFNVYLSGEIHTDWREEIQRGAEAAGLDVVFTAPVTDHPASD
FT                   AAGDHLGEAPAGFWRDHQSSKVNSIRTRSLIEKADMVVVRFGDQYKQWNAAFDAGYCAA
FT                   LDKPYATLHGEDIVHPLKEVDAAAQAGCTTTDQVVEILRYMLEAEEALLSCASPLSRQA
FT                   QRHGEPTLSPRPEFHRTAVGFRNCIDDRQPQALACPRGPLRPCEGLHPRADLRRVQLRP
FT                   T"
FT   CDS_pept        complement(599771..600805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53508"
FT                   /db_xref="GOA:A4QBB1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB1"
FT                   /protein_id="BAF53508.1"
FT                   /translation="MKLSLRARITVVFLGTVLGVGLALIGLVYAYLKLTPVPFMAQIPT
FT                   PDEGLVIDGAVPIADEVLRRVLVASLTVLALLTAVAGVIGWFVAGLVIKPLRDFADDAA
FT                   TVTRGDLSARISHQGPDDEVGELADALNAMLDELADGLERQRRFASNASHELKTPIATI
FT                   QTMADVALASGDEQILRETLGRVREVNARAADTVAALLQLANVDVRDRQEVDLAALCRD
FT                   IGCGQGVPVTAEALTVAASPTLVRQAVENMVCNGLTHGEDPSVTVAQAGRNAEITVESG
FT                   GPQLDAAEVRTWVEPFARAQRTAGAGQGLGLAIVDAIAKAHGGSVELRPRAQGGLAVTL
FT                   RLPA"
FT   CDS_pept        complement(600802..601476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53509"
FT                   /db_xref="GOA:A4QBB2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB2"
FT                   /protein_id="BAF53509.1"
FT                   /translation="MTIRVLVVDDESYLADAICTALNSAHMQATTVYDGATARSSIDDI
FT                   RPDVVVLDRDLPGIHGDDICRWVVDTHPATRVIMLTASGALDDRLAGFDLGADDYLPKP
FT                   FEVSELIARVNALAKRNLPVRGEVYRCGDVRLDTFRREVTRGGVAVPLSPKEFAVLEVL
FT                   MEAAGGVFSAEDLLAEAWDENADPFTNSPRVTVSHLRKKLGEPRIVHTVAGAGYYVAEV
FT                   PR"
FT   CDS_pept        601553..602440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53510"
FT                   /db_xref="GOA:A4QBB3"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB3"
FT                   /protein_id="BAF53510.1"
FT                   /translation="MQNRNVGIDVARAVALVGMMVAHLTYLDGVAVQVFYGFPAALFAF
FT                   VSGVSMGYMRARPAQLIVRGLCLIALHFALAPFTGQVFVVLGTIGLCMALLAWAPRWSS
FT                   PVLLWLACVLAFGSAVLASTATVLIPAFWPYSPLMWGALMIAGMLFRWHMLSPKLLWLG
FT                   LVVGLGLFAVDLALRWYTMLPEFFDVGGHTGGLGDITGSIGASVGICSLCCLLQRWIGW
FT                   LAPLGRMPLTIYCIHVLTADRLAPEWFGFWVSFGGAILISYAWLAVCDRGPLETLLRRI
FT                   TAVFGKDKNEEVRS"
FT   CDS_pept        602421..603302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53511"
FT                   /db_xref="GOA:A4QBB4"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB4"
FT                   /protein_id="BAF53511.1"
FT                   /translation="MKKFAASVAAGVVAAGALAIAPAGAMESKTFAGDTEEAKPVVSVR
FT                   VDDSDPEEGVCTGTAIDRHWVITARHCIDAAAKPGGSVRIGQGDEQRVYKVDRHEVAPR
FT                   GDIALLHTEQEINLETFAEIADEVPTGDVNIYGWSSDGSGGSTKLPSAKAKVRGDSPLA
FT                   LYEAPKALDVALKDGDRIQPGDSGGAIFADGKVAGIMSAGLFEDPENPTEEEMTSNAAV
FT                   SVAPVAEQADWIRGTIGGDAKDGDKKEDTSEPAAAASSEDSGNTARNVGIGAGVVVLAA
FT                   AGAWLLLRRRGA"
FT   CDS_pept        603605..603769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6028"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR91"
FT                   /protein_id="BAQ21090.1"
FT                   /translation="MPVDHTTILTAGYRNTPLSWTSTLGGTGQVPDWQASSWRVDETYI
FT                   RVGDRWCYL"
FT   CDS_pept        603726..604178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53512"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB5"
FT                   /protein_id="BAF53512.1"
FT                   /translation="MRPTSGSATGGATSDLAITAGGQTLDFYLSPKRNVAAAKRFLAKT
FT                   LRSNTITGSPRVINTDKAPSLTRAIAELKSEGICPQTVEHWQVKYLNNVIEGDHGRLKR
FT                   ILGLKGAFKNLDICISDVERDGGDALDSRKGQGTMFALTGNRTRTR"
FT   CDS_pept        complement(604418..605335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53513"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB6"
FT                   /protein_id="BAF53513.1"
FT                   /translation="MSKKSQEPRNYRTGRASATAGAGIFSTINKADRVAFYDRSIVLSR
FT                   IFANDPNSWVLKGGTALIWRDTTARSTRDIDLFNSAAEDINEALHALRNSLETISTAPS
FT                   DVHLVIDSAKIDVSAQGNRQQAALQVRLQSASGMPLSNTPVKIDLVVGCHVTGEVDAHP
FT                   TDGLEKVLQSHVPHIRLYPIVDHLADKVAATMQSYPSSDGDSPSSRVHDLIDIAHIAVT
FT                   EEINGTQLLVAIESERIQRGLPPYEQGFQCPPHWAELYRKRKGSKGSAPQSFDEAVDIA
FT                   KRLIDSAIFGKSLGMTWKDGSWHA"
FT   CDS_pept        complement(605301..606275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53514"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB7"
FT                   /protein_id="BAF53514.1"
FT                   /translation="MRIEEIATLASDQNGLFTTAQAARLEVDRVTLHRAARNGVVRSIR
FT                   HGVYIFESAPFSPDEELRAAWLSLDPSRTVAERLQTPEQIVICTTSAAQQYGIGDFDTP
FT                   QHEFYSAQRKQTRADDIRLRIRTLDNEDIEIRDGLPLTTPTRIILDLLEERHDLVHISR
FT                   LIADAARKGLKVEWSRLATHAHKFAGDYQLTDDGLLQALAESSESTSDTAMAALSMLES
FT                   SSHLNDLFNKDLANLVGGFSKHLTIQMPEIPDLAAQLSRVQLPDIADQIPDLGFLPNVH
FT                   SQIHDYLHHDNAVNFTKDSHTSTNKKEMRNTSNEQEKPRTTQL"
FT   CDS_pept        606626..607357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53515"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB8"
FT                   /protein_id="BAF53515.1"
FT                   /translation="MAPLLATPEQVTRISELLAVKAHSDNGKVITVGTTRFRASRSTLP
FT                   ALSMTVAQRLINALQSAEVKPDVPAGMFTAISGNWFMRIKKSDYVEGEPAVIMRRDGSH
FT                   VNVLMHGIVEDLDDEYYAIEFSDQDKEKRTQAAPLDSNYASYTFLRNAPDGSRVWGLKV
FT                   PSQVYVHHGFVDVRKANGALKSEPMGHIVTDASTHVICEIEQQSLSSCTVCGERRGRLL
FT                   FDGVKCLKCGFDLIAYNNEKR"
FT   CDS_pept        complement(607997..608449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53516"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBB9"
FT                   /protein_id="BAF53516.1"
FT                   /translation="MRPTSGSATGGATSDLAITAGGQTLDFYLSPKRNVAAAKRFLAKT
FT                   LRSNTITGSPRVINTDKAPSLTRAIAELKSEGICPQTVEHWQVKYLNNVIEGDHGRLKR
FT                   ILGPKVAFKNLDICISDVERDGGDALDSRKGQGTMFALTGNRTRTR"
FT   CDS_pept        complement(608406..608570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6029"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR91"
FT                   /protein_id="BAQ21091.1"
FT                   /translation="MPVDHTTILTAGYRNTPLSWTSTLGGTGQVPDWQASSWRVDETYI
FT                   RVGDRWCYL"
FT   CDS_pept        608666..609190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53517"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC0"
FT                   /protein_id="BAF53517.1"
FT                   /translation="MTTGEGTYGCDYFTSLFLLPQLCNNTVSRSDPLDVLFVARTFPVL
FT                   SYPVENQLADKVCAMYEVHGSRASTRYRDLYDIGLIALELEVDTEKLRTALQNQQHIRA
FT                   ITLPSRMVLPGEEWLIGYEKFISTLQQPRAELHGVDNALVVAGALLDPILTDDGQTLAP
FT                   SGDTPTCTGPS"
FT   CDS_pept        609477..611009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53518"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC1"
FT                   /protein_id="BAF53518.1"
FT                   /translation="MATAQSERIIAPEDRDTYVSEFQYDVNNPPVVDGVGGLTEAEIAE
FT                   IQDKIQQAEASGPPQDEIIPGQMWSDKVGIPEGYDKTEADRSEVAIATEQSQPQARTFM
FT                   ATAERCKSFWLIPFKVCGEILDRYEALGGETSWLLLPIEHQSINPDGQGHRQRFVGGVI
FT                   YQHPDTGAHAVSPMTMALWQRHGWEAGWLGYPLGGEVPVEGSTTIDGEISGWVQQFQGG
FT                   RVYRTPILEGFQIASINGVILDKWLELGGPSGYLGFPIADEAGVTDGMGRFSIFQRGEI
FT                   YWAPGLGAHAVSGTILDDWKSAEGPAGDFGYPIAPMEWVDEFTYIQSFEGGEIQGEVSQ
FT                   GFAPRGLTSQYIQADSQEEADAYFDAIEDEWIAESLGSPGISLMQKGAPVTYGPCILKP
FT                   NNIHIRTKSGESDFGIVGFKPSTTCTKPVSSIQHTTNLRYKYYQWWLKAASATAYSDPG
FT                   LTTTLVQKNIEHHCRGHVDTWFWGTAAGVINYGGKEYYARVYPDIARFSCRV"
FT   CDS_pept        611195..611470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53519"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC2"
FT                   /protein_id="BAF53519.1"
FT                   /translation="MDCGKNSSWRPVHGEPVIVAFSPGYSMEEGACPGGEEPVDVRSFL
FT                   DRDTAVNYLRWFDRNLSPEFWEHEFWEVELGWEASGLKELMKSWQE"
FT   CDS_pept        612069..612779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53520"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC3"
FT                   /protein_id="BAF53520.1"
FT                   /translation="MGIFSGRQFPREIILWAVRWYCRYGVSYRDLEEMMTERGVPVDHT
FT                   TIYRWVQKYAPELDKKTRWYRQVPDWQARSWRVDETYIRVGGKWCYLYRAITAGGQTLD
FT                   FYLSPKRNVAAAKRFLAKTLRSNKSAGYPRVISTDKAPSLARAISELKAEGVCPSTVEH
FT                   RRVKYLNNVIEGDHGRLKRILGPKGAFKNRTSAYRTLKGMEAMHSLRKGQGTMFAYGHP
FT                   NPDAVIVSRVFETA"
FT   CDS_pept        complement(613201..613287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53521"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC4"
FT                   /protein_id="BAF53521.1"
FT                   /translation="MAEELNENYPGGRERAEEELKAWIMQST"
FT   CDS_pept        613806..613955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53522"
FT                   /db_xref="GOA:A4QBC5"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC5"
FT                   /protein_id="BAF53522.1"
FT                   /translation="MLGMTFFLDFIVAPLVQVVTIVLGGWLLDPTGVRTSWKDFLGGGS
FT                   PELT"
FT   CDS_pept        614499..614759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53523"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC6"
FT                   /protein_id="BAF53523.1"
FT                   /translation="MTFTTKYQNWPEASVVDLSDIALEGDALDAASVLTPVVGFLRLLE
FT                   GLDLDASRDWRATADELENVINDLRDLAADMLARQQQEELR"
FT   CDS_pept        614759..615160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53524"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC7"
FT                   /protein_id="BAF53524.1"
FT                   /translation="MEDRISCAYCGGLIPPRPDPRGRRAKYCSNACRAAASRERTSKRH
FT                   ADELEAARSQMSLAVLPPAQMSSMIVTELEAVERIIRDRGEVPEAMTAIVNAAFRVAVA
FT                   AQDATPPPPPALNRQQRRASKKSPSGRKR"
FT   CDS_pept        615313..616023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53525"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC3"
FT                   /protein_id="BAF53525.1"
FT                   /translation="MGIFSGRQFPREIILWAVRWYCRYGVSYRDLEEMMTERGVPVDHT
FT                   TIYRWVQKYAPELDKKTRWYRQVPDWQARSWRVDETYIRVGGKWCYLYRAITAGGQTLD
FT                   FYLSPKRNVAAAKRFLAKTLRSNKSAGYPRVISTDKAPSLARAISELKAEGVCPSTVEH
FT                   RRVKYLNNVIEGDHGRLKRILGPKGAFKNRTSAYRTLKGMEAMHSLRKGQGTMFAYGHP
FT                   NPDAVIVSRVFETA"
FT   CDS_pept        616140..616487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6030"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21092"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VID1"
FT                   /protein_id="BAQ21092.1"
FT                   /translation="MESQQSENIVDEELLYPALPGDIEIPQTVSANSLVKVVEIGNWEP
FT                   TQNPNSIIVPGAMRSDRESIPGGFTKEEADRAEIEEAKLANTPFLRVQSDTACKVYWPS
FT                   PFQVCGEIRKL"
FT   CDS_pept        616707..617657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6031"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21093"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VK19"
FT                   /protein_id="BAQ21093.1"
FT                   /translation="MGDQWFKQSYQGGHIITRNSVPAVQAGIYGQIYEKWVELGSQNSA
FT                   LGFPISSEFVASDGVGRYNIFERGVMYWHPEYGAHAVTGDLLLQWAYSGGIEGVLGYPA
FT                   GDPELQDDGWYRQAFADGFLHGKQLSTFFPAWDEFAWDDSAGGEPGVLMSRQAANYDKG
FT                   PAGGNKYTDQVVLETEDMCGNEIILRRGWYNSDASRKDKPWGYDKIRHKHGVFSLWSVS
FT                   TVFENSCINRIEGTQQVYEEEVYQVKCDRLFLNCEQTGQSFVYRGIYERNIYKPGATEP
FT                   LGLRTFFPVHNEGTHGSSDVTPTWFSTDIPTLDLW"
FT   CDS_pept        617657..618115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6032"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VMC8"
FT                   /protein_id="BAQ21094.1"
FT                   /translation="MTYKADYDLDLEKVVFRMSQLFEDLIPSENAFDYYDKSTWPTLTM
FT                   AATWVQDDCLLIVFRVEESRGETFVGYFSRISPRYNPDNIEFGAVELMYADSIAGDWFI
FT                   EKVDLKAPQKIHWRNTHHSLNTPADIEELLDYANEIPMWLSPDLEKWM"
FT   CDS_pept        618115..618168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53526"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBC9"
FT                   /protein_id="BAF53526.1"
FT                   /translation="MHNKTMVIQLYLAELGM"
FT   CDS_pept        618743..619351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53527"
FT                   /db_xref="GOA:A4QBD0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD0"
FT                   /protein_id="BAF53527.1"
FT                   /translation="MGHEFGYARVSTNDQDARLQHDALTKAGCYRIFTDTASGSLESRP
FT                   ELDKLLDQLRPGDTLVVWRLDRLGRSIRHLIDQLATLQERGVEFRSLQENIDTSSSGGR
FT                   LVFHIFASLAEFERDLIRERTNAGLEAARARGRTGGRPPSLSGDKLRTARKLYEQKDMT
FT                   VAQIGEVLGVSRTTVYRALRRDTGALPTRKQASPGPLPG"
FT   CDS_pept        619441..619875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53528"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD1"
FT                   /protein_id="BAF53528.1"
FT                   /translation="MFVFTDPPRLTLLFVSEKETRRECCVGLLRGTARIKKLLKPPGKL
FT                   VTHYLEWEEIRSKEPGLEDAAQGTLVHLVLHSALPDPGLISFVFPGQDLILATLDEEIA
FT                   RLVLEDERSRISPEFVQLWSVPVGWEVPGLEDFLDRARGG"
FT   CDS_pept        620168..621187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53529"
FT                   /db_xref="GOA:A4QBD2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD2"
FT                   /protein_id="BAF53529.1"
FT                   /translation="MTRYGTLLGLHGKPKDRVIIMRKGSKTTRVKFPHKDRPGFNLEEV
FT                   KVDASTVLDDGGELWEKYQRTPNSATFVSFSGEPQGHLHVQRVYKNVIKASVYEGNGQW
FT                   GRIDDFHPEQVLFDAGEAWPKSKTDQLLNDTDVVPVLEDTPTPTPKTTDLGQRVGYVRV
FT                   SSTDQNLARQREAIGAVDREFVDELSARSRAQRPSLEECIAYLRHHDELVVASIDRLAR
FT                   SLVDLRSIIDQITAKGASVSFIKEGLVFSATDQDPRATLMLGILGSFAEFERSIIRERQ
FT                   AEGIALAKKAGKFTGRKKALSPEQVAQARRRVEAGETKTAIAQDLSVSRATLYRALAE"
FT   CDS_pept        complement(621400..621852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53530"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD3"
FT                   /protein_id="BAF53530.1"
FT                   /translation="MDETYIRVGGTWCYLYRAITAGGQTLEFYLSPKRNVAAAKRFLAK
FT                   TLRSNTTAGSPRVINTDKAPALAKAISELKAEGICPQTVEHRQVKYLNNVIEGDHGRLK
FT                   RILGPKGAFKNRISAYRTLKGMEAMHSLRKGQGTMFDLTGTRTQTR"
FT   CDS_pept        complement(621845..621982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53531"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD4"
FT                   /protein_id="BAF53531.1"
FT                   /translation="MTERGVPVDHTTIYRWVQKYAPELDKQTRWYRQVPDWQAKFLAGG
FT                   "
FT   CDS_pept        622029..622187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6033"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VPR2"
FT                   /protein_id="BAQ21095.1"
FT                   /translation="MHRPQDDVTGEMPTGEDAHGSDYFTPVFLLPQLCNNTLLGARAFR
FT                   HWNLTAT"
FT   CDS_pept        complement(622195..623559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53532"
FT                   /db_xref="GOA:A4QBD5"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD5"
FT                   /protein_id="BAF53532.1"
FT                   /translation="MRTENRRQCHNGVVKKNDHGTTGTSESFRIRGSIPDIPRETRWDR
FT                   LWRPFWAIPAASVVAALVFGFLLPTWERGLSDAALKFVFEGGPDAAREVLGTIAASTIS
FT                   VTGLIFSITLVVLQLVSSQFSPRMLNGFLRNRIVQATLAMFLGTFVFSLTVIRYVWSED
FT                   EDITGFVPRASVSVAFLLVLGCLGLFLAFIRLITFSMRVANAISEIGEETMALAARIYP
FT                   VQSDDAGPVQGPGWSPRPGDPREEIRVGSHGSLVWIDYRKLVSWSTEHQAVITVDRPVG
FT                   DFLVEGQPLLRVWWDGELSDRDRRVLHSAIEVRTERELHQDVAFGLRQLVDIADRALSP
FT                   GINDPATAAQCVQEIHRIFRYLVTVIEPSPYIADDDGRVRVVHQPQRIADMLYEVIREI
FT                   HLYGADSAMIPRLLRTMVEDLVTAAADHSLPAVERARGILDDETDEDRDSDTANV"
FT   CDS_pept        623775..623936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53533"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD6"
FT                   /protein_id="BAF53533.1"
FT                   /translation="MPVDHPTIYRWVQKYAPELDKQTRRYRQVPDWQASSWRVDETYIR
FT                   VGGKRCYL"
FT   CDS_pept        complement(624564..625523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53534"
FT                   /db_xref="GOA:A4QBD7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD7"
FT                   /protein_id="BAF53534.1"
FT                   /translation="MSNYSTENPFDPTQWATVPGFEEFTDITYHRHVGTTRADGIVRIA
FT                   FDRPEVRNAFRPHTVDELYQALDHARRTPDVGTILLTGNGPSEKDGGWAFCSGGDQRIR
FT                   GRSGYQYATEHAHDDATADVSTVDTARTKVEGGRLHILEVQRLIRTMPKVVIAVVNGWA
FT                   AGGGHSLHVVCDLTIASRQEARFKQTDADVGSFDAGYGSAYLAKMVGQKNAREIFFLGR
FT                   TYDAERMQQMGAVNIVADHGDLEKEAIQAAREINTKSPTAQRMLKFAFNLTDDGLMGQQ
FT                   VFAGEATRLAYMTDEAVEGKEAFLEKREPNWNEFPYYY"
FT   CDS_pept        complement(625535..625846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53535"
FT                   /db_xref="GOA:A4QBD8"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD8"
FT                   /protein_id="BAF53535.1"
FT                   /translation="MCAILRQDGAMNSLFDVSPHWSSANAKLTAHFNTGKFSTGMKFVN
FT                   LIADSAEEANHHPDILLTYGFVEITLTSHDVGEITDRDVALAKVIDAHAKTLNISAEA"
FT   CDS_pept        625845..626450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53536"
FT                   /db_xref="GOA:A4QBD9"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBD9"
FT                   /protein_id="BAF53536.1"
FT                   /translation="MRLLLTSFGHDHIRDFVRGTVAYIPDATRLFADSPEAAPFMETER
FT                   NMLREHGLSIRELPISTSTPEEVDQVLGEVDGVYVAGGETFDLMWLLRSTGNDEVLIKH
FT                   VRAGLPYIGTSAGAVIAGPSIEPISLLDSPDVAPNLSDYSGLGLCEHVVVPHAGGTIPQ
FT                   FPIDVFAETVRTYGAEFPLVLLKDGQALLIDDHGVHLI"
FT   CDS_pept        626462..627478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53537"
FT                   /db_xref="GOA:A4QBE0"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBE0"
FT                   /protein_id="BAF53537.1"
FT                   /translation="MSTPTVDEILERAHVVSLPMRVKFRGVTTREALLIEGPAGWGEFA
FT                   PFLEYDPQESASWLKSGIEAAWEGFPAPLRDRVEVNATIPAVPVDQVAEVLDRFPGCRT
FT                   IKVKVAEPGQTLTDDIARVAAVREARPGAIIRVDANCGWSVEQAVEAAQALAPLDYLEQ
FT                   PCATVEELAEVRMTVQRRGLFVRVAADESIRKSDDPYRVADLRAADVAVVKVAPLGGVK
FT                   RVLEVAQHLRARTMDITVASALDTVVGMNAGLAAVAALPKLDDDDLIDVPPAAAGLATS
FT                   QLFLEDVATPHAITDGFMETRVIAPEMDRLETLAASKDRRDWWFARVRESYPYLETI"
FT   CDS_pept        627489..629120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53538"
FT                   /db_xref="GOA:A4QBE1"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBE1"
FT                   /protein_id="BAF53538.1"
FT                   /translation="MSSTPAQDLARAVIDSLAPHVTDVVLCPGSRNSPLSLELLARQDL
FT                   RVHVRIDERSASFLALSLARTQARPVAVVMTSGTAVANCLPAVAEAAHAHIPLIVLSAD
FT                   RPAHLVGTGASQTINQTGIFGDLAPTVGITELDQVAQIAESLAQRASQIPRHFNLALDV
FT                   PLVAPELPELHGEAVGASWTHRWINHGEVTVDLGEHTLVIAGDEAWEVEGLEDVPTIAE
FT                   PTAPKPYNPVHPLAAEILLKEQVSAEGYVVNTRPDHVIVVGHPTLHRGVLKLMSDPEIK
FT                   LTVLSRTDIITDPGRHADQVGSTVKVTGTQEKQWLKICSAASELSADGVRDVLDNQEFG
FT                   FTGLHVAAAVADTLGTGDTLFATASNPIRDLSLVGMPFDGVDTFSPRGVAGIDGSVAQA
FT                   IGTALAVQSRHPDEIRAPRTVALLGDLSFLHDIGGLLIGPDEPRPENLTIVVANDNGGG
FT                   IFELLETGADGLRPNFERAFGTPHDASIADLCAGYGIEHQAVDNLQDLIIALVDTTEVS
FT                   GFTVIEASTVRDTRRAQQQALMTKVR"
FT   CDS_pept        629121..629564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53539"
FT                   /db_xref="GOA:A4QBE2"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBE2"
FT                   /protein_id="BAF53539.1"
FT                   /translation="MEWYQVRRRTRQLLIVIYIAAMLGAASMVIGPFLNDRTIEGNSGR
FT                   ALAQVTNVGSYRTTVDFQDENGIYHSPATGLLYPTGLGEGQRVWVNYAKSDPDLVKVEG
FT                   RKWTLSIIPALSVAAVATTIWSVLWLGVGRFGRRSDDANETTV"
FT   CDS_pept        629670..630911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53540"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBE3"
FT                   /protein_id="BAF53540.1"
FT                   /translation="MEIIRPMRVAIVAESFLPNVNGVTNSVLRVLEHLKANGHDALVIA
FT                   PGARDFEEEIGHYLGFEIVRVPTVRVPLIDSLPIGVPLPSVTSVLREYNPDIIHLASPF
FT                   VLGGAAAFAARQLRIPAIAIYQTDVAGFSQRYHLAPLATASWEWIKTVHNMCQRTLAPS
FT                   SMSIDELRDHGINDIFHWARGVDSKRFHPGKRSAALRKSWDPSGAKKIVGFVGRLASEK
FT                   GVERLAGLSGRSDIQLVIVGDGPEAKYLQEMMPDAIFTGALGGEELATTYASLDLFVHP
FT                   GEFETFCQAIQEAQASGVPTIGPRAGGPIDLINEGVNGLLLDVVDFKETLPAAAEWILD
FT                   DSRHSEMCAAAWEGVKDKTWEALCTQLLQHYADVIALSQRIPLTFFGPSAEVAKLPLWV
FT                   ARALGVRTRISIEA"
FT   CDS_pept        631041..632402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53541"
FT                   /db_xref="GOA:A4QBE4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBE4"
FT                   /protein_id="BAF53541.1"
FT                   /translation="MSNRHLQLIAIGGAIGTGLFMGSGKTISVAGPSVILVYAIIGFML
FT                   FFVMRAMGELLLANLNYKSLRDAVSDILGPGAGFVTGWTYWFCWIATGMADIVAITGYA
FT                   QYWWPEIPLWLPGVLTIALLFALNLAAVRLFGEMEFWFAIIKIVAIVSLIVVGLFMVVT
FT                   AFESPNGTTAQFNNLIEHGGFFPNGITGFLAGFQIAIFAFVGIELAGTAAAETENPTKT
FT                   LPRAINSIPIRIVVFYVLALAVIMMVTPWDQVSADNSPFVQMFALAGIPAAAGIINFVV
FT                   ITSAASSANSGIFSTSRMLYGLSLEGAAPKRWSRLSKNLVPARGLTFSVICLIPAVGLL
FT                   YAGGTVIEAFTLITTVSSVLFMVVWSYILVAYIVYRRNSPELHKKSIFKMPGGVVMAVV
FT                   VLVFFAVMLVVLSLEPDTRAALIATPVWFIILGIGWLSVGGAKGAKRRSQIASH"
FT   CDS_pept        632427..633119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53542"
FT                   /db_xref="GOA:A4QBE5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBE5"
FT                   /protein_id="BAF53542.1"
FT                   /translation="MAKADLDKDPFDVASMFDDVGKNYDLTNTVLSFGQDRVWRKRTRQ
FT                   RLDLKPGEKVLDLAAGTAVSTVELAKSGAFCVACDFSQGMLAAGKDRDVSKVVGDGMQL
FT                   PFADNSFDAVTISYGLRNIHDFRAGLKEMARVTKPGGRLTVAEFSTPVIPVFGTVYKEY
FT                   LMRLLPQVARAVSSNPEAYIYLADSIRAWPSQAELAREINQNGWSDCGWQNLTFGIVAL
FT                   HSAIKPEN"
FT   CDS_pept        complement(633103..634557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53543"
FT                   /db_xref="GOA:A4QBE6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBE6"
FT                   /protein_id="BAF53543.1"
FT                   /translation="MGTGWNGSAATHSSLPLVIECGFILSVNPVKWTKSFLFNRSRRKA
FT                   LEAPWVSLLALRTETMGFVSTTFDVLIIGAGPSGASAAVHAARAGLQTLLIDASSFPRD
FT                   KTCGDGLTPRAIHQLELLGVADQVTGDYFNKGLKLHGFGGSVEAPWPETYFTNKGSAMS
FT                   RMEFDDLLFRLAKSHEEVTTWENASAQDPILRGNFLEGVVINHAGQEKTVKAKHVIIAD
FT                   GVRSPFGKKLGRQWHRDEVYGIAARAYCETPLSDEPWIHSHVELRDEDGVVQPGYGWIF
FT                   PLGNGTVNLGCGALSTDKRPAKINTKKLLSFYAGQRRKAWQLGPEHDVASALLPMGGAV
FT                   SNVAGANWMLIGDSAACVNPLNGEGIDYGLETAAMAVDTLVENPKRDLTLVWPHRLRDA
FT                   YGETFMLARTAARLLTYPQFLPMAGPLAFRGPLQKAIMPAAARLMGNLITEEDKDLLAR
FT                   GWQAAGSAISWARKGSPLWDSTSSLV"
FT   CDS_pept        complement(634442..634594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6034"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VR95"
FT                   /protein_id="BAQ21096.1"
FT                   /translation="MLLWWIHLLFRARGNGLERFGRYSFIATFGDRVWIHSFGESSEMD
FT                   KKLFV"
FT   CDS_pept        634522..635574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53544"
FT                   /db_xref="GOA:A4QBE7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBE7"
FT                   /protein_id="BAF53544.1"
FT                   /translation="MSSGRTVPTRSHGLGKEGVSTTGASQVEFGDPELTARINDAMVQV
FT                   EELLHTELSSGEDFLVDIVMHLTRAGGKRFRPMFALLASEFGEKPLSENVIKAAVVVEI
FT                   THLATLYHDDVMDEASMRRGVPSANARWDNSVAILAGDILLAHASGLMSQLGTDTVAHF
FT                   AETFGELVTGQMRETVGPRDTDPIEHYTNVIREKTGVLIASAGYLGAMHAGAAPEHIDA
FT                   LKNFGAAVGMIFQIVDDIIDIFSETHESGKTPGTDLREGVFTLPVLYALREDTPVGAEL
FT                   RDILNGPLEDDETVNHVLELLSQSGGRQAALDEVYRYMDIANAELDRLPDSTVKEALRN
FT                   LATFTVKRVG"
FT   CDS_pept        637257..637592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53545"
FT                   /db_xref="GOA:A4QBE8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBE8"
FT                   /protein_id="BAF53545.1"
FT                   /translation="MSDEQNSGVGGTSRPTGKRQLSGASTTSTSSYEAKQVSAQKKSSD
FT                   SDSKPGGGVVSFLPEVVGEVRKVIWPTARQMVTYTLVVLGFLIVLTALVSGVDFLAGLG
FT                   VEKILTP"
FT   CDS_pept        637821..638777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53546"
FT                   /db_xref="GOA:A4QBE9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBE9"
FT                   /protein_id="BAF53546.1"
FT                   /translation="MSDENINKFEQDEDLNFGASFSDEFADDDFDAEADVEADAAAEAS
FT                   ALEAEQDLEEETLDAPEEAAEEAPAAAESEAPVEEDEEADSLAQAAAALGDTDEQDADA
FT                   EYKARLRKFTRELKKQPGVWYIIQCYSGYENKVKANLDMRAQTLEVEDDIFEVVVPIEQ
FT                   VTEIRDGKRKLVKRKLLPGYVLVRMDMNDRVWSVVRDTPGVTSFVGNEGNATPVKHRDV
FT                   AKFLMPQEQAVVTGEAAAAADEGEQVVAMPTDTKKPQVAVDFTVGEAVTILTGAFASVS
FT                   ATISSIDPELQKLEVLVSIFGRETPVDLSFDQVEKVS"
FT   CDS_pept        639045..639479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53547"
FT                   /db_xref="GOA:A4QBF0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBF0"
FT                   /protein_id="BAF53547.1"
FT                   /translation="MAPKKKKVTGLIKLQIQAGQANPAPPVGPALGAHGVNIMEFCKAY
FT                   NAATENQRGNVVPVEITVYEDRSFDFKLKTPPAAKLLLKAAGLQKGSGVPHTQKVGKVS
FT                   MAQVREIAETKKEDLNARDIDAAAKIIAGTARSMGITVEG"
FT   CDS_pept        639606..640316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53548"
FT                   /db_xref="GOA:A4QBF1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBF1"
FT                   /protein_id="BAF53548.1"
FT                   /translation="MSKNSKAYREAAEKIDAGRIYSPLEAANLVKETSSKNYDASIDVA
FT                   IRLGVDPRKADQLVRGTVSLPNGTGKTVRVAVFAQGEKATEAEAAGADFVGTDELVEKI
FT                   QGGWTDFDVAIATPDQMAKIGRIARVLGPRGLMPNPKTGTVTNDVAKAIEEVKGGKISF
FT                   RVDKASNLHAAIGKASFDAKKLAENYGALLDEIIRIKPSSAKGIYVKRVTLSSTTGPGV
FT                   EVDTHVTKNYAEEA"
FT   CDS_pept        complement(640366..641880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53549"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBF2"
FT                   /protein_id="BAF53549.1"
FT                   /translation="METPTQDMDVRWLYTQSQLKLREILPTNKTFDVIQISELVDPTDF
FT                   ISPNSVVLSVGIAFAETPDGLRDWAHRLADAGVIAIGFGSGLTFPQVPQALIDASLHLG
FT                   LGLFEVPREIPFISITSSVRDEQTRRAGRLQQELLLEQERLNSIAISGGIEALCRAAAD
FT                   YLGGAVTIVDSDGRVACSITTDDLDALPQAVSRLNGSSQALTDATNFGFIHRMTRYGDR
FT                   HHVLSVLMPTRPSEQHRALIRHCAGLADILLQRPEAMRDREIEVRSLAMSLLLGRSDDL
FT                   ATIHRVFADITDASGNIRPILITGNTPQSVRKALSSVATALYKQERALAHLRLAESTEL
FT                   LFLRGSRSVHNIVQLFGTAASGVRLCIGLPTRVENIDKKLIRELTATAKTLQLGTHAEP
FT                   RDGTLLWLQNPELRKILKIRSRDTYDRLLDHDRTNNTELAPTLVSFTQHGGHIGDTAKE
FT                   LGIHRHTVRTRMIRIEEICEIDLNDPLTRAELLLVIATKEGDVEKH"
FT   CDS_pept        642021..643367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53550"
FT                   /db_xref="GOA:A4QBF3"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBF3"
FT                   /protein_id="BAF53550.1"
FT                   /translation="MEDLSYRIPQSRTVAEQVPGPKSKALDERRQAAVARALAPGLPGY
FT                   VVDADGGILADADGNRFIDLASGIAVTTVGGSNAAVAKAVGAAAARFTHTCFMVSPYET
FT                   YVAMAERLNALTPGDHDKKSALFNSGAEAVENAVKVARAYTGKGAVVVFDNAYHGRTNL
FT                   TMAMTAKNRPYKSGFGPLAADVYRAPMSYPLRDGLSGPEAAERAISVIESQVGAENLAC
FT                   VVIEPIQGEGGFIVPAPGFLAAISTWCRENDVVFIADEIQSGFLRTGDWFASDAEGVIP
FT                   DVITTAKGIAGGMPLSAVTGRAEIMDAPGPGALGGTYGGNPVACAAALAAIEVMEQADL
FT                   KTRAQEIEAIIRDEFAQLSAFPEVAEIRGRGAMMAIELIDATGRPNAALTAAVAARAKA
FT                   EGVLLLTCGTDGNVIRLLPPLVIAEDTLRDGLQVLVAALERETAHQKVG"
FT   CDS_pept        643369..644730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53551"
FT                   /db_xref="GOA:A4QBF4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBF4"
FT                   /protein_id="BAF53551.1"
FT                   /translation="MSLTFPVINPSDGSTITELENHDSTQWMSALSDAVAAGPSWAAKT
FT                   PRERSVVLTAIFEALTERAQELAEIIHLEAGKSVAEALGEVAYGAEYFRWFAEEAVRLP
FT                   GRYGQSPSGIGHIAVTRAPVGPVLAITPWNFPIAMATRKIAPALAAGCPVLVKPASETP
FT                   LTMVKVGEIIASVFDTFNIPQGLVSIITTTRDAELSAELMADPRLAKVTFTGSTNVGRI
FT                   LVRQSADRLLRTSMELGGNAAFVIDEAADLDEAVSGAIAAKLRNAGQVCIAANRFLVHE
FT                   SRAAEFTSKLATAMQNTPIGPVISARQRDRIAALVDEAITDGARLIIGGEVPDGSGFFY
FT                   PATILADVPAQSRILHEEIFGPVATIVSFTDLADGVARANSTEFGLAAYGFSNNVKATQ
FT                   YMAEHLEAGMVGINRGAISDPAAPFGGIGQSGFGREGGTEGIEEYLSVRYLALP"
FT   CDS_pept        644769..646016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53552"
FT                   /db_xref="GOA:A4QBF5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBF5"
FT                   /protein_id="BAF53552.1"
FT                   /translation="MTTESIVGHNAAGTAPQNVSSAKKKYLSVAQGVALIYGTNIGAGV
FT                   LSLPYAARNGGFLALVVALLIAGTLTTISMLYIAEVSLRTKKPLQLSGLAEKYLGQWGR
FT                   WLVFIAIVVNSVGALIAYASGSGILIGNLTGLPPIVGTLGFFVLGTLIMWKGLHTASFV
FT                   EALITTGMATIIIVLCGWTVLGPGISADNLIVFHPFFIVPIMNLAVFTFLAQYVVPEIA
FT                   RGVNPATPKAVPRAIIIGMVATGVTLAAVPFAALGLLGTGVSEVVTISWGEALAPVAYY
FT                   MANAFALLAMFTSFIAIGFTAMRNVLDIGHWPEHGWQRSVAVGLTVLPPLAISLAGLGG
FT                   FVAALSYAGGFAGAIMSIIPVLLLRNSRKRGDQEPVWKATWQAHPIFQILLIVVYSLAF
FT                   VYSVLAIVGLMPAGWA"
FT   CDS_pept        646142..648094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53553"
FT                   /db_xref="GOA:A4QBF6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBF6"
FT                   /protein_id="BAF53553.1"
FT                   /translation="MLVSDIFMGDNGVMNKKLNTPNPWMLFIRSFDGIITVAALVAIAI
FT                   HLILWLALDLDGLAKNWPLIAIVILGGIPLMWDVLKSAIKTRGGADTLAAVSIITSVLL
FT                   GEWLVAAIIVLMLSGGEALEEAASRRASGTLDALARRAPSTAHRLLGATILDGTEEIAV
FT                   EEITVGDLVAVLPHELCPVDGEIVAGHGTMDESYLTGEPYVVSKSKGSQAMSGAVNGDT
FT                   PLTIVATKLAHDSRYAQIVGVLHEAENNRPEMRRMADRLGAWYTVIALALGGLGWIISG
FT                   DPVRFLAVVVVATPCPLLIAVPVAIIGAISLAARRGIIVKNPGMLENASEVKTVMFDKT
FT                   GTLTYGRPVITDIHTAPGVEEDTVLALAASVERYSRHPLADAIREGAKARELHLPDVVE
FT                   VSERPGQGLTGTVGEHLVRITNRRSTLEIDPDSKNYIPVTSSGMESVVLVDDKYAALIR
FT                   LRDEPRASASEFIAHLPKKHKVDKLMIISGDRASEVRYLADKVGIDEVHAEASPEDKLN
FT                   IVNRHNEHGATMFLGDGINDAPAMAVATVGVAMGADSDVTSEAADAVILDSSLERLDDL
FT                   LHISARMRRIALQSAGGGMALSVVGMILAVFGFLTPLMGAIFQEVIDVLAILNSARVAV
FT                   PRGAISDFDTQEKVS"
FT   CDS_pept        648113..649528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53554"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBF7"
FT                   /protein_id="BAF53554.1"
FT                   /translation="MTFRGGNTGAKHAVVVGSGPNGLTTAAVLAKAGWQVDVYESAPTP
FT                   GGAARSESVLGEGTISDLGAAGHPFGVASPAFHYLGLEDHGLEWAYSPFAMAHPLDHGR
FT                   AGLLETSLPETAKKLGPDARRWKNLHQGLTKNIDKHLANLLGPVLKWPAHPIRMAKFGP
FT                   FALLPAKRLASAAFETEEARSLFIGSAMHSVTPPHKPMTASLGLLFGALGMSRGWPVAV
FT                   GGSGRIVDALVNVINHHGGTIHCDSQIDSLSQFRDTDAIILNQTPSQVLKLKGTDLNAG
FT                   LPQRMSTWKHGPSSYKVDYLLDGPIPWSNPQVGEATTVHVGGSSEEIAFAEAEVAAGRM
FT                   PERPFIILCQQQVADPSRAREGRHVVWAYAHVPRGFVDKRAALLITAQIERFAPGFRDR
FT                   IVHSVDTNAEDLEAWNPNLVGGDITAGSALLRRMPTKIGEKTYMASASNAPGGGVHGMP
FT                   GWWAAQAVLADHR"
FT   CDS_pept        649538..650143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53555"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBF8"
FT                   /protein_id="BAF53555.1"
FT                   /translation="MEPTVKASARHTIHVTADTWRIRLSASAHSHPNDAYARRATAISA
FT                   IGSVLIDVPLQGERISESPAYDGQINADWNAEVTGTDVNIARDIISRLAAVPDVQVDGP
FT                   WWSLSDSLAAEAAVEALQGAADTARNTAAAIAESLGGQLGALLYATTDTHSSTPIPARA
FT                   EMMAAKASIPPRTLDLELAPSDIEVTKEIAVTFEFLAG"
FT   CDS_pept        650442..650957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53556"
FT                   /db_xref="GOA:A4QBF9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBF9"
FT                   /protein_id="BAF53556.1"
FT                   /translation="MANPRNEAALAELKARFAETDTVVLTEYRGLTVAQTTELRKALGF
FT                   DVQYSVAKNTLVKIAANEAGIEGLDDLLTGPTAVAFIKGEAVDTAKVLKKFGEENKAFV
FT                   VKGGYMDGNALTAEQVNAIAELDNRETTLAKLAGAMKGSLAKAAGLFNAPASQVARLAV
FT                   ALQDKKDA"
FT   CDS_pept        651035..651421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53557"
FT                   /db_xref="GOA:A4QBG0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBG0"
FT                   /protein_id="BAF53557.1"
FT                   /translation="MAKLTKDELIEAFKEMTLIELSEFVKEFEEVFDVTAAAPVAVAAA
FT                   GAAGGEAAAAEEKDEFDVVLEDAGAKKIGVIKAVRELVSGLGLKEAKELVEGAPKAILE
FT                   GANKDDAEAAKAKLEEAGAKVTLK"
FT   CDS_pept        651928..652935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53558"
FT                   /db_xref="GOA:A4QBG1"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBG1"
FT                   /protein_id="BAF53558.1"
FT                   /translation="MPGGCSGNIVRMLPKSRIFSALLLGIGVALVVWGLVAPRFVHADG
FT                   RLPLDLEATTYVLHDSDAQTTINSDPLAGVVTTPVTRQLHFEVMDPASADDATIRIGDS
FT                   MLRGNPDTQGFEQERLLSATVSSFRIDRTSGEVLSDIALTNQLASPTVQYSVDGIWLKF
FT                   PTDAQETTYNVVDPVLRSALPADFVESTEIDGREVLHYRQVIDNANVAEYFADANNTTT
FT                   LTKEDGGTTTGYFYHNVTRDFWVDQRTGLVVDLAENIDDFYGDRSGQKYEQKLLFDASL
FT                   DDAAVSKLVAQAESIPDGDVSKIANTVGIVIGAVLALVGLAGCFGAFGKKRREA"
FT   CDS_pept        653338..656835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53559"
FT                   /db_xref="GOA:A4QBG2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBG2"
FT                   /protein_id="BAF53559.1"
FT                   /translation="MLEGPILAVSRQTKSVVDIPGAPQRYSFAKVSAPIEVPGLLDLQL
FT                   DSYSWLIGTPEWRARQKEEFGEGARVTSGLENILEELSPIQDYSGNMSLSLSEPRFEDV
FT                   KNTIDEAKEKDINYAAPLYVTAEFVNNTTGEIKSQTVFIGDFPMMTDKGTFIINGTERV
FT                   VVSQLVRSPGVYFDQTIDKSTERPLHAVKVIPSRGAWLEFDVDKRDSVGVRIDRKRRQP
FT                   VTVLLKALGWTTEQITERFGFSEIMMSTLESDGVANTDEALLEIYRKQRPGEQPTRDLA
FT                   QSLLDNSFFRAKRYDLARVGRYKINRKLGLGGDHDGLMTLTEEDIATTIEYLVRLHAGE
FT                   RVMTSPNGEEIPVETDDIDHFGNRRLRTVGELIQNQVRVGLSRMERVVRERMTTQDAES
FT                   ITPTSLINVRPVSAAIREFFGTSQLSQFMDQNNSLSGLTHKRRLSALGPGGLSRERAGI
FT                   EVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYARVNPFGFIETPYRRIIDGKLTDQID
FT                   YLTADEEDRFVVAQANTHYDEEGNITDETVTVRLKDGDIAMVGRNAVDYMDVSPRQMVS
FT                   VGTAMIPFLEHDDANRALMGANMQKQAVPLIRAEAPFVGTGMEQRAAYDAGDLVITPVA
FT                   GVVENVSADFITIMADDGKRETYLLRKFQRTNQGTSYNQKPLVNLGERVEAGQVIADGP
FT                   GTFNGEMSLGRNLLVAFMPWEGHNYEDAIILNQNIVEQDILTSIHIEEHEIDARDTKLG
FT                   AEEITRDIPNVSEEVLKDLDDRGIVRIGADVRDGDILVGKVTPKGETELTPEERLLRAI
FT                   FGEKAREVRDTSMKVPHGETGKVIGVRHFSREDDDDLAPGVNEMIRIYVAQKRKIQDGD
FT                   KLAGRHGNKGVVGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQVLETHLGWLASA
FT                   GWSVDPEDPENAELVKTLPADLLEVPAGSLTATPVFDGASNEELSGLLANSRPNRDGDV
FT                   MVNADGKATLIDGRSGEPYPYPVSIGYMYMLKLHHLVDEKIHARSTGPYSMITQQPLGG
FT                   KAQFGGQRFGEMEVWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPDPGIP
FT                   ESFKVLLKELQSLCLNVEVLSADGTPMELAGDDDDFDQAGASLGINLSRDERSDADTA"
FT   CDS_pept        656919..660920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53560"
FT                   /db_xref="GOA:A4QBG3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBG3"
FT                   /protein_id="BAF53560.1"
FT                   /translation="MLDVNVFDELRIGLATADDIRRWSKGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTRDWECACGKYKRVRYKGIICERCGVEVTKSKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLDLIIYFGANIITSVDEEARHSDQTTLEAEMLLEKKDVE
FT                   ADAESDIAERAEKLEEDLAELEAAGAKADARRKVQAAADKEMQHIRERAQREIDRLDEV
FT                   WQTFIKLAPKQMIRDEKLYDELIDRYEDYFTGGMGAESIEALIQNFDLDAEAEELRDII
FT                   NNGKGQKKMRALKRLKVVAAFQRSGNDPAGMVLNAIPVIPPELRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRMIELGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIIVGPQLRLHECGLPKLMALELFKPFVMK
FT                   RLVENEYAQNIKSAKRMVERQRPEVWDVLEEAISEHPVMLNRAPTLHRLGIQAFEPVLV
FT                   EGKAIQLHPLACEAFNADFDGDQMAVHLPLSAEAQAEARVLMLASNNILSPASGKPLAM
FT                   PRLDMVTGLYYLTLEKSSEEFGGQGAYQPADENGPEKGVYSSLAEAIMAYDRGVLGLQA
FT                   PVRIRLNHLRPPAEVEAEQFPDGWNQGETWLAHTTLGRVMFNEILPWNYPYLEGIMVRK
FT                   GGGSDKIMLGDVVNDLAAKYPMITVAQTMDKMKDAGFYWSTRSGVTIAMSDVLVLPNKE
FT                   EMLDRYEESARQIEVKYNRGKLTGRERYDRLVELWKDATDEVGQAVEDLYPDDNPIPMI
FT                   VKSGAAGNMRQIWTLAGMKGMVVNSKGDYITRPIKTSFREGLTVLEYFNNSHGSRKGLA
FT                   DTALRTADSGYLTRRLVDVAQDVIVRVEDCGTRQGVRVPVAAEVLDATGAVTGYTRHDL
FT                   IETSVSGRVLAGDATNAAGEVVLAAGTDLTELNIDLLVEAGIKDVKVRSVLTCQTPTGV
FT                   CAKCYGKSMASGQQVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGGDITGGLPRVQE
FT                   LFEARVPKNCAPIASVEGVIHLEDEGNFYTLTIVPDDGSDNVVYEKLSKRQGLASTRVA
FT                   MESNAGAFIERTLTEGDRVTVGQRLLRGAADPHDVLEILGRRGVEQHLIDEVQAVYRAQ
FT                   GVAIHDKHIEIIIRQMLRRGTVIESGSTEFLPGSLVDLSEAKLANSEAIGAGGQPAELR
FT                   SEIMGITKASLATESWLSAASFQETTRVLTDAAINKRSDKLIGLKENVIIGKLIPAGTG
FT                   ISRYRNISIKPTEAARNAAYSIPTYGESIYGDDGFGEFTGASVPLDEAF"
FT   CDS_pept        661098..661280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5007"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53561"
FT                   /db_xref="GOA:A4QBG4"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBG4"
FT                   /protein_id="BAF53561.1"
FT                   /translation="MWKLSIGVIVGGILFALGLWGTHSENTVIFIAGWVGTFASFAVWF
FT                   WVIWWAAVGNTKSPL"
FT   CDS_pept        661292..662074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53562"
FT                   /db_xref="GOA:A4QBG5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBG5"
FT                   /protein_id="BAF53562.1"
FT                   /translation="MDELLKQEVKDFLTTRRARITPAAAGIETQPWSDRRVPGLRREEV
FT                   ADLAGISLEYYIRFERGNLKGASPEILQSLAKALQLSPIEREHLHNLAYRADHPRNLPS
FT                   AETPTAPLQDIVDAVTDKPAWIRNEQMDILATNRLCAELYAPILKDLPDRPNTARHCFI
FT                   GATAEQFWMDRDQFSAEFAAKLRLEYARRPSAPGLKELIDELHQKSSVFRENWASADVL
FT                   SFGSGIKRFRHPTLGERVYEYETFNLNSAPGYVLSIYF"
FT   CDS_pept        complement(662103..663023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53563"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBG6"
FT                   /protein_id="BAF53563.1"
FT                   /translation="MSRHAKKGGSFWGPTKRVTDNLIKCKHAPPRPGKPGAIPRLSARC
FT                   RQFPTTRVGLSRSHYQLAAENTKSLVRMVPMTVPQGNEPAKKLATDLNRNQVVDELSAA
FT                   VSRGQLTLEEFEDRSSKAWNARHLDTLVELISDVNDNPYTLLGQQFPGASYAPAAYETT
FT                   PPAMPNVSDPVNIVRNRITGNPNGSKMSVSFMGGTVRKGGWHVPNVHTSFAMMGGNQID
FT                   LRDAFLESDRIQINAYTFMGGIEIIVPEGVFVICDGIGIFGGFEQSVDKAGALNPARLP
FT                   NNAPTVHVKGLAFMGGVSVVTKKNI"
FT   CDS_pept        663122..663490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53564"
FT                   /db_xref="GOA:A4QBG7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBG7"
FT                   /protein_id="BAF53564.1"
FT                   /translation="MPTIQQLVRKGRHDKSAKVATAALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTSGIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGALDT
FT                   QGVKDRKQARSRYGAKRG"
FT   CDS_pept        663497..663964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53565"
FT                   /db_xref="GOA:A4QBG8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBG8"
FT                   /protein_id="BAF53565.1"
FT                   /translation="MRKSAAPKRPVVQDPVYKSELVTQLVNKILIGGKKSTAERIVYGA
FT                   LEICREKTGTDPVGTLEKALGNVRPDLEVRSRRVGGATYQVPVDVRPERANTLALRWLV
FT                   TFTRQRRENTMIERLANELLDAANGLGASVKRREDTHKMAEANRAFAHYRW"
FT   CDS_pept        664312..666441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53566"
FT                   /db_xref="GOA:A4QBG9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBG9"
FT                   /protein_id="BAF53566.1"
FT                   /translation="MAQEVLKDLNKVRNIGIMAHIDAGKTTTTERILFYTGINRKVGET
FT                   HDGGATTDWMEQEKERGITITSAAVTCFWDNNQVNIIDTPGHVDFTVEVERSLRVLDGA
FT                   VAVFDGKEGVEPQSEQVWRQATKYDVPRICFVNKMDKLGADFYFTVGTIEDRLGAKPLV
FT                   MQLPIGAEDNFDGVIDLLEMKALTWRGVTPIGTEATVEEIPAELADRAAEYREKLLETV
FT                   AESDEELMEKYFGGEELSIAEIKAAIRKMVVNSEIYPVYCGTAYKNKGVQPLLDAVVDF
FT                   LPSPLDLGETKGTDVKDPEKVLTRKPSDEEPLSALAFKIAAHPFFGKLTFVRLYSGKVE
FT                   PGEQVLNSTKNKKERIGKLFQMHANKENPVEVAHAGNIYAFIGLKDTTTGDTLCDANAP
FT                   IILESMDFPDPVIKVAIEPKTKSDQEKLGVAIQKLAEEDPTFTVELDDESGQTVIGGMG
FT                   ELHLDVLVDRMKREFKVEANIGDPQVAYRETIRKPVESLSYTHKKQTGGSGQFAKVIIT
FT                   IEPYAPAPEELEEGESAIYKFENAVTGGRVPREYIPSVDAGIQDAMQYGFLAGYPLVNV
FT                   KATLEDGAYHDVDSSEMAFKLAGSQAFKEAVAKAKPVLLEPIMSVEITTPEEYMGEVIG
FT                   DVNARRGQIASMDDRAGAKIVKAKVPLSQMFGYVGDLRSKTQGRANYSMIFDSYAEVPA
FT                   NVAADVIAERNGTAS"
FT   CDS_pept        666804..667994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53567"
FT                   /db_xref="GOA:A4QBH0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBH0"
FT                   /protein_id="BAF53567.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPELNE
FT                   AFAFDSIDKAPEEKERGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTREHVLLARQVGVPYILVALNKCDMVEDEEIIELVEMEVRELLAEQ
FT                   DYDEEAPIVHISALKALEGDEKWGKQILELMQACDDNIPDPVRETDKPFLMPIEDIFTI
FT                   TGRGTVVTGRVERGTLNVNDDVDIIGIKEKSTSTTVTGIEMFRKLLDSAEAGDNCGLLL
FT                   RGIKREDVERGQVIVKPGAYTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDV
FT                   TGVVKLPEGTEMVMPGDNVDMSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK"
FT   CDS_pept        668467..669198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53568"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBH1"
FT                   /protein_id="BAF53568.1"
FT                   /translation="MKDPSRIPPVVAQLQKVWEAQPDLALPTLLGILGNRGIGWGSTDE
FT                   DLVEALNTMYTENPGEIRGGSRIADPQREVPGRFLVETESPAYRITVDPFRVSVRRIAK
FT                   GPHRPLQPGVWEFQEIRRCRSGEPLLITDVEGIDHRLGVVVRITLLNDSPAPKTKSLDK
FT                   VRRREVGDKVFYLHFESGDTALLNHGLEIYQASRRTLEQHSVKWDQLITATPGQLLKLK
FT                   ETGSGKILELGVLEKIIPLEG"
FT   CDS_pept        complement(669203..669997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53569"
FT                   /db_xref="GOA:A4QBH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBH2"
FT                   /protein_id="BAF53569.1"
FT                   /translation="MNNRLTMEDVTMAYDNRVIAEHLNVTIPDNTFTAIIGPNGCGKST
FT                   LLRGFSRVLNPQHGKVLLDGRQLDSFKPKEIARELGLLPQTSIAPEGIRVYDLIARGRA
FT                   PYQSLIQQWRASDEDAVAQALASTNLTELAARLVDELSGGQRQRVWVAMLLAQQTPIML
FT                   LDEPTTFLDIAHQYELLELLRAFNEAGKTVVTVLHDLNQAARYADHLIVMKDGHVHATG
FT                   TPEEVLTAEMVQGVFGLPCIISPDPVTGTPTVVPLSRSHAEA"
FT   CDS_pept        complement(670016..671188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53570"
FT                   /db_xref="GOA:A4QBH3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBH3"
FT                   /protein_id="BAF53570.1"
FT                   /translation="MVFNIKSRTDAPEVPAVASEPVESTRPVSEASTSPALNPGYHAVS
FT                   VQRRRFSFLIPARLVVVSLILFAIALCSATWAITMGDYPLSLGQVINALAGTGEKFQLL
FT                   VVREWRLPVAIAAVVFGALLGIGGAIFQSITRNPLGSPDVIGFDAGSYTAVVLVILVLG
FT                   NTHYWSIAFAAIVGGIVTAFAVYVLAWRKGVQGFRLIIVGIGVSAMLSSVNAYLITRAD
FT                   VEDAMVVGFWSAGSINRVTWQSLLPSLVIAAVIIVAAIVLARSLRFMEMGDDVATTLGV
FT                   KTNSTRLALIVVGVATSALVTAAAGPISFIALVAPQLARRLTKTPGVSLVAAAAMGSAL
FT                   LSCAHLLSLIISSFYRTIPVGLLTVSIGGCYMIWLLLRETRRQYRTGTIR"
FT   CDS_pept        complement(671178..672224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53571"
FT                   /db_xref="GOA:A4QBH4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBH4"
FT                   /protein_id="BAF53571.1"
FT                   /translation="MTAVAVEKQKETSISKNLGRRRALGILGIIVALGALIVLSIAVGA
FT                   NPLSFSSVWQGFTAHDSSEASIIVWSMRIPRTLVGIVTGAAFGVAGALIQALTRNPLAD
FT                   PGILGVNAGAGFAVTVGVGFFGLSSVTGYIWFAFLGAAAATLLVYFIGASTSGSVNPVA
FT                   LVLAGVALAAVLGGVTSFLTLIDPETFESIRNWNLGSVARTDLSDTMTVLPFLAVGLAI
FT                   ALLLSGALNSIALGDDLAASLGTKVMRTRVLGIISVTLLAGGATALTGGIGFVGLMVPH
FT                   VVRWVVGPDQRWIITFSALCAPVLVLGADILGRIIARPGEIEVGIVTAVIGAPVLIALV
FT                   RRRKASGL"
FT   CDS_pept        complement(672610..673602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53572"
FT                   /db_xref="GOA:A4QBH5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBH5"
FT                   /protein_id="BAF53572.1"
FT                   /translation="MSIRPDNPQIKTSNIRTIGFLIYDGVSPLDFTGPAEAFSRSNGYE
FT                   LIYLSPSGGNIHTASGITIADTLPATSINPATLDTLIITGSDSLPQTPLKTSLIDAARH
FT                   LVCGPRRVATVCTGAFILAELGLLNGREATTHWKNARDLARRYPQIRVRPDIIHVHDGR
FT                   FVTSAGITAGIDLALSLIEEDQGAHIARDTARDMVVYMHRPGGQSQFATTTEAPSVSHP
FT                   SLQKAIDHVFEYPAASHSAASLADYVSVSQRHLTRIFQSELGLSPAQWLEQFRLNTAQQ
FT                   LILNGESISTTAGLSGFGSEDSLRRAFSKWLHITPSEYRARFRSTFPAH"
FT   CDS_pept        673713..675188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53573"
FT                   /db_xref="GOA:A4QBH6"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBH6"
FT                   /protein_id="BAF53573.1"
FT                   /translation="MSAEEAAQFINNGATVGMSGFTGAAYPKALPTAIANRAKQEHAAG
FT                   REYGIRMLTGASTAPDCDGVLAEADALSFRMPYQSDPAMRGKINAGQLNYQDIHLSHSG
FT                   LQVEQGFFGAIDIAIVEVARITKEGHLIPSSGVGNNVEYLDAAQHIILEVNSWQSLDLE
FT                   GMADIYRVPHLPHRTPIPIEKVGDRVGTTFIDIDIAKVIAVVETDAPDRNSPFKPFDEV
FT                   SKQIAGNYLDFLDGEVAGGRLAYDHYIMQSGVGNVPNAVMAGLLDSKFENIQAYTEVVQ
FT                   DGMLDLIDAGKMAVASATSFALSPEYAEKMNREAEKYRKYLVLRPLQISNSPEVIRRMG
FT                   LISSNGMIEADIYGNINSTHVAGTRVMNGIGGSGDFTRNAFASTFISPSAAKGDAISAI
FT                   VPFASHIDHTEHDAMVVITEYGYADLRGLSPKQRVPKMIAIAHPDYRPLLEEYFDRALT
FT                   SADSYQHTPHDLRTAFDFHNRLNSQGTMKIEKA"
FT   CDS_pept        675761..676066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53574"
FT                   /db_xref="GOA:A4QBH7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBH7"
FT                   /protein_id="BAF53574.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTE
FT                   KNVYAVIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ"
FT   CDS_pept        complement(676060..676533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53575"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBH8"
FT                   /protein_id="BAF53575.1"
FT                   /translation="MCSLVTVAGTLASEAMALHSAGVALTLGGTGDVNELDVVEDFNGN
FT                   VLSNLVTGDIVHTNLGDVAAGGNACFLEVTSQWLVHLAWVDFAVGDLDGVVAIGLNGAN
FT                   LGNYAWTRFNDGNRNNAVLLVEDLSHAELGAQNALDLVFTHYLFSAAKNSVDH"
FT   CDS_pept        676099..676755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53576"
FT                   /db_xref="GOA:A4QBH9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBH9"
FT                   /protein_id="BAF53576.1"
FT                   /translation="MSENEIKGILGTKLGMTQIFDEENRVIPVTVVEAGPCVVSQIRTV
FT                   ETDGYNAIQIAYGEIDPRKVNQPLTGHFKKAGVTPRRHVTEIRMDDVSGYEVGQDVTVE
FT                   IFNDIKFVDVTGTTKGKGYAGAMKRHGFAGQGAGHGNQAAHRRVGGIGAAATPGRIFKG
FT                   KRMAGRMGNDRVTTQNLKVQKIDADANIILIKGAIPGNRGGIVTVKTAVKGGAHA"
FT   CDS_pept        676752..677408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53577"
FT                   /db_xref="GOA:A4QBI0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI0"
FT                   /protein_id="BAF53577.1"
FT                   /translation="MTNLKLDVQTADGNINGSVELPAEIFDREVSVALLHQVVNAQLAA
FT                   ARQGTHSTKTRGEVRGGGRKPFRQKGTGRARQGSIRAPHFTGGGISHGPKPRDYSQRTP
FT                   KKMIKAALYGALSDRARNARIHVVSELVPGQTPSTKSAKAFIERLTERKSVLLVVSRED
FT                   INAQKSANNLPGVHILAADQLNTYDVLKSDDVVFSVEALHTFINRASGAAQEEQN"
FT   CDS_pept        complement(677405..677734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53578"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBI1"
FT                   /protein_id="BAF53578.1"
FT                   /translation="MSFSIDVLSDGAVEDVDGVAAFAKSHISALGSLASTEAGAGALAL
FT                   TCTVNGVHRCNLDAEDLFDGNLDLSLVSVSGDEERVNVLLHEAVGLLRNDRCDDDVAWV
FT                   GDSSH"
FT   CDS_pept        677408..677713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53579"
FT                   /db_xref="GOA:A4QBI2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI2"
FT                   /protein_id="BAF53579.1"
FT                   /translation="MATIANPRDIIIAPVVSEKSYGLMEQNVYTFFVSTDANKTQIKIA
FT                   IEEIFGVKVASVNTVNRAGKRKRSRTGFGTRKATKRAYVTLREGSDSIDIFNGSVA"
FT   CDS_pept        677738..678580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53580"
FT                   /db_xref="GOA:A4QBI3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI3"
FT                   /protein_id="BAF53580.1"
FT                   /translation="MAIRKYKPTTPGRRASSVSMFTEITRSTPEKSLLRPLSKTGGRNS
FT                   HGHITTRHRGGGHKRRYRVIDFRRNDKDGVLAKVAHIEYDPNRTANIALLHYFDGEKRY
FT                   ILAPKGLTQGTVIESGAAADIKVGNNLPLRNIPTGTTIHNVELKPGAGAKLARSAGASI
FT                   QLLGKEGSYAVLRMPSSEIRRVDIRCRATVGEVGNAEQINIRWGKAGRMRWKGWRPTVR
FT                   GVVMNPVDHPHGGGEGKTSGGRHPVSPWGQKEGRTRKPKRYSDDMIVRRRRANKNKKR"
FT   CDS_pept        complement(678558..678845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5008"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53581"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBI4"
FT                   /protein_id="BAF53581.1"
FT                   /translation="MTLEGLGRGEFAQLVANHGIVHENWHMLASIMDSKGVTDEIRENG
FT                   GTAGPGLDDLLGSLFVLSIYLVEEVLIDERTLFKAAWHSSLPPLSASCSC"
FT   CDS_pept        678597..678875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53582"
FT                   /db_xref="GOA:A4QBI5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI5"
FT                   /protein_id="BAF53582.1"
FT                   /translation="MPRSLKKGPFVDEHLLNKVDAQNEKGTKQVIKTWSRRSTILPDFI
FT                   GHTFAVHDGRKHVPVFVDDAMVGHKLGEFAPTKTFKGHVKDDKKGRR"
FT   CDS_pept        678879..679241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53583"
FT                   /db_xref="GOA:A4QBI6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI6"
FT                   /protein_id="BAF53583.1"
FT                   /translation="MSDNITSASATARFVRVSPMKARRVIDLVRGKTVVEALSILKYAP
FT                   QAASEPVAKVVASAAANAENNFGLDPRTLVISEAYANEGPTMKRFQPRAQGRAFQIRKR
FT                   SSHITVVVESQKEGAN"
FT   CDS_pept        679241..679987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53584"
FT                   /db_xref="GOA:A4QBI7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI7"
FT                   /protein_id="BAF53584.1"
FT                   /translation="MGQKIHPHGLRLGITSDWKSHWYADKSYADYVAEDIKIREFLSKG
FT                   LDRAGIADVVIERTRDRVRVDIHTARPGIVIGRRGAEADRIRRELEKLTGKQVALNILE
FT                   VKNVDANAKLVAQSIAEQLTNRVAFRRAMRKAIQSAMRQPQVKGIKVVCSGRLGGAEMS
FT                   RTERYHEGRVPLHTLRAEIDYGTYEAHTTFGRIGVKVWIYKGDVVGGRRESEINAPAER
FT                   RGRGDRNARPRRGGQRRQRAEQKQEG"
FT   CDS_pept        679990..680406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53585"
FT                   /db_xref="GOA:A4QBI8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI8"
FT                   /protein_id="BAF53585.1"
FT                   /translation="MLIPKRVKYRRQHRPTRSGISKGGNRVTFGEYGIQALEPAYITNR
FT                   QIESARIAINRHVKRGGKVWINIFPDRPLTQKPLGVRMGSGKGPVEKWVANIKPGRILF
FT                   EMSYPDEATALEALRRAGQKLPCKVRIVKREDQL"
FT   CDS_pept        680406..680636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53586"
FT                   /db_xref="GOA:A4QBI9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBI9"
FT                   /protein_id="BAF53586.1"
FT                   /translation="MAIGTPAHEFRELNEEELVTRLNEAKEELFNLRFQLATGQLTNNR
FT                   RLRTVKRDIARIYTVIRERELGLSVVPGAEA"
FT   CDS_pept        complement(680633..680929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_5009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_5009"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53587"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBJ0"
FT                   /protein_id="BAF53587.1"
FT                   /translation="MTPKLLSLFDDLDQTVVLVLGQWAGLFNANQVTDSGDLLLIMSLD
FT                   LLRGAKDLAVESVLLAVFDLDNDGLLHLVRNHVASADLAGALFLVVHVCLTHD"
FT   CDS_pept        680639..680917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53588"
FT                   /db_xref="GOA:A4QBJ1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBJ1"
FT                   /protein_id="BAF53588.1"
FT                   /translation="MSEANVNNQEKSTRKVRTGYVVSDKMQKTIVVEVEDRKQHALYGK
FT                   ILRSAKKVKAHDEEQIAGIGDLVRIEETRPLSKDKNYRLIEIVEKAK"
FT   CDS_pept        complement(681038..681358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53589"
FT                   /db_xref="GOA:A4QBJ2"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBJ2"
FT                   /protein_id="BAF53589.1"
FT                   /translation="MIRWWLNLHAPSIRNIRMAHENQKTVSIFAWLSVLVVAILGYVLW
FT                   LVPISWYGIREWIYPIIAVPLIGYALFTAFKSKSWVLGICAILALLSPIIWLTAGFFIF
FT                   GF"
FT   CDS_pept        complement(681375..682079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53590"
FT                   /db_xref="InterPro:IPR025971"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBJ3"
FT                   /protein_id="BAF53590.1"
FT                   /translation="MSLLKSLSLGSSAVLLTALLGGCVSLDERSTDTSMNTSTENVTTV
FT                   TATVTSTPMAEPGTAVPTSTSAPTTAPVQCNLDPRTSDFGPYLAQSRTPVGELAGSADS
FT                   VVQVPDWFYHFQMGDNGYDSCSKLSYVVLNGSNGDAERSAGTGAAIADVVVLFIDGHMV
FT                   ARPAPFEMKTVESVTRVSDSEIQVVYGHAGRSTAEGVTDYFTFNFFVDNGVLSGRGDLP
FT                   EHIDTHMRLYLL"
FT   CDS_pept        682407..682775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53591"
FT                   /db_xref="GOA:A4QBJ4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBJ4"
FT                   /protein_id="BAF53591.1"
FT                   /translation="MIQQESRLKVADNTGAREILCIRVLGGSTRRFAGIGDVIVATVKE
FT                   ATPGGNVKSGEIVKAVIVRTKKETRRADGSYISFDENAAVIIKNDNEPRGTRIFGPVAR
FT                   ELREKKFMKIVSLAPEVI"
FT   CDS_pept        682778..683092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53592"
FT                   /db_xref="GOA:A4QBJ5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBJ5"
FT                   /protein_id="BAF53592.1"
FT                   /translation="MKVHKGDMVLVISGPDKGAKGQVIAAFPKTEKVLVEGVNRIKKHV
FT                   ANSAPERGAESGGIVTQEAPIHVSNVMVIDSDGNPTRVGYRFDENGKKVRVSRRNGKDI
FT                   "
FT   CDS_pept        683092..683667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53593"
FT                   /db_xref="GOA:A4QBJ6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBJ6"
FT                   /protein_id="BAF53593.1"
FT                   /translation="MTENYIPRLKTRYQDEIRTKLQGEFEFENVMQIPGVTKIVVNMGV
FT                   GDAARDSKLINGAIEDLTAITGQKPQLRRAKKSIANFKLREGMPIGAKVTLRGDRMWEF
FT                   LDRLLTVALPRIRDFRGLSDQQFDGHGNYTFGLTEQTMFYEIDVDKIDRPRGMDITVVT
FT                   TAVTDDEGRSLLRELGFPFKGEDGNRQQ"
FT   CDS_pept        683714..684748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53594"
FT                   /db_xref="GOA:A4QBJ7"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBJ7"
FT                   /protein_id="BAF53594.1"
FT                   /translation="MSTQWVTFRGKLSNQNKGTFINVQRKLLAIVGAFMAGALALGTPT
FT                   AQAQSIGSSASQKTEVLRGLTSSAGIPDATAPEGGAKVVVFGDSHASGTNAPFDVDERG
FT                   CLKGNQSWPDQLQAQQGLQQGELIDLSCNGASINSTGFHFSDEVRHAEALGAIGPNTEN
FT                   IFIQFGKNDQWGHSPINLRYSVINCLFDAANGCGEKAVAAGTMQDPSSVTGENYAQRMK
FT                   PVIDYLKYYAPNAQITLLGYQEYTPRSGSEICVRVGGTELRKPDATNLVSYMNNLESAI
FT                   FEASEILDVQHANLREVTAGHSSCSAEPWVNGVLDMRVNAVGGTWHPSPKGDEVTAGLL
FT                   GTLM"
FT   CDS_pept        complement(684753..685562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53595"
FT                   /db_xref="GOA:A4QBJ8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBJ8"
FT                   /protein_id="BAF53595.1"
FT                   /translation="MTLSLPPIGFGTVHLDGAPGVEAIATAIDAGYRLIDTAYNYENEG
FT                   TVGKAFRESGVPREELIVTSKLPGRFHARELGRVRIEESLYRLNLDYIDLLLIHWPNPS
FT                   KDLYVEAWETLIEVRDAGLVKHIGVSNFLPNHIDRLRRETGELPAVNQIELHPYFPQVE
FT                   QVDFHDELGIITEAWSPLSNGRGLVEEPLLKEIGERYGVGGGEIALAWHHARGIVPIPR
FT                   STNPARQRSNLEAVKISLIDEDVQAITALARKNGRIKDQDPAVYEEF"
FT   CDS_pept        complement(685584..686078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53596"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBJ9"
FT                   /protein_id="BAF53596.1"
FT                   /translation="MPEQAEQPNQAREELERIFPQWFVSAAENRDMSVGQAMKFSPKRW
FT                   LFPDFSFSYDDQDFVMPLIINFDSLINDLLAHQPGAFKCPGVTLSFPNNWEDLSHKQIQ
FT                   DCLWNALEEWFYFLEIYTWSAVDQRKYEHGQVPGDLRIGCLFEFFSSSRPNLQFLSEPL
FT                   P"
FT   CDS_pept        complement(686078..687019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53597"
FT                   /db_xref="GOA:A4QBK0"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK0"
FT                   /protein_id="BAF53597.1"
FT                   /translation="MGRITQNLQVPRVVSTDEQVFVNTRPDTVAVEEPLEIRVNGTALT
FT                   TTMRTPGHDIELVHGLLLAEGLITDASEVFTARYCAGAVGPDNQNTYNVLELDVIPKDN
FT                   PARDPAQNLAQNLAQNLAQNLEGSQHEAPHIPTFQPVRELNLVAAQRNVLTTSACGVCG
FT                   TTSIEQLMNKKGWPITPITPDPRMIVSLPDKLKSKQKIFDKTGGVHAAGLATLDGEMLI
FT                   VREDVGRHNAADKVIGNMLMAGKLPLENTILVMSSRASFELVQKAAMAGISGVIAVGAA
FT                   TSLAIEAAQDAGIFLSGFVRGNKFNHYAGELG"
FT   CDS_pept        complement(687022..687360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53598"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK1"
FT                   /protein_id="BAF53598.1"
FT                   /translation="MQPSSETSFTVDTTPRKNNEAEKMQKMYQWLDTVCTELDIDPDIL
FT                   AEVVPHLLNLTRDVAHGPSRPAAPMTSFLLGLAAGRSGTSTDDWAESTLVNALHLQEII
FT                   AKNYPEAK"
FT   CDS_pept        complement(687443..689731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53599"
FT                   /db_xref="GOA:A4QBK2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK2"
FT                   /protein_id="BAF53599.1"
FT                   /translation="MTTPPTEISNVNPTANEFDDPDVGRRITSAAGVPGVLHALQHAIP
FT                   NRALLPLLTMNKPGGIDCPGCAWPEPSTANLGVVEFCENGAKAVAEETTPDRAGREFWA
FT                   EHSIYDLREKTDHWLGKRGRITEPMFYDRSSGDDHYRPISWDRAFEIIASKLREIEPDE
FT                   AVFYTSGRAPNEPAYMLQLLARRLGTNNLPDCGNMCHESTGTALGETLGLGKGSVVMED
FT                   FYNTDLLISVGQNPGTNHPRALTAFKELKENGGKILALNPMPETGLMKFREPQSVKGAL
FT                   SISDKLADEYLQIRLDGDRAFFQALNKELIRRGALDHAFLDKFCSGVDETIEHLKSLDD
FT                   EVLLKGCGLTAAEINKAADMVEKSDTVVVSWTLGVTQHKNAVYTIREMVNFLLLTGNIG
FT                   KPGAGTAPLRGHSNVQGDRTMGIWEKMPESFLAALENEFGFDVPRKHGFDTVDSLRAMR
FT                   EGKTKFFLSLGGNLVRVSSDTSVVEKGMESNELTVHLSTKPNGSQAWPGEQSLILPVIA
FT                   RTDKDVQKSGVQRVTVEDSAGAVHASTGKRTANKDLNLKSECDIIGTIGKQTFGDAFWQ
FT                   PMIDNYDVVRDHIEATIPGFHDFNRRIDNPGGFLLPNGPRERIFNTSNGKAQLTVNETN
FT                   VIELPKDYLLMNTVRSHDQYNSTIYGLDDRYRGVRNGRRVVFVNPQDCKQRGLKDGDIV
FT                   DIVSVFDDGERRAPNFRVVEYDTARDCVTTYFPEANVLVPLDSVAERSNTPVSKSVVVR
FT                   LEATGRTAS"
FT   CDS_pept        690039..690773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53600"
FT                   /db_xref="GOA:A4QBK3"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK3"
FT                   /protein_id="BAF53600.1"
FT                   /translation="MHLQILRTKCSKTTFAHRRSNAHYSVYRIENERFKALTITFSRVA
FT                   LTTLAVTATTLSLSTAANAQSSLLDETLDARQCVDADNVWVYVEYGEDSEKEPEGGCAT
FT                   DLTNGLTALKSAGFDVVTSDSSFGKMINSINGVAPDWEETGTYWSYFIGDVDEDYNVEY
FT                   SFSNYGAEGTIPEPGSVEAWVVGDGSPLEATTLPETPAATGSSEDGGWIAVIAGLLALI
FT                   GGGVAALYQGLITIPGLVLPKF"
FT   CDS_pept        complement(690872..691678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53601"
FT                   /db_xref="GOA:A4QBK4"
FT                   /db_xref="InterPro:IPR017196"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK4"
FT                   /protein_id="BAF53601.1"
FT                   /translation="MINAIALKPKTFLTLSFLAVLSIVIFFWPLIVNPESFLSDKAQAP
FT                   LYIAIVIPLVLAAVIAEISENGFDVKAVAMLGVLTAMVAVVRPFGAGAAGFEAVFFVLI
FT                   LGGRAFGPGFGFILGNTGLFASALLTAGIGPWLPYQMLAAAWVSFGAGLLPQVRGKKEM
FT                   LIIVLYAIVSSLGYGTMMNMSFWPYAIGVTSGLSFTPGAPVLENLHTFVLFCLTTSMGW
FT                   DLGRAFFTSVLLLLTAKPVLGALRRASRRAAFGVERDFGEAGVPRV"
FT   CDS_pept        complement(691675..693384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53602"
FT                   /db_xref="GOA:A4QBK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK5"
FT                   /protein_id="BAF53602.1"
FT                   /translation="MSAPFSARTAWSTDPVLELESVAASYYDDERTLAAPQISDVNLTL
FT                   FEGEILLVVGRTGSGKSTLLNAMSGAMPHATGGRLDGRVRVVGRDTRDFPPRMLSDVVG
FT                   VVGQDPAASFITNTVEEELAYSMEQLGLPPAVMRKRVEETLDLLGIAELRYVPLAELSG
FT                   GEQQRVAIGAVLTTRPALIILDEPTSALDPNGAEDVLATVTKLAHDLAMTVVLAEHRIE
FT                   RVLQYVDRVAHVGADGHVTVGTPEEIMADADVAPPIVELGRWAGWAPLPLSIRDARAHS
FT                   ADMRKRLYQRGLVVNKLHNHAVQPLLIAEDIVVEFPEIRAVDGVNLNLNAGEITVLMGR
FT                   NGCGKSSLLWALQGSGTRNQGSVQVLDEATGFSWTDPKTLKPAKRRNLVSMVPQTPTDI
FT                   LYESTVHAELARSDKDAAAPAGTTREILDSLVPNIPDHLHPRDLSEGQKLSLALSIQLA
FT                   AKPRVVFFDEPTRGLDYDGKKSLARSFQQLADDGHAILVVTHDVEFSALCADRVLFMAS
FT                   GKIISDGTAVEILPASPAYAPQVAKITAGIQEESHWLTVSAVKAALGHGEIS"
FT   CDS_pept        complement(693384..694532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53603"
FT                   /db_xref="GOA:A4QBK6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK6"
FT                   /protein_id="BAF53603.1"
FT                   /translation="MKWIKRYVLSRRMVHPWAWWVWALGIAGCASMTNNPYILALTFAT
FT                   LCFVVFNRRGSSPWSRAFPIYLMIAGWLVVYRLVMHIVVGAKIGTIELFRIPPVQLPEW
FT                   AAGIHVFGTVYLEGLIIATTQGLTLGTMIVAVGAANSLADPKKLLKSLPGALGELGTAV
FT                   VIGISIAPQMAESAFRINRARTLRGDDARGVRGFARILMPVFQDTLDRSLALANSMDAR
FT                   GYGRQAHVSKFQQRVTSIFGALGILGVTVGLFVVLDASSPMFVAVPVFITGVGFLIISL
FT                   VVASHRKTSTTFDQLPWGAAEWLVCITGVIPLLMAALTRYIDPGSMITTWVPLHMPDTV
FT                   PLLVVAGLVVATMPGFLTPRLPKNKVRVKRRKAINSPERAEV"
FT   CDS_pept        complement(694539..695612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53604"
FT                   /db_xref="GOA:A4QBK7"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK7"
FT                   /protein_id="BAF53604.1"
FT                   /translation="MSRTSTFHLSLKAFAAAVALWIVLAISPWVPSAHALTTPCEDDQV
FT                   TVMVEGNTIGCADAGGNGYQTLLDAGFDVETTVQFPEFLCRINDFPGPDVDDCMTASPA
FT                   EAYWSYWHAPLGGDEWEYSNLGAFLYYPKPGTVQAWYWGDTDRPGAIPVSKSQAELGLD
FT                   SADPDYKIDFDPNDFITTTPTSESPIADLGNDDEPTETTQAPIAGDGAGSARGQAAGPT
FT                   AEVNPENPNEVLVYQDSEGNSITKGQYENLVAAAAAKTTAAVQAPAGAGEANSQPQATA
FT                   VAEAPEVDPMTTQVLMAPAGQDGDVMAEGSTQQMYATGTVDSSAQGWIIGLTLAVISLV
FT                   SASAVAAWAIRRSEVQG"
FT   CDS_pept        complement(695633..696796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53605"
FT                   /db_xref="GOA:A4QBK8"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK8"
FT                   /protein_id="BAF53605.1"
FT                   /translation="MAHLRGKRTIRWSAATVALATGVSLLAPQVVAAQDASSDIQLATQ
FT                   FIEKEFATNGLIPGPVGTPDIGLNQDLLLSLKALDPDSPKIDAAYAAIAPELEGYVSVS
FT                   DHIFSDRLAKTVAFQDALGIRNADFIAQLVSAVQENGQIKNLDNGEATTAINNFSQAWG
FT                   VLALHRVGETEAAERATDFLETQVCSDGGVQLASAIEPTCKTTDSDVTAMAAQALTLAN
FT                   GAQDPTTQATLDYLVTTMDETGGVKNTWTGVNSNSTGLVGSAFALAGEEENYLKAREYL
FT                   ASVQFGEDSDPSIQGGFAFTVKAKETDTAISDQIRRATSQAALGFAGGNYANAELITIA
FT                   NPVDPTPPADSEGSTGGFGGAGIIIAILAILAAIAGVMGPMMANLQF"
FT   CDS_pept        complement(697117..697587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53606"
FT                   /db_xref="GOA:A4QBK9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBK9"
FT                   /protein_id="BAF53606.1"
FT                   /translation="MEEFGTDPIHGSGYFENYLPIDFSEAGFHHYLKERTDAADPSVPP
FT                   PEGFVHCSYFWIVDDDDVLVGFLALRHELNQHLLEVAGHIGYGVRPSARRKGAATAALK
FT                   LGIHEAQALGIDKVLLCVAGDNEASRNVIEKCGGVYESTIRGMRRYWIATDS"
FT   CDS_pept        697998..698396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53607"
FT                   /db_xref="GOA:A4QBL0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBL0"
FT                   /protein_id="BAF53607.1"
FT                   /translation="MTMTDPIADMLSRVRNASNAHHDTVSMPSSKIKANIAEILKQEGY
FT                   IANYTVEDAKVGKTLSLELKYSNTRERSIAGLRRVSKPGLRVYAKSTNLPQVLGGLGVA
FT                   IISTSQGLLTDRQATEKGVGGEVLAYVW"
FT   CDS_pept        698416..698952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53608"
FT                   /db_xref="GOA:A4QBL1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBL1"
FT                   /protein_id="BAF53608.1"
FT                   /translation="MSRIGKEPITIPSGVETKIDGQLVEVKGPKGTLNVNVPEPISVAV
FT                   EDGKIVVTRPDDHRTNRSLHGLSRSLVNNLVVGVTEGYTIKMEIFGVGYRVALKGKDLE
FT                   FSLGYSHPVLIEASEGITFAVDGNTKLSVSGIDKQKVGQVAAVIRRLRKDDPYKGKGIR
FT                   YEGEQIRRKVGKTGK"
FT   CDS_pept        698956..699360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53609"
FT                   /db_xref="GOA:A4QBL2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBL2"
FT                   /protein_id="BAF53609.1"
FT                   /translation="MSNTENKQKRVSVGKDIATRRRVARARRHFRIRKNLRGTPEAPRL
FT                   VVHRSSRHMHVQIIDDVAGHTLAAASSIEAEVRATEGDKKAKGAKVGQLIAERAKAAGI
FT                   EQVVFDRAGYKYHGRVAALADAAREGGLKF"
FT   CDS_pept        699401..700036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53610"
FT                   /db_xref="GOA:A4QBL3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBL3"
FT                   /protein_id="BAF53610.1"
FT                   /translation="MPGRERRDGGRSADDNKQNDRNERRGGGRRDDRRNQQQDERSQYI
FT                   ERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQKGAEEARKNF
FT                   FRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIAGGAARPVLECAGIQDILSKSLGS
FT                   DNAINVVHATVDGLKQLVRPEEVAARRGKTIEEVAPARILRARAGQEA"
FT   CDS_pept        complement(699524..700255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53611"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBL4"
FT                   /protein_id="BAF53611.1"
FT                   /translation="MELNWFAHCYLLPRHFFDDDQVANCQDHATYLWGIGTDHGVADSL
FT                   QTEGTKIVAMLGLGAHSAFDLSNLQRHFLRLLTCACTQNTCWCDLFDGLATAGCNLFRA
FT                   DQLLQAVHSCVDDVDSVVRAKGLGQDVLDTCALKNWTCCATGYNTGTWSSWLQHNDAGC
FT                   LFALNWVGDGAVDHWDAEEVLTSLFCTLLDCGRDFLGLAVTDTDHSLAVANDDKCGEAE
FT                   ATTTLDDLGHTVDGDYTLDVL"
FT   CDS_pept        700040..700225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53612"
FT                   /db_xref="GOA:A4QBL5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBL5"
FT                   /protein_id="BAF53612.1"
FT                   /translation="MALKITQIKGTVGTKPKHRDNLRSLGLKRIRHTVIRPDTPEVRGM
FT                   ILAVRHLIVVEEVAGE"
FT   CDS_pept        700232..700678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53613"
FT                   /db_xref="GOA:A4QBL6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBL6"
FT                   /protein_id="BAF53613.1"
FT                   /translation="MSEPIKLHDLRPAAGSNKAKTRVGRGEASKGKTAGRGTKGTKARK
FT                   QVSAAFEGGQMPLQMRLPKLKGFKNPNKVDYQVVNIADLAEKFPQGGDVSIADIVAAGL
FT                   VRKNELVKVLGNGDISVKLNVTANKFSGSAKEKIEAAGGSATVA"
FT   CDS_pept        complement(701193..702545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53614"
FT                   /db_xref="GOA:A4QBL7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBL7"
FT                   /protein_id="BAF53614.1"
FT                   /translation="MTNDMLATGHREIHIETKKSSDSLSNEHKRVLGGAMVGTTIEWFD
FT                   FFIYAQAAGLIFATQYFNPATNQSPSLAQIIAWASLGISFLFRPVGAIIAGHLGDKLGR
FT                   KPVLVLTLLGMGGATFAMGLLPNYAAIGIAAPILLVLLRILQGLSAGGEWGGAALIAVE
FT                   HAPTNKRGYFGAFPQVGVPAGMALATIFMLIVTTALSPEQFETWGWRIPFLSSLLLIGI
FT                   GFWIRSLVEESPVFAEMNDLKKTASAPLSTLFKQHSKLVILCALIFAGCNAAGYLAIAF
FT                   FASYGTSVLKMDRPVVLALTLLTALAWIVATLVAGKVSDVIGRKQTFVIGYAAMIIWAI
FT                   PTWLLIDTGNVLLFGIGVIVLGLFLGITYGPQPSLYAEMFPASVRLSGLSIGYALGSII
FT                   GGAFAPMIAELILDTTGNSINIGIYIAIISAISLIAVLMVPKGIQGKSLHD"
FT   CDS_pept        complement(702672..703988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53615"
FT                   /db_xref="GOA:A4QBL8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBL8"
FT                   /protein_id="BAF53615.1"
FT                   /translation="MTSVYNISSTHNGPTTGIEFASRDEITALQTERAKNTLRHSYYNV
FT                   KHYRQAFDEIGVHPDDFRELSDLAKFPMTDKSTLRANYPFGMFAVQQHQIARLHASSGT
FT                   TGLPTVVAYTHKDIETWADLMARSLRAGGIRPGDRVQVTFGYGLFTGGLGAHYGVEKLG
FT                   ATAIPTSGGQTERQIQIMNDFKPDAILGTPSYMLNVLDRIRKEGQDPRETSLRVGVFGS
FT                   EPWSEGMRHELEAGFGIDATDIYGLSEVMGPGVAQECIETKDGLTIWEDHFYPEILHPE
FT                   TLEPVPDGEFGELVITPLTKEAFPVVRYRTHDITRLLPGTARSMRRLDRISARNDDMII
FT                   LRGVNCFPSQFEELIVEDPHLRPRYQCVLTKKGRMDHLTIVVEHAQNRTADEIQQAGLN
FT                   LRKQIKDRIGITVDVDVRDEVNSGEGKAKRIVDLRNEEA"
FT   CDS_pept        complement(704306..704935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53616"
FT                   /db_xref="GOA:A4QBL9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBL9"
FT                   /protein_id="BAF53616.1"
FT                   /translation="MTPTSISQALPATGRGRPGYSRAQVISEAVNEFNAHGYEATSMGT
FT                   LAKRLGITKSAIYHHVTSKEEILQEATDLALTSLEEISTEAWEQTGGPKAQLVFLIKGS
FT                   IAVLCEHKAQVTLLLRLRGNSEAELEAMKRRRELTRAMIDLVVHAQEAGEIRPDLDAGV
FT                   VGRLIFGTVNSLTDWYEAGGKLTPEEIADTTAELVLSGLKTATPST"
FT   CDS_pept        705096..705533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53617"
FT                   /db_xref="GOA:A4QBM0"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM0"
FT                   /protein_id="BAF53617.1"
FT                   /translation="MSETAVDISQIESDLEFTRAMYENDGSLKAMGISITKLETGHVEG
FT                   EFIVRPEMCNGHNSIQGGFLFTFADALFAGACNSTRGAVTVASQVQIHFIAPAFAGETL
FT                   RGVAIERQSWGRNGLSDVTVFRGDKVIAEFRGMSRTVGKRA"
FT   CDS_pept        705713..706687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53618"
FT                   /db_xref="GOA:A4QBM1"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM1"
FT                   /protein_id="BAF53618.1"
FT                   /translation="MTTAVAPDTNADTAGQQRFDEIIAADSRIEPTDWMPAAYRKTLTR
FT                   QISQHAHSEIIGMQPEANWISRAPSLKRKAILMAKVQDEAGHGLYLYSAAETLGTSRDE
FT                   LVNQLLEGKAKYSSIFNYPARTWADIGAIGWLVDGAAICNQVPLCRASYAPYARAMVRI
FT                   CKEESFHQRQGWEILYELSHGTPEQKQMAQEAINRLYRPALQMFGPPDADSAHSGQSMK
FT                   WNIKRFSNDELRQRFVDMIVPQVEALGLTFEDPDLKWNEERGHYDFGELDWDEFFNAIN
FT                   GNGPLNSQRLKRRREAFDDGAWVREAAAAYDRKHNRVDTALVV"
FT   CDS_pept        706709..706996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53619"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM2"
FT                   /protein_id="BAF53619.1"
FT                   /translation="MSDSTWPQFEVFVRSNRGLSHVHAGSLHAPDETMALRNARDLYTR
FT                   RNEGTSVWVVPSQAITASDPDSKGGFFESASGKAYRHATYFEKSEGVPHL"
FT   CDS_pept        706993..707826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53620"
FT                   /db_xref="GOA:A4QBM3"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM3"
FT                   /protein_id="BAF53620.1"
FT                   /translation="MSFATNDSATRQTQGDAMTPEDVVASGQVASDAVANYALMLADDS
FT                   LMLAQRLGWWISRGPEMEEDIALGNIGLDLLGHARFFYSYAGTAWGKTEDDLAYFRTEE
FT                   EFRSAAIMEQENGDFAQTIARHLIVSYYLIGLYSKLESSADQMLASIAAKAVKELEYHV
FT                   DHANQWVLRLGDGTEESHRRMQDGLNYMWPYVNEIFEDLPLHTELAAQGIAVLPSELRA
FT                   DFDTRVEAVIEAATLKVPAVPQAVSGHRTGRFSEYRGFILAEMQSLARQHPGATW"
FT   CDS_pept        707877..708413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53621"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM4"
FT                   /protein_id="BAF53621.1"
FT                   /translation="MSITTTNHPLRPQDTELARLWDIAAQVPDPEIPVISIADLGILRG
FT                   VAFEGNTVVVTITPTYSGCPAMGTITADVVDALKREGFENTRVDLVLHPAWSTDWMTEH
FT                   GKEKLREYGIAPPQGMSRRTSGPILLNLAPPTPVTCPHCHSTNTKLISQFGSTSCKSLH
FT                   TCKDCFEPFDYFKVH"
FT   CDS_pept        708413..709567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53622"
FT                   /db_xref="GOA:A4QBM5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM5"
FT                   /protein_id="BAF53622.1"
FT                   /translation="MTSVIKKKAKFNTLSVSGVKKLTDDSVEVSFDVPEELQDDYDYIP
FT                   GQYVALRATVDGEELRRSYSICDIPNKGTIRVGIKKDLGGKFSTWANEELQLGDVIDVM
FT                   NPQGAFTSKIHVTSLNDAQNLVDSELGQVENPNFVAIAAGSGITPIMSIAQAVLKSLPK
FT                   ATFQLVYSNKGGADVMFADKIGDLKDKYPARFAVHHVLTREQRVNPLFSGRIDDEKMEL
FT                   LLDQVLRPDLVDEWFLCGPFELVQMCRDSLKERDIDEKRIRFELFSTGDPKSAPGGNAG
FT                   RPVIADPKGKNISIQFQLDGLSGTIESPVSAKETVLNAALRARPDVPFACAGGVCGTCR
FT                   AKVVEGDYEMDENYALEPDEVAAGYVLTCQTRPTGDCITVDYDA"
FT   CDS_pept        709580..710365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53623"
FT                   /db_xref="GOA:A4QBM6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM6"
FT                   /protein_id="BAF53623.1"
FT                   /translation="MIDLNIHRIDEHASYAEVVLNDPSTLNAIAEQDLLDISAAYTEAE
FT                   KAGVRALLLRGEGKGFCSGRNIKGVVPAEDDAADYLANKVTPVLKQMSAFPAPTFAAVH
FT                   GACLGVGLGLAIASDIVYVAEKSKFGSPFANLGATLDSGGHALFVERLGAHRTMDLIVT
FT                   GELISGAEAVNSGLFSRLVPTEELLDFTRDKVIRAAQGATQAFVTSKALVQDIRDNCTG
FT                   LWDSVAVENEEQGRLCSSTDYAEGFAAFNEKRTPVFFGR"
FT   CDS_pept        710443..711648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53624"
FT                   /db_xref="GOA:A4QBM7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM7"
FT                   /protein_id="BAF53624.1"
FT                   /translation="MSDRTAYLVSGKRTPVGRYGGALSSVRPDDLAALTITAVIEESGI
FT                   DPSVVDEVILGNANGAGEENRNVARLAWLLAGYPDTVPGITVNRLCASGMSAIALATAM
FT                   VESGQADVVVAGGVESMSRAPWVQEKPRSAFAKPGEIFDTSIGWRFVNPIFQEQEKTTF
FT                   SMPETAEEVARVKGVSREEADVFAATSQARALAAISAGHFDSEIVPVEITDRKGNVTVV
FT                   SQDEGPREGTTTQVLAKLRPVVRGGEVVTAGNSSSLNDGASAIIVASAEAVEKYGLTAR
FT                   AKVVGASNAGLAPEIMGMGPVPATKKLLKRTGWSVEDLDAVELNEAFATQSLACMRELE
FT                   LDPEKVNAWGGAIALGHPLGSSGSRITITLLNRLEKEGGSKGIATMCIGVGQGSAIAIE
FT                   RV"
FT   CDS_pept        711655..712404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53625"
FT                   /db_xref="GOA:A4QBM8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM8"
FT                   /protein_id="BAF53625.1"
FT                   /translation="MSFDFDALTITESDDLLIIELSRPEVRNAIDQTMVNELHEVCAYL
FT                   EENPKTAIIIGSDGIFASGADIGQLRERRREDALRGINNSIFHRIAQLPMPVIAAVDGF
FT                   ALGGGLELALAADFRVATQNAKFGQPEASLGIMAAAGGTWRLKAAVGEPLAKDILLAGR
FT                   IIDGEEAKTYQLVSNLAPAEDLLDEAKKLAQRIGKLDPLAVRITKSVMALPESAHPQAD
FT                   NLAQAILFESEAKFDRMQAFLDRKKSK"
FT   CDS_pept        712430..713281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53626"
FT                   /db_xref="GOA:A4QBM9"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBM9"
FT                   /protein_id="BAF53626.1"
FT                   /translation="MSSEITVPNKVGVLGGGRMGGGIAHSFLAAGAEVVVVDINDAAVE
FT                   AAKERITKDIEGSIKRGAAGTVEEWSSRLSFSVDHSAFAGLELVVEAVPESFELKTNAF
FT                   AQISAHAPEAVIATNTSSLSVSDLAATVNNQVIGLHFFNPVPASNLVEIVVATQTPQDL
FT                   VEVARGWVEALGKTPIVVKDSPGFASSRLGVVIALEAIRMVEEGVASPKDIDNAMVLGY
FT                   KFPIGPLELTDIVGLDVRLGIAEYLESTLGANFTPPQLMRDMVARGELGRKSGKGFYDY
FT                   SA"
FT   CDS_pept        complement(713278..713679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53627"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN0"
FT                   /protein_id="BAF53627.1"
FT                   /translation="MEQELWTIQLGELDKKMGVEVLEQSANKVVARMPIDGNRQSLGLL
FT                   HGGAMVSLAEAVGSWAAVIHASSMGKVAVGVDINATHHASGLKGYVTATATAIRLGRTL
FT                   TSHEVVLHDDAGKRLCTARITNAIVDKRA"
FT   CDS_pept        713795..715891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53628"
FT                   /db_xref="GOA:A4QBN1"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR011966"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN1"
FT                   /protein_id="BAF53628.1"
FT                   /translation="MSNHVDIVPSYLQGQWVRPENPSRIVDVADASTGETVARVSSEGL
FT                   DIQGALDYARTEGQKNLKALTFHERALKIKELALYLNEHKDVLYQLAMCSGANKRDNFV
FT                   DIDGGISTMFTFSSKGRRELPNTNVIVDGPPEVFAKDSSFQGQHIYTTLTGVAVQINAF
FT                   NFPVWGMLEKFAPSFIAGMPTIVKPATPTGYITAEAVRLMVESGILPEGSLQLISGSVG
FT                   DLLDHLDYNDHVAFTGSAKTADTLRNLPKVRENGVRFSAEADSLNAAILGPDASVDTPE
FT                   FEAYTKMLFAEMTSKSGQKCTAIRRAIVPSGLIEDVAQALKQRLDDKVTVGDPRDASAT
FT                   MGPLVSVEQAEDVEGAVEKLIAAGGQVVTGGTVEGAFFAPTILTFADAYAERIHDTEAF
FT                   GPVVSLIGYGDIDEAIELAALGKGSLVASVATHDPATTARVAAGIAAHHGRLHFIDRED
FT                   AKTSTGHGSPLPHLIHGGPGRAGGGEELGGVRGIKHYMQRTAIQGSPNHLTAITGEWHT
FT                   GATTNRVTRAEVEAGTAEHPFRKDLATLKIGDQFASELREVTMGEIQAFAEETGDTFYA
FT                   HVNEEAAMRNPFFPRRVAHGYLLVSWAAGLFVEPAPGPVLANYGLENLRFIQPVTYGDS
FT                   IRVELTAKRITPRVTDEYGEVAWDTVLYNQDDEIVAAYDVLTLVEKVNTTYANDQKAEE
FT                   LAGV"
FT   CDS_pept        complement(715975..716340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53629"
FT                   /db_xref="GOA:A4QBN2"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN2"
FT                   /protein_id="BAF53629.1"
FT                   /translation="MQHPPVPGKSILAFYVVVLVALCLWFKIGSIPDIAVIGYILALSF
FT                   TSAIITAALTQKSPQWVLLTVGLVGLIIVGICIFLWITVPEGILNIAVLLVASGAVIAE
FT                   ISLLISRMRPRRRQATH"
FT   CDS_pept        complement(716511..718004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53630"
FT                   /db_xref="GOA:A4QBN3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN3"
FT                   /protein_id="BAF53630.1"
FT                   /translation="MSAVARRASLQLPYTHVDDFYINGSWVKAEGTKRNPVIDPAVGQE
FT                   WGSVPEATESELDTAVGAARTALKSWGALTGEERAGYLLKIATEIESRSESLALTNTRE
FT                   NGSPISETRGAASNAAGIFRYFATLAPWLDGEDIRPFPAGGAESIVDKDPIGVCALIAP
FT                   WNFPINLVVIKLAPALLAGCTVIIKPASPTPLSIRFIIEAIEAAGVPAGVVNLLTGSGS
FT                   FGDALVRNPGVDKVAFTGSTPVGKKIAAACGELLRPVTLELGGKSSAIILPDADMSVLS
FT                   ARLIRSCMRNTGQTCYISTRIIAPSSRYEEVVQTVASTIAAGTQGDPYDEETVFGPVAS
FT                   ASQYSTVMSYIDSAREEGARVVAGGTRSIGLSEGLESGEFIQPTVFADVTPDMRISREE
FT                   IFGPVISILKYDDTNGVSEAIALANNTEFGLGGLVFGADEEQALKVARQVDSGSVGINF
FT                   FGSNHSAPFGGRHESGMGVEYGIEGLSAYLTYKSIHRTI"
FT   CDS_pept        complement(718001..718738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53631"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN4"
FT                   /protein_id="BAF53631.1"
FT                   /translation="MTRSNLPAWEQADPSVHASDPRAITFAEDFRIRPIPAVGPIDTTA
FT                   ICATPSGGFEQLWKAIEPETRTRANDIHLPIVAAYAERLCDAYPLADRELVLVAAILHD
FT                   TGWAHVDESRIISEGFSGNWRKAAIRFEHETEGCAVARRVLPSLGYTADFAEHVCDIID
FT                   GHDTRQVAYSLEDALVRDCDRLWRFDRAGIMASSSWFGMPVSDYIDRLHREILPELITE
FT                   AAHQMATADLNRARALLRTDAIR"
FT   CDS_pept        complement(718735..720003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53632"
FT                   /db_xref="GOA:A4QBN5"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN5"
FT                   /protein_id="BAF53632.1"
FT                   /translation="MNTSAETGILIIGANQSGVQLAISLRATGFTESITLLGEEDHRPY
FT                   QRPALSKEFLQDKIDKERLIFRSNEYWEENNIRLVKGVRIERIEKNDDGSGVAYGAGQE
FT                   FAFRRLALAVGARPRHLDLPGATFEGVTYLRNADDALALKAMIGSVTDAVVVGGGFIGL
FT                   EAACSLHDLGKNVTVLEYGPRLIGRAVGEETAAFFLEQHRSRGVNIVLDARMKQFVGKD
FT                   GKLSGVELEDGTVIPAQLVIVGIGVIPNTELATDLGLDINNGIVVDKHAVASDGTTIAI
FT                   GDVANIPNPIPGSPADERIRLESVNNAIEHAKIAAYSLVGQPEAYAGIPWFWSNQGDLK
FT                   LQIAGLTVGYDSTVIRQDPEKKKFSVLYYRGDNIIAADCVNAPLDFMAVRSALSKNQNI
FT                   PADLAADISQPLKKLAVDLEVTR"
FT   CDS_pept        complement(720013..720333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53633"
FT                   /db_xref="GOA:A4QBN6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN6"
FT                   /protein_id="BAF53633.1"
FT                   /translation="MSTIHFIDHAGETRTIEATVGDSVMETAVRNGVPGIVAECGGSLS
FT                   CATCHVFVDPAQYDALPPMEEMEDEMLWGAAVDREDCSRLSCQIKVTEGMDLSVTTPET
FT                   QV"
FT   CDS_pept        complement(720360..721106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53634"
FT                   /db_xref="GOA:A4QBN7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN7"
FT                   /protein_id="BAF53634.1"
FT                   /translation="MPSPRTVLITGAAGGLGRAFAEGFAAQGDRIAVADINLDGAQETV
FT                   DKLKALGADAAAFEVDVTSLESTEALAAGVTEFGGGRIDALINNAAVYATVTRSPFEDI
FT                   DPAEWDLVMGVNLKGPWLVTRSVSPFLSDNARVVNLSSATVFSGSAHWAHYVASKGGVI
FT                   ALTRVLAKELGGRGITVNAVAPGFTLTEASLGLMDNAETYGVERGSIKRASQPKDIVGT
FT                   TMFLASPEAEYITGQTLIVDGGRQFI"
FT   CDS_pept        complement(721099..723000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53635"
FT                   /db_xref="GOA:A4QBN8"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN8"
FT                   /protein_id="BAF53635.1"
FT                   /translation="MANKSFPKPSDLPVPRGAEGWEDLYPYYLVFQDKLMDEENEKFWF
FT                   CDSQHWPTVFKPFETIGGEFAVKCLGQYNARHLMIPNANGIEFRVHLGYLYMSPIPVPE
FT                   DQIAERVPMFQERITHYFQNWEPMLANWKERVLGTINELESLEFKPLPDYVPIYDIVSG
FT                   KAKDGTEVLMENFDRLIQLAYQNWQYHFEFLNLGYIAYLDFFNFCKEVFPDIPDQSISM
FT                   MVQGVDMELFRPDDELKILAQLAVDLGLQTHFANPDDPQATLAAIAKAEGGATWIARWE
FT                   EAQDPWFNFTVGNGFYGHDKYWIEHLELPLGYIADYIRRLDEGQTISRPKDELIAEKDR
FT                   VVEEYRDLLDGEQLAQFDAKCGLAATAYPYVENHNFYIEHWTMSVFWRKVRELSRTLQG
FT                   YGFWENEEDLLYLNRTEVRDVLFDLATAWGVGAPGGPIGTIIWPEEIERRKAIVTALKT
FT                   ARPAPALNTPPESITEPFTRMLWGITTEQVQSWLGNDEDTEEGTLKGMAASPGVVEGYA
FT                   RVILSADDLSEIQQDEILVAPVTAPSWGPIFGKIKATVTDIGGMMSHAAIVCREYGLPA
FT                   VTGTGAASTTIKTGDYLKVDGTKGKVVIVDPDAPRIEGPGAHSHAHEVAAHGVDTHA"
FT   CDS_pept        complement(723047..724141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53636"
FT                   /db_xref="GOA:A4QBN9"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBN9"
FT                   /protein_id="BAF53636.1"
FT                   /translation="MTNSLNIPFVQRFDEGLDPVLEVLGGKGASLVTMTDAGMPVPPGF
FT                   VVTTASFDEFIREAGVAEHIDKFLNDLDAEDVKEVDRVSAIIRDELCSLEVPENARFAV
FT                   HQAYRDLMERCGGDVPVAVRSSATAEDLPDASFAGQQDTYLWQVGLSAVTEHIRKCWAS
FT                   LFTSRAIIYRLKNNIPNEGLSMAVVVQKMVNSRVAGVAITMNPSNGDRSKITIDSSWGV
FT                   GEMVVSGEVTPDNILLDKITLQVVSEHIGSKHAELIPDATSGSLVEKPVDEERANRRSL
FT                   TDEEMFAVAQMAKRAEKHYKCPQDIEWALDADLPDGENLLLLQSRPETIHSNGVKKETP
FT                   TPQAAKTIGTFDFSSITVAMTGTK"
FT   CDS_pept        complement(724166..725461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53637"
FT                   /db_xref="GOA:A4QBP0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP0"
FT                   /protein_id="BAF53637.1"
FT                   /translation="MTSQTSQTSQQSSSTGGCPFGHTSESTSHHGYQPFDMHNPFPAYK
FT                   ELRQEEPVMFDERIGYWVVTKYDDIKATFDDWETFSSENAQAPVRKRGPQATQIMTDGG
FT                   FTAYSGLSARIPPEHTRIRAIAQKAFTPRRYKALEPDIRAMVIDRVEKMLANDQHVGDM
FT                   VSDLAYDIPTITILTLIGADISMVDTYKRWSDSRAAMTWGDLSDEEQIPHAHNLVEYWQ
FT                   ECQRMVAEAHENGGDNLTADLVRAQQEGQEITDHEIASLLYSLLFAGHETTTTLISNCF
FT                   RVLLDHPEQWQAILENPKLIPAAVDEVLRYSGSIVGWRRKALKDTEIGGVAIKEGDGVL
FT                   LLMGSANRDEARFENGEEFDISRANAREHLSFGFGIHYCLGNMLAKLQAKICLEEVTRL
FT                   VPSLHLVADEAIGFRENLSFRVPTSVPVTWNA"
FT   CDS_pept        complement(725646..726452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53638"
FT                   /db_xref="GOA:A4QBP1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP1"
FT                   /protein_id="BAF53638.1"
FT                   /translation="MAGGNREPGRTVTSKVIAVLGAFEHTMRPLGVTEIAELADLPPST
FT                   THRLVSELTEGGLLSRKSDGRYQLGLRIWELAQNTGRQLRDTARPFIQELYSLTSETAQ
FT                   LVVRDKDEALLIDRAYGTKKIPRSARVGGRLPLNSTAVGKILLAFDEPWVKQSYLKLPL
FT                   NASTPKTIVNPEVLAAQLKQIHSQGFAITHDEQRIGGASVAVPVWHTGKLGAALGLVVP
FT                   TAQAANLERYLPILQATSQRITKATALIPLDTLLASHKNAGRKGDI"
FT   CDS_pept        726828..728150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53639"
FT                   /db_xref="GOA:A4QBP2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP2"
FT                   /protein_id="BAF53639.1"
FT                   /translation="MSAIIQAFKDADLRKKIFFTIAMIVLYRIGAQIPSPGVDYATISG
FT                   RLRDLTQDQSSVYSLINLFSGGALLQLSIFAIGIMPYITASIIVQLLTVVIPHFEELKK
FT                   EGQSGQAKMMQYTRYLTVALALLQSSGIVALADREQLLGAGIRVLSADRNFFDLIVLVI
FT                   TMTAGAVLVMWMGELITEKGVGNGMSLLIFAGIATRLPTDGMNILGNSGGVVFAVVLAS
FT                   VLILVIGVVFVEQGQRRIPVQYAKRMVGRRQYGGSSTYLPLKVNQAGVIPVIFASSLIY
FT                   MPVLITQIVNSGSLEVSDNWWQRNIIAHLQTPSSWQYIVLYFALTIFFSYFYVSVQYDP
FT                   AEQAENMKKYGGFIPGIRPGRPTAEYLGFVMNRLLFVGSLYLAVIAVLPNIMLDLGVDA
FT                   GSAGATPFGGTAILILVSVALTTVKQIESQLLQSNYEGLLK"
FT   CDS_pept        complement(728129..728611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53640"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP3"
FT                   /protein_id="BAF53640.1"
FT                   /translation="MIDQRSSLIAVDTETGADGLFVVISATAGQHALHDDVFRNLVVNN
FT                   TIEGLASFGKQVSQDVSLLNGAWETIQKEAFCSIGLSKAGSNHTCSHVGWNQLASVDVL
FT                   LGLDTQRGTLANVGAEKIASRNVRNAKLLRENCSLGALTSTGRSEEYESHYFRSPS"
FT   CDS_pept        728150..728695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53641"
FT                   /db_xref="GOA:A4QBP4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBP4"
FT                   /protein_id="BAF53641.1"
FT                   /translation="MRLVLLGPPGAGKGTQAAILSEKLGIPHISTGDLFRANIGEGTPL
FT                   GIEAKQYIDAGKLVPTDVTARMVASRLAESDAAEGFLLDGFPRTVEQADILANLLSEAG
FT                   QTLDGVVNYQVSEDVVVERMLSRGRADDNEETIRTRLGVYRDETAPLIDHYGDKIINIE
FT                   AEGEVEEINARTLKALGK"
FT   CDS_pept        728852..729646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53642"
FT                   /db_xref="GOA:A4QBP5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP5"
FT                   /protein_id="BAF53642.1"
FT                   /translation="MGFRSKKKVIAAKTAAELDAMQAAGEIVGKALQAVRAEAKAGMST
FT                   WDLDQIAEQVIRDAGAVPTFLGYQGFPASVCASVNEVIVHGIPSKETILEEGDLVSIDC
FT                   GATFDGWVGDSAWSFGIGELDEDVQGLNLATEWVLMEGMKAMVPGNRLTDVSHALEVAT
FT                   RKAESKFGVVLGIVDGYGGHGIGRHMHEEPYLANEGKAGKGPVIQEGSVLAIEPMLTLG
FT                   TEDSAVLEDDWTVVTLDGSWAAHWEHTVAATKGGPRILTPRY"
FT   CDS_pept        729726..730556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53643"
FT                   /db_xref="GOA:A4QBP6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP6"
FT                   /protein_id="BAF53643.1"
FT                   /translation="MPPGEEAIKLFCLSNIKIIKQPYILQRMAKNSRIRYSASIKRGAA
FT                   AILTAAATSVALIAVPATASAQDLATGSSQIQTDAREGAWATRNTIQDQLASIGPAALP
FT                   VRAAVDNAINGMFPGLVDEKVAAEQEAARAEAEREAAAAREAEAARVAAEEAARFDRGS
FT                   CPAIADVCVDIDGGRTWLQENGQVTYGAVPVSSGGVGQETPRGTFYINRKVKDEISYEF
FT                   GNAPMPYAMYFTYNGHAFHQGNVATTSAGCVRLNTQDAIYYFNNVGIGDMVYIY"
FT   CDS_pept        730768..731934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53644"
FT                   /db_xref="GOA:A4QBP7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP7"
FT                   /protein_id="BAF53644.1"
FT                   /translation="MKIAVAGLGFVGTSNAALLSKNNEVIAMDINQTRVDALNNYVSPV
FT                   EDAELDRYLATKPETLRATTDTQEAYGDAEFVIVATPTDYDPETNFFDTKYVESAISEA
FT                   QRVNPDASIVIKSTIPVGFTEKMRAQYPNATIFPSPEFLREGSAFYDNLHPSRIVVGER
FT                   SEVGQQFALLLKEGAVDEATPVLFTDATEAEAIKLFANTYLAMRVSYFNELDTYASTMG
FT                   LKSKQIIEGVSLDPRIGNKYNNPSFGYGGYCLPKDTKQLLANFDTVPQRMISAIVESNS
FT                   VRKDFIAEDILSRQPKTVGVYRLVMKTGSDNFRSSSVQGVIKRIQQAGVPVVIYEPTLN
FT                   SESYFDSKVVTDLDEFKRDCDLIIANRPTHELDDIADRIYTRDLFERD"
FT   CDS_pept        731944..733002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53645"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP8"
FT                   /protein_id="BAF53645.1"
FT                   /translation="MGIIHIGPSPQLLPVKLGPGDILEIDSDLTGVLTVIAHGDAHNRV
FT                   HIRPANPDTFLNLESLVLTNPRHVTLSDLNIITTDDHDGVLVWATEASADIRLERVFVK
FT                   GARNGIAIGTDQPAGLRDVIVDSCLIQDCLLQGILCFGPETPQYGLHNVKVTQCRVERT
FT                   RGDPTLTNSHSGSGIILGSVDEGEIVDCHAEGNGAACVATEGPEGIFVYDCRRVRIRNC
FT                   ASKSNRTGGPADGGGFGIDIRCVDCLIENCDAIDNDGAGILVWNLPGMIGGGHVLRGNR
FT                   LSNNCRRTTWHGEITVTPSAGKVEISENTIESKANISGILTGIGAKNIKLKANAFLKSS
FT                   ALEIEECHMPQH"
FT   CDS_pept        733242..734675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53646"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBP9"
FT                   /protein_id="BAF53646.1"
FT                   /translation="MLIGNKPLVGELSLDSADAGDPSNPVHVTSERDFPGIEAEGPAGI
FT                   TIIDTSGVIVEDISVSVSHDHSEEATDGVLLHATEGSGMHSGITVQKVRVTGAYNGIAA
FT                   SSAGAGDGFDDVIIKDAIVQDCIRNGIITYGPTAPDYGHKNIRVLDSVVSGTKGISDIT
FT                   TNSGSGIVIGSVEDAVVERNEAFNNGALSNADEGPIGIWTHDSTRVLVRDNRSHDNSSQ
FT                   RSDGGGFGLDIATTNSTMERNYSYNNAGPGFLLIAHQGGGSSGANVVRYNASIGDSWLN
FT                   AYHGGISAIGGFSSSEDEPQIEDTKIHHNTVFPAPSSGAAALKLRGNLDGITVHHNILD
FT                   TSAGDAPSIAAIDVSADSKVNFIANQLAVNQFTRTPVFDWNGERAQTVEQAEALVQDSF
FT                   DNFEYAPIYPGGFEISTVLDTIAWTQPVSVPSLVPGDSTPATKDLAGNTVEEPNSYVGA
FT                   INPTFSDQNARRQRTFERR"
FT   CDS_pept        complement(734623..735630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53647"
FT                   /db_xref="GOA:A4QBQ0"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBQ0"
FT                   /protein_id="BAF53647.1"
FT                   /translation="MDLVKGPVLVTGGTGFIGSHTVVELLNAGKQVVVIDDLSNSTIDV
FT                   LASIEEITGSKPPLEIGDIRDRAFVDSVLAQYQPSAAIHFAAKKAVGESVEQPTMYLNI
FT                   NIGGTATLLDALHHAGVRDIVFSSSCSVHGETTHSPLNEDSPTQPANPYAFTKLTGEKM
FT                   LSQLVEADESWSAISLRYFNPIGAHPSGKLGESGLGRPRNIMPWLLDVAAGRKQSLEVF
FT                   GDDWPTPDGTCIRDYLHVVDVARVHVRALEHFKTGQAEVFNIGTGVGTSVLELINTMEE
FT                   ATGREIPYEISARRSGDVSALVADAQRVATQWGWVPEFSVFQMCADAWRFDQKK"
FT   CDS_pept        complement(735618..737396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0677"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53648"
FT                   /db_xref="GOA:A4QBQ1"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBQ1"
FT                   /protein_id="BAF53648.1"
FT                   /translation="MSNGWVSDIRSTGPILATDTPRVIRDASEELFVPAMPRSTQRWLN
FT                   LTVLLWVVLVICFVVWWFKPEHVGTTTGLVLNSAVASFILLLPIAFVSRIRSIRRINPD
FT                   VPLPDSRVAMVTTRAPSEPFSEVQPTLEAMLNQNYKADYDVWLCDESPTEEISDWCEAN
FT                   GVYLSTRFEDEGYHRSSWPRRTRCKEGNLAYFYDNHGYANYDIVAQFDCDHIPEPDYLE
FT                   AILRPFSDPNVGYVAAPSMCDLNRKDSWSARGRLYAEAMIHGPHQSAHNGGLTPTCIGS
FT                   HYAVRTADLAKAGGIGPELAEDFSTSYVIRLTGADGAFAVDAKAHGQGPSTFAAMVTQE
FT                   FQWCRSLTVLLFTLVGRTLNVYGPRLKFRFLFALLVMPAMGMMTGAGFLIAPLAVVFDK
FT                   QWMSMNILDFFIFTTVVSLPLVGMLLILKKAGLLRPNDIPVVNWESGLFQLVRWPYVVR
FT                   GFFAGLRQVIFRKEVHFKVTPKGDLGIQPISMNVMLPYHFLTAAMVVIGLWGLIDHRSP
FT                   GYAGLTLLGGLIYGFVCFIVPWMHFCELPSANTTFMERLRAVAFPLLAGIIMFLASVFA
FT                   LALYAAIFFGGYQWIW"
FT   CDS_pept        complement(737501..738454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53649"
FT                   /db_xref="GOA:A4QBQ2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBQ2"
FT                   /protein_id="BAF53649.1"
FT                   /translation="MRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQI
FT                   SNPRLQIKTVDVRKKFEIDGPVDIVFNLASPASPPVYTQRRVECLLINSEAVLQVAEFA
FT                   LEKGARLVQASTSEVYGDPLSHPQLEHHWGNVNPIGERSCYDEGKRFAEALLSAMRLEQ
FT                   GLNAGIIRIFNTYGPRMHPFDGRVISGFVRQALANEPLTVFGDGSQTRSFCYVSDLVRG
FT                   LWLMGNSNQPGPINLGNPIEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRRPDISK
FT                   AKELLGWEPLVGIDVGLREVINWQIETQRTYAEKIS"
FT   CDS_pept        739081..739299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53650"
FT                   /db_xref="GOA:A4QBQ3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBQ3"
FT                   /protein_id="BAF53650.1"
FT                   /translation="MAKEGAIEVEGRIVEPLPNAMFRVELDNGHKVLAHISGKMRQHYI
FT                   RILPEDRVVVELSPYDLTRGRIVYRYK"
FT   CDS_pept        739490..739858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53651"
FT                   /db_xref="GOA:A4QBQ4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBQ4"
FT                   /protein_id="BAF53651.1"
FT                   /translation="MARLAGVDLPRNKRMEVALTYIYGIGPARSKQLLEETGISPDLRT
FT                   DNLTDEQIAALRDVIEGTWKVEGDLRRQVQADIRRKIEIGCYQGIRHRRGLPVRGQRTK
FT                   TNARTRKGPKKTIAGKKK"
FT   CDS_pept        739861..740265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53652"
FT                   /db_xref="GOA:A4QBQ5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBQ5"
FT                   /protein_id="BAF53652.1"
FT                   /translation="MPPKARTNARRTGRRVVKKNVANGNAYIKSTFNNTIVSITDTNGA
FT                   VISWASSGHVGFKGSRKSTPFAAQMAAENAARKAMDHGMKKVDVFVKGPGSGRETAIRS
FT                   LQAAGLEIGSISDVTPQPHNGCRPPKRRRV"
FT   CDS_pept        740289..740894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53653"
FT                   /db_xref="GOA:A4QBQ6"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBQ6"
FT                   /protein_id="BAF53653.1"
FT                   /translation="MARYTGPATRKSRRLRVDLVGGDMAFERRPYPPGQAGRARIKESE
FT                   YLLQLQEKQKARFIYGVMEKQFRRYYAEANRRAGKTGENLVVLLESRLDNVVYRAGLAN
FT                   TRRQARQLVSHGHFTVNGKAIDVPSFRVSQYDIINVREKSQKMNWFEEAQDNLVDAVVP
FT                   AWLQVVPENLRILVHQLPERAQIDIPLQEQLIVEFYSK"
FT   CDS_pept        741012..742028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53654"
FT                   /db_xref="GOA:A4QBQ7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBQ7"
FT                   /protein_id="BAF53654.1"
FT                   /translation="MLISQRPTITEEFVDNARSRFVIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSVKIDGVLHEFTTISGVKEDVSDIILNIKGLVLSSDSDEPVVMQLVKEGPGV
FT                   VTAGDIQPPAGVEIHNPDLHIATLNETAKIEIELIVERGRGYVPATVTATGGEIGRIPV
FT                   DQIYSPVLKVSYKVEATRVEQRTDFDKLVIDVETKNSITARDALASAGKTLVELFGLAR
FT                   ELNIAAEGIEIGPSPQETEYIAAYSMPIEDLDFSVRSYNCLKREDIHTVGELAERAESD
FT                   LLDIRNFGQKSINEVKIKLAGLGLTLKDAPEDFDPSTLEGYDAETGGYIDVEAEDSE"
FT   CDS_pept        742084..742590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53655"
FT                   /db_xref="GOA:A4QBQ8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBQ8"
FT                   /protein_id="BAF53655.1"
FT                   /translation="MPTPKKGARLGGSASHQKKILSNLAASLFEHGAIKTTDAKAKALR
FT                   PYAEKLITKAKSGSVADRRNVLALVPNKEIVAYLFNELAPKFENRPGGYTRIIKLENRK
FT                   GDNAPMSQISLVLEETVSTEASRATRAAASKKAAEEAQTEEAETEEVVEAPAEETATEE
FT                   AAEEK"
FT   CDS_pept        742731..743615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53656"
FT                   /db_xref="GOA:A4QBQ9"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBQ9"
FT                   /protein_id="BAF53656.1"
FT                   /translation="MDNSTVRIRLDLAYDGTDFHGWAKQGTSDLRTVQKVLEDNLSMVL
FT                   RETVELTVAGRTDAGVHAAGQVAHFDIPAHALEQRSIDGDPSKLVRRLGRLLPDDIRVH
FT                   GVRFAEPGFDARFSAMRRHYVYRITTHPAGALPTRRHDTAQWPKPVELERMQLAADALL
FT                   GLHDFVAFCKAKPHATTVRELQKFAWKDVSTDIEPQVYEAHVVADAFCWSMVRSLVGSC
FT                   MAVGEGRRGSGFTTELLDASERSPMVPVAPAKGLSLVGVDYPSADKLQERALETRAVRE
FT                   FPDASASLKLDDE"
FT   CDS_pept        743722..746121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53657"
FT                   /db_xref="GOA:A4QBR0"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR0"
FT                   /protein_id="BAF53657.1"
FT                   /translation="MLTTLWIAVLVFTVPGLVVSWVSGLKVPWAIAASIPATFGIYGLS
FT                   AWLLGLWEMRFDLHSVVISTLVFAAVALVWRLFFVGGWLVRRRKARIRRQTLADEEPAE
FT                   NAEVSAGEPAESSTNEAAESESETSERRGIWRVIFDYMRDGGILDYRWLLPAAGAITGA
FT                   WLIIDRAVDLLLSTEHGLGDIVQGWDVHWHASTVRFIDETGIASSTMMGQLRNIETQQD
FT                   LFYPSAWHAGAWVLSDVGNLTIVEATNLTGIVLSGLLLPLAVALIAWRMINNRGLTAQI
FT                   GAGFAGLITIASPVLFWVGNYVGAWPYVAAIGASGVVLALFMSTPSMPVRIFAAALAFM
FT                   GMFQLHPAPSTIVIMVLLLWWLLKLVVVPSRKVKGWKAGIGIRLKDVGILAITGIIGVL
FT                   FMLPQVISGSEQTEDVLSYSAEEQVTRSESWLVSIFMETRHVDFFGNIDIVPVLVFAAI
FT                   GGVVALVWRGNLWAPVFYFASVALTANSLKPFEEPWGDWLNIVGGLHYSTGHRLIMPVA
FT                   MFTFAAAGIGAAAVIRLICLGPIKKFATVSGVVSVVMALVVAVPLQTWAKDFVEEGSET
FT                   TILAPHNDERMVSNNDLAAWDWLIQQPGGADMNIMGDPADGNGWMYAYNGLHSVARHYA
FT                   WPAAGEGSATAMLFWWPQLLGVGTDENPDQVNDVDQAARDLNVGYFMISPWTFWDFQIP
FT                   NFRQIDLLWQTPGVTPVYKKGDSVIFAVNDMFTDAELDQMRAPGNSPEPLPELPTLGEI
FT                   GLAETEDEVDQTYYHRPTVPAGENSAMPSAETLYAPDPTKPHTVPN"
FT   CDS_pept        complement(746122..746580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53658"
FT                   /db_xref="GOA:A4QBR1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR1"
FT                   /protein_id="BAF53658.1"
FT                   /translation="MWKDLTEPLPEACAEGFEIRVVKSPEELADYAAVLSANWNPPAET
FT                   VQRFYAEAAEYALSEESSAHYLVGYVYGRAVCSAEAFIHASVAGIYNISTLENERRRGY
FT                   GGAITLATLHTARNAGCDTAVLQASEDGEPVYRKLGFTDCGRFTEYSL"
FT   CDS_pept        746579..746962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53659"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR2"
FT                   /protein_id="BAF53659.1"
FT                   /translation="MPVSVSDVLQLAATSSSPRLSGLDAGPTHQENGRSACSTKAVVSA
FT                   IRAAAISGEKRAPVMMSNVSSSRPLSAMSRSSVCVIVADARCRWRWQKCSAKFSSIARC
FT                   NLPRSFRKLHFRYHKGAISRTHC"
FT   CDS_pept        747095..748354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53660"
FT                   /db_xref="GOA:A4QBR3"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR3"
FT                   /protein_id="BAF53660.1"
FT                   /translation="MAEGMLMPTTSAQVSGHKFLVRRIEHGLVMGDVRMIHDPLGRRRR
FT                   ALVFGVVACVMLAVGSLALAIFRPAKDPADAPLIRSESGALFVQLDGSVHPVANVASAR
FT                   LIVGEPVDPVNASDAIIAGMPRGVPVGVSDAPGLFSSAKEPEQDWFVCQDVGTGDLHIT
FT                   VPRGGLGPTLIAEGNGWLGASKSETGEVTWNLITADGRRELPAWGSEHGRITRRHLGIS
FT                   EDTPRIYLTTELLNAIPEHDAVRFPDPLPELVDASTRSWLRLDGALAEITPLQRGLLID
FT                   AGSGVFPDPTALLGVHEETANTLTLPEQTVSWQDLDGGFACADGEGQIGFLETLESGVA
FT                   LSGDSRAKSFSTNAGGAVGVDSGFGYYVVSEFGLMHPVSTGESMVALGITDVQVVPWSV
FT                   LRLLPQGSELAKETALAPTY"
FT   CDS_pept        748373..749920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53661"
FT                   /db_xref="GOA:A4QBR4"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040165"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR4"
FT                   /protein_id="BAF53661.1"
FT                   /translation="MSGLVDPDSTFLKTIGKLSNSLSIGRGVDQKEVIPKGWNAHWEAI
FT                   TKLKRSFDAIPAGERVRLAKKTSNLFRGRSDAGHGLDVAALGGVIAIDPVNATADVQGM
FT                   CTYEDLVDATLSYGLMPLVVPQLKTITLGGAVTGMGVESTSFRNGLPHESVLEMDIFTG
FT                   TGEIVTCSPTENIDLYRGFPNSYGSLGYAVRLKIGLEPVQDYVQLRHVRFNDLESLTEA
FT                   IEEVASSLEFDNQPVDYLDGVVFSPTEAYLVLGTQTSQPGPTSDYTRDLSYYRSLQHPE
FT                   GITYDRLTIRDYIWRWDTDWFWCSRAFGTQNPVVRKLWPRDLLRSSFYWKIIGWDRKYS
FT                   IADRLEERKGRPARERVVQDVEVTIDKLPEFLKWFFESSDIEPLWLCPIKLREVPGSSV
FT                   GAGEILSSPEAIDSGAAEHPWPLYPLKKDVLWVNIGFWSSVPVDLMGSDAPEGAFNREI
FT                   ERVMAELGGHKSLYSEAFYTREDFEKLYGGTIPALLKKQWDPHSRFPDLYEKTVKGA"
FT   CDS_pept        750005..751312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53662"
FT                   /db_xref="GOA:A4QBR5"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR5"
FT                   /protein_id="BAF53662.1"
FT                   /translation="MSNAVAQDLMTIADIVEATTTAPIPFHITAFDGSFTGPEDAPYQL
FT                   FVANTDAVSYIATAPGDLGLARAYLMGDLIVEGEHPGHPYGIFDALKEFYRCFKRPDAS
FT                   TTLQIMWTLRKMNALKFQEIPPMEQAPAWRKALINGLASRHSKSRDKKAISYHYDVGNE
FT                   FYSLFLDDSMTYTCAYYPTPESSLEEAQENKYRLIFEKLRLKEGDRLLDVGCGWGGMVR
FT                   YAAKHGVKAIGVTLSEQQYEWGQAEIKRQGLENLAEIRFMDYRDVPETGFDAISAIGII
FT                   EHIGVNNYPDYFELLSSKLKTGGLMLNHSITYPDNRPRHAGAFIDRYIFPDGELTGSGT
FT                   LIKHMQDNGFEVLHEENLRFDYQRTLHAWSENLKENWEEAVELAGEPTARLFGLYMAGS
FT                   EWGFAHNIVQLHQVLGVKLDEQGSRGEVPERMWWTI"
FT   CDS_pept        751513..751941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53663"
FT                   /db_xref="GOA:A4QBR6"
FT                   /db_xref="InterPro:IPR013434"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR6"
FT                   /protein_id="BAF53663.1"
FT                   /translation="MGTMREMVSDRIDRLQEAHARSKQKKFGFLVRPGTLILGWLVTII
FT                   GLITIPLPGQGWLTTFIGVGILSLELKWAKNLLAWGVHQYDRFFTWYGKKSFRFRMAML
FT                   ALMILLIWVVFIVTFWLMWHAGTIPWADEFFTWLGLSR"
FT   CDS_pept        complement(752295..753626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53664"
FT                   /db_xref="GOA:A4QBR7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR7"
FT                   /protein_id="BAF53664.1"
FT                   /translation="MCGLKGWNHCVLQLVCHSHCIYWMYLECCAVLILDSVDKMRRLIA
FT                   VSLAALFIVASTPATRAQEVEALACPEVAIADPSSAVLDEHLAQSLSQAHQLATGAGVM
FT                   VAVIDTGVSLHPRLPHLIPGGDFVGAHQSPDVPGELIDCDGHGTIVAGIIASQGNPGTG
FT                   WPYDGSSDPYIGVAPDSGIISIKQTSSYVRTREDSNVGTLSTLAESIHRALDSDAHVIN
FT                   ISVVSCLPQSPDEAASFQPLTDALNRAELQGVIVVAAAGNLGQDCPVGSTVYPAHSDTV
FT                   LSVSARFDSHTLAEYSMPGNQQILSAPSHIQAGLSPRGDGFASHMITTAGESPFEGTSF
FT                   AAPVVSATAALLRQHFPFATPYEIRARIFNSIDPARGAIDPYLALTQEIYPTTPLVHEI
FT                   ALSVPTPPDDSPRERGILVTAIIVGLLAMLAVLMGLRRIHQRTA"
FT   CDS_pept        complement(753511..754893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53665"
FT                   /db_xref="GOA:A4QBR8"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR8"
FT                   /protein_id="BAF53665.1"
FT                   /translation="MVILAIDNALRVSIRIDLTVGDAPAAVADVALPAGSSLADILDEI
FT                   LELTDAPRISRPWVAHTAAGSPIDCGIPLAETQVEQGSVVVLSPERDLEAPVLRDVAEA
FT                   LVEFSSTNRAGHLVELMTFAGLIGAAVLMTSPAASGIIVPGRMGIFVAICALLLLWLPP
FT                   AHTPILRNVLPITLILGAGGAVSVLVAGTSGTSPGALTWTIFAGACTILASSLLVHVVY
FT                   RPAILLVATLSTLGLGLLVLAATTTLWKLKATEDFSGPAAITVTAFTITMCFAPKIAAS
FT                   LAGLRVPSLPTAGEDLSVSDLTMTDPEKRIKTTKTLFDAQILGLGVLSGPLALLWVTPG
FT                   TWTTTVFSLCIAVASLLHANRHQAPIPTWTLMGLSALGFISMALSASRSGSLVALIGSV
FT                   VIIAALVSVALWISTVPTLEPTTIVWLERLESLCLAASLPLALHLLDVFGMLRGLDIGF
FT                   GG"
FT   CDS_pept        755108..758725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53666"
FT                   /db_xref="GOA:A4QBR9"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBR9"
FT                   /protein_id="BAF53666.1"
FT                   /translation="MTTSVERQEQSPTGYIVEPVTWPERDPAPPLPTEPLIAEAVPQAV
FT                   RPAPKPLLKVLMPVIMVAMVLAMVALMILTSGQLNPMVLIFPMMMGMSVLMMFAPPEGD
FT                   DTDEVRRTYLRHLGALRAKATDHAAMQRRHEWHRHPDPATLWSTLGTRRMWERTQDDQD
FT                   CLEIRFGLGVTRLDPAINVSDSGAPEDLDPVCAVSLRHTIRDVGSVQSMPVSVQLQAFR
FT                   FIGLNGAGAHDLARALVVQLLYHHGPEVVGIKAIGESGWEWLKWVPHTRDPERAAFRIL
FT                   LVDSVLTNGTESFIDDPQWTTIINVGAQTSTALGQLAEDEGLLLHVDKRLHVATAHGAE
FT                   ELGTPDAVSAELAEVFGRRLTAFRRTTTAHAASSGELLSLLGIDDVEHLTPETLWMNKR
FT                   TQPKTRLAVPLGLNASGRPMVLDLKESAHGGMGPHGLCIGATGSGKSELLRTLVLGLTI
FT                   THSPEELNLVLVDFKGGATFLGFEQLPHTSAVITNLEEESVLVERMHDAISGEMNRRQE
FT                   ALRQAGGCANVDEYNQRDGVKPMPALLIVIDEFSELLGQHPDFADLFVAVGRLGRSLHI
FT                   HLLLASQRLEEGRLRGLDSHLSYRIGLKTFSASESRQVLGITDAYQLPSQPGAGFLKSD
FT                   VDTVTRFQASYVSGPIMRRHHLAPTQSRVRLFTGWEEPKEEVIVEQSTETLIDAVVARA
FT                   ISAAKLRGLSAHRIWLPPLPAEVSIGALADDVGELSAVIGMIDRPYQQRQDPLLINFSL
FT                   NGGSGHWAICGGPQTGKSTALRSIVVSMAATHSTENIRFYVLDLSGTSLENLSRLPHVA
FT                   GVAGRKDPEKVRRVVDEVRGLINHPEKRHTFLIVDGWHTITQEFDELFDAFVDIAANGL
FT                   ASRVHLVLSTQRWSSIRPAVRDLVTGRIELKLGEAMDSVIDRKAQLRIPSKPGRGLNMD
FT                   KEHILIAHASGQDIAQVCVMADGQGWQQVPQLSVLPAHILLHELELSATPGIPIARGGA
FT                   ELSTLTWDPESSRHLLAFGSQGCGKSSLIRTIVTGLTIVGREKARLVFFDLRRTHLGLV
FT                   PEDMLAAYCATSTAVHNTIKDMVATLSARLPGPDITAQELRERSWWHGPDIYLVIDDYD
FT                   LLPAGTLHPLREIIPHARDVGLHIVLTRKAGGASRALYDPVMSEIKDQSPHVVLFDADR
FT                   DEGAILGIKPTAQPPGRATMSIRGENIGVAQMARMGDDS"
FT   CDS_pept        758722..759624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53667"
FT                   /db_xref="GOA:A4QBS0"
FT                   /db_xref="InterPro:IPR023840"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS0"
FT                   /protein_id="BAF53667.1"
FT                   /translation="MSTQTITITVLETATIFDGPETIYRYDLAAEGVLDGWAHSAVLDQ
FT                   VKQIAGENWPSVEIMVDGTDNVVKALTSMFASKGVTCDGVEVEAPPVVEEPPKIKRPTS
FT                   GKQVRQFYGIKPLHLLLVSVLVGSIAGIWVISGFTGPVDSRPVDKVAEISTQGETSISN
FT                   QPQPQPTVLVTEDLLIEAPFGFEMRSDEQSRYLEGPDPNLRIHVGVDPLHGADAALVAE
FT                   ELRRLIAEDPSLEEIPAGEWGEKTTIDYRETPGDGSHVLWVTWFEADRQLNVGCHSKAA
FT                   ETLVHKAQCRNVIEHLTLK"
FT   CDS_pept        759795..760121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53668"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS1"
FT                   /protein_id="BAF53668.1"
FT                   /translation="MSNLFRTESDVMLATAGQVDDINDQVQSELSRLRGVVDSVRGSWA
FT                   GQAQVSFDSLMNRWNSSARQLQEALASISDNIRHNARSFENTEADNSQAFNAVGAGDGA
FT                   GLPL"
FT   CDS_pept        760154..760444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53669"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS2"
FT                   /protein_id="BAF53669.1"
FT                   /translation="MDMIRYEFGAIQGAATDINSTSGRINSLLDGLKSQLQPMVASWEG
FT                   ESSEAYSEAQLKWDRAAAELNTILATISNTVAQGAERMSDVNRRAAASWGA"
FT   CDS_pept        760799..761242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0699"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53670"
FT                   /db_xref="GOA:A4QBS3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBS3"
FT                   /protein_id="BAF53670.1"
FT                   /translation="MSTYHPKSGDITRKWYVIDATDVVLGRLATHAADLLRGKGKPLYA
FT                   PNVDCGDHVIVINADKVAVTSNKREREMRYRHSGYPGGLKSMTLGRSLDLHPERTIEDS
FT                   IVGMMPHNKLTAASAKKLHVFSGSEHPYAAQKPEAYEIKKVAQ"
FT   CDS_pept        761242..761790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53671"
FT                   /db_xref="GOA:A4QBS4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBS4"
FT                   /protein_id="BAF53671.1"
FT                   /translation="MSEPIQNENVESNVADAADIAAATAATEEFTNTIGDAIATASEEE
FT                   TIEAAPVVLDGPIQTVGRRKRAIVRVRLVAGSGEFKCNGRTLEEYFPNKLHQQLIKAPL
FT                   VLLDRENQFDIVATLKGGGPTGQAGAFRLAIARALNAYNPAERGELKKAGFLTRDARAV
FT                   ERKKAGLHKARRAPQYSKR"
FT   CDS_pept        761979..763322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0701"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53672"
FT                   /db_xref="GOA:A4QBS5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBS5"
FT                   /protein_id="BAF53672.1"
FT                   /translation="MTRLFGTDGVRGLANEVLTAPLALKLGAAAAHVLTAEKRVDGRRP
FT                   VAIVGRDPRVSGEMLAAALSAGMASQGVDVIRVGVIPTPAVAFLTDDYGADMGVMISAS
FT                   HNPMPDNGIKFFSAGGHKLPDHVEDEIERVMDSLPAEGPTGHGVGRVIEEATDAQDRYL
FT                   EHLKEAVPTSLEGIKIVVDAANGAASVVAPKAYEAAGATVIAIHNKPDSYNINMDCGST
FT                   HIDQVQAAVLKHGADLGLAHDGDADRCLAVDKDGNLIDGDQIMAMLAIAMKENGELRKN
FT                   TLVGTVMSNLGLKIAMDEAGITLRTTKVGDRYVLEDLNAGGFSLGGEQSGHIVLPDHGT
FT                   TGDGTLTGLSIMARMAETGKSLGELAQAMTVLPQVLINVPVSDKSTIVSHPSVVAAIAE
FT                   AEAELGSTGRVLLRASGTEELFRVMVEAGDKEQARRIAGRLSAVVAEV"
FT   CDS_pept        763762..764067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53673"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS6"
FT                   /protein_id="BAF53673.1"
FT                   /translation="MSGFELKIGESLATLRGLLGETAQQHSIHRQRVPYYSPSASGRGF
FT                   SAHGVALADMFEGLHRGVEKRIDAFTQTTQAAEEEVKRFDNTDKVFGAGCDGIDPK"
FT   CDS_pept        764064..765611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53674"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS7"
FT                   /protein_id="BAF53674.1"
FT                   /translation="MNDPLAGYGAVVSALQGASGGMYRGPAKSEGQLREMYQTIEGLDT
FT                   SSLREAAEAAVGGTNEARIQGWVGPLLKFFGTVGGGMIATEIAERAVDWFKNRNDVEDV
FT                   SEAADKAADAIDSTVTESDQGMMHIIQQLLDIVSTLTQILGSMDRGKFPQEFRDCVQTG
FT                   ADLIDQAGDMLEGLCADRDEAISQCFSALTDHGKQVCETEPKPLCSAASGGSSGGATSS
FT                   AAASSGGSSSSTASSGSSGGSSSAADSSTSTNAESSVEKEKTTPAAVEKPDEKPVEKPV
FT                   EKTPEKPPEKPVEKPVEKQECEEKPDPKPNPKPDPDPEKCKTEPVECEPTPKPETEPEP
FT                   KPTPTPTPGTPTPIPDLETEDCEPGKETVTDSESESEECDPELNDVPEESDLIGQLIKG
FT                   AIGIGIVVVGVGLLVNFLEQCVPVIEEVSVPEPEPIPKPAPQPEPTSVKPPESELDKVA
FT                   EPAPKPIPQANYTAAAATNYSAPAHAPVVPITPAAPEVPAAPEVPAPAVNLHKAGGW"
FT   CDS_pept        complement(765590..765907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53675"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS8"
FT                   /protein_id="BAF53675.1"
FT                   /translation="MILFGTNAVLRFCTNQDHPFLVLGFPQYRFHRPPTSLLSPCHPNR
FT                   FFQRLNHNRLFLLFHIFRHIIKLSLSRSDCLFELFHPLSCALSKLLEKFRILHRYHPPA
FT                   L"
FT   CDS_pept        765605..765841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_6035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_6035"
FT                   /db_xref="EnsemblGenomes-Tr:BAQ21097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VID2"
FT                   /protein_id="BAQ21097.1"
FT                   /translation="MVAVEYAEFLQQFRERTAKRMEEFEKAIASTQRKLDDVAEDVEKK
FT                   KQPVVVESLEKPIRMARRQQRGRGPVKSVLREA"
FT   CDS_pept        complement(765925..766782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0705"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53676"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBS9"
FT                   /protein_id="BAF53676.1"
FT                   /translation="MAENLNKHLSKLSKRGPHRVLVGDMNYAGIPGKIYTPAEGDGIPG
FT                   VAFGHDWMKSIKYYHQTLRHLASWGIAVAAPDTENGFMPDHKGFASDLESSIQILGGVK
FT                   LGSGNVTVNPACLGVVGHGMGAGAAVLSAANRDLVRAVGAIYPAKTSPSAIDAAFAVKA
FT                   PGLVIGSSNLGLFESGEPAKLAANWAGDVCYRESKKGNQQGFSEDTMFKLVAGIGSPQT
FT                   GAQETVRGLLTGFLLHQLAGEKKYKAFSEPDAEAKKVVSYFGQELQEHAFPKDTSPFAF
FT                   LNEK"
FT   CDS_pept        766877..767962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53677"
FT                   /db_xref="GOA:A4QBT0"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBT0"
FT                   /protein_id="BAF53677.1"
FT                   /translation="MNLLTTKIDLDAIAHNTRVLKQMAGPAKLMAVVKANAYNHGVEKV
FT                   APVIAAHGADAFGVATLAEAMQLRDIGISQEVLCWIWTPEQDFRAAIDRNIDLAVISPA
FT                   HAKALIDTDAEHIRVSIKIDSGLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLACAD
FT                   EPENPETDRQIIAFRRALALARKHGLECPVNHVCNSPAFLTRSDLHMEMVRPGLAFYGL
FT                   EPVAGREHGLKPAMTWEAKVSVVKQIEAGQGTSYGLTWRAEDRGFVAVVPAGYADGMPR
FT                   HAQGKFSVTIDGVDYPQVGRVCMDQFVISLGDNPHGVEAGAKAVIFGENGHDATDFAER
FT                   LDTINYEVVCRPTGRTVRAYV"
FT   CDS_pept        767986..768483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53678"
FT                   /db_xref="GOA:A4QBT1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBT1"
FT                   /protein_id="BAF53678.1"
FT                   /translation="MKSEFPVSGTRRFEHAADTQNFGEELGRHLEAGDVVILDGPLGAG
FT                   KTTFTQGIARGLQVKGRVTSPTFVIAREHRSEIGGPDLIHMDAYRLLGEDSEDADPIGA
FT                   LDSLDLDTDLDLAVVVAEWGGGLVEQIADSYLLITIDRETAVQEDPESEARIFHWEWRE
FT                   GR"
FT   CDS_pept        768716..770317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53679"
FT                   /db_xref="GOA:A4QBT2"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBT2"
FT                   /protein_id="BAF53679.1"
FT                   /translation="MLDFLAANPLIALVVILAIGLAIGQIRVFGLSLGAAAVLFVALVF
FT                   STANTDIVIPMIVYQLGLAMFVYVIGLSAGPAFFSEFAKKGWKLTIFMLLLLATLIGLA
FT                   WVLIKSLGLDAAIGTGMFTGALTSTPGMAAVVELIEGIDPSLASEPVIGYSLAYPGAVL
FT                   GSIVVAAVGAKLLKVNHREDARKEGMITAPLVWKGVQLKPGITGRVGDLPRLAGESIIA
FT                   TRIVDDPHTHRLADPDLPITEGMELLINGTEEAVDRAIKALGEERETKIEDTELIYTRL
FT                   TVSSPEVAGRTVAELDTVAHGFMIARIRQGDSEVVPKPDTVINYSDRIRVVVAPGRVAE
FT                   VRRFLGDSEKSLADVNLLPLAIGLSLGLLLGAIPIPLPGGTTMSLGFGGGPIIAGLILG
FT                   ALKHTGSLTWQMPFHANRTISTLGLALFLAGVGTSAGAGFRAALTDSSSLIYMAGGLVI
FT                   TLASALLCAVIGMWVLRLRWDEAMGVAAGTTTNPAIISYLNGQTGTDLANRGYATVYPT
FT                   AMIGKILGAQILFLLL"
FT   CDS_pept        770333..771616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53680"
FT                   /db_xref="GOA:A4QBT3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBT3"
FT                   /protein_id="BAF53680.1"
FT                   /translation="MVGVVSTPARNLGSMTKTLGSLQLEEITLTLPLTEDVADERTIDV
FT                   FARIATRVGGEDLPYLVFLQGGPGNEAPRPSLNPLNPNWLGVALEEYRVVMLDQRGTGR
FT                   STPVGNDILEKPTAEVVEYLSHLRADGIVRDAEALRKHLGVNQWNLLGQSFGGFTTLHY
FT                   LSRHADSLDNVFITGGLSAIDRPAEDVYANCYNRMRRNSEEFYGRFPQLRETFRGLVNR
FT                   ARAGEIVLPTGEVVSETRLRSLGHLLGSNDGWFDLYNLLELDPTSNAFVHDLAGLLPFG
FT                   NRNPIYYVLHESSYADGVVTNWAAERVLPEDFREDPTLLTGEHVFQEWTDTVPSLKPWK
FT                   DVALALAQQEWPKLYDAKALENSQATGAAAVYANDVFVPVDYSLETAQHLPGVQLFITS
FT                   QHEHNGLRASSGAVLKHLFDLTHGREVR"
FT   CDS_pept        771623..772300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0710"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53681"
FT                   /db_xref="GOA:A4QBT4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBT4"
FT                   /protein_id="BAF53681.1"
FT                   /translation="MLVLALDTSTPDLIVGVVDSDTGNTRAETIIEDTRAHNEQLTPTV
FT                   QKTLLDANLSFSDIDAIVVGCGPGPFTGLRVGMVSGAAFGDALGIPVYGVCSLDAIAHN
FT                   IGARNIPHALVATDARRREIYWATYRSGERDLGPDVIAPANIQISGAVDTISIPEHLVE
FT                   KLPEYLQNVTMHSGKPAPASLVAVADFSVEPQPLVPLYLRRPDAKEPKPKPKSAAIPEV
FT                   DLS"
FT   CDS_pept        772297..772806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0711"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53682"
FT                   /db_xref="GOA:A4QBT5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBT5"
FT                   /protein_id="BAF53682.1"
FT                   /translation="MSEQFELRELRREDAGRCADLEQILFPGDNPWPRDVFAVEFSHPT
FT                   NFYIGAFDEGYLVAYAGLAMMGPVDDPEFEIHTIGVDPEFQRKGLGRVLMDQMMHAADS
FT                   HDGPVFLEVRTDNVPAISMYEAFGFKTLAVRKNYYRPSGADAYTMQRPRLSDRKDQQTD
FT                   TEGTPN"
FT   CDS_pept        772810..773844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0712"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53683"
FT                   /db_xref="GOA:A4QBT6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBT6"
FT                   /protein_id="BAF53683.1"
FT                   /translation="MIVLGIESSCDETGVGVVKLDGEGNLEILADSVASSMQEHARFGG
FT                   VVPEIASRAHLESMVPVMREALRQAGVDKPDAVAATVGPGLAGALLVGASAAKAYAAAW
FT                   GVPFYAVNHLGGHVAVANLEGETLPHAVALLVSGGHTQLLEVDAVGLPMKELGSTLDDA
FT                   AGEAYDKVSRLLGLGYPGGPIIDKLARRGNPEAIAFPRGLMKKSDSRHDFSFSGLKTSV
FT                   ARYVEAAERNGEVISVEDVCASFQEAVCDVLTFKAVRACRDVGAKVLLLGGGVAANSRL
FT                   RELAQERCDKAGIELRVPRFNLCTDNGVMIAALAAQRIHEGAQESPISVGTDPSLSVET
FT                   PQVF"
FT   CDS_pept        773863..775587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0713"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53684"
FT                   /db_xref="GOA:A4QBT7"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBT7"
FT                   /protein_id="BAF53684.1"
FT                   /translation="MKPVFSVDQIRRAENTLFELQADPDELMISAASAVADVALAMVDG
FT                   PAPAVSSEESILLLVGPGGNGGDALYAGAFLAEEGHHVDALLLGNGKVHQSALAYYESL
FT                   GGQIISDFPPHYLYRLVIDGLFGIGGRGGLTPELASLVESFSASGIPILAIDVPSGVHA
FT                   DSGELPPGVLVTVEGFDDDAPMARQKIPAHIDADVTITFGGLRRAHAVSPACGEVLCAD
FT                   INIAGGGGKSLSAELSQVQAEDATPQMFASKAYQRKDSLFERANLKATAPHIHRIGQHF
FT                   TLLNMEPGPDHDKYSGGIVGIVAGSGTYPGAAVLSVKAAVRATSAMVRYVGPAVNFVIQ
FT                   SLPEVVATQSLATAGRVQAWVHGPGRGLEAEQSAELAELLSRPEPVLIDADSLSLLQLS
FT                   AELRQALRERKAPTVLTPHKGEFERIAAELRSEGVEIPQADKDPIGAAQALAKEFDCCV
FT                   LLKGKYTVIAAHDFVHAINAGHSWLATPGSGDVLSGLVGAHLAQSYAELNRLPEFFPDV
FT                   TLSDSAIYTQIAPAATIHAVAAGLAARTEFGFAPTSASLIADAIPAATAKVDLKRIV"
FT   CDS_pept        775661..776083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0714"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53685"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBT8"
FT                   /protein_id="BAF53685.1"
FT                   /translation="MTYGFLVNTDLTHRAIDFDLENAAKFLGGADDGRVAVAFQEDGTL
FT                   YAALYSASAKDEGAAANPVASLGRNAAATGDGSFFSDPTAAICGPVIFVGAEGEDITLD
FT                   EIERIKDGIRAARNYRDDYPEEFNLWRNAVYNLRTA"
FT   CDS_pept        776253..776552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0715"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53686"
FT                   /db_xref="GOA:A4QBT9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBT9"
FT                   /protein_id="BAF53686.1"
FT                   /translation="MANVNIKPLEDKILVQINEAETTTASGLVIPDSAKEKPQEATVIA
FT                   VGPGRFDDKGNRIPLDIKEDDVVIFSRYGGTEIKFGGVEYLLLSARDILAIVEK"
FT   CDS_pept        776564..778180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0716"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53687"
FT                   /db_xref="GOA:A4QBU0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4QBU0"
FT                   /protein_id="BAF53687.1"
FT                   /translation="MAKLIAFDQDAREGILRGVDALANAVKVTLGPRGRNVVLDKAFGG
FT                   PLVTNDGVTIARDIDLEDPFENLGAQLVKSVAVKTNDIAGDGTTTATLLAQALIAEGLR
FT                   NVAAGANPMELNKGIAAAAEKTLEELKARATEVSDTKEIANVATVSSRDEVVGEIVAAA
FT                   MEKVGKDGVVTVEESQSIETALEVTEGISFDKGYLSPYFINDNDTQQAVLDNPAVLLVR
FT                   NKISSLPDFLPLLEKVVESNRPLLIIAEDVEGEPLQTLVVNSIRKTIKVVAVKSPYFGD
FT                   RRKAFMDDLAIVTKATVVDPEVGINLNEAGEEVFGTARRITVSKDETVIVDGAGSAEEV
FT                   EARRAQIRREIANTDSTWDREKAEERLAKLSGGIAVIRVGAATETEVNDRKLRVEDAIN
FT                   AARAAAQEGVIAGGGSALVQIAETLKAYAEEFEGDQKVGVRALATALGKPAYWIASNAG
FT                   LDGSVVVARTAALPNGEGFNAATLEYGNLINDGVIDPVKVTHSAVVNATSVARMVLTTE
FT                   ASVVEKPAEEAADAHAGHHHH"
FT   CDS_pept        complement(778319..778618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0717"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53688"
FT                   /db_xref="GOA:A4QBU1"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU1"
FT                   /protein_id="BAF53688.1"
FT                   /translation="MTLPHQLPGPNADFWDWQLHGTCRGETSDVFYHPDGERGRARQRR
FT                   ELRAKAICAACPVLESCRKHALAVAEPYGVWGGLSESERLVILRNNERKQPVAV"
FT   CDS_pept        779060..779242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0718"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53689"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU2"
FT                   /protein_id="BAF53689.1"
FT                   /translation="MADTERELATLVPQATAGDRRALQRIMEIIHPMFCVMLALVLEVD
FT                   GSQRQKTLLKRSVWQ"
FT   CDS_pept        779284..779625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0719"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53690"
FT                   /db_xref="GOA:A4QBU3"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU3"
FT                   /protein_id="BAF53690.1"
FT                   /translation="MAFVYGIASNKVADAHRAMSRDKSTPIEEVPETSPDTFTPEDFAL
FT                   VSDGSNRVRELLDLLSEKARDILILRVIVGLSAEETAEMVGSTPGAVRVAQHRALTTLR
FT                   STLEQQENK"
FT   CDS_pept        779625..780653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0720"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53691"
FT                   /db_xref="GOA:A4QBU4"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU4"
FT                   /protein_id="BAF53691.1"
FT                   /translation="MTRRLNGGDQDGQEHVNGQLKQLFDDDAFLTDLSRGVDPSEGDDA
FT                   LAGLLLDLTKEAQEPPAAMPDWSTLLPGILDQDQDSPVESTSDTTVMQASNPATQEFAP
FT                   VSISDTPNTATNSADADESATVVPLAARREKRAKSGSSGVHSLDASATQRKSHPFLSGL
FT                   VGAAAATLVIAGGGAAVYNADENSPLYGMNQQLFGNQDSPSVVELASTLEEVDSRTASG
FT                   DVEGARALLEQARAMLDGMAPPPKAPSEATRTVESEPGTQTLTATVTESASPEPPVTET
FT                   QTVTSTEVQTVTTTAVAPPVWTPNPEPTTTDAPTSTPSTGGGEGTGNDGDSGLVPPQTP
FT                   GN"
FT   CDS_pept        complement(780703..781125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0721"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53692"
FT                   /db_xref="InterPro:IPR035165"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU5"
FT                   /protein_id="BAF53692.1"
FT                   /translation="MYWVLATSANRVEDVNFDAMMPRDPFADDPNDPASFITDDDPYDH
FT                   PEPLSEEERIHVSQDLRFVMEFKKVLGPRGIEGVFFMCEDCEEFHYYDWDIMAANMRAT
FT                   LAGELSPVHEPSAQPNIDAYVPWDYCIGYLDGLEAK"
FT   CDS_pept        781239..782759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0722"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53693"
FT                   /db_xref="GOA:A4QBU6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU6"
FT                   /protein_id="BAF53693.1"
FT                   /translation="MTTQSRVSTGGDNPNKVALVGLTFDDVLLLPDASDVVPSEVDTST
FT                   QLTRNIRLNTPILSAAMDTVTEARMAIGMARHGGIGVLHRNLSIQEQAENVELVKRSES
FT                   GMVTDPVTCTPDMSIQEVDDLCARFRISGLPVVDEAGKLVGICTNRDMRFESDMNRRVA
FT                   EVMTPMPLVVAEEGVTKEQALALLSANKVEKLPIIAKDGKLVGLITVKDFVKTEQHPNA
FT                   SKDASGRLLVAAGIGTGEESFQRAGALADAGVDILVVDSAHAHSRGVLDMVSRVKKAFP
FT                   KVDIVGGNLATREAAQAMIEAGADAIKVGIGPGSICTTRVVAGVGAPQITAIMEAAVPA
FT                   HKAGVPIIADGGMQFSGDIAKALAAGANSVMLGSMLAGTAEAPGETITINGKQYKRYRG
FT                   MGSMGAMQGRGLSGEKRSYSKDRYFQSDVKSEDKLVPEGIEGRVPFRGAIGDIIHQQVG
FT                   GLRAAMGYTGSSTIEELHNARFVQITSAGLKESHPHHIQQTVEAPNYH"
FT   CDS_pept        782876..784000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0723"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0723"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53694"
FT                   /db_xref="GOA:A4QBU7"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005992"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU7"
FT                   /protein_id="BAF53694.1"
FT                   /translation="MRDHVEIGIGREARRTYSLDDISVVSSRRTRSSKDVDTTWHIDAY
FT                   KFDLPFMNHPSDALASPKFVIEMGKQGGLGVINAEGLWGRHADLDEAIAKVIAAYEEGD
FT                   QAAATRTLQELHSAPLDTELLSERIAQVRDSGEIVAVRVSPQNVREIAPIVIKAGADLL
FT                   VIQGTLISAEHVNTGGEALNLKEFIGSLDVPVIAGGVNDYTTALHMMRTGAVGIIVGGG
FT                   ENTNSLALGMEVSMATAIADVAAARRDYLDETGGRYVHIIADGSIENSGDVVKAIACGA
FT                   DAVVLGSPLARAKEAAGKGYFWPAVAAHPRFPRGVVTESVELDEQAPSLEQILHGPSTM
FT                   PWGVENFEGGLKRALAKCGYTDLKSFQKVSLHVN"
FT   CDS_pept        complement(783997..784917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0724"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53695"
FT                   /db_xref="GOA:A4QBU8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4QBU8"
FT                   /protein_id="BAF53695.1"
FT                   /translation="MAIIKGMNKQSAAVLMVMGSALSLQFGAAIGTQLFPLIGPWSVTS
FT                   LRLFIAGLIMCLVIRPRLRSWTKKQWIAVLLLGLSLGGMNSLFYASIELIPLGTAVTIE
FT                   FLGPLIFSAVLARTLKNGLCVALAFLGMALLGIDSLSGETLDPLGVIFAAVAGIFWVCY
FT                   ILASKKIGQLIPGTSGLAVALIIGAVAVFPLGATHMGPIFQTPTLLILALGTALLGSLI
FT                   PYSLELSALRRLPAPIFSILLSLEPAFAAA