(data stored in ACNUC30630 zone)

EMBL: AP009256

ID   AP009256; SV 1; circular; genomic DNA; STD; PRO; 2089645 BP.
XX
AC   AP009256; BAAD01000000-BAAD01000012;
XX
PR   Project:PRJNA16321;
XX
DT   06-DEC-2006 (Rel. 90, Created)
DT   11-MAY-2017 (Rel. 132, Last updated, Version 9)
XX
DE   Bifidobacterium adolescentis ATCC 15703 DNA, complete genome.
XX
KW   .
XX
OS   Bifidobacterium adolescentis ATCC 15703
OC   Bacteria; Actinobacteria; Bifidobacteriales; Bifidobacteriaceae;
OC   Bifidobacterium.
XX
RN   [1]
RP   1-2089645
RA   Suzuki T., Tsuda Y., Kanou N., Inoue T., Kumazaki K., Nagano S., Hirai S.,
RA   Tanaka K., Watanabe K.;
RT   ;
RL   Submitted (04-DEC-2006) to the INSDC.
RL   Contact:Tohru Suzuki Gifu University, Life Science Research Center; 1-1
RL   Yanagido, Gifu, Gifu 501-1193, Japan
XX
RN   [2]
RA   Suzuki T., Tsuda Y., Kanou N., Inoue T., Kumazaki K., Nagano S., Hirai S.,
RA   Tanaka K., Watanabe K.;
RT   "Bifidobacterium adolescentis complete genome sequence";
RL   Unpublished.
XX
DR   MD5; 167f2ee86f554de8b06af6cb98d4f782.
DR   BioSample; SAMD00061080.
DR   EnsemblGenomes-Gn; BAD_r0001.
DR   EnsemblGenomes-Gn; BAD_r0002.
DR   EnsemblGenomes-Gn; BAD_r0003.
DR   EnsemblGenomes-Gn; BAD_r0004.
DR   EnsemblGenomes-Gn; BAD_r0005.
DR   EnsemblGenomes-Gn; BAD_r0006.
DR   EnsemblGenomes-Gn; BAD_r0007.
DR   EnsemblGenomes-Gn; BAD_r0008.
DR   EnsemblGenomes-Gn; BAD_r0009.
DR   EnsemblGenomes-Gn; BAD_r0010.
DR   EnsemblGenomes-Gn; BAD_r0011.
DR   EnsemblGenomes-Gn; BAD_r0012.
DR   EnsemblGenomes-Gn; BAD_r0013.
DR   EnsemblGenomes-Gn; BAD_r0014.
DR   EnsemblGenomes-Gn; BAD_r0015.
DR   EnsemblGenomes-Gn; BAD_t0001.
DR   EnsemblGenomes-Gn; BAD_t0002.
DR   EnsemblGenomes-Gn; BAD_t0003.
DR   EnsemblGenomes-Gn; BAD_t0004.
DR   EnsemblGenomes-Gn; BAD_t0005.
DR   EnsemblGenomes-Gn; BAD_t0006.
DR   EnsemblGenomes-Gn; BAD_t0007.
DR   EnsemblGenomes-Gn; BAD_t0008.
DR   EnsemblGenomes-Gn; BAD_t0009.
DR   EnsemblGenomes-Gn; BAD_t0010.
DR   EnsemblGenomes-Gn; BAD_t0011.
DR   EnsemblGenomes-Gn; BAD_t0012.
DR   EnsemblGenomes-Gn; BAD_t0013.
DR   EnsemblGenomes-Gn; BAD_t0014.
DR   EnsemblGenomes-Gn; BAD_t0015.
DR   EnsemblGenomes-Gn; BAD_t0016.
DR   EnsemblGenomes-Gn; BAD_t0017.
DR   EnsemblGenomes-Gn; BAD_t0018.
DR   EnsemblGenomes-Gn; BAD_t0019.
DR   EnsemblGenomes-Gn; BAD_t0020.
DR   EnsemblGenomes-Gn; BAD_t0021.
DR   EnsemblGenomes-Gn; BAD_t0022.
DR   EnsemblGenomes-Gn; BAD_t0023.
DR   EnsemblGenomes-Gn; BAD_t0024.
DR   EnsemblGenomes-Gn; BAD_t0025.
DR   EnsemblGenomes-Gn; BAD_t0026.
DR   EnsemblGenomes-Gn; BAD_t0027.
DR   EnsemblGenomes-Gn; BAD_t0028.
DR   EnsemblGenomes-Gn; BAD_t0029.
DR   EnsemblGenomes-Gn; BAD_t0030.
DR   EnsemblGenomes-Gn; BAD_t0031.
DR   EnsemblGenomes-Gn; BAD_t0032.
DR   EnsemblGenomes-Gn; BAD_t0033.
DR   EnsemblGenomes-Gn; BAD_t0034.
DR   EnsemblGenomes-Gn; BAD_t0035.
DR   EnsemblGenomes-Gn; BAD_t0036.
DR   EnsemblGenomes-Gn; BAD_t0037.
DR   EnsemblGenomes-Gn; BAD_t0038.
DR   EnsemblGenomes-Gn; BAD_t0039.
DR   EnsemblGenomes-Gn; BAD_t0040.
DR   EnsemblGenomes-Gn; BAD_t0041.
DR   EnsemblGenomes-Gn; BAD_t0042.
DR   EnsemblGenomes-Gn; BAD_t0043.
DR   EnsemblGenomes-Gn; BAD_t0044.
DR   EnsemblGenomes-Gn; BAD_t0045.
DR   EnsemblGenomes-Gn; BAD_t0046.
DR   EnsemblGenomes-Gn; BAD_t0047.
DR   EnsemblGenomes-Gn; BAD_t0048.
DR   EnsemblGenomes-Gn; BAD_t0049.
DR   EnsemblGenomes-Gn; BAD_t0050.
DR   EnsemblGenomes-Gn; BAD_t0051.
DR   EnsemblGenomes-Gn; BAD_t0052.
DR   EnsemblGenomes-Gn; BAD_t0053.
DR   EnsemblGenomes-Gn; BAD_t0054.
DR   EnsemblGenomes-Gn; EBG00001203217.
DR   EnsemblGenomes-Gn; EBG00001203218.
DR   EnsemblGenomes-Gn; EBG00001203219.
DR   EnsemblGenomes-Gn; EBG00001203220.
DR   EnsemblGenomes-Gn; EBG00001203221.
DR   EnsemblGenomes-Gn; EBG00001203222.
DR   EnsemblGenomes-Gn; EBG00001203223.
DR   EnsemblGenomes-Gn; EBG00001203224.
DR   EnsemblGenomes-Gn; EBG00001203225.
DR   EnsemblGenomes-Gn; EBG00001203226.
DR   EnsemblGenomes-Gn; EBG00001203227.
DR   EnsemblGenomes-Gn; EBG00001203228.
DR   EnsemblGenomes-Gn; EBG00001203229.
DR   EnsemblGenomes-Gn; EBG00001203230.
DR   EnsemblGenomes-Gn; EBG00001203231.
DR   EnsemblGenomes-Gn; EBG00001203232.
DR   EnsemblGenomes-Gn; EBG00001203233.
DR   EnsemblGenomes-Gn; EBG00001203234.
DR   EnsemblGenomes-Gn; EBG00001203235.
DR   EnsemblGenomes-Gn; EBG00001203236.
DR   EnsemblGenomes-Gn; EBG00001203237.
DR   EnsemblGenomes-Gn; EBG00001203238.
DR   EnsemblGenomes-Gn; EBG00001203239.
DR   EnsemblGenomes-Gn; EBG00001203240.
DR   EnsemblGenomes-Gn; EBG00001203241.
DR   EnsemblGenomes-Gn; EBG00001203242.
DR   EnsemblGenomes-Gn; EBG00001203243.
DR   EnsemblGenomes-Gn; EBG00001203244.
DR   EnsemblGenomes-Gn; EBG00001203245.
DR   EnsemblGenomes-Gn; EBG00001203246.
DR   EnsemblGenomes-Gn; EBG00001203247.
DR   EnsemblGenomes-Gn; EBG00001203248.
DR   EnsemblGenomes-Gn; EBG00001203249.
DR   EnsemblGenomes-Gn; EBG00001203250.
DR   EnsemblGenomes-Gn; EBG00001203251.
DR   EnsemblGenomes-Gn; EBG00001203252.
DR   EnsemblGenomes-Gn; EBG00001203253.
DR   EnsemblGenomes-Gn; EBG00001203254.
DR   EnsemblGenomes-Gn; EBG00001203255.
DR   EnsemblGenomes-Gn; EBG00001203256.
DR   EnsemblGenomes-Gn; EBG00001203257.
DR   EnsemblGenomes-Gn; EBG00001203258.
DR   EnsemblGenomes-Gn; EBG00001203259.
DR   EnsemblGenomes-Gn; EBG00001203260.
DR   EnsemblGenomes-Gn; EBG00001203261.
DR   EnsemblGenomes-Gn; EBG00001203262.
DR   EnsemblGenomes-Gn; EBG00001203263.
DR   EnsemblGenomes-Gn; EBG00001203264.
DR   EnsemblGenomes-Gn; EBG00001203265.
DR   EnsemblGenomes-Gn; EBG00001203266.
DR   EnsemblGenomes-Gn; EBG00001203267.
DR   EnsemblGenomes-Gn; EBG00001203268.
DR   EnsemblGenomes-Gn; EBG00001203269.
DR   EnsemblGenomes-Gn; EBG00001203270.
DR   EnsemblGenomes-Gn; EBG00001203271.
DR   EnsemblGenomes-Gn; EBG00001203272.
DR   EnsemblGenomes-Gn; EBG00001203273.
DR   EnsemblGenomes-Gn; EBG00001203274.
DR   EnsemblGenomes-Gn; EBG00001203275.
DR   EnsemblGenomes-Gn; EBG00001203276.
DR   EnsemblGenomes-Gn; EBG00001203277.
DR   EnsemblGenomes-Gn; EBG00001203278.
DR   EnsemblGenomes-Gn; EBG00001203279.
DR   EnsemblGenomes-Gn; EBG00001203280.
DR   EnsemblGenomes-Gn; EBG00001203281.
DR   EnsemblGenomes-Gn; EBG00001203282.
DR   EnsemblGenomes-Gn; EBG00001203283.
DR   EnsemblGenomes-Gn; EBG00001203284.
DR   EnsemblGenomes-Gn; EBG00001203285.
DR   EnsemblGenomes-Gn; EBG00001203286.
DR   EnsemblGenomes-Gn; EBG00001203287.
DR   EnsemblGenomes-Gn; EBG00001203288.
DR   EnsemblGenomes-Gn; EBG00001203289.
DR   EnsemblGenomes-Gn; EBG00001203290.
DR   EnsemblGenomes-Gn; EBG00001203291.
DR   EnsemblGenomes-Gn; EBG00001203292.
DR   EnsemblGenomes-Gn; EBG00001203293.
DR   EnsemblGenomes-Gn; EBG00001203294.
DR   EnsemblGenomes-Tr; BAD_r0001-1.
DR   EnsemblGenomes-Tr; BAD_r0002-1.
DR   EnsemblGenomes-Tr; BAD_r0003-1.
DR   EnsemblGenomes-Tr; BAD_r0004-1.
DR   EnsemblGenomes-Tr; BAD_r0005-1.
DR   EnsemblGenomes-Tr; BAD_r0006-1.
DR   EnsemblGenomes-Tr; BAD_r0007-1.
DR   EnsemblGenomes-Tr; BAD_r0008-1.
DR   EnsemblGenomes-Tr; BAD_r0009-1.
DR   EnsemblGenomes-Tr; BAD_r0010-1.
DR   EnsemblGenomes-Tr; BAD_r0011-1.
DR   EnsemblGenomes-Tr; BAD_r0012-1.
DR   EnsemblGenomes-Tr; BAD_r0013-1.
DR   EnsemblGenomes-Tr; BAD_r0014-1.
DR   EnsemblGenomes-Tr; BAD_r0015-1.
DR   EnsemblGenomes-Tr; BAD_t0001-1.
DR   EnsemblGenomes-Tr; BAD_t0002-1.
DR   EnsemblGenomes-Tr; BAD_t0003-1.
DR   EnsemblGenomes-Tr; BAD_t0004-1.
DR   EnsemblGenomes-Tr; BAD_t0005-1.
DR   EnsemblGenomes-Tr; BAD_t0006-1.
DR   EnsemblGenomes-Tr; BAD_t0007-1.
DR   EnsemblGenomes-Tr; BAD_t0008-1.
DR   EnsemblGenomes-Tr; BAD_t0009-1.
DR   EnsemblGenomes-Tr; BAD_t0010-1.
DR   EnsemblGenomes-Tr; BAD_t0011-1.
DR   EnsemblGenomes-Tr; BAD_t0012-1.
DR   EnsemblGenomes-Tr; BAD_t0013-1.
DR   EnsemblGenomes-Tr; BAD_t0014-1.
DR   EnsemblGenomes-Tr; BAD_t0015-1.
DR   EnsemblGenomes-Tr; BAD_t0016-1.
DR   EnsemblGenomes-Tr; BAD_t0017-1.
DR   EnsemblGenomes-Tr; BAD_t0018-1.
DR   EnsemblGenomes-Tr; BAD_t0019-1.
DR   EnsemblGenomes-Tr; BAD_t0020-1.
DR   EnsemblGenomes-Tr; BAD_t0021-1.
DR   EnsemblGenomes-Tr; BAD_t0022-1.
DR   EnsemblGenomes-Tr; BAD_t0023-1.
DR   EnsemblGenomes-Tr; BAD_t0024-1.
DR   EnsemblGenomes-Tr; BAD_t0025-1.
DR   EnsemblGenomes-Tr; BAD_t0026-1.
DR   EnsemblGenomes-Tr; BAD_t0027-1.
DR   EnsemblGenomes-Tr; BAD_t0028-1.
DR   EnsemblGenomes-Tr; BAD_t0029-1.
DR   EnsemblGenomes-Tr; BAD_t0030-1.
DR   EnsemblGenomes-Tr; BAD_t0031-1.
DR   EnsemblGenomes-Tr; BAD_t0032-1.
DR   EnsemblGenomes-Tr; BAD_t0033-1.
DR   EnsemblGenomes-Tr; BAD_t0034-1.
DR   EnsemblGenomes-Tr; BAD_t0035-1.
DR   EnsemblGenomes-Tr; BAD_t0036-1.
DR   EnsemblGenomes-Tr; BAD_t0037-1.
DR   EnsemblGenomes-Tr; BAD_t0038-1.
DR   EnsemblGenomes-Tr; BAD_t0039-1.
DR   EnsemblGenomes-Tr; BAD_t0040-1.
DR   EnsemblGenomes-Tr; BAD_t0041-1.
DR   EnsemblGenomes-Tr; BAD_t0042-1.
DR   EnsemblGenomes-Tr; BAD_t0043-1.
DR   EnsemblGenomes-Tr; BAD_t0044-1.
DR   EnsemblGenomes-Tr; BAD_t0045-1.
DR   EnsemblGenomes-Tr; BAD_t0046-1.
DR   EnsemblGenomes-Tr; BAD_t0047-1.
DR   EnsemblGenomes-Tr; BAD_t0048-1.
DR   EnsemblGenomes-Tr; BAD_t0049-1.
DR   EnsemblGenomes-Tr; BAD_t0050-1.
DR   EnsemblGenomes-Tr; BAD_t0051-1.
DR   EnsemblGenomes-Tr; BAD_t0052-1.
DR   EnsemblGenomes-Tr; BAD_t0053-1.
DR   EnsemblGenomes-Tr; BAD_t0054-1.
DR   EnsemblGenomes-Tr; EBT00001574036.
DR   EnsemblGenomes-Tr; EBT00001574037.
DR   EnsemblGenomes-Tr; EBT00001574038.
DR   EnsemblGenomes-Tr; EBT00001574039.
DR   EnsemblGenomes-Tr; EBT00001574040.
DR   EnsemblGenomes-Tr; EBT00001574041.
DR   EnsemblGenomes-Tr; EBT00001574042.
DR   EnsemblGenomes-Tr; EBT00001574043.
DR   EnsemblGenomes-Tr; EBT00001574044.
DR   EnsemblGenomes-Tr; EBT00001574045.
DR   EnsemblGenomes-Tr; EBT00001574046.
DR   EnsemblGenomes-Tr; EBT00001574047.
DR   EnsemblGenomes-Tr; EBT00001574048.
DR   EnsemblGenomes-Tr; EBT00001574049.
DR   EnsemblGenomes-Tr; EBT00001574050.
DR   EnsemblGenomes-Tr; EBT00001574051.
DR   EnsemblGenomes-Tr; EBT00001574052.
DR   EnsemblGenomes-Tr; EBT00001574053.
DR   EnsemblGenomes-Tr; EBT00001574054.
DR   EnsemblGenomes-Tr; EBT00001574055.
DR   EnsemblGenomes-Tr; EBT00001574056.
DR   EnsemblGenomes-Tr; EBT00001574057.
DR   EnsemblGenomes-Tr; EBT00001574058.
DR   EnsemblGenomes-Tr; EBT00001574059.
DR   EnsemblGenomes-Tr; EBT00001574060.
DR   EnsemblGenomes-Tr; EBT00001574061.
DR   EnsemblGenomes-Tr; EBT00001574062.
DR   EnsemblGenomes-Tr; EBT00001574063.
DR   EnsemblGenomes-Tr; EBT00001574064.
DR   EnsemblGenomes-Tr; EBT00001574065.
DR   EnsemblGenomes-Tr; EBT00001574066.
DR   EnsemblGenomes-Tr; EBT00001574067.
DR   EnsemblGenomes-Tr; EBT00001574068.
DR   EnsemblGenomes-Tr; EBT00001574069.
DR   EnsemblGenomes-Tr; EBT00001574070.
DR   EnsemblGenomes-Tr; EBT00001574071.
DR   EnsemblGenomes-Tr; EBT00001574072.
DR   EnsemblGenomes-Tr; EBT00001574073.
DR   EnsemblGenomes-Tr; EBT00001574074.
DR   EnsemblGenomes-Tr; EBT00001574075.
DR   EnsemblGenomes-Tr; EBT00001574076.
DR   EnsemblGenomes-Tr; EBT00001574077.
DR   EnsemblGenomes-Tr; EBT00001574078.
DR   EnsemblGenomes-Tr; EBT00001574079.
DR   EnsemblGenomes-Tr; EBT00001574080.
DR   EnsemblGenomes-Tr; EBT00001574081.
DR   EnsemblGenomes-Tr; EBT00001574082.
DR   EnsemblGenomes-Tr; EBT00001574083.
DR   EnsemblGenomes-Tr; EBT00001574084.
DR   EnsemblGenomes-Tr; EBT00001574085.
DR   EnsemblGenomes-Tr; EBT00001574086.
DR   EnsemblGenomes-Tr; EBT00001574087.
DR   EnsemblGenomes-Tr; EBT00001574088.
DR   EnsemblGenomes-Tr; EBT00001574089.
DR   EnsemblGenomes-Tr; EBT00001574090.
DR   EnsemblGenomes-Tr; EBT00001574091.
DR   EnsemblGenomes-Tr; EBT00001574092.
DR   EnsemblGenomes-Tr; EBT00001574093.
DR   EnsemblGenomes-Tr; EBT00001574094.
DR   EnsemblGenomes-Tr; EBT00001574095.
DR   EnsemblGenomes-Tr; EBT00001574096.
DR   EnsemblGenomes-Tr; EBT00001574097.
DR   EnsemblGenomes-Tr; EBT00001574098.
DR   EnsemblGenomes-Tr; EBT00001574099.
DR   EnsemblGenomes-Tr; EBT00001574100.
DR   EnsemblGenomes-Tr; EBT00001574101.
DR   EnsemblGenomes-Tr; EBT00001574102.
DR   EnsemblGenomes-Tr; EBT00001574103.
DR   EnsemblGenomes-Tr; EBT00001574104.
DR   EnsemblGenomes-Tr; EBT00001574105.
DR   EnsemblGenomes-Tr; EBT00001574106.
DR   EnsemblGenomes-Tr; EBT00001574107.
DR   EnsemblGenomes-Tr; EBT00001574108.
DR   EnsemblGenomes-Tr; EBT00001574109.
DR   EnsemblGenomes-Tr; EBT00001574110.
DR   EnsemblGenomes-Tr; EBT00001574111.
DR   EnsemblGenomes-Tr; EBT00001574112.
DR   EnsemblGenomes-Tr; EBT00001574113.
DR   EuropePMC; PMC2430713; 18505588.
DR   EuropePMC; PMC2570300; 18689518.
DR   EuropePMC; PMC2615632; 19004868.
DR   EuropePMC; PMC2873357; 20380746.
DR   EuropePMC; PMC2937518; 20805404.
DR   EuropePMC; PMC3063602; 20679197.
DR   EuropePMC; PMC3115465; 21538547.
DR   EuropePMC; PMC3318781; 22307308.
DR   EuropePMC; PMC3642284; 23640377.
DR   EuropePMC; PMC3815754; 21261928.
DR   EuropePMC; PMC4034290; 24936345.
DR   EuropePMC; PMC4178631; 25107967.
DR   EuropePMC; PMC4178644; 25085493.
DR   EuropePMC; PMC4392159; 25858847.
DR   EuropePMC; PMC4472781; 26086721.
DR   EuropePMC; PMC4817515; 27035119.
DR   EuropePMC; PMC4908950; 27379055.
DR   EuropePMC; PMC4921777; 27446019.
DR   EuropePMC; PMC5540593; 28764658.
DR   EuropePMC; PMC6079163; 29356451.
DR   GOA; P0CG91.
DR   InterPro; IPR008515; Ubiquitin-like_Pup.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP009256.
DR   SILVA-SSU; AP009256.
DR   StrainInfo; 5333; 1.
DR   UniProtKB/Swiss-Prot; P0CG91; PUP_BIFAA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2089645
FT                   /organism="Bifidobacterium adolescentis ATCC 15703"
FT                   /strain="ATCC 15703"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:367928"
FT   CDS_pept        1..1500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BAD_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COG family: ATPase involved in DNA replication
FT                   initiation"
FT                   /note="Orthologue of BL0640"
FT                   /note="PFAM_ID: AAA"
FT                   /note="PFAM_ID: bac_DNAA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38782"
FT                   /db_xref="GOA:A0ZZ99"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZ99"
FT                   /protein_id="BAF38782.1"
FT                   /translation="MADNTTTDPLEQARGVWSDALALLHQNPSLSVRDKSWLENVYPEG
FT                   MWGPTIMLCVPSEAAQQALQTELNKPLMEALRESAEQDIFPAFKIVEMKPKTEEQPEET
FT                   YPRFSPAKSPAKSPANETMQGQLPIPATMPPEQDHFQSGQNRPLLDPETHLNKNATFDT
FT                   FVPGDSNRFARTVALAVAEGSGHDFNPLCIYGGSGLGKTHLLNAIGNYALVKDPNLKVR
FT                   YVTSEEFTNEFIEALADTNQSSGQIKEFNRRYREVDVLLIDDIQFLSGKDATLEQFFHT
FT                   FNTLHQANKRIVIASDVPPKDLQGFNERLISRFESGLTVDVKPPDLETRIAILRMIATM
FT                   NGSNIPNDVFNLIAERFTENIRELEGALNRVTAMASLSNQPVTKALAEQTLQDFFTTDV
FT                   EIKPADIITQVAKYFYLTFDDIVGRSRTKKIALARQIAMYLVRELTSMSLNDIGLVFGG
FT                   KDHTTVMHAYTRINDEMQEKQEIYNYVTELTLQLKQRSNDK"
FT   CDS_pept        1997..3121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BAD_0002"
FT                   /product="DNA polymerase III, b subunit DnaN"
FT                   /note="Binds the polymerase to DNA and acts as a sliding
FT                   clamp"
FT                   /note="Orthologue of BL0638"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38783"
FT                   /db_xref="GOA:A0ZZA0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA0"
FT                   /protein_id="BAF38783.1"
FT                   /translation="MKVEVNSQALADAVAWTTRVIDARPATPILAGIRLEAIDGTLQLS
FT                   AFNYAISARHHIEAGVDEAGSVLVLGKLLADITKSLPAAKTYLSTDGSTMTITSGKSTF
FT                   TMQLMPESEYPDLPVVPTKLGQVDSPTFAQAVNQASVAVSREENRPVLTGIRVQFQGDK
FT                   VIMSSTDRFRLARSSFTWTPEDATISTTALVRGSLLRDMARSLDEHQNVTIDFDADNPS
FT                   LLGFENAGRVSTSQLIDGEFPAVDRLYADEYPIHAVINKQALIDAIKRVSLVAERNAPI
FT                   RMVFSGQELTLSAGTADEAQAKEILDIDMDGEDITVAFNPSYLVDGLSAISEPFVRMKM
FT                   TTAVKPVEFNGQQEADSDESMDYRYLLVPMRFNN"
FT   CDS_pept        3200..4411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BAD_0003"
FT                   /product="recombination protein RecF"
FT                   /note="COG family: recombinational DNA repair ATPase"
FT                   /note="Orthologue of BL0637"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38784"
FT                   /db_xref="GOA:A0ZZA1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZA1"
FT                   /protein_id="BAF38784.1"
FT                   /translation="MHISRLALDHYRSWDHCVLDFEPGINILQGSNGLGKTNIVEAVEV
FT                   LSTGSSHRTSSSLPLVEKGHPSATVRANVEDAGEQRTYEITIAARGANRARVDGGKSQY
FT                   MRDIVGWVPSVSFTPEDQRLVSGDPATRRNFLNQAASLLLPRYAQSLQQFTHVAKQRAA
FT                   LLKQLSDGSGIDPEYGRQAVLSGLEVWTGQFIALGVQLTKDRNDVIGLLREPFTRIYAS
FT                   LAGEEEQADLVYEPSFDEVLLFDEPAAEISRHFQRIYPGEVARGQNLIGPQRDDLTLRL
FT                   NDMPAREFASNGEMWTMALALKMALYEVVSAQRDVKPIVILDDVFAQLDESRRGQILDF
FT                   ARRQDQVLITVAAASDIPQGEAHVIDVAALRAQSQETDGDIAAMAAMLAAGRGAQSQGI
FT                   EAES"
FT   CDS_pept        4411..4896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0004"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0636"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38785"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA2"
FT                   /protein_id="BAF38785.1"
FT                   /translation="MPKPPICELLNLDQRKLPAEVFDRISDRAGRLKEREERARKAWES
FT                   FGKPGRDPETVGSLFNLLASNGAWIPHLKMAQMRDHWDQVVGVENAKHSYPASLRDGVL
FT                   TIRCDSPAWTTTLSYMTPLLTDTIRRKLEGLTINEVRVTGPQSQGFSRGRISRKIRY"
FT   CDS_pept        5177..7315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BAD_0005"
FT                   /product="DNA gyrase (topoisomerase II) B subunit"
FT                   /note="Decatenates newly replicated chromosomal DNA
FT                   andrelaxes positive and negative DNA supercoiling"
FT                   /note="Orthologue of Rv0005_BL0635"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38786"
FT                   /db_xref="GOA:A0ZZA3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA3"
FT                   /protein_id="BAF38786.1"
FT                   /translation="MAGKMQEGISVADLDADSLNESAENTQEDQIQDQIQNDQLEDAQL
FT                   DDSLSPEHYDASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYA
FT                   SHIEVTILPDGGVRVVDDGRGIPVDEVPGEGISGVETVMTKLHAGGKFGGGGYAVSGGL
FT                   HGVGISVVNALSTRVDIEVRRQGFHWTQTYIDQKPTARLLKGKPMEEGESTGTSVTFWA
FT                   DGKIFETTTYDFEILRNRFQQMAFLNKGLKISLTDLREPDQAGDEVSGEESETEDKFQT
FT                   VTYQYNDGIKDYVDYLVKSRKATPVEPDVIDFEAEDLKIGISAEIAMQWTTAYSEAVHT
FT                   FANTISTTEGGTHEEGFRAALTSLVNRYAREKNILKDKDENLSGDDVREGLTAVVSVKL
FT                   TNPQFEGQTKTKLGNSEAKTFVQRVMTDKLGDWFDAHPNEAKNIIQKAIEASRARLAAK
FT                   KARENTRRKSIFESAGMPDKLKDCQSNNPEECELFIVEGDSAGGSAIQGRNPITQAILP
FT                   LRGKILNTERASLDRMMKSDTIESLITAVGGGYGEDFDLNKVRYHKVIIMADADVDGAH
FT                   IATLNLTLFFRYMRPMITAGYVYVAMPPLYRLKWTKGPHDFVYTDAERDRVLAEGKAAG
FT                   RQLPKGEGIQRYKGLGEMSYQELWETTMDPDHRILKQVQIEDAAAADETFSMLMGDEVE
FT                   PRRLFIQRNARNVSWIDA"
FT   CDS_pept        7411..10071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BAD_0006"
FT                   /product="DNA gyrase (topoisomerase II) A subunit"
FT                   /note="COG0188"
FT                   /note="Orthologue of MT0006_BL0634"
FT                   /note="negatively supercoils closed circulardouble-stranded
FT                   DNA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38787"
FT                   /db_xref="GOA:A0ZZA4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA4"
FT                   /protein_id="BAF38787.1"
FT                   /translation="MEPLSPQEADNTDYGLMVGERVQKKDLQQEMRESYLAYAMSVIVD
FT                   RALPDVRDGMKPVHRRVIYAMYDGGYRPDRGYSKCARVVGEVMGKYHPHGDSAIYDTLV
FT                   RMAQSWSMRYTLVDGQGNFGSPGDDPAAAMRYTECRMAPLAMEMVRDIDKDTVDFLPNY
FT                   DGKTQEPTVLPARFPNLLCNGSSGIAVGMATNIPPHNMREVAEGVHWALDHPDASREEL
FT                   LDNLIRIIKGPDFPTGATILGHKGIEQAYRTGRGLITMRAVVNTEEIKGRMCLVITELP
FT                   YQVNPDRLVVSIREAVRDGKIQGIADMRDETSGRTGQRLVLVLKRDAVPKVVLNNLYKH
FT                   SQLQQTFGANMLALVDGVPRTLSLDAFIRHWVNHQLEVIARRTAYLKREAEERDHILQG
FT                   YLKALDMIDEVIALIRASESAETARTGLMDLLDVDEVQADAILAMQLRRLAALERQKIL
FT                   DEHNELMRKIADYNDILAKPERQRKIVGDELDEIVAKYGDERRTKILPYSGEMNVEDLI
FT                   AEENVVVTVTHSGFIKRTKADEYRAQHRGGKGIKGAKLREDDVVDHFFLTSTHNWLLFF
FT                   TNKGRVYRLKAYELPEGSRDSKGQHVANLLQFGPDETIQTVLSIPNYDVAKYLVLATRS
FT                   GKVKKTALAEYDSPRQGGLIAVRLMTDENGENADELIGAALCNADDDIILVSKQGMSLK
FT                   FEANDEQLRPMGRQTAGVQGMKFRDGDELLAMDVVQGDSDRDLLVVTNEGFAKRTAISE
FT                   YRLQGRNGYGVKAVQLAEGRGSLVGAVIVEESDQIMAIMKSGKVIRSNVAEVKRTGRTT
FT                   QGVTLAKPDKNDEIISIARNEETDEDDAEQAAAENGAVQNDAAAQSQAETTTENSAETG
FT                   TEATSDAGDGENVEA"
FT   CDS_pept        10146..10682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0007"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0633"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38788"
FT                   /db_xref="GOA:A0ZZA5"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA5"
FT                   /protein_id="BAF38788.1"
FT                   /translation="MSENNESHQAQAGAQAPRVARSASSQPLSGTEQSQAHENMAAASG
FT                   GVKVREKARRGAPRARRMSLSLTRIDAWSAAKVAFMLSIAGGIIQIVAVTLLWLLLNVV
FT                   GVFDQVTQIVSSTGLDAGGFDLANVLSLSTVLSAVTIFSIIEVVLFTVLVVILTLLYNV
FT                   VSTLVGGIHVTLGDD"
FT   CDS_pept        complement(10915..12261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="BAD_0008"
FT                   /product="glutamate dehydrogenase"
FT                   /note="COG0334"
FT                   /note="Converts 2-oxoglutarate to glutamate"
FT                   /note="In Escherichia coli this enzyme plays a role in
FT                   glutamate synthesis when the cell is under energy
FT                   restriction"
FT                   /note="Leucine dehydrogenase"
FT                   /note="Orthologue of BL0630"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38789"
FT                   /db_xref="GOA:A0ZZA6"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA6"
FT                   /protein_id="BAF38789.1"
FT                   /translation="MLTDEYVKRVYAQVEKRDGDQPEFLQAVREVFESLEPVVEKHPEY
FT                   EKAGVLERLVEPERVVKFRVAWTDDEGKVQVNRGYRIQFNSAIGPYKGGLRFHPSVNEG
FT                   VIKFLGFEQILKNSLTSLPMGGGKGGSDFDPKGKSDAEVMRFCQAFMTELCRHIGQFTD
FT                   VPAGDINVGAREIGYLFGQYKRIRDEYSGVITGKGLEFGGSLARTEATGYGLCYYTQEA
FT                   LRVLKNDSFEGKTVVISGSGNVAIFATEKAQALGAKVVTASDSNGYVYDPDGIKLDIVK
FT                   DIKLGHRGRIKEYAERVPGAEYHEGCKGVWTVPCDIALPCATQNEIDEESAKALVANGC
FT                   KVVCEGANMPSTPEAIAVYQDNGLLYGPAKAANAGGVAVSGLEMSQNSYRLSWTFEEVD
FT                   NKLKSIMENIVANSLAAAKEYGHEGDLMLGANAAGFVKVANAMVAQGVL"
FT   CDS_pept        12452..12895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="BAD_0009"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /note="COG1970"
FT                   /note="Orthologue of BL1747"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38790"
FT                   /db_xref="GOA:A0ZZA7"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA7"
FT                   /protein_id="BAF38790.1"
FT                   /translation="MLEGFKKFIARGNMIDMAVGVVMGGAVTTVVNSIVNSVINPFIAM
FT                   IFGKPNMDGLLAITFNGATVSFGAVLGAILNFLIIAAAVYFCILVPINKFRDMTEALLA
FT                   KTKLAEQKEAEEKAAEEPSAEEQTVQLLQQIRDELAKQNTARN"
FT   tRNA            complement(13060..13132)
FT                   /gene="alaW"
FT                   /locus_tag="BAD_t0001"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:13097..13099,aa:Ala,seq:ggc)"
FT                   /note="codon recognized:GGC"
FT   tRNA            complement(13134..13206)
FT                   /gene="alaV"
FT                   /locus_tag="BAD_t0002"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:13171..13173,aa:Ala,seq:tgc)"
FT                   /note="codon recognized:TGC"
FT   tRNA            complement(13249..13322)
FT                   /gene="ileU"
FT                   /locus_tag="BAD_t0003"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:13286..13288,aa:Ile,seq:gat)"
FT                   /note="codon recognized:GAT"
FT   CDS_pept        13528..14124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0010"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /note="COG family: predicted metal-dependent hydrolase"
FT                   /note="COG1451"
FT                   /note="Orthologue of BL0621"
FT                   /note="PFAM_ID: DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38791"
FT                   /db_xref="GOA:A0ZZA8"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA8"
FT                   /protein_id="BAF38791.1"
FT                   /translation="MRVAIVRKPIKNMYLRIKPPNADIVISAPQRMSQSAIERFVTERK
FT                   PWIERAQRSMRQARDAQLNAQRAQNGNIGDTGASANPPAFVWTDEAKARAQRNIESQLP
FT                   VLLAKWGPIVGRTPTHITLRLMSSRWGSCTPKTGRIRLNLQLGLMAPRFLEYVLVHEMT
FT                   HLWENGHGEGFQRRMSAYLPQWRQLRRDINRQVVL"
FT   CDS_pept        complement(14138..15487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0011"
FT                   /product="hemolysins and related proteins containing CBS
FT                   domains"
FT                   /note="COG family: uncharacterized CBS domain-containing
FT                   proteins"
FT                   /note="COG1253"
FT                   /note="PFAM_ID: CBS"
FT                   /note="PFAM_ID: DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38792"
FT                   /db_xref="GOA:A0ZZA9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZA9"
FT                   /protein_id="BAF38792.1"
FT                   /translation="MGIMSLGLNILLIFIFLLLGSVFAGTELALVSLRGSQIDQMEQED
FT                   ARGKRVAQIARDPNTFLSTVQIGVTLCGFLSASFGESSIAPYIVPVIEDWGVPHNVAAP
FT                   LTTIALTLIISYCSIVISELVPKRIAMQRNEQIARAVVPAIHVFAKVCKPIIWLIGKNT
FT                   NGIVRLLGFDPNETDSEVSDDELRVLVNTNTNLSKDERTILDDVFDASETIVAEVMRPR
FT                   ADVAFLDGSMPIAEAAAYVREMPYSRYPVTGKDFDDVLGFVHVRDLLDIRDPKARTVAD
FT                   VTREGISLPGTSKLLPSLELLRKRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEY
FT                   DLPEEKGGERTERAAFVNGVATIEGGMTIEDFADLTGIELEDGPYETVAGYFLAHTGKM
FT                   GEVGDVLSSDDGYDMVVTEVDGRRIETLEVRRHTADEDGSAAGDSAADAK"
FT   CDS_pept        complement(15555..16250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icfA"
FT                   /locus_tag="BAD_0012"
FT                   /product="carbonic anhydrase"
FT                   /note="COG family: carbonic anhydrase"
FT                   /note="COG0288"
FT                   /note="Orthologue of BL0616"
FT                   /note="PFAM_ID:Pro_CA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38793"
FT                   /db_xref="GOA:A0ZZB0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB0"
FT                   /protein_id="BAF38793.1"
FT                   /translation="MTDEPFVNQNDVEGTASGVWSRMLAGNRRFAEGKLEHPNRSVEAR
FT                   EATIDTHEPEAAILSCSDARVSPDIIFDAGIGDLFTVRTAGQVIDDAVIASLEYAVDVL
FT                   GVRLLVVLGHQNCGAIKQACKEYEALLHELTADAEDSLMAADSVADLDERILNAKSLML
FT                   RTVGFSIWQAHESELESTEDFERVHIARTIEQLVEQSEVIQHALAEDRLMITGARYQLD
FT                   TGKVEVLSF"
FT   CDS_pept        complement(16714..17352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribAB"
FT                   /locus_tag="BAD_0013"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="Identified by sequence similarity"
FT                   /note="ORF located using Blastx"
FT                   /note="Orthologue of IL1869_ MHP7448_0272"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38794"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB1"
FT                   /protein_id="BAF38794.1"
FT                   /translation="MNLHKKIAFTTVLVAILAFSGTPSAMASTSGHDRSAFNSSAEVAL
FT                   QEKLSNIASTNNLDVEFGEFKIDAPQSTIDEYHGDANLYAESIAKAYEEDTASNTRETK
FT                   NASTRGTATYTSSVFSGVPAGGACWVKQDFRATVTNYKVTSKSLLGSSYQTGVCVFQWS
FT                   PNYSWFEGNLNVLSKGTFHAVVKGGPVSFAATFKAFFHTNKTSLYQEFQ"
FT   CDS_pept        complement(17422..17823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pra"
FT                   /locus_tag="BAD_0014"
FT                   /product="PE family protein (Fragment)"
FT                   /note="Orthologue of Rv1078"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38795"
FT                   /db_xref="GOA:A0ZZB2"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB2"
FT                   /protein_id="BAF38795.1"
FT                   /translation="MGKIWCRRAASYILRIILPTSLLSQLINSVLYGRSSIDGTMGIWI
FT                   NCVSIIIVCVISACSTRNGQAWSHHFLGLQVVDQYSNLPISGVRMGLREIAHCVDFVPC
FT                   FIGFLWPLWDTKGQTFADKIMRTTIISIE"
FT   CDS_pept        complement(18079..18501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps8E"
FT                   /locus_tag="BAD_0015"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="Binds directly to 16S rRNA central domain where it
FT                   helps coordinate assembly of the platform of the
FT                   30Ssubunit"
FT                   /note="Identified by similarity to GP:29608270"
FT                   /note="Orthologue of AF1910_ DET0967"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38796"
FT                   /db_xref="GOA:A0ZZB3"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB3"
FT                   /protein_id="BAF38796.1"
FT                   /translation="MVSPSIVFNNGTNGGEFYMRPQVSSRVTSFEMHAHRANPVDFGAN
FT                   IVLALSTTSGKRVINKTVGTNQKENSAVHISHSTCPARIMYAYFSKATLENKQFPLDSK
FT                   RRSEQSIHILNENKRCRLSCFSSYSFHLLQTAVTPT"
FT   CDS_pept        complement(19708..20613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0016"
FT                   /product="hypothetical protein"
FT                   /note="Conserved phage-associated protein"
FT                   /note="Orthologue of PPA1609_ DET1107"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38797"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB4"
FT                   /protein_id="BAF38797.1"
FT                   /translation="MKHARTHAYPATCQFCHSPIHMSVPTEQDILIVSTEIEHIHRIQA
FT                   DVETDLAILVDKADEVQQELHLEKQQHRQNMHSLKSDIQPTAQHMQQDIEQIAHAEQLH
FT                   AEYAELIALHARFNKALDDAGQATQNDEKYKPRECFQSDFWYSMNNTIRSILQQCHFQG
FT                   ADTADFSRSSFDVEIAGYSKADEQGKGYCAFLNSVVMLAFHDYLNEQSKHTPGWLLIDT
FT                   PLHGFDEGIRPLEDSSMKVGLFSYLAKQAVSQQIIIIENTNHMAGIPLDDNINIVEFSK
FT                   DKHNGRYGYLDGIYDVSDES"
FT   CDS_pept        complement(20714..21538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0017"
FT                   /product="conserved phage-associated protein"
FT                   /note="Orthologue of PPA1609"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38798"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB5"
FT                   /protein_id="BAF38798.1"
FT                   /translation="MRNTWIRRISAIRKDGVESAINLTCGLNCIIGASNTGKTRIAKTV
FT                   EFACGGKELPFTDKTAYEIAQVTFVTNGGEVSLSRSIHVQNTIHVKSSNPMIVPGSYSV
FT                   SSRAGKSINTVLLALLGVESTRRIATNETYHTVAFTWNAIRHLMIVPEDQIGRARPSIL
FT                   FPKSTSLATLTQSLSSLLVLVQDEKIDNSIQTESASERHARRKAVEQFIHQQLDDIEPR
FT                   IRHLEEMRHIATNEGKTIHTYLRPSQKSITRRTAKTNSPQSRCPYHLTYLSA"
FT   CDS_pept        complement(21535..21954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0018"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /note="Orthologue of DET1106"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38799"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB6"
FT                   /protein_id="BAF38799.1"
FT                   /translation="MNNSLFNTTQETATRLTLCLPLLSRPSTIDEITAIDLIATYMKTF
FT                   GFGQRNLHGDGPHALAEYDARRKRIQAGLAQLVIVGAATVDSTCLLYRATPECFQYSEA
FT                   LHGDYAASYRQAVQLLIKNDYETIMNRITKENNQL"
FT   CDS_pept        complement(22263..23174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0019"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0608"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38800"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB7"
FT                   /protein_id="BAF38800.1"
FT                   /translation="MCLVSNPFNRRKLRFSDPAVSGVYWRYSSVLPAYSSESGFHRRNS
FT                   DLMGRRRMKTNGDEKETHLAETTATYALGVFCQLVNPYISGVDHHKKGFMKDFFDAVLE
FT                   DDGLRNPLPQHHRNRKPGKTTITTGVWSGINDTDLTRFYNGRKKIPAWKAAEFYQRLDI
FT                   SKVERLCCDISIDALADFQKELIKANIRVTDISELPSATGKWLLSILQANAGGRDILID
FT                   GISFQPKFDIFENLPLASGRINNGKLHLGRSSVPWKAYPIPPDKPDDHLEKDIPHADAS
FT                   RLCRSLAQANQLFRRSSSDMSS"
FT   CDS_pept        24357..26753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfG"
FT                   /locus_tag="BAD_0020"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of PPA1591"
FT                   /note="Peptide glycan binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38801"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB8"
FT                   /protein_id="BAF38801.1"
FT                   /translation="MTDQMVLQTQQWLNKTYGNDPRFKKINPDGRTGWPTIYALTRALQ
FT                   IELGIQSTADNFGPSTQRLFKQRYPNGVRQQAVADKSTSNVYSIIQGALWCKGYSTGGN
FT                   ISQHFYDGTGSAIRKLKADMGIEGDSSVDVEIMGALLSMKQFVLLASYGGIDSVRRAQQ
FT                   FINKAYRPYTGIIPTDGLYGREMNTALIQVLQSLEGFSPSEATGNFGNGTRSRLKTITA
FT                   NNASSNESWVWLASTALACNGIGGGPTFVWTSTFANIVKAFQERYAIAVTGSIDSTTWM
FT                   SLLTSKGDPDRPCVACDTRFEITDARLATLKADGYEIVGRYLTEPGQSSLAPKDYFKAI
FT                   RPGELERITRGGMRFFPIFQEYSTKLEHFTPANGAAHAKTAREAAQRLGIPPTHIYFAV
FT                   DFDATDDQVTSNILPYFRAVCSSLGGGYGVGIYASRNICSRVIGAGCASNAFVSDMSTG
FT                   FSGNLGFPIPDGWVYDQFTEIDDYKGQGWDLDRVAYSGKVSACASLLPAVPVPAPDPDP
FT                   VSPETDPLLRWVAVTEQECRKALAALGTQVAVYEDSIGQFILEWLRKPEYWSEGGSGTQ
FT                   AMWHAYTPEVSTPPDLDAARVVCANVCEAQPSIKEKLPSTRDVAHMAATALGYLTWGIE
FT                   NNPAKYGLGDLGGWPLDLLQIWGAYRRDGKHADLAAWLYKHLGKDEGFGYDDVLADADA
FT                   WLIASSMRKRSGSTVLSAAMRETFKQSETHRIVRFYDERFASSADNVVSAYSTMADGLD
FT                   ALGLTNIGMSESILKKAAGTDKLPDKQEAEVSARAFAAFIDQPRR"
FT   CDS_pept        complement(26853..27488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0021"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0607"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38802"
FT                   /db_xref="GOA:A0ZZB9"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZB9"
FT                   /protein_id="BAF38802.1"
FT                   /translation="MNGEVPCRLTARASPFASHGPRLAGDGAHGTGARAERQTRMIGGG
FT                   HMDAERDTDGTTDAHEGDHTPADGAGTEGEGGKPDTRPGDRLATIRRTLWWIGLALQLP
FT                   FALTLIHFDTPYLILERILCAIPPRLASDPSSIVGIPALETEWCREFLALVLGAVCWVT
FT                   AGVMRLVADSPSNHGKETLPVRIFAGIITIIVLMATGITGLFLGIAAF"
FT   CDS_pept        27518..28351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0022"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0606"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38803"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC0"
FT                   /protein_id="BAF38803.1"
FT                   /translation="MFRRPAATPEQECHKAPAALGTQVAVYEDSIGQLILQWLRKPTYW
FT                   SEGSSGTQALWHAYTPEPVTPSELALSRQACGVACDAQPVIKGTLPNRDIAHMAATSLG
FT                   YLTWGVTNDPMDYGLGDLGGWALDLLQIWGSYLANTPKEDLASWLHAHLGEQDARMGFS
FT                   YSDVLADCDAWLLARSMQSNSSERSLSTAMRDMFAQSETNRIKRFYQSRFKGSADNLVI
FT                   AFRKLVDGIDLGIFDNVSGSKKALLIASHADRLPSQAEAGILALSYAESLENPNR"
FT   CDS_pept        complement(28422..29057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0023"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0605"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38804"
FT                   /db_xref="GOA:A0ZZC1"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC1"
FT                   /protein_id="BAF38804.1"
FT                   /translation="MIGGDMDKPSNERGSTGPTDGIKAEGDAGNERHICKANPAMIDDI
FT                   GKKHGLEDTSENFSGKKYALAPKAATKFLKASRCYVALGKARRVLWWLGLLLLSPALIL
FT                   WAEWGANGDDDTIICRVLTFSSSSCMNLTTATEYVRRLTLVLIMGVVCWIAALVIFGVR
FT                   SYMRSVYPELRDHSSSASHVLVGIISFLVLVMVFPVLVITLLSALMTL"
FT   CDS_pept        complement(29202..31958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0024"
FT                   /product="narrowly conserved hypothetical protein"
FT                   /note="Orthologue of BL0604_ Tfu_2554"
FT                   /note="Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38805"
FT                   /db_xref="GOA:A0ZZC2"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC2"
FT                   /protein_id="BAF38805.1"
FT                   /translation="MTTENEQITPADAAIVSSGTGTKGPEERDLPASLKEEMDLCLQIL
FT                   REVLGEFDENLLAKFDEVREHALKASDERFSGILTDTNPDQDDLQKVVDIIDKTDVHEA
FT                   QLLARAFTTYFHLANLCEENYRVSVLHSRENAVDDTQAVDPVNEMTCAYHQLINEMGPA
FT                   RAKELLDQLEFHPVFTAHPTEARRKAVEGKIRRISQLLEAHKLLGGSDKKENSRRLFNE
FT                   IDALFRTSPIALKKPTPVEEADTILDIFDNTLFYTIPQVYRRFDDWVLGDKAGLVPPVC
FT                   PAFFHPGSWIGSDRDGNPNVTAKVSRQVARKFSDHVLGALEIETRRVGKNLTMEAETTP
FT                   PSAELKSLWNHQKEMSERLTDKAALISTKELHRAVMLVMADRLKATIDRDADLMYHSCE
FT                   DYIADLKTVQRSLAEANAKRSAYGPLQDLIWQAETFGFHMVEMEFRQHSVVHSRALEDI
FT                   REHGLHGERGELQPMTHEVLDTFRALGSIQKRNGIKAARRYIISFTKSAQNIKDVYELN
FT                   RLAFSHPEDVPTIDVIPLFEQLEDLQNSVDVLEEMIKIPEVQARLKATGGKMEVMLGYS
FT                   DSSKDAGPTSATLALHSAQERIAKWAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPV
FT                   GSVKCRFKLTEQGEVIFARYGNPVLAIRHVESVAAATLLQSAPSVEKRNTDMTKKYADM
FT                   ASKLDEAAHNRFLDLLNTDGFAPWFSTVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTI
FT                   PWIFSWAQARINLAAWYGLGTACEQFGDLNTLRQAYEEWPLFSTFIDNIEMSLAKTDER
FT                   IAKMYLALGDREDLNKKVLDEMELTRKWVLKIVGDEWPLQHRHVLGQAIRIRSPYVDAL
FT                   SVTQVLALGSLRKRVDKEELTHGQKENYTYLILCTVSGVAAGLQNTG"
FT   CDS_pept        32160..33992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0025"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Bcr"
FT                   /note="Orthologue of BL0603"
FT                   /note="Uncharacterized BCR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38806"
FT                   /db_xref="GOA:A0ZZC3"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC3"
FT                   /protein_id="BAF38806.1"
FT                   /translation="MGMWECSENIRPAHTLDLNSVSALHEHDENTERVDSSAKAVSKFH
FT                   THSIPLDMEDIERDWDKPVTEAGIAAKASVIVRVGMLDLGAGTGSFRVREMMHRIAYPL
FT                   GVHVRADVNLTDIEASCTDGKDRITEVVDLPTTGVNTERIWLLEHFADWFNVNLGKGSM
FT                   YHSQSDVSEGLMQHLDKRDASQVSAELSKQLKERQKAEQNQEGSDDPVLDALEMVTERA
FT                   QEGDSTARPLHMRDIEAAAAAGRSNGDSVAEKPRKNRNCKPPKEYAEHFDHIGKAAGES
FT                   QGVTVRQAHERLDMIERRKPLYSPAFAGLASACACASFVFLLGGGPYDMIGAFVGAGLG
FT                   HWLRRRLFAHHLNQFFVTFVCVAVAALACTGMLRLIGLFDPIALQHDTAYIGAMLFVIP
FT                   GFPLITGGLDMAKIDFPSGVQRLTYVLCIILMATLAGWMVASIVHLNPQGFEPLGLNPV
FT                   INCLLRMLFAFIGVWGFSVMFNSPQRMCLVAATIGAITDTLRLEIVDLGVPAEAGAFIG
FT                   AFLAGLLASAWRSAVRHGLLAPHLGYPRICLTVPSIVIMVPGLYMYQAMFHLGQFDTLN
FT                   ALDWAFRAFMVIICLPIGLAMARVVTDKSWRYDI"
FT   CDS_pept        34050..35645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuE"
FT                   /locus_tag="BAD_0026"
FT                   /product="possible sodium_proline symporter"
FT                   /note="COG family: Na+_proline_ Na+_panthothenate
FT                   symporters and related permeases"
FT                   /note="COG0591"
FT                   /note="Orthologue of BL0602"
FT                   /note="PFAM_ID: SSF"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38807"
FT                   /db_xref="GOA:A0ZZC4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC4"
FT                   /protein_id="BAF38807.1"
FT                   /translation="MVLYFAAMLTIGFVYSKRSNSSTKQYFAGGRGVGPWLTALSAEAS
FT                   DMSGWLLMGLPGVAYFTGAVDPMWTAIGLALGTYLNWKLVARRLRRYSVVAGDAITIPD
FT                   FFSKRFHDDRNIVSTIAALIILVFFCVYVGSCFVTVGKLFSTLFGWDYHLTMVIGAAIV
FT                   FAYTIIGGYLSVVVTDFIQGLLMFFALAVVFIGSVASAGGIDNTVAFLKGIPGFLDGTH
FT                   VATPILNDAGEQIVKAGQAMFGAPADYGIITIISMLAWGLGYFGMPQVLVRFLSIRSSE
FT                   EIKKSRIIATTWCVISLACGVCIGLVGRAMMPTQFATQAAAENIFIVVSQALLPSFMCG
FT                   IVVSGIFAASMSSSSSYMIIGASAVGENIFRGLLHRKATDRQVMMVARITLLVMFIFGI
FT                   VVAFDQNSSIFQVVSYAWAGLGASFGPLMLTSLYWRRTNKYGAIAGMLSGTATVLIWHN
FT                   LVKPLGGIFAIYELLPAFIVSLLFIVVVSLLTPAPSAEVLHEFDHYLDDPDDRHVDDDL
FT                   VAAEIAAGEKRSQI"
FT   CDS_pept        complement(35784..36884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="BAD_0027"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /note="COG family:tryptophanyl-tRNA synthetase"
FT                   /note="COG0180"
FT                   /note="Orthologue of BL0600"
FT                   /note="PFAM_ID: tRNA-synt_1b"
FT                   /note="Tryptophan-tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38808"
FT                   /db_xref="GOA:A0ZZC5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC5"
FT                   /protein_id="BAF38808.1"
FT                   /translation="MTDETQEQQITAVGNEMSASFLAAKKRSDETLAAIEKNPGKFTML
FT                   TGDRPTGRLHMGHYFGTLRSRVEMQNKGVHTNIIIADYQVITDRDTTEHIQDNVLNLIL
FT                   DYMAAGIDPEKTMIYTHSSVPAENQLMLPFLSLVTESELHRNPTVKAEMEASGHALTGL
FT                   LLTYPVHQACDILFCKGNIVPVGKDQLPHIELTRTIARRFNERYAKKNPVFPEPDAILS
FT                   DAPEIPGLDDQKMSKSRGNSIMLSATAAETAKLIKKSRTDSERKITFDPINRPEVSALL
FT                   TTAALTTGRDPKEIAEEIGDSGAGALKMYVVESVNNFLAPMRERRAELAKDMDYVRDVL
FT                   AEGNKKANAIANETLEQVRDAMGMRY"
FT   CDS_pept        37011..37382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0028"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0599"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38809"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC6"
FT                   /protein_id="BAF38809.1"
FT                   /translation="MGRGRQKAKQQKIARKLKYLTTDTDYDELAKELGAQEPGSGSFDP
FT                   FADIEAKYSHDVDAEDETVGDGQTSSDSADDLDEYAKWAAEAAAKATSGEFPAAKAAPK
FT                   PHKPIPMPVPSALKPKKQD"
FT   CDS_pept        complement(37518..37955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0029"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0598"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38810"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC7"
FT                   /protein_id="BAF38810.1"
FT                   /translation="MAVIREQDLGKGRAAFEQWQDAAHNIFSEQLPADDDAAFDFRLNF
FT                   SPRLPRQLWAMAVRYSLYLLEKKAPGEGVEVRVAPWGAIKILDGPASDPHNLTPPDVIE
FT                   LDPDVWMRLATGITSWGEEKDAGRITAVGERDDLSGLLPLA"
FT   CDS_pept        38284..40740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="BAD_0030"
FT                   /product="glycogen phosphorylase"
FT                   /note="COG0058"
FT                   /note="Orthologue of slr1367_ BL0597"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38811"
FT                   /db_xref="GOA:A0ZZC8"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC8"
FT                   /protein_id="BAF38811.1"
FT                   /translation="MTEITAPKSAVTAEQFADEIREQLKYTQGVTVEQAKPADVYVAAS
FT                   AAVRRHLVDSWMKTQADMVNGNTKAVGYLSAEFLMGKQLENALLNAGLTDQFDKAVEAL
FT                   GFDAQEVIDAEYEPGLGNGGLGRLAACFIDSLASLGVPAFGYGIQYKYGIFKQEFDENG
FT                   KQIETPDYWLANEEPWGHIDYNRDQKVSFGGEVVEENGKKVWKPAWSVRAVPVDYMVPG
FT                   YASGRVNTLRLWTAKSYDEFDLLTFNKSEYLDAVKPQVEAENISKILYPEDSTPQGKAL
FT                   RLEQQYFFVSASIHDAIRVFYPGQDKPDLTTFPDKINFQLNDTHPVIGIPELMRVLMDE
FT                   YGYDWDTAWTITNKTFNYTCHTLLPEALEVWPSKLIGELLPRHLEIIEKINDQFEAELK
FT                   AKGVAEETIKDMAIYTGDSVRMAYLATYGGSHVNGVAELHSQLLKDVTLKNFSDVYPDK
FT                   FTNVTNGVTPRRFIKLANPRLSDLITEGLGTDKWLSDLELLKGLIPLADDDEFVKKFAA
FT                   VKQANKVDFSNFAKRKYGFDIDPNTMINTMVKRLHEYKRQALKILSVIADYADIKSGKV
FT                   SADDIMPRTIVFGAKAAPGYYLAKQTIQLINNVVRVINNDPDVKGKLNVYFPWNYNIEL
FT                   AMNLIPATDLDEQISQAGKEASGTGNMKFALNGALTVGTLDGANVEIRERVGAENFFLF
FT                   GMTEPEVSALYAKGYDTKGLSREYYEKDPQLKAAIDMVADGTFSDGDKDTYKDLVNDWL
FT                   NKDYFMTLADFRAYMDIQAQIEETYRDPMKWSRMAVLNVANSGYFSSDRSIEDYLERIW
FT                   HTGPLK"
FT   CDS_pept        40845..41195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1A"
FT                   /locus_tag="BAD_0031"
FT                   /product="membrane carboxypeptidase"
FT                   /note="Orthologue of jk2069"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38812"
FT                   /db_xref="GOA:A0ZZC9"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZC9"
FT                   /protein_id="BAF38812.1"
FT                   /translation="MGFSKGLFVCFSHVRLRMPVVPERTCRTYVAIQRQYDGRPQANRN
FT                   RKSKRKTLYRKIQGEATNPTRHRCAGERRNQAASGSAAGAAAVASASGSASLVRPRSTG
FT                   EELFSHGSSHGS"
FT   CDS_pept        41217..42377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0032"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38813"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD0"
FT                   /protein_id="BAF38813.1"
FT                   /translation="MYRPTTPASKAPKSSAKNFQPLEDLFSMTAPFKVSKHWLTCSFKP
FT                   ALFPILIRGMCRLGGFTRRKIPHVPVVLSYGIPTIQSVSRFPIVQGSVLRPIAAIPVAQ
FT                   RRPGHHHRHHGDLHRGVDHRSGPLPRLARRRQRVRERRHAAARHGRPAPVDLHHLDVPA
FT                   PADLAVAHPVQHAYFVVRGARAGTHDGALAVSCAVPAVRIGRRRRTDGVGRVLAVGMDD
FT                   RRIWRVRRAVRPVRRDSGGVQENRHRYSFDADLDADQLPDAGDHAGHCMAGACRRIHRR
FT                   RRACVAAGHRPACVPRQKPDVAHHGVRHHGVRGGRGDHRGMQRRQSADAYVTSVPVMRE
FT                   LHTCSFPHPWITLWISDVKPVGKSGITWWIIHKDIHKMAEHKEFPM"
FT   CDS_pept        42641..43915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0033"
FT                   /product="N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38814"
FT                   /db_xref="GOA:A0ZZD1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041497"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD1"
FT                   /protein_id="BAF38814.1"
FT                   /translation="MSDGPLLNDVTRAFAEAHRNEDVRDLALKTKRTADLDLPAALDQI
FT                   AGWQIARNKLPQWAACADIVYPAHISMEQCSSQFTAQYKAEIARRLLRSLPQSAGQTAN
FT                   DATMTDLTGGFGVDFSYLARGFGHATYVERQSHLCELAAHNMAALGLTQAQVVCGDGVE
FT                   YLRAMEPAQLIYIDPARRDEHGARTYAIEDCTPDVLALRDLLLAKARYVMIKLSPMLDW
FT                   RKAVDDFAGTVAEVHIVSTGNECKELLLVLDGKAAGATSDAAAADTRAPHVYCVNDDQR
FT                   LDYDAAAYTRGLRIGDAPLPHELRYLYEPNASIMKAGCFDVVEARFGAVQIGPSSHLFV
FT                   SDEPVDGFPGRGFAIETIGGMGKKELKRLLSGLDRANIAVRNFPLTAPQLRKKLKLADG
FT                   GDAYLFGTTMQGGDHVLIRTAKISR"
FT   CDS_pept        complement(44105..44572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0034"
FT                   /product="membrane protein"
FT                   /note="Orthologue of BL0593"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38815"
FT                   /db_xref="GOA:A0ZZD2"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD2"
FT                   /protein_id="BAF38815.1"
FT                   /translation="MLMADEELHETTADDQKDLQSADDTAAVEETTEDVVDKTSVDEDQ
FT                   SDDDDLDIPMDRVEAVLNATVDKDSLSPQMQRMMNRQAENTRRVEESIKGTKSNPRWFV
FT                   PLFCALMIIGLVWAVVYYLTTDYPIPHIGAWNLAIAFAIIMVGFIMTMWWR"
FT   CDS_pept        44708..45487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0035"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0592"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38816"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD3"
FT                   /protein_id="BAF38816.1"
FT                   /translation="MAKHTGKHSAKRSKAAGVAAFLVLLFSGFLLSTNLRVNRSVVVSN
FT                   DTAELVEQRVKKVNSLRSEIDALSTRVNDLSKTLDSQNADGSQDSESAGNGTMLPAVEG
FT                   PGLVVTLDDSPLWENMVDANGSSANINDYVVHQQDIEAVVNALWAGGAESMQIMDQRVL
FT                   FNSAVRCSGNVLLLQGKKYSPPFKISAIGPVEGMRKALDDSEEVSIYKQYVSAFGLGWQ
FT                   VDEKTKLHFDATDALQQPLQYAKALENDKNGDSQEGK"
FT   CDS_pept        45494..46588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0036"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0591"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38817"
FT                   /db_xref="GOA:A0ZZD4"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD4"
FT                   /protein_id="BAF38817.1"
FT                   /translation="MKHVASRGGRTKSALWTILGILAELMLTAAAICALYIAWQMWWTG
FT                   VQSEHNQIETRQSVSWSDPGKSGNVTVAKAQQGDPPVQPQSATEGELIAQIYIPRFGSQ
FT                   WQRNLVEGTDLTQLNKHGLGHYTDSQMPGQVGNFAFAGHRNGYGQPLGDVDKLQEGDPI
FT                   IVRTQDYWYVYHYTSYKIVLPTQTEVVAANPENPGATPTKRMLTMTTCEPKYSTPTHRW
FT                   ISYAEFSYWAKVSDGIPQELASQNANGTVKFVNNEQSSFLSSIDTLKPWIFGALAAYVI
FT                   IFISAAVAWRWPYLADVRAGRRKKADFSLYGSLVRLQPGVLPIRLLLVLLLVFAAAASC
FT                   FEWLFPWAASTIPMLQEMSNYTAI"
FT   CDS_pept        46667..47314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BAD_0037"
FT                   /product="Para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /note="COG family: anthranilate_para-
FT                   aminobenzoatesynthases component II"
FT                   /note="Orthologue of BL0590"
FT                   /note="PFAM_ID: GATase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38818"
FT                   /db_xref="GOA:A0ZZD5"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD5"
FT                   /protein_id="BAF38818.1"
FT                   /translation="MMTDSARILVVDNYDSFVYTIVGYLKTLGATVTVVRNDAIDPSQP
FT                   GVIDEYDGVLISPGPGAPAESGASEDMIRLCAKLDKPMFGVCLGMQALAEVFGAIVSHA
FT                   PTIMHGKTSQVEHIDDEIFDGVANPMTATRYHSLAVEPESVPDDLVVTAWTQGDHIVQG
FT                   IKHRSKPMYAVQFHPESVMTQDGYRLLANWLKVCGQDSAVEKSAGLQPKVVE"
FT   CDS_pept        complement(47433..49493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="BAD_0038"
FT                   /product="probable serine-threonine protein kinase"
FT                   /note="COG family: serine_threonine protein kinases"
FT                   /note="Orthologue of BL0589"
FT                   /note="PFAM_ID: pkinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38819"
FT                   /db_xref="GOA:A0ZZD6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD6"
FT                   /protein_id="BAF38819.1"
FT                   /translation="MNINMPTSLAGGRYQLGQLVGRGGMAEVHVATDTRLGRTVAVKIM
FT                   RADFATDSIFLERFRREAHSVAQMNNPNIVNIYDSGEETVTTETGEIEHLPYLVMEYVK
FT                   GQTLRDILKVNGALSQRDAEQVMMGVLNALEYSHRMGIIHRDIKPGNIMISEQGVVKVM
FT                   DFGIARAIDDSAATMTQSQGVVGTAQYLSPEQARGESVDMRSDLYSAGCVLYEMLTGRP
FT                   PFTGDSAVAIAYQHVSEVATPPSTIVPGLPKMWDSICAKAMAKDRQNRYATASEFKNDL
FT                   LTFMNGGVPMAAAFNPLTDLTNMKARKQAEMDAATVPMAPATDAPTQAFNPVTGQFEAV
FT                   PNPNGGVETKTRAEQRAKAVQERKKKQIIIASVVGSIVVLLAVIGIFFALNGHKNTADL
FT                   VSVPDFTDTSNISQARVEEQLKALGLKLDARDDATSSQPKGTITKQNPQGGRKVAKGST
FT                   VSVWFSTGPQAVPVPDVSGKTQEEAKSILEAAGFKVGNVKTVDNATIAKDQVVNTDPAA
FT                   NSKQTKGTIITLYISSGMTKIPDGLVGQAKDSVIAQLKQAGLTQITIESEYSDSVQSGA
FT                   VTRIDPGSGSTVEMGTAVTIWVSTGKQQTSVPNVAGMNYADAKALLEGYGFQVNVSGPQ
FT                   DGTVASMSPNGGSKADNGSTITLTTKAQPATDTGDNSNGNTTDNNQQQPQH"
FT   CDS_pept        complement(49490..50434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="BAD_0039"
FT                   /product="probable serine-threonine protein kinase"
FT                   /note="COG family: serine_threonine protein kinases"
FT                   /note="Orthologue of BL0588"
FT                   /note="PFAM_ID: pkinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38820"
FT                   /db_xref="GOA:A0ZZD7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD7"
FT                   /protein_id="BAF38820.1"
FT                   /translation="MKLVEGQLIHRRYRLDSRLAQGGMGEVWKGYDIQLGRPVAIKALR
FT                   GDLGVTQEAKLLRLRAEAHNSANLAHPNIAALFEYYEHDGIGFLIMEYVPSKSLADLYH
FT                   EQNGPMDPIKLLPILIQTARGLFVAHSHGVIHRDVKPANIMVSDSGEVKITDFGVSYST
FT                   NQEQITQDGMVVGTAQYISPEQAQGKHATPQSDIYSLGVVAYEGLCGHRPFTGATPVDI
FT                   AAAHVNNPVPPLPDTVDVQLREFVMSMLAKDPLDRPKDALVVSRTLSRIERRLLDQQTQ
FT                   LADTMVVSSGGRLPRRVVSKPHISVSNDWKEQG"
FT   CDS_pept        complement(50431..51897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="BAD_0040"
FT                   /product="probable penicillin binding protein
FT                   transpeptidase"
FT                   /note="COG family: cell division
FT                   proteinFtsI_penicillin-binding protein 2"
FT                   /note="Orthologue of BL0587"
FT                   /note="PFAM_ID:Transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38821"
FT                   /db_xref="GOA:A0ZZD8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD8"
FT                   /protein_id="BAF38821.1"
FT                   /translation="MNKSLRQLFTIVVALFVILGMSTTIIMAIRANQLTNDARNVRALY
FT                   HEYGAPRGSILAADGSVIAKSDPSNDSFSYQRSYSAGELYAPVTGFFSISQRGWSGVEA
FT                   SRSSLLSGQSEQLLWQRFKSLFTGQENKGANIETSIDPKIQQAAYNSLGSTDGAAVAIE
FT                   PKTGRILAMVSTPSYDPNQLASHDMSQANSNYGVLSQDATNPMLNRATSQLYPPGSTFK
FT                   TVVAAAALETGQYQPDTQIPAGASYTLPGTVTQLTNAVPQADGADGKISMEDALAYSSN
FT                   TAFAQLGVSLGDNAVSSMAKKLGFDSPITVDGSDYTGTPWVSVTSKFPTDINDDKLALA
FT                   SIGQGDTVVTPLQNAMVAAAIANDGKLMQPTLVDRVRSADLSVISQTKPTVMSHAFSAD
FT                   TANKLTQMMEAVVTKENTNLAINGVQVAVKTGTAQIGNGNTSIDGWVIGFAPADDPKIA
FT                   VAVVVHNVDLYGSFAAGPIMKAMMQEALAE"
FT   CDS_pept        complement(51890..53473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="BAD_0041"
FT                   /product="protein involved in cell wall formation and
FT                   stabilization of the FtsZ ring during cell division"
FT                   /note="COG family: bacterial cell divisionmembrane protein"
FT                   /note="Orthologue of BL0586"
FT                   /note="PFAM_ID: FTSW_RODA_SPOVE"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38822"
FT                   /db_xref="GOA:A0ZZD9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZD9"
FT                   /protein_id="BAF38822.1"
FT                   /translation="MIATRLRQLGMLLFSMLLCAVAFFQMFERTTNGFPQNYVWMLAFV
FT                   SALFLTAWGLLLRFQPHADQSVMCCVLVLTGIGVTMIARLDQDTKTTVAFRQLLWLAIA
FT                   LVFANLLVVFMRDYRVLRRFSYVSMVIGIVLLLSPMLPVVGSEQYGARIWVKIPGLGSF
FT                   QPSEFAKLFLAFFFASYLFDHRDQLAVGGKKILGIQLPRIKDMGPIIVVWIVSMGVLVL
FT                   QHDLGTSLMFFAMFVSMLYVATGRKSWIVIGFIAFAAGAVAAASIFSHVGSRVDAWLHP
FT                   FSAAQYNKEYGGSYQLVTGIFGLASGGLMGTGLGQGHPSITPIANSDYIYAALGEELGL
FT                   TGLMAILMLYLLIIAAGMITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTG
FT                   LTLPYMAAGGSSLIANYMLAALLIVISNSANRPESEIDSDTFQQEAVRVLRERERNRRT
FT                   EIAGNTRSGAAKASAIPAVRANHAGAAGQAGHAVPANQTSQAGQTDQSNPTIPITGVLP
FT                   TIDQQGASHE"
FT   CDS_pept        complement(53470..55092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0042"
FT                   /product="possible phosphoprotein phosphatase"
FT                   /note="COG family: protein serine_threonine phosphatases"
FT                   /note="Orthologue of BL0585"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38823"
FT                   /db_xref="GOA:A0ZZE0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE0"
FT                   /protein_id="BAF38823.1"
FT                   /translation="MTFLPTSTASQQLFMYSTVVSDVGTVRSNNQDSAFAGEHLIAICD
FT                   GMGGHAGGDTASTIAIRSLAHIEQDNVDGDVQVVSHMMATSVMAAHDAIVGKAKRERRL
FT                   AGMGTTVTSVALVAGCWVLAHIGDSRAYLLHDGHLVRMTSDHSYVQHLIDTGRISEAEA
FT                   RNHPQRNVVMRVLGDFDIDSRPDIAIRKAHPGDRWLLCSDGLCGVLEDSTLEEVLSTCA
FT                   DQEECAQRLVSMALRAGSTDNVTAVIADATLALDADAFDLPHQTPLVGGAASASLETIA
FT                   DIVNEPVASAPPLREGKQSPAARAAALRSGKDPNEEPKQPEQRVAQPSSVREDNGDRVN
FT                   TDTGEIPIVQKRNGRISADPNDPEVAKAIRNEHIEERKTKRSRKFRNRIITILIIILVL
FT                   LGVAGVGVGTYRWSQTKYYIGDNNGKVAIFQGVPTSIFGAKLSHAVTDTNMKTSDLPPS
FT                   WREQLDQGISFDTYGEAKSHTRLIKKQLNDAKRKQEARQQEKAEAEQKAKDEAAAKQKQ
FT                   QDEAAKKAADQAAQTNKSGGDKS"
FT   CDS_pept        complement(55089..55604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0043"
FT                   /product="hypothetical protein"
FT                   /note="COG family: FHA-domain-containing proteins"
FT                   /note="Orthologue of BL0584"
FT                   /note="PFAM_ID: FHA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38824"
FT                   /db_xref="GOA:A0ZZE1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE1"
FT                   /protein_id="BAF38824.1"
FT                   /translation="MLTELTFAILKYGFLVLLWIFVACTVRSLYRDIETLSPRKSRAHR
FT                   RKERAARKAVESPAPVAAAAPSASAATNAKPTLLVIIDGPLAGSSVPLAGNTITLGRSA
FT                   SNTVVLDDEFVSSHHARVYTDPATGRWAIEDLGSTNGTVVNHQRLNAPMILGARVPVRI
FT                   GATTFELR"
FT   CDS_pept        complement(55633..56340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0044"
FT                   /product="hypothetical protein"
FT                   /note="COG family: FHA-domain-containing proteins"
FT                   /note="Orthologue of BL0583"
FT                   /note="PFAM_ID: FHA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38825"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE2"
FT                   /protein_id="BAF38825.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLKPVDLSSALEREIDKEAM
FT                   PVTRDRTVAPNEYRFKLSTPDFNNIVEWGAETLANELADNLTQYAKSQNYAFVGPVVVI
FT                   FEEDLELSKGDYRLSRESVQGNTVPVTTDAQTEDCPMLEIGEHQYLLTEEKTIIGRGSD
FT                   CDIVIDDPGISRRHMEIDVTDNGNTVIARDLNSTNGMYVEGHHVEAATLLDGNTITIGR
FT                   TRILYWASSQEQE"
FT   CDS_pept        56490..59000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0045"
FT                   /product="probable dipeptidyl peptidase IV"
FT                   /note="COG family: dipeptidylaminopeptidases_acylaminoacyl
FT                   -peptidases"
FT                   /note="Orthologue of BL0582"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38826"
FT                   /db_xref="GOA:A0ZZE3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE3"
FT                   /protein_id="BAF38826.1"
FT                   /translation="MNDAIDEFPGLKARTLRFTCGAPRSARAIGDGSRALFLRSDGPED
FT                   TVTSLWMSVIGSDGDTDEILLADPRTLLADADAEDVPAEEKARRERAREGGSGIVGYSV
FT                   DAAGNRVTFTINGQLFLTDIAAGVTHGIAIDEPEFKPVLNPRISPDGRHIMYTTGTYLV
FT                   DVDLADVSDTTDAGEDAGDAVSIVASVPQDDADDVADTQDGTKDDAQSDAAESQAGEWK
FT                   IGLAEFAAGEEMDRYDGFWWSPDSKYVLFETFDASHEQTWYIADPADPTKPAQARRYPQ
FT                   AMTANADVHLTLLELGYDTDGCYYGGIAHNVEWDRESYEYLAAVSWTEGHEPLLLVQDR
FT                   LQQHDQVLAVHVGEPIVTMSAPENGFTDEDGSEVETFSIAIPEYAPGEEPGTTRVLEEH
FT                   SNDCWLDLIAGTPAYTPDGRLVCAMNDMDADTNRLTVDGTPFTPKGLQVREVLDVTDDD
FT                   VLCVVQRTPELLPAADLPFLWQSNADDHDARSFDVVSIRYDGDWEPLTYVPGQWTMSRA
FT                   GDGCVVTGRGMDDAAMQMQHCMNVRTTDGDGDGVDAADMMSMVVSPIENHAETPGFMPN
FT                   VRFVRLGERALYAAVILPSADSAYAHADQLPVLMKPYGGPGFQQVVESQSFYWDAQWWA
FT                   DQGYIVVTADGRGTTGRGPKWDRAIYENMKAVTLEDQVDAVYALPDALASIATKTGVAV
FT                   PKPDLGRVAMIGWSYGGFLSALAVLDAPDTFAAACAGAPPTDWTLYDTHYTERYLGLDP
FT                   TTYERNSIVADAPKLSRPLMLIHGFADDNVTIANSLRLSQALMAAGRKHTFLPLNGITH
FT                   MTNDETVARNLLLLQRDFLADALV"
FT   CDS_pept        complement(59226..60515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0046"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of CE2341"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38827"
FT                   /db_xref="GOA:A0ZZE4"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE4"
FT                   /protein_id="BAF38827.1"
FT                   /translation="MHAEPTKPRPVSAFRSWHNHMRADHPKLWHPIRITIVVITVWWIL
FT                   FCLVLAPTDNPAAIVWTIIEIAVLLLSPFFPKSMSLLFLIMSQSGPWLIPGADVNSLPG
FT                   ILYTFGMLAYETNNLVALLLLAYSIGDQLFRQLVLGTSRSNPVAIIAMVSLVLMLGCGL
FT                   RWNQAVAGSRAEAEQAKARLREMESRSHIAEAIHDAVTGDLSAAAFVAQRRIDALSGGG
FT                   DGDGSASTDGDDGKNADERRDELDKWTQVNDYILSALTNVHRVIDELDMDVTVLEEDAD
FT                   GKAFSDLLKATMAGGDRRLRALGFDITSILHVAGGAPSASPSLAGIANDLLRETYANIA
FT                   RHAQSGSKADLSVILKPNAVEITQINQARTTETDRTQPGGHGLAYFSKQLESHGGKLET
FT                   TLRDGEWTLFAYLPIPVPETLPPLAGHPES"
FT   CDS_pept        complement(60505..61170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0047"
FT                   /product="response regulator of two-component system"
FT                   /note="COG family: response regulators consisting of
FT                   aCheY-like receiver domain and a HTH DNA-binding domain"
FT                   /note="Orthologue of BL0903"
FT                   /note="PFAM_ID: GerE"
FT                   /note="PFAM_ID: response_reg"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38828"
FT                   /db_xref="GOA:A0ZZE5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE5"
FT                   /protein_id="BAF38828.1"
FT                   /translation="MNPAKSAAPIPKIHRVALVDNDPRALESLSLLIEAKVPTAYVVWT
FT                   ATSGDEAIERCQRNDDNLNLLVLDMSMEGLQGPAICHRIRLMDRHLPILGITSFSINSY
FT                   RSRLMEAGAQGLIGKEDSDQLAKAIERLCGGNVMEGFEPPALANVRIRREEETSPRLTV
FT                   REEQIISLCADGMLDREIAERLDISESTVRKHMQGILKKLNCKTARQAVALWVRSHAR"
FT   CDS_pept        61460..62524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0048"
FT                   /product="hypothetical protein"
FT                   /note="COG family: lysophospholipase"
FT                   /note="Orthologue of BL0581"
FT                   /note="PFAM_ID:abhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38829"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE6"
FT                   /protein_id="BAF38829.1"
FT                   /translation="MTLRLLDEANYDAEMESKVLPALDACMTEGWMDPATVDWNGDALP
FT                   KLDEPGRLHYCCYDAAKFDVLREDGASGVFRGAIVISHGFTEFARKYSEMAWYFLLAGY
FT                   SVCILEHRGHGHSVHDVDNPSLVWIDDWRRYVSDFAAFADTVGREYACGEPLNLYCHSM
FT                   GGGIGAAVMEHYPSLFDKAVLSAPMIAPVVGMPTWIARIATGALCGLGFGKARVFGHTD
FT                   FSPELDLDEHKGASEARVRWFHKQRVDDVACQTNAATFEWAHQAMALSRAVLKPDMCGA
FT                   IETPTLLFQAGRDVWVLNGPQDDFVERVREGGGLIEKIRYGKSLHEIFSMPNTVVGPYV
FT                   NKILDFFSAPADSL"
FT   CDS_pept        62598..63500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0049"
FT                   /product="putative permease"
FT                   /note="Orthologue of str1623"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38830"
FT                   /db_xref="GOA:A0ZZE7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE7"
FT                   /protein_id="BAF38830.1"
FT                   /translation="MAEKTFERTPKDLIIGIAMTLCGGVLWGVNATVSKILMGTYHASP
FT                   LWIACVRELAAGVLFLTCSAIMTPKLLTGALRDRKSYPRLLATAIICVLLVQVAYLESI
FT                   NWTNSGTATVLQSLNLLFVLGVVCLRGRRLPGVREGIGVALAFAGTVLIATGGDFTTLK
FT                   LPLVGLIWGAINAASTAAMVFLPVKLIERWGNFTVNGIAFLISGLVLLPFVRPWATAPQ
FT                   LDWLGVGLMTFTVIGGTFGAFWLYMAGVVRVGSMRATMLGTSEPVMATISAVAWTDAVF
FT                   EPTDLVGFVMILIMVFLVR"
FT   CDS_pept        63623..64252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0050"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /note="Identified by match to protein family HMM PF00753"
FT                   /note="Orthologue of BTH_I2788"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38831"
FT                   /db_xref="GOA:A0ZZE8"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE8"
FT                   /protein_id="BAF38831.1"
FT                   /translation="MTYGSWKSAFNRNLMLGLNLLLRFGLRHFQAQGAVLVAGVNVGIL
FT                   HVLANVEATRARAGVAFATQPAAVVVLVLVRAVAMRGNGQIAVLQVQRNVVLLEARHVD
FT                   VDHVALVGLTHIGAHHACGHVRIACGCAVHVAPTLEERIVEQIGEHRVIHQSRKHCHNR
FT                   YSLSKCAFCARSNAAWQPAVRLSLRRHHPARPATGFVAASGTLPGS"
FT   CDS_pept        64283..64600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0051"
FT                   /product="transport system permease protein"
FT                   /note="Orthologue of Ava_2828"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38832"
FT                   /db_xref="GOA:A0ZZE9"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE9"
FT                   /protein_id="BAF38832.1"
FT                   /translation="MSCSFRDYAHSEIPGNACDCVRGKVVRRISFFFRIGRMGLVCNAL
FT                   RICFSNRSREVWFWVAMCSILPNWLFGLCFLENRTFVVLVLGLDVRLSVSAEIAGLSAH
FT                   F"
FT   tRNA            complement(64679..64761)
FT                   /gene="leuX"
FT                   /locus_tag="BAD_t0004"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:64726..64728,aa:Leu,seq:cag)"
FT                   /note="codon recognized:CAG"
FT   CDS_pept        complement(65182..65508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0052"
FT                   /product="uncharacterized protein containing conserved
FT                   domain"
FT                   /note="Orthologue of CAC3033"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38833"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF0"
FT                   /protein_id="BAF38833.1"
FT                   /translation="MMLKTILTITFACILSTVQGMPPCAISNPSVSNAAAVTVSSKATC
FT                   DHEYKLLGKTCKRLHGAAAAVCWAGAAAAYAACLAGKSSNATNSQTLSSNPKSEQPAIE
FT                   DTRI"
FT   CDS_pept        complement(65538..66023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaT"
FT                   /locus_tag="BAD_0053"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of Bcep18194_B2659"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38834"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF1"
FT                   /protein_id="BAF38834.1"
FT                   /translation="MKKNTLRVIATILACATLASGSATAMADEASLPSMDEVPNSAAIE
FT                   HEAHSLSVQPTADKQYAYPAEAEASGIFPTKNANALQPLNDTDDVPQSRGAVGNVAKAL
FT                   KVAAKIFSGAKWLGDLSGFLQKPENWAAGKIEQFLRQHGVNASTAHCVAQILANILI"
FT   CDS_pept        66140..67573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="BAD_0054"
FT                   /product="putative exodeoxyribonuclease V"
FT                   /note="Orthologue of SAV5329"
FT                   /note="PF05127: Putative ATPase (DUF699)"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38835"
FT                   /db_xref="GOA:A0ZZF2"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF2"
FT                   /protein_id="BAF38835.1"
FT                   /translation="MTLLLYGTALRDLHDDGMCPPVKGVNMRRKQNACDSNGGVHTERV
FT                   TAGMHDLTYGLKDFFREVFLDKDDIDYERRFDVRSLPLLVVAMAAGWLYSRDGNGFYAC
FT                   VSAIFAVSYTVYFIVNRGVYIVRLFRGENIFGKRRVRCMKYRGTIHSSVAGGLAKALEK
FT                   FVDNDTLYAYIGGYGVPLLGTATMIAYDASHWLWLALVGGVLCVVYALYWLIYAFVAAH
FT                   RALIAVLADRDRRLEQAGYRMTVMRRDAKLASRTHDTVTGGLSYIAFIAQQQLEGKTLS
FT                   DEERVAWKHIDDAAQRTMDNVHEVIDILGRDIDPANPVGGEGFDCESQEIQMPDVSSLE
FT                   RIIREHCDEGDSRLKTLGFVGTSEIQLDVADADDTGESVCADLIDECTSLIDELYTNIS
FT                   CHADTSQPYAVFVSSENGCLRITQVNAIACPHDAQSGYKKKVSGRGLAFHRRMLDAMSG
FT                   SITTCEEGDTWTLHVVIPL"
FT   CDS_pept        67644..68375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0055"
FT                   /product="response regulator of two-component system"
FT                   /note="COG family: response regulators consisting of
FT                   aCheY-like receiver domain and a HTH DNA-binding domain"
FT                   /note="Orthologue of BL0903"
FT                   /note="PFAM_ID: GerE"
FT                   /note="PFAM_ID: response_reg"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38836"
FT                   /db_xref="GOA:A0ZZF3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF3"
FT                   /protein_id="BAF38836.1"
FT                   /translation="MVVNVMETNVERIDKSVEHIGIVDNDVLTLGALSSYLAQQFGDEK
FT                   ILWRCTLGKKAAELCSNSQTRPQILLMDMSLSDADGVQICQEIRRTVDDMPILAITSFP
FT                   LRRYAAAVAQAGVQGIVAKRNLRTIAAALECVVSGHVYLPDELAETMPDLHFELPVQAH
FT                   RRIDAETLGGQAVKPVLSDRETAIIVRYARGQTTLQVGECLGLSENTVKTYTKRAMAKL
FT                   GAKTRGQAIALWLMQTMTHGV"
FT   CDS_pept        complement(68587..70047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="BAD_0056"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /note="COG family: queuine_archaeosinetRNA-
FT                   ribosyltransferase"
FT                   /note="Guanine insertion enzyme Tgt"
FT                   /note="Orthologue of BL0556"
FT                   /note="PFAM_ID: TGT"
FT                   /note="tRNA-guanine transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38837"
FT                   /db_xref="GOA:A0ZZF4"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF4"
FT                   /protein_id="BAF38837.1"
FT                   /translation="MAPPRQSALSHTVESMTSLNEPQTGAVAHETSAANAAAGATHDAA
FT                   GNTTSAASTENLIEHPRGAEPGKPGRRDAFYFEQKTRLPDAADGKGRGGARYGRTGIIH
FT                   TPHGDIHTPAFVPVATQAAMKAVLPETMKDLGAQCLLSNAFHLYERPGEQVLDEAGGLA
FT                   KFMNWNGPTFTDSGGFQVLSLGAGFKKTLAMDVTGMKSDDVIAEGKERLAFVDEDGVTF
FT                   KSPLNGSLHRFSAEISMGIQHKIGADIMFAFDELTTLMNTRGYQERSVERTYRWAQRCV
FT                   AEHRRLTEERLGKPYQALYGVVQGANYEDLRRHAAEQIASLDFDGVGIGGAIEKRIIGD
FT                   TCAWICDAMPESRPRHVLGIAAVDDIFACVENGGDTFDCVAPARCGRNGAIFTRHGRYN
FT                   IKRAQFKHDFGPLEEGCDCYTCTHYSRAYVDHALRAREFNGFTLATIHNEHFFVKLLDD
FT                   IRASIDGGYFEKFRDETLAHFYENGSKG"
FT   CDS_pept        70216..72141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="BAD_0057"
FT                   /product="possible DO serine protease"
FT                   /note="COG family: trypsin-like serineproteases_ typically
FT                   periplasmic_ contain C-terminal PDZdomain"
FT                   /note="DegP or HtrA"
FT                   /note="Orthologue of BL0555"
FT                   /note="PFAM_ID: PDZ"
FT                   /note="PFAM_ID: trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38838"
FT                   /db_xref="GOA:A0ZZF5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF5"
FT                   /protein_id="BAF38838.1"
FT                   /translation="MAEDNSDQNIAQPQDGTQQTAPQTPSENVADEAQTSVTEPIAVPN
FT                   AGEQPTTALPTVDAADGTAGNTADDTPDYASAAGERTVINNATQDAPTEQYRPAPEYGA
FT                   YGPVPTPPAGDASGQTVQQPQYGAQQQGQRQPQDNRPSFFGAFGNPYTTGNQRNNGNPF
FT                   GNPFGGSSAQNGAQQNNQQQPQYGANMPPAGPGNRNPFGAPGQGFPNQPNQTPVVTKQK
FT                   SGMTSHVVTAVVAALVSGALCLGVGFTAITNGWVHVPSSSSLSDVKSNTSGSGSAKAKS
FT                   GTAVDWTAVAKEVSDSVVAIDVATSDGEAKGSGVVISDKGYIATNNHVISGAQQIQVTL
FT                   ASGAVYSAKVVGTDTTTDLAVIKLDNPPSDLKVAEFADSDNLAVGEAVMAIGNPLGYDD
FT                   TATTGIVSALNRPVTVTDDDNNAIVTNAVQIDAAINPGNSGGPTFNAAGQVIGINSSIA
FT                   STASSSGTAGSIGIGFAIPANLVKRVTNEIIDNGSVKHVVLGITIKSSSVEADGVTRGC
FT                   AQVQAVTDGGPASKAGVKAGDSIVAFNGKAVNNNYSLLGYVRASAMGDKVKLTVVRGGN
FT                   TMDLEVTLDQEETKTNSSNKQEQRQQNNGNDDNGNGQNGGSQNGQNGGNGNNGDGGGLF
FT                   DPFGLW"
FT   CDS_pept        72497..74806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0058"
FT                   /product="probable cation-transporting ATPase V"
FT                   /note="COG family: cation transport ATPases"
FT                   /note="Orthologue of BL0554"
FT                   /note="PFAM_ID: Hydrolase"
FT                   /note="PFAM_ID:E1-E2_ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38839"
FT                   /db_xref="GOA:A0ZZF6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF6"
FT                   /protein_id="BAF38839.1"
FT                   /translation="MRRIISICKEVPLLPIAIIAAIPLALLGSWRPWEAAGVSLTFGPF
FT                   NPGVGQWIVIALVVYTIVVTVIGMIDDLRHGHVGVDLLAVIAIASTVAVQEYWAAWAVV
FT                   LMISSGEAIEEFAQSKAEGNLTALVDAAPRTAHVVTLPGVGARAAAAGADGTAGDAEGD
FT                   MTADGFRKVASVDVPNAAETNKSTTQTKPYDAAGEHFETVPVDQVKLGDVILVLPGETV
FT                   PVDGELLSGVATLDLSNINGEPVPREVYAGARVLSGAVNGSTALTMRATQLAQDSQYQK
FT                   ILELVSSAQESRPTVVKTADVLAVPFTILSLAIAGIAWAVAGTPLRFAQVLVLATPCPL
FT                   LIAAPVAYVAGTGRLAKAGILIKAQDVLENLGRVSHIFFDKTGTLTVKQPQVVRVEKPF
FT                   ENSSPYDENHILMMAGVVEGYSVHILSKGIAAAGQKAMQELYARYENGQRLCAERDLPG
FT                   HGRDYPVVKNIEEQSGKGVSGEVNGHAVRVGRFAYVTADEAGFTHVLGAGAAAGIAAGA
FT                   VADSAVGDSATGTAAGASKKPEVNSLFAPLEPDEMAAYVAIDGKLAARIVLRDVPRENA
FT                   KSSLEKLHRLGVKKLSMLTGDKEASARIIAGEVGIDDVQSELFPEGKVAAVKNATEDAH
FT                   QNQPAWDKVVQRVVGESMTRQVTMMVGDGVNDAPVLAVADIGMAMTDGTSTAASESAQV
FT                   VIMNDDIASVPRAIAIARRTKKVMLQAVLVGLGLAIIGMVAAAFNLIPVVVGAFMQEAI
FT                   DVVSILWALTALLDRE"
FT   CDS_pept        complement(74857..75927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0059"
FT                   /product="L-asparaginase I"
FT                   /note="Orthologue of PPA0367"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38840"
FT                   /db_xref="GOA:A0ZZF7"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF7"
FT                   /protein_id="BAF38840.1"
FT                   /translation="MQRHAHRDTRRQITRSRKATMRIHITYTGGTIGMVESPNGLVPGA
FT                   DMRGWLRRLIEDAHLDPSLFSFTELDPLIDSSNATPDNWQTMADDLRAHRDDADAFVVL
FT                   HGTDTMSYSSAALSYALTGFGKPVIFTGSQHPLGKIESDATANVTGALNAAMSGRFHGV
FT                   GLFFGHHLFAGNRVSKSSSWAFEGFSAPSTGPLARTGTPWHWYAGDSAGSGCGWASPLP
FT                   YSRHDVAVIDMAPGISAARLAAMLDPRPEAVLLRAYGVGNVPSDEPGLTDVIADVLHDG
FT                   VPVVIASQCQQAEVLLGHYETGDAIARAGAIGSGDMTLEAAYAKIMFLLSQGVDAADFG
FT                   TWMRRNIAGEISPSSM"
FT   CDS_pept        76153..77937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0060"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of sll0641"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38841"
FT                   /db_xref="GOA:A0ZZF8"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF8"
FT                   /protein_id="BAF38841.1"
FT                   /translation="MGCLRGASQCRTVVACALLCLWLTDGGYSTRGARRMGLSMNTVAD
FT                   CLQRHYRVVVFAVYLAVVIVTMAFHEPWFDEAQSWLIARDCPYRDLLLVRPHYEGHPPL
FT                   WWLLLSIPAKLGVPYEWGLKGVELVCSALMCGLLVFRAPLPRLAVALLPFTYFLCYQYG
FT                   VTSRPYALMCCALFVIAACWKSRDEHPWRLTAAFVLLCCTSSYGIALACAFALVWMVRA
FT                   IRGATGRPAVRDGLFGNPARFAAWMVLLAVGLVLTACVLPRSDTFGAVQDPGGNPPIAQ
FT                   FALFWTVLPAESMFTAFAGDVSLHGLHMGVLAIALCVALSLAIWSVLARVALRRKNLDL
FT                   LLVTYVLLSLCATKYFSMHHIGIIFALFVVQLWINVQDKALGIADIPLPTPLSRSLRAA
FT                   CATHAVRVAHIARIAIVVALLPSLVWTAAAIACDIRYDYSAGRALATFVRNNNLEHNRW
FT                   VSFWRYLPDTTWPDGTHTNRMEDTYRYSWPAIAANPYFARNLLDCTYEGRTFVPNQVPS
FT                   RAQMNREIASCAAKGAPEFLIGDTDFPQYFFHRLGLKRGDYRQIVVASQHVPWKTWVTS
FT                   SDIAVYVRSDVYRTLPHA"
FT   CDS_pept        78010..79470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fprA"
FT                   /locus_tag="BAD_0061"
FT                   /product="probable ferredoxin/ferredoxin-NADP reductase"
FT                   /note="COG family: NADPH-dependent glutamatesynthase beta
FT                   chain and related oxidoreductases"
FT                   /note="Orthologue of BL0552"
FT                   /note="PFAM_ID:pyr_redox"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38842"
FT                   /db_xref="GOA:A0ZZF9"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF9"
FT                   /protein_id="BAF38842.1"
FT                   /translation="MEHMSETNELRIAVIGAGPAGVYSSDIFLRQLGKLGEELGLGTKA
FT                   RIDLFEKLPVPFGLVRYGVAPDHPSIKFIASALEKTLDNPDIHLYCDVEFGKDVTLDEL
FT                   LERYDAVLFATGAVEDKPLGLPGADLDGVYGAAKFVEWYDGYPTGAREWPLEAEEVAVI
FT                   GGGNVAMDVARELMRNADDLKERTDIPDNVYEGIKANKAKTLHLFIRRGVAQAKFSVQE
FT                   LREMEKLPGVQLIINEDDFDLDDDTIEEAGKDKLTRQMVEELFTIREMAEDMEDDGDTD
FT                   FEGNPADRKYYIHFNSAPVEVLGKDGKVKAIRVEKTTTSADGKMTRTGEFEEYPVQAVY
FT                   HAIGYKPATAPGIAYDERRAHLANANGDGRITTEASGEGAQVRERLYATGWAKRGPVGL
FT                   IGSTKSDALLIVTNMLEDLSKAAEGGRVAADRDPESIDRLLASRGVKPIDFAGWKKVDA
FT                   FERAEGAKEGREHKKVIDPEQMRALAHA"
FT   CDS_pept        79703..80833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="BAD_0062"
FT                   /product="probable protease htpX homolog"
FT                   /note="COG family: Zn-dependent protease with
FT                   chaperonefunction"
FT                   /note="Orthologue of BL0551"
FT                   /note="PFAM_ID: Peptidase_M48"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38843"
FT                   /db_xref="GOA:A0ZZG0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG0"
FT                   /protein_id="BAF38843.1"
FT                   /translation="MVIMNGKLQVHGHCNGLKTTLLFALMWGIIMLIWWAAGASQSTLG
FT                   IYLCIGIGSTFVSYWFSDKLAIASMHAQPVSEQEAPVLYKIVRELSAKAGKPMPRIYIA
FT                   PTMSPNAFATGRNERHAAVCCTQGILQMLNEREIRAVLGHELMHVYNRDILTSAIASAM
FT                   ATVISYLGYSLMYFGGGRSRDDRDNSASGGLGLLGVLLSTILAPIAASLIQMAISRTRE
FT                   YDADEDGSKLTEDPEALASALNKISGGAAAMPMEKTAGTQSVAAMMIASPFSAEGFSRL
FT                   FSTHPPIQDRIARLMQMGQEMRQQGAQSGYLAGGYATTGVAAIDIRQGGYDGPQFGSQY
FT                   GSAYDSYGSGPAGSAGSTGGYSRDYSQRPMRRRGSR"
FT   tRNA            81167..81240
FT                   /gene="glyT"
FT                   /locus_tag="BAD_t0005"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:81199..81201,aa:Gly,seq:ccc)"
FT                   /note="codon recognized:CCC"
FT   CDS_pept        81673..82659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0063"
FT                   /product="hypothetical protein"
FT                   /note="COG family: permeases of the
FT                   drug_metabolitetransporter (Dmt) superfamily"
FT                   /note="Orthologue of BL0575"
FT                   /note="PFAM_ID: DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38844"
FT                   /db_xref="GOA:A0ZZG1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG1"
FT                   /protein_id="BAF38844.1"
FT                   /translation="MGRLEPVNTNQKSPSDSGANHPTGNSCNPLLGHATSHAATLIGLF
FT                   AIVLWGFMAGLVRLVSESFGATLGSALIYTVGGVMLFIVRRPKPIREAPCKYLIAGGLM
FT                   FIAYEASISLSIGLATTNAQSVEVSLVNYLWPTLLVLMTAAVSHKRGAVAKAIPGAVIA
FT                   TIGVAMAVGGESLDMQEAVHNIASNPLPYVLAFVGAFIWAIYATFTPSLSGGYDGTTIF
FT                   FCCVAVVLWTIHFVSGDGLPDTAPGIGGYAALIACAASISGGYACWGYGMLHGSMETLA
FT                   IGSYATPLFSTASSTLLLGVALGMPFWIGVVLVVAGSLINVWFARCP"
FT   CDS_pept        complement(82999..85323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="BAD_0064"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted membrane protein"
FT                   /note="Orthologue of BL0137"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38845"
FT                   /db_xref="GOA:A0ZZG2"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG2"
FT                   /protein_id="BAF38845.1"
FT                   /translation="MIWGIFKRDMCHATRNVIAVIVSMGLVVVPALYAWFNIAASWDPY
FT                   GNTKALKVAVANNDKGYKSDLIPVRVNVGETIISTLHANDQLDWQFVKSDKAIDGVKSG
FT                   EYYAAIVIPKGFSADMMTLFSPDIKHAQLKYYLNEKINPIAPHITDQGATTVVNTIDKT
FT                   FAKTIAQVGLDLASSILHYSQSPQMAEYMRNLNGNLTTTADTLSGASQQVTSYSQLLGS
FT                   ANDIVDSTGKLLASATKAGKQAQNALKQGKSGATSLTSAGANVTSSVNTALDQVSGAFD
FT                   QVAAKVNKAFDAIGKDSDTAASQLATLSEQISSGESLYDTYITSLNHMRESVEQLPDSD
FT                   SAKQALLEAIDREITLLEAAKGDSQKLAQQLKDASTQVTQDTAAAERSRKEILNRITSA
FT                   KQSISNVRDDYATNVKPKIDALASTVSTLISQTDSIITQLSGTADDLDDVTGDVGTNVT
FT                   SIRSTLGAIAKKLDSSAATVKELITKLETGGNAGDGNSDGGNGGNDASSSDSGESDELR
FT                   ALATANASTLSTLISAPVALHRVSVYPIANYGSAMAPFYTILSIWVGAIILCAMLKVTI
FT                   SDREKAHVLGLGDTLPRVAGPSGPGNASRWGLRLDHEYFGRYAIFALLALLQGTLVCLG
FT                   DMYFLGVQANHALQFLAVGWLAALVFSNIVYTLTVSFGDIGKAVAVVLLVMQVAGSGGT
FT                   FPIETLPKFFQMLYPFLPFPHAIDAMHAAMAGSYGNEYLLDMVYLALFLIPSLLLGLVL
FT                   RKPVIRLNNWVSRNLESTKVM"
FT   CDS_pept        complement(85326..88037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0065"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted membrane protein"
FT                   /note="Orthologue of BL0138"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38846"
FT                   /db_xref="GOA:A0ZZG3"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG3"
FT                   /protein_id="BAF38846.1"
FT                   /translation="MHQVFAIFLRDVKRILKNPVALVVTLGVAIIPSLYAWCNILANWD
FT                   PYANTGNIQVAVANEDKGTTSTLVGHLDAGQQTVNQLKKNHQLGWRFVPKQQAIEGVES
FT                   GKYYAAIVLPEDFSSRLIGTVTGKGDRPSITYYINEKLNAIAPKITDTGATTIDEQINT
FT                   TFVSSVADAVAKEVKEAAGETTGSVKSAQSDVINDLTDTINQLETVQQQLRDTRSTLDK
FT                   ALTTIDSAKQSNIALTSEITNSLDTVGKASDLLSETRTQTERFSNTLVGALDNGSTQLS
FT                   GLQVNVSNATGTVLSGLNTTQDALDQVSSTMHHVNTTTGNVLDDVEKALQASQLDPNSQ
FT                   TYKDLSAQLAEARKQLTFQQQRIDAFDQDTTAAINAGKNTANGFNDDVTTLAKNGTASM
FT                   ASARTTITGTVMPNLNTGLDTLSLANGSLSGTLTTLQSTLEQGNGLLDQLSRTVTQTNT
FT                   TIAGTQTQLANLAKQLNTTRTDVAALSSSAMFQQLSQALGLDASEVGSFVGEPVHLDEQ
FT                   VLYPVKNYGSAVTPFYTNLALWVGGFVLVAIYKLEVDRDEKIRMYTPRQGYMGRWLLFV
FT                   TVGFLQAIIATIGDLALGIQCEHPFLFILAGIFASFVYVNIIYALAVAFRHIGKAVAVI
FT                   LVIIQIPGAAGLYPIEMMPEFFRRLKPFLPFTYGINAMRGPIGGMYANHYWIDMLSLFW
FT                   YLPVALFIGLVVRKLALNLNRLFDNRLADTDLMITEHNEGTVEPLRLTETAQQIAEEFP
FT                   ELVRRRAIHFFRLYPRLVRWGFLALAVLPFVFLLLLFITRMKLAMLLGWIISIIAIDTY
FT                   LIVVEYLRERYANYLGEEAMSAEEFRSAILHENLLFRPGMHYKPMHAVRTRLYEAAHGG
FT                   SAGHAPEHAAEYAAGNTDGNAGRSLREEGNEQ"
FT   CDS_pept        88346..89413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="BAD_0066"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /note="Catalyzes the formation of glycerone phosphate
FT                   andglyceraldehyde 3-phosphate from fructose
FT                   1_6_bisphosphate"
FT                   /note="Orthologue of BL0550"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38847"
FT                   /db_xref="GOA:A0ZZG4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG4"
FT                   /protein_id="BAF38847.1"
FT                   /translation="MTIATPERYAQMLDAARRGGYAYPAINVTSTQTLNAALQGFAEAE
FT                   SDGIIQVSVGGAAYFSGQRVNDRVTGSLAFAAFAHEVAAKYPNITIALHTDHCAKQYLD
FT                   EWVRLLLDHEVEQVKHGQEPTFQSHMWDGSTVPLDENLDIAEELLDKSQAAHTVLEIEI
FT                   GAVGGEEDGHSAEINDKLYSTPAQGITVAQRLGLGERGRYMAAFTFGNVHGAYKPGVVK
FT                   LRPELLDEIQTTVALAIKAGEMPDPAHSLDVAPGKPFALVFHGGSGSAPEEIAQAVSYG
FT                   VVKMNIDTDTQYAFSRAVAGHMFSNYDSVLKIDGEVGNKKLYDPRSWGREAESAMAARV
FT                   VEACKQLGSAGRALN"
FT   CDS_pept        89599..90885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="BAD_0067"
FT                   /product="adenylosuccinate synthetase"
FT                   /note="Catalyzes the formation
FT                   ofN6-(1_2_-dicarboxyethyl)-AMP from L-aspartate_
FT                   inosinemonophosphate and GTP in AMP biosynthesis"
FT                   /note="Orthologue of BL0549"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38848"
FT                   /db_xref="GOA:A0ZZG5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZG5"
FT                   /protein_id="BAF38848.1"
FT                   /translation="MPGIVLIGAQWGDEGKGKATDLIGTKVDYVARFNGGNNAGHTVVV
FT                   GDESYALHLLPSGIISPNTTPVIGNGVVVDPEVLFQEIDGLESRGVDCSRLLVSESAHI
FT                   IAPYHRVLDKVTERFLGKHKIGTTGRGIGPAYADKINRVGIRVHDLFNAEHLHDKVEAS
FT                   LHQKNQMLVKLYNRRPIDVDETTDELLKLGERLKPYVANTSLVLNKALDEGKTVLFEGG
FT                   QATMLDVDHGTYPFVTSSNPTAGGACTGTGVGPTKITRVVGVSKAYVTRVGEGPFPTEL
FT                   FGEEGEWLRAQGHEYGVTTGRPRRCGWFDAVVNRYAAQVNGLTDIVLTKLDVLTGLKEI
FT                   PLCVAYDVNGERRDDMPTDQAEFAAAKPIYESMPGWDEDISQVHDFNDLPKTCQDYVKR
FT                   LEELSGCRISVIGTGPQRDHIIQINSLID"
FT   CDS_pept        90933..92660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0068"
FT                   /product="probable voltage gated channel protein"
FT                   /note="COG family: chloride channel protein EriC"
FT                   /note="Orthologue of BL0548"
FT                   /note="PFAM_ID: TrkA"
FT                   /note="PFAM_ID:voltage_CLC"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38849"
FT                   /db_xref="GOA:A0ZZG6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG6"
FT                   /protein_id="BAF38849.1"
FT                   /translation="MTSAGGPVPAGTLRMVRAMACAYDAHRIHTDGVRGGGTEKGSAMT
FT                   AMPPNDRFDRFDRFSKLVPRFDHLKWKMAAAGILVGLISGFLVVLYRLGIEYGTDTARW
FT                   IYARIRETPWLVAPWAVAAITAALAIAWMVKKEPMAGGSGIPQTNGVVICGLKMRWQTI
FT                   LPVRFIGGLLGSLFGLSLGREGPSIQIGASGAQFLSHRLRGKKREDMQEHYLVTAGAAA
FT                   GLSAAFSAPLSGMMFALEGVHRSFSPAILMGATAASLTADFVSKYCFGLRPVLDFGTIG
FT                   QLPLGEYGWLIPLGLVAGLVGSLMNRSLLGFQTLYGKLPAWSRPLIAIALALPIGIWLP
FT                   DVLGGGSNLIAMAEHARVGLGMLCVLFVAKVLFTSTSFGSGAPGGIFMPILAVGSLAGG
FT                   ICGETLHQFGNLPSDSVAIFSVCVMTGTLAASVKTPITSILLAVEMSGTLTHMLPVAAV
FT                   AFIALLVSDLLRTKPIYGELLERYMRAQGGTTAIANRIDNGIMELPVEMGATADGKLMR
FT                   DVRWPYGCLVIGLRRGERQIVPHGDTRLRAGDYLVVLFSGEDESDARHAMRRLCDVSV"
FT   CDS_pept        92801..93943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB2"
FT                   /locus_tag="BAD_0069"
FT                   /product="protein crcB homolog 2"
FT                   /note="COG family: integral membrane protein
FT                   possiblyinvolved in chromosome condensation"
FT                   /note="Orthologue of BL1091"
FT                   /note="PFAM_ID: CRCB"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38850"
FT                   /db_xref="GOA:A0ZZG7"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG7"
FT                   /protein_id="BAF38850.1"
FT                   /translation="MRPARCRMAGAERRCPRKAKYKGNVMESQEQRAADSPNAGDEPNP
FT                   ATQSIDVAEVARADVRPSGAAASKHPPQIPLAPMKRMQARFNPLADGLMYLVVFVGGFV
FT                   GVGFRRATDLLLPSVNGSPFVVGTFVSNMLACFLFAMLTEYMATASWLRRRVRQVVSRG
FT                   VGLGLLGGLSTMSGVMLETMEGMREQRFGSALGYLAGSFAGGLIAAAVGVALMQALLAR
FT                   GTRKRVRNAIADASTASVSSMSDSGDSDAYGIVQDVQMTDTAVSATQSVTQTVPMADSG
FT                   ESDVPAAQNVQNNVPDAQGVRHVKVADAAHSAAQAALEAAQAAQQAAQVAQQVAQTGQV
FT                   PKIESQPQSSQPVAPLPSFEPKPVTAEIPLVADPTTGEVR"
FT   CDS_pept        94436..95905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0070"
FT                   /product="branched-chain amino acid ABC-type transport
FT                   system permease components"
FT                   /note="Orthologue of Tfu_1182"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38851"
FT                   /db_xref="GOA:A0ZZG8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG8"
FT                   /protein_id="BAF38851.1"
FT                   /translation="MKTTREEKPMTAVTYLTRHRRPGIVILCSIVAVLSMLFVLPPAIA
FT                   SAADSGAQAVDECNPTASNGCVNGILQDADKKPIADVTITLSGKATAETKTAADGKWAF
FT                   SVADDGDYTVTIDASVAKEHGLKASSATVTIRKASFDKQRGVVRFDQAGDSTGSGTSGT
FT                   SGSSGSANGTKGATGTSGSTAATQSPVKKGGSNVGKRIWQQLYSGIIFGLMLGLMSVGM
FT                   NLVYGTTGLQSFSHGEQVTLGGLMAYVGTQMLHMPLIASAIFAIVIGALTGFIQNEIVW
FT                   GPLRRRHVGTMQQMIVTIGLSMALQYTFQFFFGGDIKGIVKSVPDSFQLGPITTDMPTL
FT                   VSALIAICVIVGVTLFLYKTRLGRATRAVSDNAALAAASGINVDQVVRVVWILSCAMAA
FT                   LSGVLLGVYLNGISWNTGATLILLMFAAVTLGGLGTANGALIGSLVIGIVADMSSLVIP
FT                   NDMRYASALAILIIVLLVRPQGIFGKQQRVG"
FT   CDS_pept        95909..96892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0071"
FT                   /product="branched-chain amino acid transport system
FT                   permease protein"
FT                   /note="Orthologue of Tfu_1183"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38852"
FT                   /db_xref="GOA:A0ZZG9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZG9"
FT                   /protein_id="BAF38852.1"
FT                   /translation="MDIMTIISNAAGELIAPTTAAYVLAAIGLNIHFGMTGLMNMGQAG
FT                   FMLLGAYGFAITQSMGCNLFASVCAALALAVIYALLLGIPTLKLGPDYLAMVTLAAAEI
FT                   IRIIGRSTAMTNFTGGSAGISPQDFTEKFESLSPLPDGSTTFLLWTYSNNIANSWWLRI
FT                   VAWVLVVIAALLCWRWFHSPWGRMLKGIREDENAIRSLGKPVTRYKMESLILGGLFGAI
FT                   AGIIFVLPRSVQPDSLGRTVTFYVWTILLLGGAATILGPVLGSCVLWVLLTFVKEVMRN
FT                   TVPETLISSNQIEALGWVIVGVALMCLVIFRPQGLLGDRKELAFHA"
FT   CDS_pept        96966..97916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0072"
FT                   /product="branched-chain amino acid transport system
FT                   ATP-binding protein"
FT                   /note="Orthologue of Tfu_1184"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38853"
FT                   /db_xref="GOA:A0ZZH0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZH0"
FT                   /protein_id="BAF38853.1"
FT                   /translation="MQPGVPFQDLTKWATKAPEGETLISTAYRDKVTDDLKFVENKPGV
FT                   HKPDPILVADNVTRKFGGMTAVDVSHFEIERHGITALIGPNGAGKTTFFNLMTGFDTPN
FT                   TGTWQFDGKDMAHVQPEKVARMGMVRTFQLTKVMSRLTVLDNMLLGAPVQPGEGMFRAL
FT                   FPGMWRKQEQANIEKAEALLERFLLIKKKDDYAGALSGGQRKLLEMARALMSDPKLVML
FT                   DEPMAGVNPALKQSLLDHIMALREEGTTVLFVEHDINMVRHIADWVTVMAEGKIVAEGQ
FT                   PKSVMNDPAVIDAYLGAHANVDLGDDSVLEDLKEA"
FT   CDS_pept        97918..98727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivF"
FT                   /locus_tag="BAD_0073"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /note="Orthologue of Tfu_1185"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38854"
FT                   /db_xref="GOA:A0ZZH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZH1"
FT                   /protein_id="BAF38854.1"
FT                   /translation="MSDIASVADEPLTRAQIHMGEPEGEPLLDAVDLVAGYIPGVNILN
FT                   GASLTLHEGEIVGIIGPNGAGKSTLLKSLFGLVHIHSGKLLLKGEDITNLRADKLVSRG
FT                   VGFVPQTENVFPSLTIAENLHMGAFQAPKLFNERFDYVCSIFPKLGQRKNQLAGQLSGG
FT                   ERQMVAMARALMMKPSVLLLDEPSAGLSPMLQDETFIRVRQVNKAGVSVVIVEQNARRC
FT                   LQICDRGYVLDQGRNAYSGKGRDLMNDPKVVSLYLGNLEEEVQEEGR"
FT   CDS_pept        99086..100387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivF"
FT                   /locus_tag="BAD_0074"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="Orthologue of Tfu_1186"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38855"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZH2"
FT                   /protein_id="BAF38855.1"
FT                   /translation="MIQMKKINMKGMRKLSITATAMVAAAVMALAGCGSSNSSSSSSSS
FT                   ASTSGTKTSKFVLGGLWPETGSLAYLAPPELAAEKLAVKDINDAGGVLGNKITTVDADT
FT                   SDADHADQNTSAAQSVLSKNPSFIIGPASSSVVKNTYKSITSQNIPMLSMGATSASFSG
FT                   LSDYFFRTVAPDTVQGAVMGNLIAQDGVQKLAIAVFNDEYGTGLRDTIVKTASAAGVDI
FT                   IYGEKDTFDPTETNFSSIATAIKASNPDATLVIAFDQTKPLLKALASAGVNTKKLYFVD
FT                   GNTSDYSSELDAGLLEGSKGTIPGINPSDDFVKRLESTGVDLKNTTTYGAETYDGIILA
FT                   ALAAQKGGSADGKTIQANMAAVSGSTKGEKCDSYKACVALLKDGKEIQYKGQTSIGAFN
FT                   DAHDPSSASIGVYKYDADNKPVFDHSQEGSVPKA"
FT   CDS_pept        100769..101854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0075"
FT                   /product="LacI-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulators"
FT                   /note="Orthologue of BL0546"
FT                   /note="PFAM_ID: Peripla_BP_like"
FT                   /note="PFAM_ID:lacI"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38856"
FT                   /db_xref="GOA:A0ZZH3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZH3"
FT                   /protein_id="BAF38856.1"
FT                   /translation="MVGMRDVAKEAGVSLSTVSLVVNKTGYVSDDMRARVEAAMKELNY
FT                   VPNELARNLYKNRTNLVGVIVPTIRHPFFATLTAHLQRELAAQGLRTMLCSTADAENGE
FT                   VEYVDMLRRHMMDGIIVCSHTTHPNDYWTSIHRPIVAFDRVLGGGIASIGSDHEQGGRL
FT                   MAHMLVNTGAHHVVMIGGPRDQFFDLAARNGDSPDDFDLHKTTFPTVRYYLALEQELKA
FT                   AGVRYEYVEAGNVEDFQGYKNAVNAVLNSMPVDGVDAVVSSDIGAALCVREAMRRHISI
FT                   PRDLQIIAYDGTYLTDLAGMKMTAVAQNFDKIAQVAVGNIVRAIAKEGDAKADTTSATG
FT                   RKPYEPDVLIPVTLKLGDTTR"
FT   CDS_pept        complement(101915..102868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BAD_0076"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="Catalyzes the formation of 4-aminobenzoate
FT                   andpyruvate from 4-amino-4-deoxychorismate"
FT                   /note="Orthologue of Lxx17640"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38857"
FT                   /db_xref="GOA:A0ZZH4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZH4"
FT                   /protein_id="BAF38857.1"
FT                   /translation="MSSIVLAVGNGKTLFGGSGVAPDADLVRFVDPESPIINAFDLCAL
FT                   RGDGIFEATTVWRGFPVSLENHLKRLANSARLVDMPEPNIPALTRAVQLVIDQYDDPEP
FT                   GPMLRIIVSRGLDPDTGVGKAADRTPTVYIFLDAKGTLHSLEPITMASMTRGYPSDITA
FT                   RAPWLLNGAKTLSYAFNCAVHRECARRGVGDAILFTEDGYTMECPNSSIVARYGDTFVT
FT                   PDPRIGILNGTSQREMFAWALEEGKKAEYRKLPIAELREADSLYMTHGGWSIPISAIDG
FT                   RALAVDAAEIQAINDAIHSGRTHEDALKIGPTGDYE"
FT   CDS_pept        103080..103985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0077"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of jk0403"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38858"
FT                   /db_xref="GOA:A0ZZH5"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZH5"
FT                   /protein_id="BAF38858.1"
FT                   /translation="MNVRFCGIGFRSSSAVRSEKAGRRPTGKVSAMVDGMSDMGTTELG
FT                   AASTPEQARAAFRDGLVRPTCGIAQGYAQANLMILPKEQAFDFLLFAQRNHKPCPLLEV
FT                   MEPGVTAPVTAPGADIRTDVPLYRVWKRGELVAEVPDIREYWRSDLVTFVIGCSFTFEF
FT                   PLMEAGVPVRHITAGRNVPMYDTSIECRSAGAFHSTMVVSMRGIPSTQVADACRISGYY
FT                   PSVHGAPVCVGDPSAIGIDDIMHPDYGDAPVLEPGDVPVFWACGVTPQAAVMASKPEFA
FT                   ITHAPGHMFITSKRDLEYMV"
FT   CDS_pept        104792..106306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spl"
FT                   /locus_tag="BAD_0078"
FT                   /product="sucrose phosphorylase"
FT                   /note="COG family:glycosidases"
FT                   /note="Orthologue of BL0536"
FT                   /note="PFAM_ID: alpha-amylase"
FT                   /note="Sucrose glucosyltransferase Spl"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38859"
FT                   /db_xref="GOA:A0ZZH6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR015325"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="PDB:1R7A"
FT                   /db_xref="PDB:2GDU"
FT                   /db_xref="PDB:2GDV"
FT                   /db_xref="PDB:5C8B"
FT                   /db_xref="PDB:5M9X"
FT                   /db_xref="PDB:5MAN"
FT                   /db_xref="PDB:5MB2"
FT                   /db_xref="PDB:6FME"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZH6"
FT                   /protein_id="BAF38859.1"
FT                   /translation="MKNKVQLITYADRLGDGTIKSMTDILRTRFDGVYDGVHILPFFTP
FT                   FDGADAGFDPIDHTKVDERLGSWDDVAELSKTHNIMVDAIVNHMSWESKQFQDVLAKGE
FT                   ESEYYPMFLTMSSVFPNGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDI
FT                   DTDSDKGWEYLMSIFDQMAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEG
FT                   VKRGLEILIEVHSYYKKQVEIASKVDRVYDFALPPLLLHALSTGHVEPVAHWTDIRPNN
FT                   AVTVLDTHDGIGVIDIGSDQLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASN
FT                   LDLYQVNSTYYSALGCNDQHYIAARAVQFFLPGVPQVYYVGALAGKNDMELLRKTNNGR
FT                   DINRHYYSTAEIDENLKRPVVKALNALAKFRNELDAFDGTFSYTTDDDTSISFTWRGET
FT                   SQATLTFEPKRGLGVDNTTPVAMLEWEDSAGDHRSDDLIANPPVVA"
FT   CDS_pept        106598..108190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0079"
FT                   /product="hypothetical protein"
FT                   /note="COG family: permeases of the major
FT                   facilitatorsuperfamily"
FT                   /note="Orthologue of BL0534"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38860"
FT                   /db_xref="GOA:A0ZZH7"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZH7"
FT                   /protein_id="BAF38860.1"
FT                   /translation="MTEDNQNNEFKPQPLPGQVFIRPGIDDRPDYEKTLTPEAKAAMRR
FT                   LSVQQHPRIPEASNERPETQAARIASEGGAPLTAAAHLDVAVPNLESSFLDLRDPMTAP
FT                   DGTKPTAMQANRLVAGFALGSMLLSAPMAAFNTVLIPQTVSRLSGINRVTDLAMLVIAG
FT                   AIMTFLLNACIAVGSDHSYCRFGRRTPWIASGSVLAAICMAILSACDFLPWAVFFWLAT
FT                   QAAYAMAAIPFAAAFGERVPDKFRDRADSWHGKGLALGQLVGVAVAVALTPHAGGEGWD
FT                   GTTGFAMLVFAGWLVVAAVVTLLILPFEGASSYLPRRDVEKGDFFSQYRPPQNAPKFSV
FT                   AFAARMFAVAATAGIAVYQWYLAPNIVGNTDEAGLFGIAGAGSVVVVMAICTFVGALIA
FT                   ALLLGRVVSLFGDLRIPAVASAVLFMVAALLPLLMDDGFLAVALYALLAGFAYVVFDGA
FT                   SQSLDLAMLPDVRSVGRSLAAYSLANTFGTILGVAACAAVIVATGATVLIFAVATVSML
FT                   LAGLLTLRLKSQQ"
FT   CDS_pept        108669..110018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="shiA"
FT                   /locus_tag="BAD_0080"
FT                   /product="transmembrane transport protein possibly for
FT                   shikimate"
FT                   /note="COG family: permeases of the majorfacilitator
FT                   superfamily"
FT                   /note="Orthologue of BL0532"
FT                   /note="PFAM_ID: sugar_tr"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38861"
FT                   /db_xref="GOA:A0ZZH8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZH8"
FT                   /protein_id="BAF38861.1"
FT                   /translation="MSTVEAAAGKAQAMVRDSVKTVIAASMVGTAIEFYDFYAYGTAAA
FT                   NYFPKVFFGDTTNPTVALLASLLTFAIAFIARPLGSLVFGHFGDRMGRKTTLVVSLLTM
FT                   GIATFLIGCLPTYNQWGVAAVAVLCLCRFVQGIGLGGEWSGAALVATENAPEDKRALYG
FT                   SFPELGAPIGFFLSNGTYFLLETFNDNDAMLAWGWRVPFLLSSILVIVGLVVRVQMEET
FT                   PIFRMAQEQKKVVKSPLTEVFKKSWKEVIQATFLVAVTYTLFYTLATWSLAWGTKTVEQ
FT                   GGGNLGFTNQEYLLMLMIAVCVFAAFIVISCVNADKFGRKRVIIISSCCLIAFALLFPF
FT                   LLDPAVVGQRNFATNLLFLCIGFALMGTAFGPIGAFLPELFDANVRYSGSGIGYNLAAI
FT                   VGAAFVPTIATWLSHHWGVHSVGLYLGVMALCCLIAVLSCKETKNVDFTK"
FT   CDS_pept        110250..111356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC2"
FT                   /locus_tag="BAD_0081"
FT                   /product="Ketol-acid reductoisomerase 2"
FT                   /note="Catalyzes the formation
FT                   of(R)-2_3-dihydroxy-3-methylbutanoate
FT                   from(S)-2-hydroxy-2-methyl-3-oxobutanoate in valine
FT                   andisoleucine biosynthesis"
FT                   /note="Orthologue of BL0531"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38862"
FT                   /db_xref="GOA:A0ZZH9"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZH9"
FT                   /protein_id="BAF38862.1"
FT                   /translation="MFGKSKFRIAKNNKGAPIMAATIWYEKDADLSVFDGKKVAILGYG
FT                   SQGHAHALNLRDSGVDVVVGLRPTSKSVEYAKEQGLEVKPVAEAVAEADVVMILLPDQY
FT                   QAAVYKKDVEPNLKPGAALAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYAAG
FT                   RGVPVVVAVEQDPDGKTWPLCLAYAKALGALRAGAIKTTFTEETETDLFGEQDVLMGGI
FT                   NHLCDMGFDVLTEAGYQPEIAYFEVFHELKMLVDLANEGGLNKARWSCSDTAQYGDYTS
FT                   TVITEETKKRMQYQLKRIQDGSFAKEFMDDQAAGAPKFKKLQEEYSHPHLETVGPKLRA
FT                   MFSWNNQVDADADMAESFNGKIARTQVQ"
FT   CDS_pept        complement(111553..112593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC1"
FT                   /locus_tag="BAD_0082"
FT                   /product="Ketol-acid reductoisomerase 1"
FT                   /note="Catalyzes the formation
FT                   of(R)-2_3-dihydroxy-3-methylbutanoate
FT                   from(S)-2-hydroxy-2-methyl-3-oxobutanoate in valine
FT                   andisoleucine biosynthesis"
FT                   /note="Orthologue of BL0530"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38863"
FT                   /db_xref="GOA:A0ZZI0"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI0"
FT                   /protein_id="BAF38863.1"
FT                   /translation="MAAQIWYENDGDLSVLEGKKVAIIGYGSQGHAHALNLRDSGVDVV
FT                   VGLRPTSKSVEHAKEQGLEVKSVPEAAAEADIIMILAPDQYQRTIWANDIEPNIKPGAA
FT                   VAFAHGFNIHYGYIKPTEDHPVFMVAPKGPGHIVRREYANGRGVPVVVAVEQDPRGDAW
FT                   DITLAYAKALGALRAGAIKTTFTEETETDLFGEQNVLMGGVNKLVEMGFEVLTDAGYQP
FT                   EIAYFEVCHELKMLVDLMNEGGLNKARWSCSDTAQYGDYTNTCIDEHVRERMQYHLKRI
FT                   QDGSFAKEFIDDQDAGAPKFKQLQEEYGNVRIESVGPKLRAMFSWNNGKDDDADMATFT
FT                   GKIARG"
FT   CDS_pept        112996..114870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0083"
FT                   /product="sialic acid-specific 9-O-acetylesterase"
FT                   /note="Cytosolic sialic acid"
FT                   /note="Orthologue of RB10048"
FT                   /note="Sialic-acid O-acetylesterase"
FT                   /note="sialic acid-specific9-O-acetylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38864"
FT                   /db_xref="GOA:A0ZZI1"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR039329"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI1"
FT                   /protein_id="BAF38864.1"
FT                   /translation="MFDEEAEAMVTATGIAPGSEMTAQMEQVEERNVSGVLHIASIFAS
FT                   HMVLQRNKPIAVFGALAADCAGMEVVAEIHDFDGSLIAQEHAYSSQNVVNGFSQWRVML
FT                   PAQPEGGPYTLRIVAGNDAIEFDDVLIGEVWLAGGQSNMELELRNSEHADEALEDCADP
FT                   LLRFYNVPKTGVINRNAENTSSWQESSPENSGVMSAVAYYFARKLRSELDPDLPVGIVD
FT                   CYIGGTSISCWMSEDALNSSDAGRDYLTRYQRAIAGKTQQQFELETSEWQSQMDAWNAA
FT                   VETVRQTNPNATSSELSEQCGTCPWPPPLTPTSQWRPCGPFHAMLERIMPYSLAGFLWY
FT                   QGEEDEQYSGSYRELLGMMIGEWRALWSENLPFLIVQLPQWINGKTAADGNDPMRWPVL
FT                   REAQWDAAQSIDNVYAICTIDCGEYDNIHPLDKRTPGERLANCALRQIYGMDRVPVHGP
FT                   TVLGFRCDPNGRVRLFFRYAHGLHFEGTTPGGGDDDDFDGQLPTLVRVPEHSGFELAGS
FT                   DGMFHPATAAIFVDCDIDDLVNSRVNVVDYNATEFGIPINSRSIGTITLATPDVPEPVA
FT                   MRYAWRSWGPAPLFNDDGLPAQPFRLDLTDHTSPVESAEPVTPDGTAD"
FT   CDS_pept        complement(115008..116537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="BAD_0084"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /note="Orthologue of BL0152"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38865"
FT                   /db_xref="GOA:A0ZZI2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI2"
FT                   /protein_id="BAF38865.1"
FT                   /translation="MSDVTAAKKPRGTDDVPVPPTLRKSLKNRHIQLIALGGAIGTGLF
FT                   YGSSESIQLAGPSILLAYLVGGLAIFMIVRALSEMAVEDPKAGAFSYYATRYWSRRAGF
FT                   ISGWNYWFNYVLVAMVELAVVGSFVNYWFPNIPKWVSAAVFLVAIAALNLMGVNKFGEF
FT                   EFWFAIIKIVAVLAMILGGLYVVIANVPTASGIRASFANWFTVDGGFLPHGLMTRNADG
FT                   TWTGLLMALVVVMFSFGGTELIGITAGETENPRTTIPKATNGIIWRILVFYICALGVIM
FT                   AVIPWSKIDGDSSPFVQIFDSVGVHAAAGILNFVCLTAVMSVYNSGLYANSRMLYSLAK
FT                   QGNAPAYLGKLSKKGVPVGGVITSAIIIAIAVVVVFVWPEFAFNYLMSIATIAAAINWI
FT                   MIMITEIKFRRMVAAGDGPAELKGLKGKEALDKIAFKLPFANVTPYVVIAFMLLVVVLM
FT                   CFSASYRIAVIAGVIWLAVLFAAAQLALGKSGSERGEDAAVIVDAAAATAE"
FT   CDS_pept        116725..119886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0085"
FT                   /product="large transmembrane protein possibly involved in
FT                   transport"
FT                   /note="COG family: ABC-type transport systems_ involved
FT                   inlipoprotein release_ permease components"
FT                   /note="Orthologue of BL0155"
FT                   /note="PFAM_ID: DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38866"
FT                   /db_xref="GOA:A0ZZI3"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI3"
FT                   /protein_id="BAF38866.1"
FT                   /translation="MSGLLNGLFGLEVRFARLLCDSNARFGHVLRMCGLARLSKLHGVQ
FT                   WNEGLRTEVDMAFVKDMLRMWAHSWKRFISIAMITLLGVAVLTGIYAGCRDAFRSTDRF
FT                   FDAQGLHDVQVLSTAGLSNGDIAALRKVNGVAKVQAERSQEVTFDLDGRKSATMQEIGT
FT                   NGIDQPYLQEGRMPKKAGEIAVTRKFIRDSGKRIGSRLTVTPESASSDTSDTNDTNGAD
FT                   GTNETNGTDEAPSFPTKLTIVGVVLDPQNLSNPDGYSAMTSFRSTATTDYTFFAPSDGV
FT                   TGTLYTSATLLVKGAAAESTFDESYENTVKQVTDRIDGTVKTDRQKARRQELLDAGNKK
FT                   IADARAEADKKFADAQSQIDANRQQFNQQVDQIVSMQAGAAAAGAAANGANAGAAAAAG
FT                   ATTPQLDETTRETMRETIIAASPELTQAKQQLDQAQSQLNEQKASTEHTLKTKENELKT
FT                   SIPQVRWYVQDRQSLGGFSALKSDLDSIQSLGNAFPIVFLLVAVMMSLTAMARMVEEDR
FT                   SLIGTYVGLGYGRLAVALRYLLFALLACLIGGGLGLIAGFLGIPAFLLVVLQGMYVMPG
FT                   LRLEYDWLYGSLGIALFVVGVLAATIYACVQEMRQTPASLLRPKAPRAGSRILLERIRP
FT                   VWNRMGFLGKVTARNIFRFKSRLIMTVGGVAGCTALIVCGLAINDTVADLGIKQYRDIY
FT                   QYDLMVVSDDSGASAMRTKVASDGRVTSSLDVRIESGDLTVAGSGDGDSGKAGSSGSES
FT                   IQLVAVPEKHLSDLGEMVTLQPVSSGILGTSGVGKTGSLKLDDDGVIVAQSAASALGVK
FT                   AGSKVRLTNGDGVQATAKVSAVNRNLIGSDVYVSETYYAKLFDSKDAKNTKNSKSSEDS
FT                   EALTWNAMLAKLSGSDTSQTDYAESLEEDSSVMKAVSCAHMADSFKFDLMGAVVALIVA
FT                   LAGGLALVVLFTLANTNVSERVREMATLKVLGFFDREVHHYVNREMMILTVMGVILGLP
FT                   LGRLVGGMLTMALNMPSLYFEVEVKPLSYVIAAVATMAFALLVQLFVNPVLDRIDPISS
FT                   LKSVE"
FT   CDS_pept        complement(119905..121179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0086"
FT                   /product="Na(+)/H(+) antiporter homolog"
FT                   /note="Orthologue of DIP0794"
FT                   /note="Similar putative integral membrane efflux
FT                   protein,Na(+)_H(+)antiporter NapA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38867"
FT                   /db_xref="GOA:A0ZZI4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI4"
FT                   /protein_id="BAF38867.1"
FT                   /translation="MAFLFLLAGYEIDPKRLAGHQGKVGLLTWGITLGLAWLVVTFLPF
FT                   FTKQGINGIATVIALTTTALGTLMPILKERNLEGTPIGDAIISYGTWGELGPILAMAIL
FT                   LSTRTGWQTMLVLGAFLAICLLCAMLPTKALKTGHRLYRFLTENANTSSQTLMRLTTFL
FT                   LIFLVTISALFELDAVLGAFAAGFILRYIIPDGSKSLEMKLEGVGYGFLIPVFFVVSGA
FT                   AINVRAVAGRPALLVAFIVMLMLIRAVPVYLALSLDKRKNPLSSHHRVTVALYCTTALP
FT                   IIVAVTSLAVKVGTMQSDTASTLVAAGAITVFLMPLLGSITYQVADVHPVTAVREIAHT
FT                   PSDWRTIVREHAQVRALLHHQDRLKRMAETLESLEKQEGLNGLDSRRAELVERARLEID
FT                   RQLKELGLNPQLTTQLPHNYRYPKN"
FT   CDS_pept        122116..122919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0087"
FT                   /product="possible sortase-like protein"
FT                   /note="COG family: sortase (surface proteintranspeptidase)"
FT                   /note="Orthologue of BL0498"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38868"
FT                   /db_xref="GOA:A0ZZI5"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI5"
FT                   /protein_id="BAF38868.1"
FT                   /translation="MGARGGSRSDGPQQIKDLRADDFYGDSHDGNDGSRGPHDTTRNTC
FT                   TYTLPTFAEATDASEAMRERRADRNKSIAMRVLAAVLILTALGIGMFPRVLQYRSAREL
FT                   ASTSARSEKRVAGWPYPQADEAFAAAREYNKRLAKSGQPVIGEAKDPLAELYDDPQNAA
FT                   NNASADGSDNSSDSASAKDTEYQSLLDSGDGVMGAIRIPKISVNLPVYHGTSELTLASG
FT                   AGHLYGSSLPVGSTPKPPSASSDSRPAASTRCSAKTKTSAPNSTS"
FT   CDS_pept        123032..124609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aapA"
FT                   /locus_tag="BAD_0088"
FT                   /product="amino acid permease"
FT                   /note="COG family: gamma-aminobutyrate permease andrelated
FT                   permeases"
FT                   /note="Orthologue of BL0156"
FT                   /note="PFAM_ID: aa_permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38869"
FT                   /db_xref="GOA:A0ZZI6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI6"
FT                   /protein_id="BAF38869.1"
FT                   /translation="MTIMTLGNTNTGKAGTNTQAADASDATQNAQSTQSHIKSVESLDK
FT                   DNDMERGLKNRHVQFIAIGGTIGTGLFLGSGKSIALTGPSIIFVYIGVGLIMFLLMRAI
FT                   GEMMYSDPSQHTFINFITRYLGRAWGKFAGWTYWIVLILTGMTEITAVSTYFVTFFGTF
FT                   GIDLNAWKWLIELCFLVALTGINLIAVKVFGEAEFWFSMIKITLIVGLIVTAVVMLFLG
FT                   FSYPATHIEGVDGTVSGATVSLTNIADGFQLAPNGWMNFFMSFQMVFFAYQLIEFVGVT
FT                   VSETQNPRKVLPKAVNELIMRILIFYVGALVAIMAIVPWRNFHQNADGSFGSPFIMVFK
FT                   YAGLDWAAALVFFVVITAAASALNSLIYSAGRHLYQLAQDSESPAMQRLGEVSDRKVPA
FT                   KAIIVSGCMILFSPLINAIPGVSGAFVLFASAASAVVIFIYILTMLAHRRYRQSADFLP
FT                   DGFVMPAWQVCDWIAVAFYVVVYVTLFLSSDTLGSAVAGLVWFVVFGGYCLLHERFQNR
FT                   DLKAALGK"
FT   CDS_pept        complement(124790..125704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BAD_0089"
FT                   /product="thiazole biosynthesis protein thiG"
FT                   /note="Functions in thiamine (vitamine B1) biosynthesis"
FT                   /note="In Bacillus subtilis this enzyme catalyzes the
FT                   formationof thiazole from dehydroxyglycine
FT                   and1-deoxy-D-xylulose-5-phosphate and ThiS-thiocarboxylate"
FT                   /note="Orthologue of BL1055"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38870"
FT                   /db_xref="GOA:A0ZZI7"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI7"
FT                   /protein_id="BAF38870.1"
FT                   /translation="MSTENTITTAAADVAAAPNATLDELVGTTTNTAILPEPDAHAYDE
FT                   IATGDADPLILGGHKFTSRFILGSGRYDLNLIKATIENAGTQIVTMALRRCRTTENNLL
FT                   DYIPKGITMLPNTSGARNAEEAVRIARLAREVCQTDFVKVEIEHEAKYLLPDNEETIKA
FT                   TKQLAKEGFVVMPYMFPDPIAAKRLEDAGAACVMPLGAMIGSNKGLRARDFIEVIIKNS
FT                   NVPVIIDAGIGRPSQAAEAMEMGADAVMAYTAIASAGNIPLMARAFKKAIEAGREAYLS
FT                   GLGKVTEDHAVPSSPTNEADYIG"
FT   CDS_pept        complement(125855..126568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0090"
FT                   /product="thiamine biosynthesis protein ThiF"
FT                   /note="Catalyzes the adenylation of ThiS which is
FT                   involvedin the formation of
FT                   5-methyl-4-(beta-hydroxyethyl)thiazolephosphate"
FT                   /note="Orthologue of CAC2923"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38871"
FT                   /db_xref="GOA:A0ZZI8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI8"
FT                   /protein_id="BAF38871.1"
FT                   /translation="MTFEPSASQAQIDARQHAFDNQPDPATLVSREEIRAALLDRHTAA
FT                   TQDKLDAAHVAICGCGGLGSTIAVALTRIGVGHLHLIDFDRVDMTNLNRQQYFLKDLGQ
FT                   YKTEALRSNLRQINPFTDITIDTVKVTDENVPTLFENEDIICEAFDVPENKTMLVNAVL
FT                   ENLPGKKLVSASGMAGFRSSNLVSTRRVSKNFYFCGDGETAPVPGAGLMAPRVGVVACH
FT                   EANMITRLILGEEDA"
FT   CDS_pept        127216..128274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0091"
FT                   /product="possible oxidoreductase in aldo-keto reductase
FT                   family"
FT                   /note="Orthologue of BL1023"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38872"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI9"
FT                   /protein_id="BAF38872.1"
FT                   /translation="MRIGCVLARKGKMMMNGELAGFTIPRLGMGTMALAIEGRPDRDTA
FT                   IRTIHAGLDAGVRYLDTAWSYYLPSEPGTGTAKDLGYGEKLVRDALASWNGPRDEVLVA
FT                   TKTGYRRTMEIPAFVAPVSDSPESDTQGRDSEGCSRRPGGERQHLQAAGSQYGWMADSR
FT                   PETMIRDAKESALHLGVDTLDLLYSHGPDPEVAYEDQVGALKQLLNEGVIRYAGISRVD
FT                   NAQIDIAREILGDKLIAVQNQFSPSHPDPEHTMEHCAELGLAFVCWSPLGGFLDAFDQR
FT                   AYDPFRTVAGNHGCSYQRVVLAWELSRYERLFTIPSARNPQEINDSFAATELTLTQDEL
FT                   AMLNASVDARRG"
FT   CDS_pept        128458..128949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0092"
FT                   /product="possible MarR-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulators"
FT                   /note="Orthologue of BL0160"
FT                   /note="PFAM_ID:MarR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38873"
FT                   /db_xref="GOA:A0ZZJ0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ0"
FT                   /protein_id="BAF38873.1"
FT                   /translation="MGFEEELFHELATNTWDKRSRMQQEMVKGAKGEPFAVQELYRKGP
FT                   LTPSQLASSMKTTTGRVSALLSALEKKGQITRESDPDDRRVVHVNLTEAGRERAERQRE
FT                   SMREAICWIFSQMGERRAREFVELTEEFTTYMSLCMPGKPRPTADEVKAAFSGNAQEDA
FT                   "
FT   CDS_pept        129076..130827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0093"
FT                   /product="probable permease protein of ABC transporter
FT                   system"
FT                   /note="COG family: ABC-type
FT                   multidrug_protein_lipidtransport system_ ATPase component"
FT                   /note="Orthologue of BL0162"
FT                   /note="PFAM_ID: ABC_membrane"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38874"
FT                   /db_xref="GOA:A0ZZJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ1"
FT                   /protein_id="BAF38874.1"
FT                   /translation="MLRIVRYLSKAEIGQMLVALVSIVGQIWLDLTLPDYMADITQLVE
FT                   TPGSEMHDIWVAGGKMLLVSLGSAACAVVTGFIAARVGASFSQRLRSLEFNKVESFGPA
FT                   EMNRFSTASLITRSTNDITQIQMFITMGLMMIVKAPIMAVWAVCKIAGKGFDWTLATGI
FT                   AVAILLVVIAVLMHFVMPKFKAMQRLTDNINLVARENLTGLRVVRAYNAEDYQEAKFTE
FT                   ANKELTETQLFTNRAMAIMMPLMNTIMNGLMLAVYWIGAYLIDAAEAVDKLTTFSDMVV
FT                   FSSYSIQVIMSFLLLSMVFVLWPRADVSAQRVLEVIDTEPMVTDGTQDAGKPGEEGEIE
FT                   FRNVSFAYPDSRHAMLEGVNFKAKKGQTVAFIGSTGSGKSSLINLVPRFYDATQGEVLV
FT                   DGVNVRDYKLKALRDKIGYVPQQSFLFKGTIASNVAYGDTDRDDDTVRRACDVAQATEF
FT                   IDKKQKKYDSGISQGGSNVSGGQKQRLSIARAVYRHPEILIFDDSFSALDFKTDRAVRD
FT                   ALEKEAKDSTKLIVAQRIGTIMNADRIIVLDDGKVVGQGTHEELLDTCEVYRQIAESQL
FT                   SEDELKR"
FT   CDS_pept        130839..132680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0094"
FT                   /product="probable permease protein of ABC transporter
FT                   system"
FT                   /note="Orthologue of str0434_BL0163"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38875"
FT                   /db_xref="GOA:A0ZZJ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ2"
FT                   /protein_id="BAF38875.1"
FT                   /translation="MPRGMGRGRGAVEKPKDFGGVMKKLVKFCSRYIPVMILALVLGAA
FT                   GTVCQIIGPDKLKDMTNEITKGLPAMVHGKPVMNSIDMDAVSRIAWLLVALYVGYALLS
FT                   YLQSWLMANVTQRTAQQLREAISQKINRLPLKYFDKVSYGDVLSRITNDVDAIGQTLGQ
FT                   SVGSLITSITLFFGALIMMFYNNVTMTLCAIGSALLGLIIMGVIMKVSQKYFTRQQVAL
FT                   GDVNGHVEEMYTGHTVVKAFCGEERSIEQFEKYNNDLYVSGWKSQFLSGLMMPIMNFVG
FT                   NFGYVVVCVVGAALAMDGNIEFGVIVAFMMYIRLFTQPLSQFAQAFQNLQRCAAASERV
FT                   FGFLEEPELSDETGKQALLGVGADGKPQPVRGDVEFSHVRFGYDADKTIINDFSASVKA
FT                   GQKVAIVGPTGAGKTTMVNLLMRFYEISGGTISIDGIDTKSVPRWNVHDQFSMVLQDTW
FT                   VFRGTVRENIAYSKKDVTDEQIVAACKAVGLHHYIMSLPNGYDTVLDDKASLSQGQRQL
FT                   LTIARAMVEDAPILILDEATSSVDTRTEELIQKAMDALTVGRTSFVIAHRLSTIRDADM
FT                   ILVMNGGDIVERGTHEELLAKGGFYADIYNSQFTLAE"
FT   CDS_pept        132851..133831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0095"
FT                   /product="oxidoreductase"
FT                   /note="Orthologue of lp_3100"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38876"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ3"
FT                   /protein_id="BAF38876.1"
FT                   /translation="MKSIEIGKSAVVASQAALGVMRMDALDADAAAEVVRTAAEHGVNF
FT                   FDTADIYGFNVNRDHASSRVLGRAWKDAGLKREDIFLQTKFGINIDFSDPNNVHATRYD
FT                   FSAKHLITRLDEELEALGTDYVDFALLHRPDTLMEAEEIVEAFTTLHKAGKVRHFGVSN
FT                   VNPWQAELLQSWLGDDPAMRLEASQLQFGLMHAQMVSDELMTNSGAEGMVVANHSDGLL
FT                   SYSRLRHMTIQAWSPFQSGTEYGPFVGNEHFPELNKALDEKAAKYGVSANAIATAWVLR
FT                   HPAKIQIVLGSMNPTRLGEMLDGADIDLDKQDWWDLYVAAGNLIP"
FT   CDS_pept        complement(133916..135049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0096"
FT                   /product="hypothetical protein"
FT                   /note="COG family: membrane-associated lipoproteininvolved
FT                   in thiamine biosynthesis"
FT                   /note="Orthologue of BL0164"
FT                   /note="PFAM_ID: ApbE"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38877"
FT                   /db_xref="GOA:A0ZZJ4"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ4"
FT                   /protein_id="BAF38877.1"
FT                   /translation="MPHATYSAYQVAQARTPPSRARASIVGMDSLAPLAHRMPYTAAFP
FT                   KALGTGLLISTPRPITAELRGEMERFIDEYEHALSRFRADSLVAHIGNAKHGGHFDFPD
FT                   WAGPLFDLYDALHAATRGAIDPCVGEDLIRLGYDPALSFTVEADAGERLGALHGRAVWG
FT                   RDVVRSSGTTLVTRSPVHVDFGACGKGYLVDSLGGLLTDSELSRTSHVKSAETTNPTCQ
FT                   SSISDSKRESAAPEFVIDAGGDLLARTNKPIRVALEDPDDPSCAVGVALIGDGAFCASA
FT                   PSRRHWEVAVNEQTHLAIHHLLNAIDGLPVQQTEAAWVAVQSASFGDYPTAVADGLATA
FT                   LFVADPNELRSVFVFDCATLDADRHATISAGFPGRFF"
FT   CDS_pept        135393..137180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0097"
FT                   /product="widely conserved hypothetical membrane protein"
FT                   /note="COG family: high-affinity iron permease"
FT                   /note="Orthologue of BL0455"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38878"
FT                   /db_xref="GOA:A0ZZJ5"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ5"
FT                   /protein_id="BAF38878.1"
FT                   /translation="MSSRVAQRHAAGSYDSCDSRVSASGRLAALVAALMIALATLFAGT
FT                   AMPQQASAADDSQTNFDSWTAAAQNIAKQLATAEKDYNDGDYGQAGTGFQTAHWIGYDA
FT                   SNFSKAVNDTISADKQQALLTQFTDLEGLAYQQGQGGAIAGKIDALNADLTATAQTLDG
FT                   NANLADPKTYAKQRAEQTAAERKKLDAAKKNSSKGKGDRTWGEVASEMNVILDKAYKAA
FT                   ISGKGAEGSSLVNDAYYQYYEKLGFEKNVMNAISGDRVSQVEYQFKMTRKTMRDGSSDK
FT                   EIKKLVDDLKSWLVEDAATLDGGAAGNVNAFTKAITSSAGQAFLILIREGLEALLVVAA
FT                   VVAYLVKSGNRRFTKWIYLGVLAGLAGSGLIAVLFTFLFGGSGPIQEISEGVCALIAML
FT                   MLLWTSNWMLNKSSVEAWNRYIRTKTESAVADAQNKVAAGEGVGLGMVVSLAMLSFLAV
FT                   FREGAETVIFYESIYSMSRDAQGMWIGGIAAGVVLLVIFLVLRFTSVKIPIGPFFLVTS
FT                   ILMAVLVVIFAGGGIHALIEGDLIDGHYLSSVPTNDWIGLYPYVECLAAQAIAAIAVLA
FT                   LFAVGFARKRKLRTPDNRK"
FT   CDS_pept        137242..137901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0098"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted periplasmic_secreted protein"
FT                   /note="Orthologue of BL0454"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38879"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ6"
FT                   /protein_id="BAF38879.1"
FT                   /translation="MKNKKIAALLGILLAGSMAFSLSACGNSSDSAASDKSSASASASK
FT                   ADDSSKDDSSDSAGFEEIQVDEKHSDQECGPLTVNAVYFQPIDMEPSGMGLKAADASFH
FT                   LEADIHANQKGTELGYGKGDFVPDLTVNYDIIDKTSNASVASGTFMQMNASDGPHYGAN
FT                   VKLDKAGAYKLVLKIESPEKKGWMLHVDPETGVKGRFWTEPIEVTFPDWNYTPQEW"
FT   CDS_pept        138168..139439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0099"
FT                   /product="narrowly conserved hypothetical membrane protein"
FT                   /note="Orthologue of BL0453"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38880"
FT                   /db_xref="GOA:A0ZZJ7"
FT                   /db_xref="InterPro:IPR018758"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ7"
FT                   /protein_id="BAF38880.1"
FT                   /translation="MLLQFVTVLQGVLAPALLVMALSVMLTVGEGRDKPLSAYWRLAGF
FT                   VVGFAGAVVFAALRATAVITQRTFVNYPTLWCCVILDVAVFVIVLFACRITADWHNHRA
FT                   LLDIANLVAALAIAATTFRALPDVILRLTIFVEPGDPIFTSDMLLRALGFALGAAVAII
FT                   AALIFRTMRSTAVRWSFTTAVLLLVALLFAQHFTDLAQILQSKRIVSFPTAAFLALVWG
FT                   INHQRSLTIAMALVFAIPAIASIVMGFKVKPTGANEAIARTHIAFRRRAKAAGAFSLVA
FT                   MICVTVALTYGVAQTQKVVTLSPPEDYSLADGVATIKFSQISDGHLHRFEYRAKDGTSM
FT                   RFIIIKKNGGAYGVGLDACDNCGDAGYYEKDGKIICKKCDVAINLATIGFKGGCNPIPF
FT                   DYQVKPGKIVIQTSTLDALSSHFQ"
FT   CDS_pept        139465..140964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0100"
FT                   /product="possible permease protein of ABC transporter
FT                   system"
FT                   /note="COG family: ABC-type transport systems_ involved
FT                   inlipoprotein release_ permease components"
FT                   /note="Orthologue of BL0452"
FT                   /note="PFAM_ID: DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38881"
FT                   /db_xref="GOA:A0ZZJ8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ8"
FT                   /protein_id="BAF38881.1"
FT                   /translation="MFFLKMISRSFSRQFKRRLLIAVTVCLSATVSVAMLGVVFDVGDK
FT                   LNAELSTYGSNIVVQPKSDAVVSDLYNTGDSAGSASGSSSGSDGGSTSDGSAAADSADP
FT                   TAFLKESDAQKIKTIFWAFNITNFAPELNIHADAGCVGSGASSAGSAGTAGASGAAASA
FT                   AKCKATNVPIVGTWFAKTLHMDSGESTVAGMNGMRSWWKINGTWPKDDSEQAMVGSALA
FT                   AKLGVNVGDSVTLDKTIAVGADDNTNGGTGKTGKSSTERNRVKVKIVGIFDSGDSDNSA
FT                   IYMPSIATQTLANLPNSIDKIEVKALTTPDNDLARKASKNPNALTQDEWETWYCTAYPS
FT                   SIAYQIEEVLPGAVAKQVRQVAALQGDVLNKTQAVMVLMTVLLLVAAAIAVANLMAASI
FT                   GERGSELALLKAIGATDGAVSRLMLAETAVISLVGAIAGALLGSGVAQIVGHVVFGSGI
FT                   TMRPMVFVLVFVLLAVTVLVASLSSIRAILGLRPAEVLHGR"
FT   CDS_pept        140995..142299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0101"
FT                   /product="possible permease protein of ABC transporter
FT                   system"
FT                   /note="COG family: ABC-type transport systems_ involved
FT                   inlipoprotein release_ permease components"
FT                   /note="Orthologue of BL0451"
FT                   /note="PFAM_ID: DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38882"
FT                   /db_xref="GOA:A0ZZJ9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZJ9"
FT                   /protein_id="BAF38882.1"
FT                   /translation="MTNRKMFFTMLWGAVFRRRSRAMMAVIASLVGAATLFCLASVCVA
FT                   VPQQMNEEMRAYGANLIVTPASATGKSQGIDTATVRNVTALIGAGHSVKSAAYRYESVR
FT                   INSAPYTIAGVDVKAVRALNRHWNVTGDWPGSGNVMVGRDVADALGVKVGSRVTIGYRA
FT                   ADASASASSSASAKSDSDESTETAESSAQGTQSTQTTQGEQTTQATENGRVSSDIMDNN
FT                   GTEFRIAGIVDTGGNEDSIIYATTADVSKLAGHERGADVVEYSVNAMGDELNAIVNRIN
FT                   KNTNTAVKAQTVTKITSSDTRIIAMLQTLFWIVSLVVLVLTLVGVGTTISSIVSQRRNE
FT                   IGLRKALGADSRAIGVEFYVESGIYGLIGGLLGTAIGYVLARVLCATVFGRAIGFDWLL
FT                   GAGSLLLSVAIAVIASIPPVRRATRIDPTIVLREE"
FT   CDS_pept        142317..143192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0102"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG family: ABC-type transport systems_ involved
FT                   inlipoprotein release_ ATPase components"
FT                   /note="Orthologue of BL0450"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38883"
FT                   /db_xref="GOA:A0ZZK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK0"
FT                   /protein_id="BAF38883.1"
FT                   /translation="MLLELDHISKIYGDLHAVDDLSLTVPQGQWLAIVGSSGSGKTTLM
FT                   NMIGCMDTPSKGSVMLEGRRLEDLNARQLADVRKNMIGLVFQKFYLVPHLTAVENVMVA
FT                   QYYHSVVDEKQAMEALERVGLKERAHHLPGQLSGGEQQRVCIARALINCPKLILADEPT
FT                   GNLDERNEKIVLDLFRQLHEQGTTIIVVTHDALVASCAQREIMLNHGVLVGEQWNDEDA
FT                   KRAYEAAGGKPAHTGSAEEGAQNGGIAILFADPTKAAKTGDTDAANVAVAAGVADDTDV
FT                   EPDVMKGEQA"
FT   CDS_pept        143189..143746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0103"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0449"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38884"
FT                   /db_xref="GOA:A0ZZK1"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK1"
FT                   /protein_id="BAF38884.1"
FT                   /translation="MSTAQSNAVKVIALSAASIALLSACGEPKATPMDDEYAGNSGESV
FT                   QSQENKSKTDGKAADNTAGGDATTKNHADDANSTTSSKQDTGNYADGDYSINGQYGPVG
FT                   EDTIDVQLTVKDQNVTAVNIVGHPFTSISKKHQNDFAKAVPDAVVGKPLKDLKVDKLAG
FT                   ASWTSEAFNKALEVARQEASIQ"
FT   CDS_pept        complement(143811..144488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0104"
FT                   /product="possible TetR-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulator"
FT                   /note="Orthologue of BL0448"
FT                   /note="PFAM_ID:tetR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38885"
FT                   /db_xref="GOA:A0ZZK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK2"
FT                   /protein_id="BAF38885.1"
FT                   /translation="MGGTTQEGTRKTVQKTTQEDVGTVRGRRERLREQTDRKIMKATLG
FT                   IVISDGIGAVTIEEVARRSGVAKTTIYRRYRNADDLLQRIQPEVAGLPNFNDLKPSRSG
FT                   LATMLRRIQNCFDSELGLKAVGVVLSSDNATLKAIAAQVLAPAEERFVGFMERGIADGV
FT                   FQNRLDYTFLFSTVLGSMLACKALAGQEAGGERQSGKERKSDSWAENMATLLWPNVCAE
FT                   SAR"
FT   CDS_pept        complement(144488..146683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0105"
FT                   /product="hypothetical membrane protein with similarity to
FT                   phage infection protein"
FT                   /note="COG family: predicted membrane protein"
FT                   /note="Orthologue of BL0447"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38886"
FT                   /db_xref="GOA:A0ZZK3"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK3"
FT                   /protein_id="BAF38886.1"
FT                   /translation="MKTIWKLFVGDIRRITSNVVSIIIVIGLVVIPGIFTWFNVAASWD
FT                   PFANTGNLKFAVANEDDGYRSDLIPVKINIGDQVVNTLRSNDQLDWTFTTKKEAINGTK
FT                   SGEYYAAVVIPKNFSTRMMTFFASDGDHAEIAYYNNEKKNALAPKITGQGADTVSAQVN
FT                   ETFSETLTSTALSVASQLANQLDKPAAQEQLTQFNGNISDFAETLTDASGTLRTFSTLT
FT                   QSARHLLESSDGLIANVSGNAKSAGTTLKQAGSGVEDLTGALKTGTTALGTALTDSANS
FT                   FTAMEADVDSLFGNAGTQAGNTANALRNQATNISKQAQSYQQIYDSLDALSANEKLPEA
FT                   VRNAIDHLKTNVGTTITQLNDLASALNGSADNIDAKVSDTTAERAEIKKLAQQAATSVS
FT                   GIKTDYESQLKPQLDDIATSITSTTTALNATAADLKGALGNLNGTTKTADKNLTAISSV
FT                   LDSTADSLAGAGKKLGAFTGTLTDALNSGDMSAVKDVLSDNTDSLAAALAAPVKVKRNA
FT                   VFPVKNFGSQMAPFYTILPLWVGSLLMAVTLKTTVSRKVRKELGDPKPHQLFLGHYGVF
FT                   GVIGLLQSTFSLGGSLLFLHVQAVHPLLFMLSGWVSSLVFSFFTYTLVASFGNVGKAIG
FT                   VLFLVMQISGANGAYPLAVLPKIISGISPFLPATHSITAMRAAIGGIYSNDYWFAIGAL
FT                   LLFIPPLLLIGLLLRIPLVKFNHWYVSKLESTKVIAA"
FT   CDS_pept        complement(146680..149508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0106"
FT                   /product="hypothetical membrane protein with similarity to
FT                   phage infection protein"
FT                   /note="COG family: predicted membrane protein"
FT                   /note="Orthologue of BL0446"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38887"
FT                   /db_xref="GOA:A0ZZK4"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK4"
FT                   /protein_id="BAF38887.1"
FT                   /translation="MHNVLQILRRDFKRLVTVPAAWVIMIGLILIPPLYAWFNIYGFWN
FT                   PYGNTDSIKVAVANMDEGTDNALLGKVNLGDQIEGTLKSNDQLGWEFMGKANAMEAVES
FT                   GDCYAAIVIPSDFSEDLANVVTNSKHRPTLEYYVNEKASPISPKITDQGATVVDRTVNN
FT                   TFVSTVSDVLVKAVNSANGTISGNTNAIANETIGELDNTKRNVGTIRSAIADFDTQLAN
FT                   VPQQTKAARNALNDVQLAAASAGRGLAGASTAIGTAQTQLNTLSSNANSALETGSGLVS
FT                   QATAQSTASINQISSAVSAASGSAQQAVTGMQNITDSNAKLLEKLKSASDNAQYQQIIS
FT                   KLENTNNTAAGTLADLKTLSENTQDTAGSVSKLSTDFNIGTQNSLKSAGTARNAINSGA
FT                   LPRLNSALGSLAGTAGTLAGTVTSQDSVVRQTNIVLDQLDQVASDARIGLEQTDQQLAK
FT                   METKLTTVSTDLKALGTTDLLASLTGSGSLDADKIASFMESPTVIDTKNVYPVNSYGSG
FT                   MAPLMTNLALWVGAFAFVVIYKVEVDDEGLEGLDPTATEKYLARYLLLGTMGVIQGAIC
FT                   TVGDLILGVQTACAPLFILTGMITSLVYLSITYALSTTFMHIGKGLCVALVIVQIPGAS
FT                   GLYPIEMMPKFFRMVYPFVPFSYSIDAFRETIAGFYDGHWIKAIGTLLLFAAMAFVIGL
FT                   VVRPLLVNLNRLFAREIKESDMIIGEEVELPERGYNMSQAIQVLADKGGYREVIEERAS
FT                   RFAELYPKLKRGALVIGFVVPVTLAAVFSFTNGEKVVVLATWVVWILLIMGFLMVIEYM
FT                   RDNLNRQVELGHLSDESIQSMLVERQAARIRRKKRAQQERRNRLLRKTRRRTSGKRTTS
FT                   DNRNTSVIKETTENVTGVNHNEDDGIAILVQKMQTTGPSAAANDAATDTTETTETAETT
FT                   ETTENTEERSNA"
FT   CDS_pept        149971..151275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0107"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0445"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38888"
FT                   /db_xref="GOA:A0ZZK5"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK5"
FT                   /protein_id="BAF38888.1"
FT                   /translation="MSETAQSESRSEDSAAGKTDGEIKAIAAETEIAAIEEGGKQGTGE
FT                   VGNPADRRLPLIVRIYGIVMLIEGVVTLPFIVLACLYSIRAVFSGKVAFDALSLTAILS
FT                   VVHAAVLLVVTACLAVFGVMLIMNKRRHIAQWTYLMIPLTLAEGLLSLALQGLGVNLIG
FT                   PAIQLVVLIALHVTADPSLREERRLQFALRRMDARSAYEDAASQGMAGRDLTGKGYISL
FT                   DFFNLFWLFAIGCVFGLVIETIYHFVLFGEYQDRAGFLWGPFSPIYGFGVVIVTVLLNH
FT                   LWQSNWLLIFCSSAVIGGAFEYFTSWFMQAAFGIRAWDYTGQWLSIDGRTSGKYMFFWG
FT                   ILGLIWVKLILPRLLRLIQRIPWKIRYSLTLVCFILIFVDGVMTLMALDAWYSRMAGVA
FT                   QNSPVSQFFATYFNDDFMAHRFQTMKIDPSTAGRM"
FT   tRNA            complement(152267..152339)
FT                   /gene="lysT"
FT                   /locus_tag="BAD_t0006"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:152304..152306,aa:Lys,seq:ttt)"
FT                   /note="codon recognized:TTT"
FT   CDS_pept        152443..153948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepDB"
FT                   /locus_tag="BAD_0108"
FT                   /product="dipeptidase"
FT                   /note="Orthologue of BL0439"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38889"
FT                   /db_xref="GOA:A0ZZK6"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK6"
FT                   /protein_id="BAF38889.1"
FT                   /translation="MSCTTILVGKKASYDGSTIIARDDDSGSGRYDPKKFVVVAPQEQP
FT                   RHYRSVLSHVEIDLPDNPCRYSIVPNVLPNRGILAEAGVNERNVAMSATETIAVNERVL
FT                   GADPLVALQPADEANGKPETPGGIGEEDIITLVLPYVNTAREGVKRLAELLETYGTYES
FT                   NGIIISDVDEIWYVETIGGHHWIARRVPDDKCAIIPNQLGIDYFDFDDAFSDAREFMCS
FT                   ADLQEFIETHYLGRAAGTQGGMNGGHCNPRIVFGTATAKDHIYNTPRAWYMYRYLDPAD
FT                   AENLTPESDDIPWCLEPENAVTVEDVDFLLGSHFEGTPYDPYGTQGTEESRHRYRPIGI
FT                   NRTGHMVAMQIRPYAPVESRSIMWISYGSGAFTTSAPFYANVDDTPAYLRDTTPEVSTD
FT                   CLYWTNRLIATLADAHFYETSNAVEGFSEDVRSFGHRLVERTDDALATAGATDAPSVTA
FT                   RLAAANDEMADYLRKRNTKLLGDVLYTSSNLMHNSFAMSDRWN"
FT   CDS_pept        complement(154092..155123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0109"
FT                   /product="probable glycosyltransferase"
FT                   /note="COG family: glycosyltransferases involved in
FT                   cellwall biogenesis"
FT                   /note="Orthologue of BL0438"
FT                   /note="PFAM_ID: Glycos_transf_2"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38890"
FT                   /db_xref="GOA:A0ZZK7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK7"
FT                   /protein_id="BAF38890.1"
FT                   /translation="MQEKKTLTFVVPAYNMTEYLERCVESLIASKRNDDIEVLIVDDGS
FT                   SDGTLEMAKTFEARNPGIVRAIHQENKGHGGAVNTGIAAASGMYVKVVDADDWVGPESL
FT                   EQVLAVLRDEVGKDDPLDMLVTNYVYDKVGKRNKHVVNFRHAMEPGKRLTWDDLGHFGL
FT                   TEYILMHALVYRTAVVRESKMQLPEHTFYVDFIYAYQPFPWVKSLQYLDTPFYHYFIGR
FT                   DGQSVQTDVMIRRVDQLRLVNQCMVHATPERGTVPDGLYRYMIHFLAIESSVASVFMIL
FT                   SREPENYEKKKAMWADIEAYSPTIYKDVRKKAMSRALNLRGSAGRFVIRKGYFLAEHVV
FT                   GFN"
FT   CDS_pept        complement(155307..156200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0110"
FT                   /product="probable TetR-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulator"
FT                   /note="Orthologue of BL0437"
FT                   /note="PFAM_ID:tetR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38891"
FT                   /db_xref="GOA:A0ZZK8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK8"
FT                   /protein_id="BAF38891.1"
FT                   /translation="MANTSRMTSYQRREQLIEIGRSLFASKGFEAVSVEEIASTAKVSK
FT                   PIVYEHFGGKEGLYAVVVDREMRALTDVLINALSDPQAHPRQIVERTALALLTYVEENA
FT                   EGFRVLTRDSPKTDPSNSFNSLLGDIAVRVEDILTDAFKRQHLPAKSVPYYAQMLIGMT
FT                   VYTCQYWADQRKLSKEQLAAHIVNLAWYGLSRMEAKPELRYESEKAAREAEKQAAREAK
FT                   AIAKQEKQGKKAAKSQEKAVAAGDDATDGTTVTDGSQAVGKSQAADESNESDETNESQN
FT                   PQSPHESQKQSTIDEN"
FT   CDS_pept        156967..158229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BAD_0111"
FT                   /product="FtsY signal recognition particle"
FT                   /note="COG family: signalrecognition particle GTPase"
FT                   /note="Orthologue of BL0436"
FT                   /note="PFAM_ID: SRP54_N"
FT                   /note="PFAM_ID:SRP54"
FT                   /note="docking protein; FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38892"
FT                   /db_xref="GOA:A0ZZK9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZK9"
FT                   /protein_id="BAF38892.1"
FT                   /translation="MDTNVIIAIVAVVVIAAILVIGGWCLGKTRKNAVNKSTEDAKAAA
FT                   DARLAAEAKSAAADPSTVKPSVDSNVDAAEKAPAESQQKSSAQASSSETAAPAPATEAK
FT                   PEPVHETPESAGTRMQRLKARLSKSGNPFGKALFNILAKDQLSEADWEDVEDTLLLADV
FT                   GAEASEQLVEELRNDARIAGQSDPAEVRAALKDKLLKLVGTDTDRRLNANKEGANKPSV
FT                   IIMVGVNGTGKTTTAGKLSRLLVSEGKQVMLGAADTFRAAAADQLETWGAKVGVPVVRS
FT                   DKDGADPASVAFEASAKAKEENADVLIIDTAGRLQNKANLMDELGKIRRVTEKNLPVDE
FT                   VLLVLDATTGQNGMTQAKVFAEAIGITGVVLSKLDGSAKGGIVISVQKELGVPVKLVGL
FT                   GEGPDDLAPFDPEGFVDGILA"
FT   CDS_pept        complement(158316..159506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA1"
FT                   /locus_tag="BAD_0112"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /note="Orthologue of lp_0400"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38893"
FT                   /db_xref="GOA:A0ZZL0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL0"
FT                   /protein_id="BAF38893.1"
FT                   /translation="MATFIISLCAILMLTTVSGLICRKAQLPEVIGQILVGILVGPSLL
FT                   GVMHMSDSLSLFSDLGIIILMFLGGVGCDLQLLKKYSKAAVIIACMGVVFPVAVMGGVS
FT                   LLFGFKPIPAAFIGVVFSATSVSISVAVLKEAGLLDSKEGVSILGAAVADDVIGVILLS
FT                   VMCTLVNTGSVDVAGLGLILLKQVLFFVAAAVVVVWVAPALMTLAGVLKAPSGIAVMAV
FT                   IICLAMAWASNLAGLSYAVGAFFAGIAVSNSDYAEDADRYIEPVGDTLFVPVFFVGIGL
FT                   QTTGVDDTKMIVFIAIMTVLGVITKVVGCGLGGRMAGFGGASALMIGAGMVPRGEMALI
FT                   TAQIGFNEHVLGSEYYSTIIFIISLVTLVAPLLLKLTIRKVPGVGAAAAGTAGAEQ"
FT   CDS_pept        159921..161216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtP"
FT                   /locus_tag="BAD_0113"
FT                   /product="possible ammonium ion transporter"
FT                   /note="COG family: ammonia permeases"
FT                   /note="Orthologue of BL0435"
FT                   /note="PFAM_ID:Ammonium_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38894"
FT                   /db_xref="GOA:A0ZZL1"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL1"
FT                   /protein_id="BAF38894.1"
FT                   /translation="MGQLDSGNAAWILTSASLVFLMTPGVAFFYGGMVRAKAVLNMMIM
FT                   EAAALSVTMIMWVLWGWSIAYAGTSVGGIFGDPATGFLLKDTMVSDKGVFTSAALNGNN
FT                   YPVSVDVAFQSAFAMITVALICGAIAERVKYSTWMIFVALWITFDYAPLAHMVWNGGLL
FT                   SADGAISQAIGAAAHDFAGGTVVHINAAVAALVIVLIIGKRKGFGTQPFRPHNVPFVML
FT                   GAFLLWFGWFGFNAGSAFAANGTAGYAWVSTSAATAAAMLSWGFTEKIRTGHYTAMGAA
FT                   SGIVAGLVAITPAADVVSPLWAIVLGAIAGVLTCLACGLKFKLGYDDSLDVVGVHGVGG
FT                   FTGTVLIGFFGEGTGLFAGGDWRQLVVQIIVALVAIVWSAVITGIIAFALEKTIGWRVT
FT                   EAQEVGGIDLADQGERAYDFAGTASSVLKEVK"
FT   CDS_pept        161218..161556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="BAD_0114"
FT                   /product="nitrogen regulatory protein N-II"
FT                   /note="COG family: nitrogen regulatory protein pII"
FT                   /note="Orthologue of BL0434"
FT                   /note="PFAM_ID: P-II"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38895"
FT                   /db_xref="GOA:A0ZZL2"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL2"
FT                   /protein_id="BAF38895.1"
FT                   /translation="MKLITAIIQPHKLDDVKEALAAAGVHGLTVSEANGYGRQRGHTEV
FT                   YRGAEYTVDLIPKIRIEVLSDDADAETLVGVIVKSAGSGTIGDGKVWVAPLDSVTRVRT
FT                   GETGSAAI"
FT   CDS_pept        161713..163539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="BAD_0115"
FT                   /product="protein-pII uridylyltransferase"
FT                   /note="COG family: UTP"
FT                   /note="Orthologue of BL0433"
FT                   /note="Uridylyl removing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38896"
FT                   /db_xref="GOA:A0ZZL3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL3"
FT                   /protein_id="BAF38896.1"
FT                   /translation="MTSAVDGFKQRFMAMSQPDADGVYRNGAAKRKARTELAMGNLTQL
FT                   WNEACEAVSFDVPATGIGLGAVGSLARGQVGPSSDLDLAVIYEPHALTDQQLNELANKL
FT                   WYPIWDSGLDLDQSVRTVAQCEAVTDRDLPAAMGWLDVVPIAGDTGLIESTAVSILERW
FT                   RKAARKRLPELLGSAKSRLDEFGRMAYINQPDIKEARGGLRDSVLVSALAASWLADRPH
FT                   GTYDDAVERLLDVRDCIHLVAGKDTNMLLSPYQAKVAAMLGLADPTLPDGEREAKSIDD
FT                   LQTLLARVGRQIAFSLDSTASRAEHSLTHDKPRFAFFQVFQPRGGGKRQAPTFDVIAPG
FT                   VAKHEEEIVLAPGAEPAADPNLVLRVAVAAAEFGLPIAPGTLRNLKKCPIGDRNWTDES
FT                   RELFIRLLASGPALLNVWEDIDFIDVPGKLIPEWLGVRNRPSASAAHRYTIDRHMVEVV
FT                   TRLGRETPSGGRYDDRHYEALLLAGILHDIGKRPGVANHAAEGARHATVVVERMGFDRD
FT                   IVRWVTLLVREHLTLSEFATGRNPNDPNVGDDLAGRLDHNPVLLDMLFDLTRADGSSLG
FT                   ATSGETISKQYGWSKWRETLVRTMYNATRYHM"
FT   CDS_pept        163925..165382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BAD_0116"
FT                   /product="replicative DNA helicase"
FT                   /note="COG family: replicative DNA helicase"
FT                   /note="Orthologue of BL0431"
FT                   /note="PFAM_ID: DnaB"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38897"
FT                   /db_xref="GOA:A0ZZL4"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL4"
FT                   /protein_id="BAF38897.1"
FT                   /translation="MAENDSWNNGSAQNRGFSNAGNGANGMNGRSGQAVRDALFDRVPP
FT                   HDDAAEMAVLGGMLMSKDAIGEVSQMIDVSDFYQPRNQTVYEAVIKLFSASQPVDAVLV
FT                   ANELLAEGNLEKVGGSDYLHSLVASVPTAANATYYADIVHQRAILRNVIAAGTKIAQLG
FT                   YTAEGSQAEDVVNLAQAEVYEMSTGKVRQDYAPIGTVIADTLDQLDRLQSGEVSRGVPT
FT                   GFRDIDDVTQGLQPGQMIVVAGRPAMGKSTLGVDFARSAALHHGLTTIIFSLEMSKNEL
FT                   AQRIISAESNIPLAAMRRADDITPERWAILNELQGKLQNAPLFIDDSPNMSLMEIRAKC
FT                   RRLKQTNDLKLVVIDYLQLMTSGKAVESRQQEVSDFSRALKLLAKELEVPVVALSQLNR
FT                   GPEMRQDKKPQLSDLRESGSIEQDADVVFLVHRPDAYDKEDRPGEADIIMAKHRNGPTD
FT                   TFNLAFLGAYSKFKDMPQDYQSQQEAV"
FT   CDS_pept        165384..166967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0117"
FT                   /product="hypothetical protein"
FT                   /note="COG family: UDP-N-acetylmuramyl tripeptidesynthase"
FT                   /note="Orthologue of BL0430"
FT                   /note="PFAM_ID: Mur_ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38898"
FT                   /db_xref="GOA:A0ZZL5"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL5"
FT                   /protein_id="BAF38898.1"
FT                   /translation="MAWNSFATPLIGKAVRAASRLAHGGGSAFPGKIVERIDPQFLSRT
FT                   LAQLPLGVVLVSGTNGKTTTTRMVASMLQSLGLKVFTNPTGSNFTRGVVSSLLAEVSLS
FT                   GKLDADIAVLELDEAYAVHFVKQVPPDYCLLLNVMRDQLDRFGEIDNTARLLSKAAEAT
FT                   TGTVVLNREDPRIARLADVAHTEDGVEVRYFGLDESLRGFFPSDDDMSTTVDAEAHDSA
FT                   EHGGNIGDSGNAGDTADAVAAAAPATSQPQDGPDALPADVTLRAVGDHRATFAIDGETY
FT                   ETAVKLEGVYNLYNAAAALAVVRAVAADAQAMFLPFEDALADSVDADGPDAGTETDGNG
FT                   SHDAIDQAAADEILRAAGVSPRMIAFAHATTQAMIDTAGEVTPAFGRGEVITVNDTPVE
FT                   LLLVKNPMGFRLSLASFKPEGCDTMICINDEYADGRDMSWLWDVDFTSLRGTGVKAVSG
FT                   VRAWDMALRLEYDQVPVESVSTDLEESVVNFVNANSGTPKHIYCTYTAMLKTRAALAKI
FT                   ADVADAGVGK"
FT   CDS_pept        167033..167791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0118"
FT                   /product="possible cobyric acid synthase CobQ"
FT                   /note="COG family: predicted glutamine amidotransferase"
FT                   /note="Orthologue of BL0429"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38899"
FT                   /db_xref="GOA:A0ZZL6"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL6"
FT                   /protein_id="BAF38899.1"
FT                   /translation="MSQVIDIVSLYPKDMNIYGDSGNVLTIQRRLALYGYEPRVHAYNQ
FT                   GCDWPEHVDMILGGGGQDTGQKKIIDDFFQRADLLRSLAADGVPMLMICGLYQLFGEYF
FT                   ETVDGSRLDGIGVIGAYTVGQETRMIGNLTETSADFGKIIGYENHSGQTFLRDGVQPLG
FT                   TVEQDGTGNNGEDHTEGARVHNVIGTYMHGSLLPKNPAIADFLIRTAVERRYGTFDPAA
FT                   AGQTDAQRAALHRIDEIADRARRVAMSRPR"
FT   CDS_pept        167859..168179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0119"
FT                   /product="hypothetical protein"
FT                   /note="COG family: chaperonin GroEL (Hsp60 family)"
FT                   /note="Orthologue of BL0428"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38900"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL7"
FT                   /protein_id="BAF38900.1"
FT                   /translation="MRLTGFARRRCEENAIEWYHHHLKEDIMADFNFGDGLRKVFLAGV
FT                   GALATTVEKSQEIVDDLVKKGELTVEQGKVLNAELKHKVEEAKEAPEAKDAAPAETEDK
FT                   AE"
FT   CDS_pept        168694..170199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0120"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted unusual protein kinase"
FT                   /note="Orthologue of BL0427"
FT                   /note="PFAM_ID: ABC1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38901"
FT                   /db_xref="GOA:A0ZZL8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL8"
FT                   /protein_id="BAF38901.1"
FT                   /translation="MRLMLEALGPTFVKVGQILSMRSEILPQSFCDELSKLRAGADPMP
FT                   YSTVLQVLEDEYGRPVDEIFDHIDPTPLGSASLAQVHRAKLLTGEDVAIKVQRPGVRET
FT                   MAQDVSIMRTIAGIATKTMRSAQVVDLSGVVEELWDTFESETDFLIETRNLAEFKRFCE
FT                   RYKYMDCPKPYPELCTEHVVVMDYVEGISVSHPDELLAAGYDLKEIGTKLVDNYATQVL
FT                   DEGFFHADPHPGNIMVRGGQIVLLDLGMTGRLNAKTRSVLKDMIFAVAEQDSPKLADGL
FT                   LRFAGAEADPEDYPALLADLDVIVKEFGTVDLAELDIAAMLTALTQMAQRHGIEVPSTV
FT                   TTVGRALVTLEGLLDEFIPDVNMIQIISDHIASSTSKKDFAKDETKSLALESHQALHSL
FT                   LAAANELKVASRMLTRGQLRVNMEMVGSQEPIHLLANMVNRLTMALIVVGLFIGSSIVY
FT                   YAGIKPVIFGIPIVGFLGYVIAFILSVWIVFDIYFKGRDSKKR"
FT   CDS_pept        170413..171123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0121"
FT                   /product="putative peptidoglycan bound protein"
FT                   /note="Orthologue of lmo2085"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38902"
FT                   /db_xref="GOA:A0ZZL9"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZL9"
FT                   /protein_id="BAF38902.1"
FT                   /translation="MSTMTSPPGSHGGEDMQAGKSQRSVLALVITCALILGFGIPLIPL
FT                   VGVDSAEGTEVSAASDVATVSAENSLQNGSFEQPDAYQYRETSDVPYWKSTTTSGNIEI
FT                   GSVFKNGNGDNDSLHMRTGEKVAAAEGSQFGKPATSNGNDQYAELNSNQASSLYQVVNT
FT                   VPESKYDWGLYHRGRQGKDAMALVVGPKQNVAPMKTSATSNDQLPVQNRERDQGLAIRR
FT                   DHPGHPHLRPADHR"
FT   CDS_pept        171257..172141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0122"
FT                   /product="sortase"
FT                   /note="Orthologue of M6_Spy0161"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38903"
FT                   /db_xref="GOA:A0ZZM0"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM0"
FT                   /protein_id="BAF38903.1"
FT                   /translation="MNRKTVQSIAIIAIFITGALLLFYPLVGNWWNERRYDMLVSGYTQ
FT                   RVQVNPSGEDYAEFKRIDAYNATVPGKGVPDAFAVTTPEEDAEYASFLNEDPNGVMAYI
FT                   NIPRLKSTLPICHYTTPESLQKGVGHLRGSALPVGGKNTHAVLSAHRGLPTSRLFTDLD
FT                   KVRKGDHFYITVLNRTLAYEVDRISVVKPDQTKELSVQPGKNLVTLVTCTPYGVNTQRL
FT                   LVRGHRVPYNAAQAKHEAADSAVSSFTVYGFVATYGTLAIALAGIAVLRRNAAARTSHH
FT                   AADWPHSLTVSVR"
FT   CDS_pept        172645..173715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0123"
FT                   /product="possible phosphodiesterase"
FT                   /note="COG family: glycerophosphoryl
FT                   diesterphosphodiesterase"
FT                   /note="Orthologue of BL1252"
FT                   /note="PFAM_ID: GDPD"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38904"
FT                   /db_xref="GOA:A0ZZM1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM1"
FT                   /protein_id="BAF38904.1"
FT                   /translation="MPMSKSFLKKALLGGAVAAGAAVWAIAPRSFSDKRRNYVPAVPDV
FT                   WYAHRGLHDAGSGLTAQYANESGEYVALARRMAMKAGYGSPDTPGVIAPENSLAAFAAA
FT                   CEAGYGIELDLQMTRDGEVVVVHDGDLMRVAGDPRRIADLTYDELTRIPLFPTDAPGAC
FT                   KAAPLPLALEEPPLVTTPDNAPEGYYQHVPLFADVLKVVAGRVPLIVEYKFDDNSKWDP
FT                   RDVELMEKGDALLQAYSGKYVIESFNPAAVNWYKENRPEVCRGQLSWWPYGEDKPTDPV
FT                   ALGKEYAAGALLSDWISRPDFVAYDWKGGNSPQVKLARFMGAVPVSWTVRSRDEYAQCC
FT                   DQFDRHIFEAFVPDEQ"
FT   CDS_pept        complement(173876..174517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="BAD_0124"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /note="Catalyzes the formation of uracil
FT                   and5-phospho-alpha-D-ribosy 1-diphosphate from UMP
FT                   anddiphosphate"
FT                   /note="Orthologue of BL1254"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38905"
FT                   /db_xref="GOA:A0ZZM2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZM2"
FT                   /protein_id="BAF38905.1"
FT                   /translation="MDIHVLNHPLVDHKLTVLRDKNTPSSTFRELVSELVMLEAYEATR
FT                   DIEVVDKPIETPVAPMIGKHIAAPAPIIVPVLRAGLGMLDGMTKMIPSAEVGFLGMKRD
FT                   EENPTQQITYANRLPEDLTGRQCFLIDPMLATGGTLVAATHYLAERGAKDITAVCILGA
FT                   PEGLKFVEENLDPSIKFKLVLCAVDEKLNDKCYIVPGLGDAGDRLYGVID"
FT   CDS_pept        complement(174872..175648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0125"
FT                   /product="hypothetical protein"
FT                   /note="Identified by sequence similarity"
FT                   /note="Orthologue of Lxx18480"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38906"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM3"
FT                   /protein_id="BAF38906.1"
FT                   /translation="MHYGSGSVVPSRSAGFTNTGSPRPARPGQLDQMMADNIAGDADPA
FT                   EINEMCHASAAALLDRVHHTQDAELVERVLTLVDREGVDVIAELWSHADPDSLPGILWR
FT                   LYLLRTWMRKNRESIARLWRVGEPVATTASAIAGVDQAPTENDIARTADSILAGAFTGD
FT                   FAVALERAAAFTDVVALGLRIEARKLASLSGSSEAGSSDVSDGSATSAAAGSRPSAVEK
FT                   RARAKAAKLMHTAGNLFATAKDFRHGANLWRRGRLE"
FT   CDS_pept        complement(175650..176738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT1"
FT                   /locus_tag="BAD_0126"
FT                   /product="probable MutT1 protein"
FT                   /note="COG family: NTP pyrophosphohydrolasesincluding
FT                   oxidative damage repair enzymes"
FT                   /note="Orthologue of BL1258"
FT                   /note="PFAM_ID: NUDIX"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38907"
FT                   /db_xref="GOA:A0ZZM4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="PDB:3FJY"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM4"
FT                   /protein_id="BAF38907.1"
FT                   /translation="MSEKMRRIVEAAGGIVWRWKAGSDIANDPAIASSKSAQEQLDSIE
FT                   VCIVHRPKYDDWSWPKGKLEQNETHRHAAVREIGEETGSPVKLGPYLCEVEYPLSEEGK
FT                   KTRHSHDCTADTKHTLYWMAQPISADDAEHLLDAFGPVHRADVGEINDIVWVSVREARK
FT                   ILSHSTDKDTLAVFVDRVQEGAATAQNLLIVRHAKAESRKSWKGTDANRPITPKGAAMA
FT                   FALNRELACFNPTRLATSPWLRCQETLQVLSWQTERPMEHINTLTEDAFAEHPAVSWLA
FT                   FREQITQTLNSRETTAICMHRPVIGGMYDHLRGLCARKQLAKQLIAKSPYMPTGTAMSL
FT                   FIIDTPQGPSIIDIQKVSPIVY"
FT   CDS_pept        complement(176846..179080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="BAD_0127"
FT                   /product="polyphosphate kinase"
FT                   /note="Catalyzes the reversible transfer of the
FT                   terminalphosphate of ATP to form a long chain
FT                   polyphosphate"
FT                   /note="Orthologue of Rv2984_BL1259"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38908"
FT                   /db_xref="GOA:A0ZZM5"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM5"
FT                   /protein_id="BAF38908.1"
FT                   /translation="MAQIFDAPSKAILRSQIAEHIAETDKNDKRELQAGEEPLPNDRFF
FT                   DRELSWLKFNKRVLELAQDEDLPVIERASFAAIFANNLDEFFMVRVAGLKRRIDTGIAV
FT                   TAASGLSPRQQLRAISEQAHRLQDEHAHYIIDHILPDLAKEQIVLLSWDKLTAAEQERL
FT                   SRYYRQQVFPVLTPLAVDPAHPFPYISGGSLNLAVLVENPASGKSHFARVKVPDNLNRL
FT                   VPVDDLTEDENTNVRYGFITMENLIIAHLESLFPGMIIKEARSFRVTRNEDIDVEEDDA
FT                   ENLLNAMEKELLRRRFGPPIRLEISDETSPFLSQLLADQLRVSADEVYRLPAPLDATVL
FT                   FELGGIDRPDLKYRPFIPTTNRQIAEVESSRAQDIFAAIRERDILLHHPYDSFSTSVQA
FT                   FLAQAAADPKVLAIKQTLYRTSSNSPIIDALIDAAHAGKQVLALVEIKARFDEDANIAW
FT                   ARKLERAGVHVVYGIVGLKTHCKLSLVVRQEADGLRRYCHVGTGNYNPKTARIYTDLGL
FT                   LTCDPVVGQDMTRLFNQLSGYAPKSSFHRLLVAPRTVRSGLIQRIRREEDAARAGKEAW
FT                   IKIKVNSIVDEKTIDALYRASQAGVKIDIVERGICALKPGVPGLSENIRVRSILGRFLE
FT                   HSRIYAFANSDGPQIGEGPAAGPEVWIGSADLMHRNLDRRVEALVRIVAPEQIDELIKY
FT                   VDLQMADSTASWHMQADGTYVRHCKDEEGRPLVDSQEYLIKKHTRRPVRH"
FT   CDS_pept        179939..180763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0128"
FT                   /product="hypothetical protein"
FT                   /note="COG family: septum formation
FT                   inhibitor-activatingATPase"
FT                   /note="Orthologue of BL0509"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38909"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM6"
FT                   /protein_id="BAF38909.1"
FT                   /translation="MGSPLESSSTRLKPVEAQPEPAPRNVVVVGSAVAGVGASTLAALL
FT                   ARELTERGCKSVLVDADLNGGGLDVLLGVEDEDGSRFGDISAPLGKVDGKALLRELPVW
FT                   DGVPLLACNPWRSENPQSWEIQACIRALAQVKDAVIVDAGQWRGLDDIPELAQATHITV
FT                   VEMTVLGLARAKVAMQSRGTAERQKHGHIVGVEPRGVARGRGVTTLEETENYLGHSLAA
FT                   VVKPDAKLCGELLDGLGLRRPNRQTVKALAALTDELQESLEGKRVKHGTRTP"
FT   CDS_pept        180744..181736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0129"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted ATPases involved in pili
FT                   andflagella biosynthesis_ VirB11 family"
FT                   /note="Orthologue of BL0508"
FT                   /note="PFAM_ID: GSPII_E"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38910"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM7"
FT                   /protein_id="BAF38910.1"
FT                   /translation="MELGPLSAIASQPGVTDIAVTCDGTVWADCGQGMQEVCLLRRCFP
FT                   SAQSIREFAARLCSQLGRRLDDACPIADASTVDGLRVHAVIAPLVPQGAAISIRLPDAV
FT                   SPNLESLARNGMFPAEWLPLLAGLVSRKASVLVTGGTGAGKTTMLKAMLMRCPPNERIV
FT                   TVEEVRELGMIQHANHVSLVTREANTEGAGGIGLSELICATLRMRPDRVVVGECRGGEV
FT                   VDLLRALNSGHRGGMTTLHANQVEAVPARLVSLGLLAGLEPRATAALAEDAFDVVLHVE
FT                   RIAGRRRIAQVGRLEAVEGRLHGRLLAAWDGRTVRAGQRWDGFMSRWSA"
FT   CDS_pept        181736..182506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0130"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0507"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38911"
FT                   /db_xref="GOA:A0ZZM8"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM8"
FT                   /protein_id="BAF38911.1"
FT                   /translation="MRDACGWEYCAAWLASMAVWLWLNRNVEWAGLRRLQRVLVRFGLR
FT                   SADDSGGADGDGTCDDESDGHGRTVRNDGENRDASPRMPTIGAAACVAALRASVRSGAT
FT                   LVQAFEELQGAPFAVPELTRFRIDMAVRSRCSLQEQHKHVDQLGAELHAACTLSLQLGC
FT                   EMSRCLEAVAASLKRRRLLDDLRANAFAMPQATVKLLMALPLLTVMLGECMGAHPLRFL
FT                   VEDVKGWMCLGFAGCCYAVGWYWIRRLMRQEHVR"
FT   CDS_pept        182503..183018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0131"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0506"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38912"
FT                   /db_xref="GOA:A0ZZM9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZM9"
FT                   /protein_id="BAF38912.1"
FT                   /translation="MSLAWPMLAAVGAAGATWLYEWSPARNPPDSDVRSCNLPLPLILE
FT                   MLSVAIRQGASIPRALITVGNIVEGEFGGGLRSAGERLNSGMPWNEAWPDDDDCAVVRD
FT                   AFSSSWSSGSSPVNRLATAIEQLDWDERSRIEQSAAKLSIRLLLPTGLCMLPAFVAIGV
FT                   IPAVMSFL"
FT   CDS_pept        183285..183572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0132"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0505"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38913"
FT                   /db_xref="GOA:A0ZZN0"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN0"
FT                   /protein_id="BAF38913.1"
FT                   /translation="MNDAMSINVDGSPGLMGRVGQKLCAAKERANKAVCLLDARMRLLT
FT                   AEPEKGAVTAEYAVVLVAATAFAAVLIAIVKSDVVKTLLTGLIKKALSVG"
FT   CDS_pept        183575..183940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0133"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0504"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38914"
FT                   /db_xref="GOA:A0ZZN1"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN1"
FT                   /protein_id="BAF38914.1"
FT                   /translation="MLARWWRRHARDADCGTVTAEFAVVLPCVAAVAILVLCLGRASIV
FT                   SMNCQDAAAAGARAMAIDAGGEAKARAAAQTIAGGGSTVSFAANANSVTVVVRCPVAAD
FT                   PTGVLPASVVGKATRYF"
FT   CDS_pept        183993..184412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0134"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0503"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38915"
FT                   /db_xref="GOA:A0ZZN2"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN2"
FT                   /protein_id="BAF38915.1"
FT                   /translation="MRGKKGTTSVKHDVKQYVRRVLHVLKGADEGSGTISGVALIAIVA
FT                   AMLGAVAMAGNLLLCVHRAQNTADLASVAAAQSLRDGAADPCAAASRTTSGNGTRLESC
FT                   AIEGEDAVVAVQAATQVPFAPWVVRQSRAGPIACD"
FT   CDS_pept        184435..185625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0135"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Acr"
FT                   /note="Orthologue of BL0502"
FT                   /note="PFAM_ID: DAGKc"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38916"
FT                   /db_xref="GOA:A0ZZN3"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN3"
FT                   /protein_id="BAF38916.1"
FT                   /translation="MTTRNVQLKVMGNLALDVKHGYRTSMSKTSHANTTVAVVCNPTSN
FT                   KGKGAQVGGHVIDLLRGAGRKHGFDVIDVTGTSFDDSLANARRRGDEYDYLVAVGGDGM
FT                   VALGANAVGCSGKPLGIVAIGSGNDFARGLDLPVNRVETAVEGIVGAIVRGTHIDVDMG
FT                   LVTSLPDGHAIDSTDGTDVSQSRSPIDRYYAGMLSCGLDASINDRANHSHLPNGSLRYF
FT                   AAVIVELTHMKSYGYHIKATLADGSVEERDIISPLLTVANSRHIGGGIEVSPYSRFADG
FT                   LLDLVWLDHVPNFRECVDAVARAYHGRLLGSHAFGWKRVRDIEITRATEGDEPSVLMAD
FT                   GEYVGHLPVKVLAKDSALRVLVPPAVAEAQAADSEERVLETIKRDGRDPLTGRFLA"
FT   CDS_pept        complement(185729..186367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0136"
FT                   /product="possible TetR-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulator"
FT                   /note="Orthologue of BL0501"
FT                   /note="PFAM_ID:tetR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38917"
FT                   /db_xref="GOA:A0ZZN4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN4"
FT                   /protein_id="BAF38917.1"
FT                   /translation="MPHKALPRDWEERAMTGKPEASTSTIGDARRLQIVQAAREICLEK
FT                   GFSKITISDIAERVGMTRSLFYHYFQDKDQVADAVLDDVISEVIARLEEWNEHREAGNI
FT                   SKALDDVVRLTRSLIADEGPFSQRLIEDGNAALYLRFIDRAADRISEYLCGSTVREFEE
FT                   KHGMPIRNEHETFYTLIVGLISLIRLHPDIDDDIVRQVAAQTLHLDEYL"
FT   CDS_pept        186591..189035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BAD_0137"
FT                   /product="DNA polymerase III subunit gamma_tau"
FT                   /note="Orthologue of BL0500"
FT                   /note="Plays a role in assembling DnaB onto the
FT                   primertemplate and interacts with the core polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38918"
FT                   /db_xref="GOA:A0ZZN5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN5"
FT                   /protein_id="BAF38918.1"
FT                   /translation="MALALYRRYRPDTFDGVIGQDQVTVPLMRALDENKLTHAYLFSGP
FT                   RGCGKTSSARILARCVNCAKGPTSHPCGECASCRDLATGGPGSIDVVEIDAASHNGVDD
FT                   ARELRERAGFAPARDRYKIFILDEAHMVTPQGFNALLKIVEEPPEHVMFIFATTEPDKV
FT                   IGTIRSRTHHYPFRLVPQEVMGPYLEQICADEHIEAEAGVLRLAMRAGGGSVRDTLSVL
FT                   DQLMVGAVDGKIPYDSAVALLGFTPDALIGEAIDAVADKNGEALYGVIQKVVVGGFDPR
FT                   RFVEDLLARVRDLLVLTLGGERAESVLSDDTATENMDDLHRQAASLGLAALTQMADTIN
FT                   ATLANMTGAISPRMRLELLAARLLAGRETGVVAQAAAPSSGMPEAGHAGGAAASESQRP
FT                   SGSRRYAAQSARGRHAVEPSAAPTNPADAVVSGAASVLAEVQQAMGGPLSEGSEPAASA
FT                   ESKPVETQSAPSKLSNAEPSAPTQSVTQSAPQPAATDDRTPDQKWDAIVAGLPEDVRRY
FT                   VDREKVPRVLLDGVKGRLWIKFDKSLSKYAFAKAVAKEAVDGTTNVVQIVRGEVHKVFG
FT                   PDVTLAPAKKLADGSTAVPWSKLSPEEQSKINAQLVQEQLKAATLLTANLGKEVAKEPE
FT                   DDDPWNTPIPQTPIAEGNANDVQPPEHHVKHVDVPDVSDDVDPWATPLPTPQTDDREQG
FT                   QPNGPEQPRQNQPEQHSERHSARQSAREMQSQQAQQPASSPAGFADDPWGAPMPVQAGP
FT                   PEPEVAPEDDEYSMSDESIGASNALDMNDLNRVFEVKKVEEFSSDDPHNPRNMQVKKTL
FT                   DD"
FT   CDS_pept        189152..189754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BAD_0138"
FT                   /product="recombination protein recR"
FT                   /note="COG family: recombinational DNA repair protein"
FT                   /note="Orthologue of BL0499"
FT                   /note="PFAM_ID: RecR"
FT                   /note="PFAM_ID: Toprim"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38919"
FT                   /db_xref="GOA:A0ZZN6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZN6"
FT                   /protein_id="BAF38919.1"
FT                   /translation="MALAYDGAIQRLIDAFANLPGIGPKGAQRIAFYLLNAPDEESQAL
FT                   IDAITEVKEKVRFCDICGNVCETSPCPVCADPRRDHSVICVVEEPKDVMSIERTREYRG
FT                   MYHVLGGVINPMANVQPSDLNIAKLIERLKDSEVKEVILALNPNVEGEATTSFLSQLLS
FT                   QTDIKVTRLASGLPVGGDLEYADEITLGRALAGRRAV"
FT   CDS_pept        189874..190635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="askA"
FT                   /locus_tag="BAD_0139"
FT                   /product="aspartokinase"
FT                   /note="Aspartokinase alpha subunit; AskA"
FT                   /note="COG family:aspartokinases"
FT                   /note="Orthologue of BL0494"
FT                   /note="PFAM_ID: aakinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38920"
FT                   /db_xref="GOA:A0ZZN7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN7"
FT                   /protein_id="BAF38920.1"
FT                   /translation="MALIVQKFGGSSVADPESIKRVARRIIETKNAGNDVAVVVSAMGD
FT                   TTDDLIDQALSIDSNPPAREMDMLMTAGERISMSLLAMAIHAAGSHAYSFTGSQAGFMT
FT                   DAQFGTAHIKAVKPDRVRRALDKGSVAIVAGFQGVNEGGDATTLGRGGSDTSAVALAVA
FT                   LDADICEIYTDVDGVFTADPRIVPTARRIPVIDYESMLEMSSCGSKVLALRCVEYAQRF
FT                   GMPLHVRSSFSHRRGTLIVPEGVDPRTLPNI"
FT   CDS_pept        190752..191294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="askB"
FT                   /locus_tag="BAD_0140"
FT                   /product="aspartokinase"
FT                   /note="Aspartokinase beta subunit; AskB"
FT                   /note="COG family:aspartokinases"
FT                   /note="Orthologue of BL0493"
FT                   /note="PFAM_ID: ACT"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38921"
FT                   /db_xref="GOA:A0ZZN8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN8"
FT                   /protein_id="BAF38921.1"
FT                   /translation="MGDLFPDLGPEVPIISGVAHDSTESLATVRRVPNEPGMAAKVFTM
FT                   LAEAGVNVDMIVQASASTGTADISFTVPGTAAAKVQEVLQEKQGELGFQSFDVDPNVGK
FT                   VAVVGVGMKTHSGLAAKFFNALSDKGVNVLMISTSEIRIAALVPLEQLNDAVKALHTAY
FT                   GLDADQVEAVVYGGTGR"
FT   CDS_pept        complement(191510..192604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="BAD_0141"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /note="Catalyzes the formation of aspartate
FT                   semialdehydefrom aspartyl phosphate"
FT                   /note="Orthologue of BL0492"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38922"
FT                   /db_xref="GOA:A0ZZN9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZN9"
FT                   /protein_id="BAF38922.1"
FT                   /translation="MSEKIKVGILGATGMVGQRFVTLLENHPWFELVTLAASAHSAGKT
FT                   YEEAIGSRWKMETPMPEFVKHMVVKNVADVEDVVKDVDFVFSAVNMPKDEIRAIEEEYA
FT                   KTETPVVSNNSAHRWTPDVPMVVPEINPEHYEVIEHQKKRLGTTHGFIAVKPNCSIQAY
FT                   TPALAAWKEFEPHEVIVSTYQAISGAGKTFKDWPEMVGNIIPFISGEEAKSEKEPLKVF
FT                   GHVDEAKGEIVPFDGPLRITSQCIRVPVLNGHTATVFINFGKNPTKDELIDRLVNYTSK
FT                   AAELGLPHAPKHFIQYLTEDDRPQVLKDVDYEGGMGVSIGRLREDSIFDWKFVGLAHNT
FT                   LRGAAGGALESAEMLKALGYITKK"
FT   CDS_pept        192793..193434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0142"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0491"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38923"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP0"
FT                   /protein_id="BAF38923.1"
FT                   /translation="MVDMSKASEEAQKQLDRIVALGYPDVADMSAAAFRSLARPLIRAL
FT                   EDCDGSADLGTQILLVPTRELVTPESLIARTSINRMAGFTTMPPRDIASFLPQDGFEPP
FT                   EGPFYLVIEPHTGTCYINREPDVARKLIDSDERLPLTLEEGLAIATQHPEWLLEKNGFN
FT                   LLGSRSADGRVPSIWMSQNAPRLGAVWPNSRHTWLGNAYCMARRGVSLFR"
FT   CDS_pept        193503..196046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="BAD_0143"
FT                   /product="serine_threonine protein kinase"
FT                   /note="COG family: serine_threonine protein kinases"
FT                   /note="Orthologue of HTA426"
FT                   /note="PFAM_ID: pkinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38924"
FT                   /db_xref="GOA:A0ZZP1"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP1"
FT                   /protein_id="BAF38924.1"
FT                   /translation="MFCTQCGSKNAPESKFCTNCGNPLVSVPVQPDAGQARISDDFSVD
FT                   STVAETPASQLAPQSAEQPEEQSAAQHEERPAEQLASQPADAIPPVPLPGGGTLPVAQS
FT                   ATSAASQSVPSVSETPEPKSDGTVRDASPNRKLIIGIAVAAMLLVAAVVAGIVTYNMEL
FT                   WGGKSLPDVAVASPKDSSKTPDAKVVVRQLEGKGLKVKRVKEFSGVKSGKFLGYQGIQS
FT                   GDRVRAGSVVTVRESAGPGVPEGTVGKKAESVVTTFSQMGVPVHYKQVIVSDTSKTTEG
FT                   SVISTYPAQGQGVKDDKKGIYIGVATKSDGGLPSDIVGQEISDVKSSLESKGYDVKVEK
FT                   RLSSKQYIGKVSGSEPGPGSQLNEGQTITLYQGVDAKGAKQTFIDHSGTGGDGLLMGTS
FT                   DVASGQWCNKAGDCITLGQDDSYSSGDIVFLKVKDGAANTKYSMTGESLISCDAVQQPY
FT                   CSSKKADYLLTGNSGAFELFPHKAFETYWCGDSALGGEGDMRSCVAGKVHDIDSDSSDA
FT                   SDYEPDGSGKFHMMDLFAVFPVGSDVESVEKIGYFDASALAAAQKQKPVDTDRPFLMYR
FT                   DVNQYKNGEKESTYTRDWFDPFMPYNGYNGSKDDTVKMKPAPSDETAYYLVEDVQPDWD
FT                   SLEDANIKGVSAKSQKSNGKNASRNADTKKSDSQSDAATRSLMKSIAGKYGFASGSGGW
FT                   STTMTVASDGTFSGTYHDSDMGITGDDYPNGSVTISNFKGRFKDAKKNADGSYTMQCDK
FT                   SALKIDGNIGDTYIKNGSKYTVADPYGIAPCGAFTVYPAGYDSSQLSEAIVGWSHAWYD
FT                   SMPAKLETPIIVNAEDTNLGSESQQDAFFQSKYLE"
FT   CDS_pept        complement(196123..197646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0144"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0490"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38925"
FT                   /db_xref="GOA:A0ZZP2"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP2"
FT                   /protein_id="BAF38925.1"
FT                   /translation="MSLRFNSDGTFRVLQMADIQDGPDVREDTIRLIEGAIRKAHPDLI
FT                   VLTGDQIRGYDPAYIDTFLRRRGEQPGTHVRAVTEIEAKIRGIKRHPIAKTLTKSQPSD
FT                   ERWMIDGIGTDSPKLVKSAGRNGSASKLESWAEAINRATAASLLDETRQKVRDTFAAFL
FT                   GPALESRIPFAATYGNHDFQCGILADEQDDLYREFAGCMNPVAGSSPLALEPGTFALPI
FT                   EASDGSGRITMSVMMVNSGDYADTADAGDGNGRQSVTEYAKYAANSRGWDLADSDGYGT
FT                   PSPEAVEWLKRVQRELGRRNGDGQAVPAIAFQHIPPQEFYDCLREVPAYTPNAVEGARE
FT                   FAGHCYVLDRDVCRPGSRLGEAIGCADVNVGEVDALREAGGYFALFCGHDHKNSFVGHV
FT                   HDIDLGYAPTCGFECYGPKSRFRGIRLFEFREDNPMAYVTRMLTWGDLVGRYSSNELRV
FT                   FFEDHCVTDLIGVRNELRRPQVSATLLGAGAVTCGAIGYAVRGLLRKSQ"
FT   CDS_pept        197848..199758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0145"
FT                   /product="possible TetR-type transcriptional regulator"
FT                   /note="Orthologue of Rv3710_BL0448"
FT                   /note="leuA_alpha-isopropylmalate synthase (EC 4.1.3.12)"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38926"
FT                   /db_xref="GOA:A0ZZP3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP3"
FT                   /protein_id="BAF38926.1"
FT                   /translation="MGQDQSSVFDLAAVAAASNGGNNDPLLPPARYIGAPQKPSKMPYN
FT                   KYVAYDKQVPFDFPERTWPGKRLQRAPRWCSVDLRDGNQALVNPMDSERKLRFWNLLVS
FT                   MGFKEIEVGFPSASETDYDFIRMLIERELIPDDVTIVVLTQAREHLIRKTYECLKGAKR
FT                   AIVHFYNSVSVLQREVVFRKDKAGIKKLATDAAALCKELEGEAKGIDLYYEYSPESFTG
FT                   TEPEYAVEVCNAVIDVIKPTPEHPMIINLPATVEMTTPNVFADEVEYVSNHLVPRDAVV
FT                   LSLHPHNDEGMGVAATELAVLAGADRVEGCLLGNGERTGNVDLVTLGLNFLTQGIDPQI
FT                   DYSNVPEIRKTVEYCNQIKISERHPYAGNFVFTAFSGSHQDAIKKGLEARQVAADRAGA
FT                   DLDSFVWLVPYLPIDPKDIGRSYEAIIRVNSQSGKGGMAYLLKTNHNLDLPKRLQVEFE
FT                   KVVQNYADETKKEVKDEDIWRLFKDEYLPVEESGATAAGVVVGDSKDETLEQWGRLKLL
FT                   KVSVSSGEDGSDTVLKARILDRGVNVGVDEPVEREVSGIGNGPIAAFLNAVSNFGIEAS
FT                   VMDYVEHTMSVGTDAMAASYVECQIGEEDNTSIVWGVGIDTSIVTSSLKAIISAINRSE
FT                   R"
FT   CDS_pept        200017..201081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0146"
FT                   /product="large protein with C-terminal homology to
FT                   alpha-arabinofuranosidase II"
FT                   /note="Orthologue of BL0184"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38927"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP4"
FT                   /protein_id="BAF38927.1"
FT                   /translation="MSANYSLLCYTREATGREEANNEDIAYSMHLALRSGDDAEWQPLN
FT                   ENYGIFFAAGVPIAAATAESRHACTAAAHFAADRFDAPRPATDAVAHGVVMPGMDITLK
FT                   SLKNPFLFRLADGRFAIAATRTARGGEPDGSERSAFLLAISDDLTAFDQRGLVLLRTTG
FT                   GVNHPSVSFDAADACYVVSWTGDDGKARTARTADIVAAAGSGRPLDVVESASSQPLRQT
FT                   GDCGIPNAVVGNSIAISEPEAERLIERFGRIRNTGTSVPAQRIDAGLHGEDARNAVLAL
FT                   AATRAELSYSDGSQATRAVDWNMAQLEAIAQEASEGTLKAGQTRTVEGVIRQSVYPVPF
FT                   AVERADPSVLSFVK"
FT   CDS_pept        complement(201172..201954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0147"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of CE1245"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38928"
FT                   /db_xref="GOA:A0ZZP5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP5"
FT                   /protein_id="BAF38928.1"
FT                   /translation="MSESTDAAAGGRRGGRTVSKSTPDEVMELACGLPLTRSVLRSVVA
FT                   GATPGQLGVLADLFRAENASRTESRRARLIRNAGFPCVKGFDGYDWGMASFPADWGREQ
FT                   LMDLGFVDRAEDLVLYGDVGCGKTHMAIATGMLACERGMPVRFFTASSLVMRLRRARDE
FT                   NRLDAELRAIGRARLLVIDELGYLPIDIDGARLLFQVVADSYEKRSVVFTTNLEFGRWG
FT                   EVFGDGDMAAAVIDRIVHHGRIVRFRGESYRNSHSLMK"
FT   CDS_pept        complement(201947..203410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0148"
FT                   /product="putative transposase"
FT                   /note="Orthologue of CE1244"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38929"
FT                   /db_xref="GOA:A0ZZP6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP6"
FT                   /protein_id="BAF38929.1"
FT                   /translation="MTTPVRIQQSIRQLETKGLTHTQIARELGVSRTTVVKYATRDYSP
FT                   VPPTGGTASRSLVAGEYARKADEWLEADRRMPRKQRHTARRVHERLVEECGFEGSYSSV
FT                   QRWVKRWRQRHRGEAEGFSELEWAPGSAQVDFGQALAVVAGVERTVHFLVVSFPYSNMR
FT                   YVAALPGETAECVCHGLNKVFSHAGMVPRVLVFDNATGVGHRRADGTVTQTRLFSLFCA
FT                   HYGFETRFCNPYSGWEKGSTENAVGFLRRNLMVPTPSAEGWDRLTDAWLERCDEIARGV
FT                   HYREDVPIRDLFETDLDHMLPLPPSMFDACDWRGVKADRTGTVTIDSNRYLAGPKWHSM
FT                   RLMAGVRALRVELRSMDGEPIVTLERRWGRSPDTAMDPLSLLAIIARKPRSWGESPIRS
FT                   DFPEETRVLLDRMEPRERGLLVDDIRHAAVVSGFRAAVMAVVEIVAAGRRPDRAAIDQT
FT                   ARRIAQGDGPESRARLDTYSRFMREDGDE"
FT   CDS_pept        203538..204662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0149"
FT                   /product="large protein with C-terminal homology to
FT                   alpha-arabinofuranosidase II"
FT                   /note="Orthologue of BL0184"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38930"
FT                   /db_xref="GOA:A0ZZP7"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP7"
FT                   /protein_id="BAF38930.1"
FT                   /translation="MPFRFGGDAVHVYLTINTVFAWKFNGKPMFMFIATDDTDGNCVDP
FT                   NDGRTHMPLRIADSIEALSDAAGGQAKEIDLLACGDLNSEDRPMTGCFWAPELHVIGGK
FT                   LSVLFMPCFDGPRVNPDGTPNDRAGKPDMWTGSCHIMQLKQHSDGTDFDPREPENWTVP
FT                   EPILDPDGETLNPIQRISLDMTVLCDSGRWYYAWQQVGSIWIASFDPARPARLTSKPKQ
FT                   IVVPEFAWDNMIAEGPNAIVHDGTIFLIYSGSLVGIDYTTGLVTAPAGQGADLTDASVW
FT                   TKLDYPLQKSGMYNGRWQLGTGHGMWSHDEDGNLIYVFHNAEYEHGRYGGRDAQVRRVH
FT                   WSKEGMPILDMQTAEELDPDYAGVTMEVGFFDAD"
FT   CDS_pept        204672..205763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0150"
FT                   /product="LacI-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulators"
FT                   /note="Orthologue of BL0185"
FT                   /note="PFAM_ID: Peripla_BP_like"
FT                   /note="PFAM_ID:lacI"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38931"
FT                   /db_xref="GOA:A0ZZP8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP8"
FT                   /protein_id="BAF38931.1"
FT                   /translation="MTKGVYMPKRTGGNGEHVVTMREVAKAAGVSIKTVSNVVNDYEFV
FT                   SQATRDKVNKAIAELGYTVNVSARNLRRGQTGIIGLAIPDLQMPYFAQLSSLVIEEAKK
FT                   VGLRVIVEPTQYSRDGELEALHGSQQMMIDGLIYSPLELGQDDVEQLKVDYPLVLVGER
FT                   IFTDQVDHIATENVEGAKRATQYLLTTGCRRVAVVGVHPGEKVGSAALRYQGYLEALEE
FT                   AGVEFDDRLVVESGMWHRSDGVRAMNALLDSGVEVDGVVALNDMLASGVMHAIQMHGLH
FT                   IPDDISVVGFDNSDDSQYLSPALTSIAPGLEAVARLSVKVLKERIDGRDPNADRPGEKV
FT                   FRKVASSLVVRQSTKLPIDSLVL"
FT   CDS_pept        205760..206044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0151"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /note="Orthologue of BMAA0057"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38932"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZP9"
FT                   /protein_id="BAF38932.1"
FT                   /translation="MSFRLPSGKFLPACVPIESALPPRCRRRAWALGRKLGRTALSVSS
FT                   THDRRRHRHWHEWRKRWTPMPSGSTASKHLPTMTRPSCYNDVRMIYSTL"
FT   CDS_pept        206077..207138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0152"
FT                   /product="exo-alpha-L-arabinofuranosidase II"
FT                   /note="Orthologue of BL0187"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38933"
FT                   /db_xref="GOA:A0ZZQ0"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ0"
FT                   /protein_id="BAF38933.1"
FT                   /translation="MVVYNNPIVLQRADPWVLKVDGEYYFTASDPEYNCIAIRHASNIN
FT                   DLQKAPETVVWRKHESGPASIYIWAPELHRINGAWYIYFAGAATDFEASGLPTHRMFVL
FT                   ENTDDDPTSDNWVERGQIITPIDSFALDATTEVIDGVQYLVWAQKDPAIEGNSNLYIAK
FT                   MANPWTLGSDPVMLTKPEYDWECIDFLVNEGPAFLFHGNKIYITYSASGTGVPYAVGLL
FT                   TAECGSDLLDKASWTKSPVPVFKTCAENGQYGPGHNSFTKSEDGTEDLMIYHCRNYTEI
FT                   KGDPLFDPNRHARVGVVKWTADGPDFGVPEPDNLWTPTTTDVLPADGGPLAGTPCVLSA
FT                   ASTGLHGSSIGVS"
FT   CDS_pept        207439..208719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0153"
FT                   /product="solute binding protein of ABC transporter system"
FT                   /note="COG family: sugar-binding
FT                   periplasmicproteins_domains"
FT                   /note="Orthologue of BL0188"
FT                   /note="PFAM_ID: SBP_bacterial_1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38934"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ1"
FT                   /protein_id="BAF38934.1"
FT                   /translation="MNKGIRAAALVVAAASVISLGACGGGSKAAGSNGGVTELSVWSGF
FT                   TENDGKVVQSIADDFNKSQSNVKVTIEQNPWNVINDKLLSSISAGNGPDVVTYQPDGAK
FT                   GFIKQGAIVSTDDFYSDSSNETSHYRKNVVKDGEVDGKHYGVPMGHAPYSVYFNKAIFD
FT                   AAGITEDQYPKTWDDLAALASKLTVDKDGDGTPDQYGIALADKDAGYLPIFLQGAGTDL
FT                   VVDGKANLTSKKSKDTLTWIRDNFYAKKSSPSNLSLVDAQTLFCSGKAAMFWIGPWIVN
FT                   AAKEKGIETGTFEMPKGPEKQVTEVAANYWYTTSQVDGNDAKKKAAYAWMKFFNNKKNQ
FT                   ITWAVKANYPPNRTDVTADDMKSNNFVSQISPYMDHSSLLLGSVPSGFADVQSELNALG
FT                   PKISESTGDLTDILQKSNDKIQGYIEE"
FT   CDS_pept        208807..209757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0154"
FT                   /product="sugar permease of ABC transporter system"
FT                   /note="COG family: ABC-type sugar transport
FT                   systems_permease components"
FT                   /note="Orthologue of BL0189"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38935"
FT                   /db_xref="GOA:A0ZZQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ2"
FT                   /protein_id="BAF38935.1"
FT                   /translation="MRASSSGYKPPRSLVTSDSPVRRNEMKRAQTRMGWLFSAAAIVII
FT                   GAFVFYPAFYALWMSFTNATGFNKPQFIGVKNYTDLFSNQDAVHALLNTLIYTVIYMPL
FT                   LIIVALAVAMLLNRDDLPLRGFFRSAIFLPFVISMAVAAMAWQFILDPNLGFLPYWLSK
FT                   IGIHMGDVLGSTTWALPTVTVVGVWKNFGYFMVIFLAGLQGVSHELYEAAELDGCGAWR
FT                   KFTSVTLPGLRSTMTYVVIMALIQSFQAFDQIYVMTSGGPDHMTETVVYRIYTEGFRNF
FT                   HLGAASALSYVLLVFTFIVGVIQLVLNNRYEKESM"
FT   CDS_pept        209757..210644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0155"
FT                   /product="sugar permease of ABC transporter system"
FT                   /note="COG family: sugar permeases"
FT                   /note="Orthologue of BL0190"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38936"
FT                   /db_xref="GOA:A0ZZQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ3"
FT                   /protein_id="BAF38936.1"
FT                   /translation="MKKGSVVSASHNSSRYITPRVLLGRVGVYILLILTSLITVFPFFV
FT                   CLVTSFAPSKEVNAWPPKLIPSSLTLDNYVQLFNRIPVGTQFRNSVIFAGFVTLFSVAF
FT                   DALAAYALSRLDFRGRNVLLFVLIASMMVPYQALLIPTYKMLSSMGLIGNYNMVAMILP
FT                   RAADVAGIFLLRQFFISLPRDLDNAARIDGANEFRVFWSIVLPNAKQGLFTLALFNFMN
FT                   NWNDLLWPLIMTSKSDDRTLIAGLSLLNGSVGGAIPYGIMMAGAVIAAIPLVIIFAFVQ
FT                   KQFVEGVAMSGMKG"
FT   CDS_pept        210652..211923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0156"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of gll2003"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38937"
FT                   /db_xref="GOA:A0ZZQ4"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ4"
FT                   /protein_id="BAF38937.1"
FT                   /translation="MVNQKVSPVKKWFENKEKLNFSLGIEDTFIPQTRPGMRALDEYEL
FT                   TKHYECWYDDIGLISETGANQTRWGIPWYLVNPAPGKFRFDWLDRVVDRFEEIGVDVIV
FT                   DLMHYGTPLWLDNGFLNTDYPKYVAEYAATVAQRYQNRLNIWTPLNEPLLNMMYCGQYG
FT                   YWPPYLVGDDGFVKLFRQITKGMILTQQAISEVSPESTFVNVEASFRFAGDVDAYSDEV
FT                   GFLKQRRFLVEDTIMGRMNSNHPLYGWLSKHGIQDDDFQWYLDNSIKPDVIGVNYYPQV
FT                   STVKYVAGDPHDGSPYDPLPFQNDGVEGLKDVLTLFSERYELPVYLTETCSPGPVEERI
FT                   RWLHESVAAVDELRAEGMNLIGYTWWSLFDMMYWVYRDEDKPAEQYLAQMGLWDLRAND
FT                   HLSFDRIRTAAVDEYRRLVEAHRK"
FT   CDS_pept        complement(212410..214725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0157"
FT                   /product="probable penicillin-binding protein"
FT                   /note="COG family: membrane
FT                   carboxypeptidase(penicillin-binding protein)"
FT                   /note="Orthologue of BL0487"
FT                   /note="PFAM_ID: Transglycosyl"
FT                   /note="PFAM_ID: Transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38938"
FT                   /db_xref="GOA:A0ZZQ5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ5"
FT                   /protein_id="BAF38938.1"
FT                   /translation="METMVSRTRSVSSRSKSARSGSATSTTPRVGTTYGVHGEVLSKPP
FT                   QGPKHTSHRAPKKTRKHKHLVLKWVLGIFAALIAAGIGLFAYMYITTEIPQPEKFALAE
FT                   KTTVYYNDGTTPIGSYAEQNREIISCADLPDYVGNAIVASEDRSFYTNKGIDPIGIARA
FT                   FYNNLTTGSRQGGSTITQQYAERYYLGETTSYVGKLREAFLAVKIAQAQDKSQVLCNYM
FT                   NTIYLGRGAYGIQAAAKAYFGKDAKDMTLSEAAMLAGIIPAPSVWTPDVNPKQAEKRYK
FT                   RVLNIMDEDGYITPDEKKAAKFPQTIEIQQNNQMSGPNGYLLTMVQNELVNTKAFSKQD
FT                   LETGGYKIVTTIDKSKQDLMFSTISPSQNGMQGIVPDGMQFGALSVNPKDGSIISLYAG
FT                   DDYLTKQLNNVTQATYEVGSTMKPFALLAAVNEGVSLNTYFNGNSYRTFPGITETVSNY
FT                   GGENLGYVNLYTATEQSSNTVYMDLQTKLGAQKIAETARQAGVDDSSLDGSNPFTVLGN
FT                   NGLTLKDMTQGYATLANQGNKPTLHIVAQVQTANGTDLYNAPTSAEQTFEANNANLVTK
FT                   ALTGVVQRGTATEARATGHTIAGKSGTANDSNAASFIGYTPSMLTSVAMWYPDANGNPQ
FT                   QIPSFGRWTGGSDYPVHLFTEYMKQALADTPNETFPDATDNGKVGGPDGTWGTGAQKTW
FT                   TRKQQTTVTPRTEENTQQTTPNQTEETQNTGQGGGDGGNSGGIPANGDGNDTNGGNGGG
FT                   TSDDNSGNNGANGDTSQQ"
FT   CDS_pept        214937..216079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0158"
FT                   /product="myo-inositol-1-phosphate synthase"
FT                   /note="Orthologue of Tfu_3099"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38939"
FT                   /db_xref="GOA:A0ZZQ6"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ6"
FT                   /protein_id="BAF38939.1"
FT                   /translation="MSIRVAIAGVGNCASSLVQGVEYYKDTKDEDKIPGLMHNNFGGYR
FT                   VRDIEFVTAFDVDALKVGKDLSEAIGASQNNTIKFADVPNLGVEVLRGPTNDGLGEYYR
FT                   QMIEESDAEPVDVAQVLRDKKVDVLVSYLPVGSEKADKAYAQAAMDAGCAFVNCLPVFI
FT                   ASDPEWAQKFRDAGVPIVGDDIKSQVGATITHRVLARLFEDRGVRLDRTYQLNVGGNMD
FT                   FMNMLQRSRLESKKISKTRAVTSVVPHEMDPHNVHIGPSDYVAWLDDRKFAFVRLEGTT
FT                   FGDVPLNLEYKLEVWDSPNSAGIVIDAVRAAKIALDRHLAGPVLAPSSYFMKSPAVQHE
FT                   DGEARRLVEEFIKGEVEGTEEQLDADVAAAKAAGKDVWRA"
FT   CDS_pept        complement(216306..217484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gif"
FT                   /locus_tag="BAD_0159"
FT                   /product="probable UDP-galactopyranose mutase"
FT                   /note="COG family: UDP-galactopyranose mutase"
FT                   /note="Orthologue of BL1245"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38940"
FT                   /db_xref="GOA:A0ZZQ7"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ7"
FT                   /protein_id="BAF38940.1"
FT                   /translation="MTDAVEYPDLVVVGAGLFGLTVAQQAVEHLGVRVEIIDVRDHIGG
FT                   NAYSYMDEETGAEIHKYGAHLFHTSNKRVWDYVNRFTSFTDYVHRVYATHDGEVYPLPI
FT                   NLGTINQFFHAHYTPAEAKALVDEQAGELAGTDPKNLNDKGISLIGRPLYEAFIKNYTG
FT                   KQWQTDPKDLPAGIINRLPVRFNYDNRYFRDTWEGLPTDGYTAWMERMIDDPRIHVTLR
FT                   TDFFDESQPYNRKALAAAGVPVVYTGPVDRYFDYSLGELKWRTVDFREVRYDEGDHFGC
FT                   PVMNFSDPDVPYTRAIEFKNFNPERRASQNPDRTVVWEEYSRFAERGDEPYYPINTEAD
FT                   KALYARYEELAKAEPRTVFGGRLGTYKYYDMHNVIDTALTAYEEQVEPLLKK"
FT   CDS_pept        217768..218859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0160"
FT                   /product="possible pre-pilin peptidase"
FT                   /note="COG family: membrane-associated
FT                   phospholipidphosphatase"
FT                   /note="Orthologue of BL0486"
FT                   /note="PFAM_ID: PAP2"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38941"
FT                   /db_xref="GOA:A0ZZQ8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ8"
FT                   /protein_id="BAF38941.1"
FT                   /translation="MTNEFKPLVRDPQQPVNMLQQPTAATPAEPLESLSFPDMREVEAV
FT                   LSPQDVNKGLAQVDPLTRHPRVSSIVLCVVFGLLMLAASAGVWWLGVRTMDGQSYEDIV
FT                   WSKFDAALPGWLAPVVHVFAISAVVITVSVIMGAIAFAVLIVRKRWLSIAQLAVFGGLC
FT                   FAAAELLKPLLPRPYLINLESNPNNSASSGHVILAAAASVMLLCAVPRVLRALVAVIGW
FT                   AYTVLVGLSVIAAQWHRPTDVIMALLIVGGLALLALATTFASGMDEPGTRVSSASVQIV
FT                   GSVMLTIGVLGILYGAYIIWQIQPGLAMSAEWTNAGAYVSTALLTAAVSALVLGITLAM
FT                   RQLTASPLTKLGLVGAPPAPPKR"
FT   CDS_pept        218965..222048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="BAD_0161"
FT                   /product="DNA topoisomerase I"
FT                   /note="Catalyzes the ATP-dependent breakage
FT                   ofsignle-stranded DNA followed by passage and
FT                   rejoining_maintains net negative superhelicity"
FT                   /note="Orthologue of Rv3646c_BL0485"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38942"
FT                   /db_xref="GOA:A0ZZQ9"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZQ9"
FT                   /protein_id="BAF38942.1"
FT                   /translation="MAMATGSKLVIVESPTKAKKIGGYLGSGYTVMASVGHIRDLAQPS
FT                   QVPAAEKAKYGKFGVDIEDGFKPYYIVDGNKKKTVADLKSALKKADTLYLATDEDREGE
FT                   AIAWHLVQTLKPKVPVKRMVFHEITPEAIKASLNNTRDVDAAMVDAQETRRILDRLYGY
FT                   ELSPVLWRKVGPGLSAGRVQSVATRLIVERERERMAFVRAPYWDVTATLEAPDADGNNV
FT                   AFDSRMVSLGGRRLAGSKDFGDDGQLTAAGVKDNVVQLDETHANAIARSLEYATFTVSS
FT                   METKPYRRRPVPPFTTSTLQQTAGNRLGMSSRQTMRAAQGLYENGFITYMRTDSVTLSQ
FT                   EAIAAAREAVSRHFGEKYLSDAPKQYATKTAGAQEAHECIRPAGAHFRDPAEIATKVPA
FT                   DQLKLYTLIWQRTLACQMADATGSTATVRLSSPTEADGEAMFQASGTVIEFPGFMKATG
FT                   EGRRSVVDAKKSAEAAGVKIGDKAEKSAKASKKTDDNVSLPPMQPGDELAAVDVAADGH
FT                   ETQPPARYTEASLVKTLEQKEIGRPSTYASIISTIIDRGYVYERGRALIPSWLAFSVTK
FT                   LLETKFPKYVDYEFTADMETGLDQIAGGHETGKAWLTRFYFGSGDGAAQSADEAHEGLQ
FT                   QQVAQLGEIDAREINTIDIGDGLHVRVGRYGPYLEDMKHLDAEGNPKRASLPDTLAPDE
FT                   LTVEVGHDLIENHSGGPRELGKDPVSGGTVEVRNGRFGPYVALVMPSAEDAGDTAAESA
FT                   AGKAGKTKRSGGKKAASDRPKMASLFKTMSPESLTLEDALKLLSLPREVGSYDEANAET
FT                   GEMQTVTVMANNGRYGPYLTKTGADGKSDTRSLASEDEIFTVDLEKAKELFAQPKYGRG
FT                   RGRGAAKPPLRDLGTDPETQKHVTIKDGFYGAYITDGETNRTLPKQYAPESIEPAEAFR
FT                   LLAEKRAQGPSKRRGRKTAAKGAKKGAAKGAKSAKKVSATEQARADRRAKVRELADKGW
FT                   ANTRIAKEIGSTASTVKADVDWLTANEGYARPEVVPAR"
FT   CDS_pept        222170..222823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0162"
FT                   /product="thymidylate kinase"
FT                   /note="COG family: thymidylate kinase"
FT                   /note="Orthologue of BL0484"
FT                   /note="PFAM_ID: Thymidylate_kin"
FT                   /note="dTMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38943"
FT                   /db_xref="GOA:A0ZZR0"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZR0"
FT                   /protein_id="BAF38943.1"
FT                   /translation="MQGTFISFEGVDGVGKTTQVERLRAYVESQGRECVVTREPGGTAL
FT                   GVAIRKMLLHGVDTGDENDCADIAPRTEALLFAADRAQHVAEVILPALQRGAVVITDRY
FT                   LDSSLAYQAGGRELTAAEIRNLSMWATNGLLPERTYLLDMDPAQSHARLQHAEDRMEAA
FT                   GNDFQRRTRVAFLDLAEREPERFHVIDASQSIEDVWARIKADFDTVSTADGGIA"
FT   CDS_pept        222820..223968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0163"
FT                   /product="possible DNA polymerase III delta prime subunit"
FT                   /note="COG family: ATPase involved in DNA replication"
FT                   /note="Orthologue of BL0483"
FT                   /note="PFAM_ID: AAA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38944"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR1"
FT                   /protein_id="BAF38944.1"
FT                   /translation="MSVWNSIVGQAQVVEQLKAIASGDPKAIAQSWLICGPPGSGRSNV
FT                   ARAFAAALESPDHGLNDEPTKTTEQVLAGTHPDVSVLATNKVTIGIGEVRDIITTSEQM
FT                   PGTAPWRIIIIEDVDRMMERTTNVLLKEIEEPSPHTIWLLCAPSAQDVLPTIRSRTRIV
FT                   NLAVPSNQAVAKFLESQGFEPNIAARAARLSEGHIGIASLYAKDERVMTDRDELIVGVL
FT                   GLHRASDAVLLAGNLIDNAKAQAEAEVNVKASEAEADFRRINGLGPKDRIPPKLRGAYN
FT                   AIAKKDELKRRATRLTRDVLDRALNSVASIYRDVAVLQNNAEDAVGLINLENRSAITEL
FT                   SVRLDRAGAVRRLENIATARRRLNGNGNPVLVFEALFCALIP"
FT   CDS_pept        complement(224011..225066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="BAD_0164"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /note="Orthologue of SAV5320"
FT                   /note="Transcriptional regulator mediating carboncatabolite
FT                   repression"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38945"
FT                   /db_xref="GOA:A0ZZR2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR2"
FT                   /protein_id="BAF38945.1"
FT                   /translation="MAGRTDSGSSITNVAATAGVSIATVSRVLSGKRGKDDDIARRVRE
FT                   AAKQLGYSVNYAASALRSDVTKTIGLVIPSATEPFSAQLLDEIEPTIDTESQQLLLGIG
FT                   ATQEAQAERIESLVNRHVDGLIVVPAAGADLAGTLNQYANTLPIVQICGRQTAPRVSVV
FT                   GIDENAAMEAIVKHLAEQGIASAAYMAGDELSFESAELFATFHTHMRTYGLVTSENWNQ
FT                   FGERTVQRGFDCAMRLFNGPLVQPEAVVCADDAIAFGVMVAFDALGIRVPEDVLVVGYH
FT                   DSAIARTTMPRLTSVRAPFERIVSECLRLLASGPAGGAAETAAAPGGSVRAPRVMLAPQ
FT                   LIVRDSSVFRR"
FT   CDS_pept        complement(225274..225612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0165"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /note="Orthologue of BURPS1710b_0065"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38946"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR3"
FT                   /protein_id="BAF38946.1"
FT                   /translation="MSRQPNVSKPTTNHNKGDHYGNPQSRHQRSGRHSRPSGRHVRTGR
FT                   HRFRPDRDHRQGRRQRRSGRLHPVHHGSGHQAGRHRGHQRRRRQRRGRGRQPGQHPRQR
FT                   RVTHRITH"
FT   CDS_pept        225852..227546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="BAD_0166"
FT                   /product="PTS system, enzyme I"
FT                   /note="Identified by sequence similarity"
FT                   /note="Orthologue of Lxx00830"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38947"
FT                   /db_xref="GOA:A0ZZR4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR4"
FT                   /protein_id="BAF38947.1"
FT                   /translation="MRIHIFSKETGKGVLMNIKGVGIGRGVAVGPVIRMAAPLPEPSDA
FT                   PRAENISAETEIARVEKSLALVNADLNRRAEEAANGDEGAKQAAPILQAIAMFASDPSL
FT                   AQSIKDLINQGKTAERAVLEGFGAVEDMFRAIGGYQAERAADLHDVGQRVIADLMGAPA
FT                   PGLPVSETPFVLVAEDLSPADTAALDMSKTLAIVTSQGGPTSHTAILARARGIVAVVSA
FT                   AEAAELENGTNVIVNAAKGEIVVNPSEDEIAAAEAAKSRAAAAKELRGKPGATKDGHLI
FT                   PLLANVGKPSDAAKALEYGAEGVGLFRTEFLFIGNSEPPSVEEQTKAYTELLSQFPGKK
FT                   VVIRMLDAGADKPLPFLTPEDEPNPALGLRGLRTLRAHMDVLEGQLKALAAADAATDAN
FT                   LWVMAPMVADQHEADYFVKLGKSFGLKFVGAMAEVPSIALMADKVADVADFVSIGTNDL
FT                   TQYTLAADRTLGSVANYQTAWHPAVLRAIKMICDAGNAKGMPVGVCGEAAADPDLAVVL
FT                   AGLGVNSLSMTPVALDDVRASLAEVTFEEAKAKAAAALNGDFYKPAE"
FT   CDS_pept        227684..228373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0167"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of SAR0943"
FT                   /note="Similar to Bacillus subtilis hypothetical protein
FT                   YxkA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38948"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR5"
FT                   /protein_id="BAF38948.1"
FT                   /translation="MRSPRGRGRFGCGLCRLLRLRRLRHRRRRVIRPRRVTRMRDTGSM
FT                   KISADFTVIPDAFAKAAPPENCIDGTPIVSFPFYIDELDPSVQFLHWEFVDPDSIPVCG
FT                   FQWNHWSLANLPVDALMYDFNDSHALAIPADFSRTVSAMIPETVQGRTSAASPLLKGRS
FT                   DDPAVTMRYNGPYPPDRDHEYYLHVWGTTAPLNGLNQGFWLNEMERALRNSGAIADQGA
FT                   IFLTGKA"
FT   CDS_pept        228482..230074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="BAD_0168"
FT                   /product="dipeptidase"
FT                   /note="Orthologue of BL0479"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38949"
FT                   /db_xref="GOA:A0ZZR6"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR6"
FT                   /protein_id="BAF38949.1"
FT                   /translation="MACTTILVGKDASYDGSTIIARNEDSANGEFCPKRFIVVKPDEQP
FT                   RHYKSVLSHVEVDLPDEPLQYTAVPNADLKEGIWGEAGVNEANVAMSATETLTTNERVL
FT                   GADPFVELTPAKGKKGEDGYEPEVPGGIGEEDFLTLVLPYVKTAREGVTRLGALLEQYG
FT                   TYEMNGVAFSDVDEIWWLETVGGHHWIAKRVPDEAYVTMPNQLGIDEFDLDDALGDQEE
FT                   HMCSADLGEFIERNHLDLAVENVTPFNPRDAFGSHSDSDHVYNTPRAWYMQRFLNPYDE
FT                   QWDGRDADHQPTSDDIPWARQPDRKITIEDVKYVLSSHYQGTPYDPYGKLGDQHSRHMF
FT                   RPIGINRQSQLSVMQIRPYRPQVNRAVQWIAYGSNPFNTLVPFFPNVDSTPKYLEDTTT
FT                   RVTSENFYWENRIIAALCDASFADTANAVERYQEKTGGMGHRMVAATDGQIDRLVEDVI
FT                   DEFDADDETGDVQPMEPDEIIEAVRNGEAREVLATANETMAAQLKAETDKLLDSVLYTT
FT                   SMNMKNGFHMSDF"
FT   CDS_pept        230264..231847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="BAD_0169"
FT                   /product="formate-tetrahydrofolate ligase"
FT                   /note="COG family: formyltetrahydrofolate synthetase"
FT                   /note="Orthologue of BL0478"
FT                   /note="PFAM_ID:FTHFS"
FT                   /note="formyltetrahydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38950"
FT                   /db_xref="GOA:A0ZZR7"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR7"
FT                   /protein_id="BAF38950.1"
FT                   /translation="MCCSGHVRRSTPPGGRLQERTPVTSIEDFISQYGLVQKIDAFGYL
FT                   DYLKSNPDAPRKHGKVVLVTADTPLKASRGEGKTTTTIALIDALRERGIDAAAVLRQPS
FT                   MGITAAGSKGGASGGGKASLTHPELIDWGLCGEMGAIEAAQNLLVSFAEKAVDDGKLDT
FT                   ILVPRVSEVPSRSLRQIAVDRGKGDVAERVVLTPTCELMQIVVLSRSMDEISERVAKMV
FT                   AGTKDGKAVTFGEFVDLWRITGILGDAVKPAKTETVNGSPVYVHGGPFANVSIGIPTLV
FT                   SVEMACALHDVVIVEAGYGTDAGAQKWLDIACREYDAQWPSAAIVVTRASTWRDDPDLA
FT                   WRYPFHVQRLEGLDIPTFPLINLWDGEDDQIPALKATAKELEFRDPIIGNLYRDGGDAL
FT                   APQLDAFVDAVTNGSMPAEPHSHKGMALVENVRWVAENAYGVPADRVILKDGFAESLQA
FT                   AEGLCASAGIDFGSLALVAVKSPATMTDNDRAPEAERTVTLKKVEVHSGAGLVHVNLTT
FT                   SLTTPMPKIV"
FT   CDS_pept        complement(232301..232648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0170"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0477"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38951"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR8"
FT                   /protein_id="BAF38951.1"
FT                   /translation="MPVIHTHVSVSTTPGQREALKTAYGKAISAVPGKSEGWLMCPFED
FT                   NMPIYFGGDDSKPAAYVEVNVFGRSVPGSAWEKLTEQIMAALGKELGIPADRTYIRYTA
FT                   TTDWGWNGGNF"
FT   CDS_pept        232732..233292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0171"
FT                   /product="narrowly conserved hypothetical membrane protein"
FT                   /note="COG family: uncharacterized membrane protein"
FT                   /note="Orthologue of BL0476"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38952"
FT                   /db_xref="GOA:A0ZZR9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZR9"
FT                   /protein_id="BAF38952.1"
FT                   /translation="MRKLIEQLMKFGIVGVIAFIIDWGILNILVGAFHMHNVLAATISF
FT                   IISLIFNYVASMKMVFKHREDMARWMEIVIFVVGAVIGLFMNDAIIWISTYGMNHDAYV
FT                   SQSAEYLIRTNVGKLIATAVVMVWNFVTRKWLLDDTHTNATNRLKKKENRLSPEELEAK
FT                   WENSFSHKLGVWSLEHTPKGWPK"
FT   CDS_pept        complement(233415..234839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0172"
FT                   /product="hypothetical protein"
FT                   /note="COG family: permeases of the major
FT                   facilitatorsuperfamily"
FT                   /note="Orthologue of BL0475"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38953"
FT                   /db_xref="GOA:A0ZZS0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZS0"
FT                   /protein_id="BAF38953.1"
FT                   /translation="MTNNVLVGVKNIGQRLFGGYAELLRIPHTARFSVGSVIACMPFPM
FT                   VGMTITISVQHYYGNYSLAGALTAVQAIALAVTSPVLGKLVDKFGQRQVSIPTIIVWMV
FT                   AAISLVSCITARVPSWILFCIVPFMAAIPPWGAMSRQRWTTLLKGDAEKTNRALSLSGV
FT                   FDECMWVIGNPLASTLAVISGLLAFSFTGICVVVGALMFLTELTTEPKSQTQLAREAGM
FT                   TRKEYRERETARSKALQTEAAVEYARDKARAEGKTAAEVKAAMQKAATDIAAGSKESIW
FT                   GPGLIAVCVTWFGLGAFQSAAGISIVAFATEAHMKQFTGFVFACFSFSSLIGALVYGAK
FT                   NWTIPLWKRFYFCLAVVNLGIGSFMFAKHLWVIMIIYLCIGVCQAPTWVNGNQLMLHLV
FT                   PPTRFTEGMAWMGAMNSIGGSVGSAIAGQFIDRMGSRGGFIVVTALALTSLAIAMLGFK
FT                   QIKESTEQPTLTNVSA"
FT   CDS_pept        235218..235877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0173"
FT                   /product="hypothetical protein"
FT                   /note="COG family: phosphoglyceratemutase_fructose-2_6-
FT                   bisphosphatase"
FT                   /note="Orthologue of BL0474"
FT                   /note="PFAM_ID: PGAM"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38954"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZS1"
FT                   /protein_id="BAF38954.1"
FT                   /translation="MPATTIHFVRHGKVENPGHLLYERLPGFHLSDVGVRMAQATAHYI
FT                   AVSPQLNTVSAVYSSPLERTRETAGEILESLNSVRGLRGEEPLELQTDERLIEARNEFR
FT                   GKRIGFGEGALWKNGNWKLVRNLWKPSWGESYQSIAHRMQDFALEKVAEYPGKQIVVVS
FT                   HESPIWSYRHMLETGHPEHNMLLRHTALASITSITYDCNTGKIMSITYADPAADVE"
FT   CDS_pept        235961..237022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0174"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0473"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38955"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZS2"
FT                   /protein_id="BAF38955.1"
FT                   /translation="MSFVYDQKVVDSMYGSHVVSMAVDYGVDLVKMWPLQTNQELENDV
FT                   KYAENLQVMFSGMMTQVLLKRSEEVDQSVAEAVYEGMDVLPGVDPEIIRTLMDANHAYD
FT                   VMASYHGVDGIELFMETARILGIDVETRIEKEIQDLMENLSRTMRSASGFEVDDDVAEN
FT                   VGICQSATVDRNEFARRYLASMTVLDALINLMCYGTDDSQEQAIRVLPVLLFVNAMRNQ
FT                   LSIPPTFINAEQLINLFGLRDTARQFGRPQSVFDSSFNPLTFSTTVKYLAFFAGQEWLR
FT                   HMRFLEWDPKQAEQDAKDEDERKSREALAKKYNLTSDGDNAASDADLDSSADSNLSEDS
FT                   DSSEEAGSEPTEE"
FT   CDS_pept        complement(237282..238598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0175"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized membrane protein"
FT                   /note="Orthologue of BL0471"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38956"
FT                   /db_xref="GOA:A0ZZS3"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZS3"
FT                   /protein_id="BAF38956.1"
FT                   /translation="MTDPNQYNPQVPQPAAQYGQAPAPDYGQTAPQYGTPDYGQAQAPQ
FT                   YAAPNYNQAPQYGQAPQYGQAPQPQYNQAPQYAQAPQYGQAPQYGQAPAANYGQPAPQP
FT                   QSGNSFFALTAPLDMPAYGCNLGEAIVRFFKKYAVFKGRASRSEFWWWFLTYTVVTFVL
FT                   SLVFRTLRNLTDSGVIATVGDSFSSIWGLVVLVPTIALGVRRLHDINMRGTVLAIIYAV
FT                   QAAAGIFFAIGLILIIGSSLSFRSLEAGNSVSIGGVVLLILGVLAFIASGVFYFVLMAR
FT                   DSNPEGARFDAPTASNAWAPATGEAPADPYAAQATSYGNVPLPTNPAAAAPAAPYTAPA
FT                   TPTDSYTAPAPQYDAAQQHAAPQYAAPQQNPLAEAPSVPSMPPMPAVPTMPPTPSIPPM
FT                   PEVPAQFQHPHEQPNTDAPADSDAPAVPNDPANGTDQQL"
FT   CDS_pept        238766..240286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BAD_0176"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="Charges one glutamine molecule and pairs it to
FT                   itscorresponding RNA trinucleotide during
FT                   proteintranslation"
FT                   /note="Orthologue of BL0469"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38957"
FT                   /db_xref="GOA:A0ZZS4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZS4"
FT                   /protein_id="BAF38957.1"
FT                   /translation="MTEVENTRPELPENVRVRFCPSPTGIPHVGMVRTALFNWAEARHT
FT                   KGTFVFRIEDTDAQRDSEESYNQIIEALNWLGIDWDEGINVGGPDGPYRQSERGDIYKD
FT                   VAAKLLEAGYAYESFSTPEEIEARNVAAGRPKAFGYDGYDRNLTEEQKAAFRAEGRKPA
FT                   LRIRMPDEDVAFDDLIRGRIEFKAGSVPDYVIVRPNGDPLYTLTNPVDDAMMRINVVLR
FT                   GEDLLSSTPRQIVLYRYLIELGVAKEMPLFGHMPYVMGQGNKKLSKRDPESNLFLHRDN
FT                   GFIREGLLNYLALLGWSIAPDRDVFSMDEMIEKFDVRDVKANPARFDVDKAISINAEHI
FT                   RMLEPQDFLNRSVPYLHRDGVVSADSWDALTDREREVLTAAAPLVQPRVRLLGEVAGMV
FT                   GSLLSTEGYIEPDADAKKQLKDSAPAVLDAAIAALDAVAEGDWKTDSLHETLNKALVED
FT                   GGYKPRLAFGPVRVAMSGRRVSPPLFESMEIVGKDVAMARLKGLREHL"
FT   tRNA            240485..240560
FT                   /gene="gluT"
FT                   /locus_tag="BAD_t0007"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:240519..240521,aa:Glu,seq:ctc)"
FT                   /note="codon recognized:CTC"
FT   tRNA            240596..240670
FT                   /gene="glnT"
FT                   /locus_tag="BAD_t0008"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:240629..240631,aa:Gln,seq:ctg)"
FT                   /note="codon recognized:CTG"
FT   CDS_pept        240838..242301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0177"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted phosphohydrolases"
FT                   /note="Orthologue of BL1260"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38958"
FT                   /db_xref="GOA:A0ZZS5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZS5"
FT                   /protein_id="BAF38958.1"
FT                   /translation="MTELQHAAKATRPRIQPAEEGDRRPLSVSARLGRLQFHQSGKFRV
FT                   LQFADIQDGPKVSKDTISLIEASLDATRPDLVIFNGNQIAGYDSAYALTSRKRRWDARP
FT                   ASASSEASGERYAAALEHTRELVRATIEQLVHPLADRGVPWAVTFGNHDFQCGLDNAEI
FT                   ESICREFPGCINPERAADGTTGIAVKHGVKHDVGDMEQDFGLPEQPVIACAPGTFALSV
FT                   TDVDRTYGVLGLVLLDSGDYARSGGYGSPSEAALRFLADAPGLMAAQSQQLQQDRQDEQ
FT                   DSPREPRKTPSTLPCMVFQHFPIEQYYRLLKPVAATAARAIEGYRNFAGRHFVLNEDKT
FT                   QPGSYLGEGVSCPDADSGEFAILDKAGYFAISAGHDHRNAFVGSVPVGTDGDRQMMMVA
FT                   SPTSGFGSYGPVPAKRAARLFEFDIRHPYEPRTQLLEYDELVGKPSAGKAYAYGMTSES
FT                   KPDSEGMDLLHRPTWWSKTWNKLVSLFRR"
FT   CDS_pept        complement(242411..243235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0178"
FT                   /product="IclR-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulator"
FT                   /note="Orthologue of BL1261"
FT                   /note="PFAM_ID:IclR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38959"
FT                   /db_xref="GOA:A0ZZS6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZS6"
FT                   /protein_id="BAF38959.1"
FT                   /translation="MTSSSNTSNAMPKTQAMNATNEANGNYAATPQSNEIHSGVGVLDK
FT                   TVKILDALESGPATLGQLVSATGLARPTAHRLAIALERHRFVLRDQHGRFVLGSRFAEL
FT                   AAAAGEDRLLTAAAPILQTLLDRTGESAQIYRRQGDQRVCIAAVERASGLRDSIPVGAM
FT                   LSMEAGSAAQILLAWEDSERLHQGLRHAKFTAAKLTAVRKRGWAESINERDEGVCSISA
FT                   PIRNASGQVIAAISISGPNGRMGANPGRRYAPLVMAAGKYLTDALIKASSGR"
FT   CDS_pept        243552..244955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="BAD_0179"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /note="Catalyzes the isomerization between2-isopropylmalate
FT                   and 3-isopropylmalate"
FT                   /note="Orthologue of Rv2988c_BL1262"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38960"
FT                   /db_xref="GOA:A0ZZS7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZS7"
FT                   /protein_id="BAF38960.1"
FT                   /translation="MGTTLAEKVWADHLVRKGSDGAPDLLYIDLMLMHEVTSPQAFEGL
FT                   RLAGRKPRHVDQLIATEDHNTPTVDIDRPNPDETSALQLSTLEKNCKDFGVRLCPLGDA
FT                   DQGVVHAFAPVLGLTQPGMTIVCGDSHTSTHGAFGAMAIGIGTSEVEHVMATQTLSLKP
FT                   FKTMAVNIEGDLPKGVTAKDIILAIIAKIGTGGGQGHVIEYRGEAIKKLSMDARMTICN
FT                   MSIEAGARAGMIAPDEVTFEYLKGRPHAPEGEMWDKAVEYWKTLKTDDDAVFDKEVTIN
FT                   AEDLEPYVTWGTNPGQGVKISGVVPDPASFNDETERSAAERAIAYMGLKPGMRIKDIAV
FT                   DTVFIGSCTNGRLEDLRVAASIMKGHHKADNIHRVLVVPASSRVRLQAEKEGLDKIFKD
FT                   FGAEWRNAGCSMCLGMNPDKMVARERSISTSNRNFEGRQGKGSRTHLASPAVAAATAIR
FT                   GTICSPADL"
FT   CDS_pept        245045..245734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BAD_0180"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /note="Catalyzes the isomerization between2-isopropylmalate
FT                   and 3-isopropylmalate in leucinebiosynthesis"
FT                   /note="Forms a heterodimer of LeuC_D"
FT                   /note="Orthologue of BL1263"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38961"
FT                   /db_xref="GOA:A0ZZS8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZS8"
FT                   /protein_id="BAF38961.1"
FT                   /translation="MEKLTTLTGVAVPLRRSNVDTDQIIPAVFLKRVKKSGFDDALFYA
FT                   WRRDPEFVLNKPEYKQGKILVAGPDFGIGSSREHAVWALHDYGFRVVISSRFADIFYGN
FT                   TAKNGVLAAIMPQESIELLWKLLDEEPGREMTVSLEDRTVTCGDVTLPFEVNDYTRWRL
FT                   MNGYDDIDLTLQHEDDIIAYEKMRAEKFPFKPKTLPVKREPEQPIESAREGEYPDWQGP
FT                   LADRGII"
FT   CDS_pept        246136..247749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0181"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of GK0575_BL1784"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38962"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZS9"
FT                   /protein_id="BAF38962.1"
FT                   /translation="MREGNRLEAKRAKGGLPHSLWETYSSFANTEGGLILLGVSEHEDH
FT                   SLYITGVDDARNMAQDFWNMVHDPSKVSAVVLSDNDVVIRHTSQGDVISIDIPRAARDC
FT                   IPVYVGQNPMTGSYRRNGDGDYLCDEETVRAMLRDSDLLPLDRTIVEGMGADALNADSV
FT                   ASYRRQFKNRRPGHPWVGLSDEDFLLRIEALRLDGSQVRPTRAGLLMFGEAWRITSEFP
FT                   YYFLDYREVMDDQERWNDRFTSDDGTWSGNLYDFWGKVVNRLRSAVAHPFQLDADLHRI
FT                   DDNLMDKAVREAVTNTLVHADYFIRRGTVIIQYYDRIVLSNPGSLRLSSEEVMQGGISD
FT                   TRNPTLMKMFNLIGIGEKAGSGFDVMREGCLFAGTAAPELEVFDDPGRVQLTLYPRKIA
FT                   GDSMIAGASAVPGVSADGGGPVGAESPTMRNSEHGTGTVHRIGARGADRLNDMVGTFGK
FT                   NVALPADFGNAIRPQSQLEKITYALTVGGPQPTSYLAVVLGLGLTRTREILASLVKDGV
FT                   IEPIGVGRGRKYRLAEHTGS"
FT   CDS_pept        247942..249084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0182"
FT                   /product="hypothetical protein"
FT                   /note="COG family: dihydroorotate dehydrogenase"
FT                   /note="Orthologue of BL1265"
FT                   /note="PFAM_ID:DHOdehase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38963"
FT                   /db_xref="GOA:A0ZZT0"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT0"
FT                   /protein_id="BAF38963.1"
FT                   /translation="MSQGFAPFYDVNRTYEDNYLQGPFGAFAEVMKGDSAAGASAQSAQ
FT                   TTQSQSSDQAEEFLGFRVNLPFGIPAGPLLNERFTTAAFRMGFDLAVYKTVRSRAWGCN
FT                   AFPNVLAVHPKNADGSLVPGSAELDEGVLADTRYELPISISNSFGVPSRDPDEWQPDMK
FT                   KAIAAAGDGQLLVPSFQGSRVDGMDRKAYIADHVTTAHLVTETGAGLMEMNTSCPNEGH
FT                   NRLLCHDPHLVGEITEAVKNEIGDRPLIVKLAYIPNDTDLETMVRETVGHGTVQGFSTI
FT                   NTISARLVDANGNQALPGAGRDRSGVCGNAIRGAGLDMVGRLAAIREKLGFDFAIVGVG
FT                   GVIRPDDYKAYREAGANAVMSATGAMWDANLAREIKETLR"
FT   CDS_pept        249180..250505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BAD_0183"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="Adds enolpyruvyl to UDP-N-acetylglucosamine as
FT                   acomponent of cell wall formation"
FT                   /note="Orthologue of BL1267"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38964"
FT                   /db_xref="GOA:A0ZZT1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT1"
FT                   /protein_id="BAF38964.1"
FT                   /translation="MSDNKNDILHVEGGKPLNGTIKVRGAKNFVSKAMVAALLAPGTSV
FT                   LKNVPEIRDVHVVSDLLRLHGVDVTVDGANGVVTIDATNVQLADVADVDTLSGSSRIPI
FT                   LFSGPLLHRLGEAFIPALGGCNIGGRPIDFHLETLRKLGANVDKEHKDGIHITAPNGLH
FT                   GAKIHLPYPSVGATEQTLLAAVLAEGKTELSGAAIEPEIMDLVSVLQKMGAIISVDVDR
FT                   TFRIEGVKELKGYTHTSLTDRIEAASWASAALATHGDIFVKGATQPEMMTFLNVFRKIG
FT                   GEFDITDKGIRFWHPGGDLKPVAIETDVHPGFMTDWQQPLVVALTQANGLSIVHETVYE
FT                   NRFGFTKPLVQMGATIQLYRECLGSLPCRFQQRNYKHSAVIFGPTPLTGRDIDVPDLRG
FT                   GFSHLIAALAAKGPSNVQGISLIDRGYADFRGKLEALGADFD"
FT   CDS_pept        250836..251756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0184"
FT                   /product="hypothetical protein"
FT                   /note="COG family: 1-acyl-sn-glycerol-3-
FT                   phosphateacyltransferase"
FT                   /note="Orthologue of BL0347"
FT                   /note="PFAM_ID: Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38965"
FT                   /db_xref="GOA:A0ZZT2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT2"
FT                   /protein_id="BAF38965.1"
FT                   /translation="MTNVSAAGGTMEAMASKGKPSPRSAVKPLSDEQVAKLAQKHHLVD
FT                   PTHDFPTGPRKANTTEIEAQNPKATHRLLTGCDVVLRNHSKVKAWGLEHVPETGPFITA
FT                   ATHVTMYDVFVPMVSMFHQGRRPRYMAKAEMAKWPLIGKWFQLVGMQPVQRRAGKAKAI
FT                   EETSVEILTSGRPLTVWPEGTVTRDPQKWPMSMKNGVGVIALESSRRLGYQVPLYCAVT
FT                   WGAASINHWWPWPRKNVVMCYDEALDYADLLDGCDSWGDEVPTDRADELTRRIRVRMTE
FT                   IMAEIRGEQAPDGYWDYRTMSRVKD"
FT   CDS_pept        251928..252926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0185"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /note="COG family: glycerol 3-phosphate dehydrogenase"
FT                   /note="NAD(P)H-dependent
FT                   dihydroxyacetone-phosphatereductase"
FT                   /note="Orthologue of BL0346"
FT                   /note="PFAM_ID: NAD_Gly3P_dh"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38966"
FT                   /db_xref="GOA:A0ZZT3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT3"
FT                   /protein_id="BAF38966.1"
FT                   /translation="MANVTVLGAGAWGTAFGQVLADAGNNVTMWAIEPEIVEGIRDHHH
FT                   NGVRLPSVETLPSNMTATGDRAEAVANADIVIVAIAAQFARVALTEFKGLIPETALVAS
FT                   LMKGIERTTGKRMDEVVMETLDLPAERFAAISGPNLSKQIADREPAATVVGCANIDNAR
FT                   TIATACTTDYFRAFVTRDVIGLEMCGSLKNVVALAVGMARGAGYGENTAAMIETRGLAE
FT                   LTALGEAAGADPKTFAGLAGVGDLIATCGSPLSRNYTFGSNLGKGLSVEEATKVSNGVA
FT                   EGVPTTDAVVALGKQYGVPTPLATAMSHVLDDGISCAQMLSELFGEGITEE"
FT   CDS_pept        253001..254137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="BAD_0186"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /note="COG family: D-alanine-D-alanine ligase and
FT                   relatedATP-grasp enzymes"
FT                   /note="D-alanylalanine synthetase"
FT                   /note="Orthologue of BL0345"
FT                   /note="PFAM_ID: Dala_Dala_ligas"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38967"
FT                   /db_xref="GOA:A0ZZT4"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZT4"
FT                   /protein_id="BAF38967.1"
FT                   /translation="MAKKRIVVMYGGKADEHSISCISAASALRALDTDKFEAIPVGITK
FT                   DGKWIVNGENPLGWSLDEGLPTVEKTPGAKDVVLEVALGQDGFFAREDDGTMTPFGHVD
FT                   AVFPVLHGPYGEDGTIQGLFEMMGVPYVGCGVLASAACMDKHYTKVLLAAAGIPVAPGI
FT                   TLDARSFDKASEFKTDADAIMAQVSEAGLQYPLFVKPSRAGSSFGVTKVEHEGDAAELA
FT                   AAVYEASRHDWRILVEQGIDAREIECAVLCPKAGEAPQASWPGEIVLDKRAEGDDQFYD
FT                   FDSKYMDAAASHVEVPANLPEETLNLVRETAKKAFVAVDGAGLSRVDTFVTKDGKVMVN
FT                   EINTMPGFTSISMYPKAWEATGVRYTDLITKLIEGVLR"
FT   CDS_pept        254369..255535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0187"
FT                   /product="possible solute binding protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type iron_thiamine transportsystems_
FT                   periplasmic component"
FT                   /note="Orthologue of BL0344"
FT                   /note="PFAM_ID: SBP_bacterial_1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38968"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT5"
FT                   /protein_id="BAF38968.1"
FT                   /translation="MNALRKIAVGSLAAVLACSMAACGSGNANSTDSASNTGKTVKVDE
FT                   KSAKATSISDFGGMDGLVAAAEKEGALNVIALPHDWSNYGDVISGFKKKYPKIKINEQN
FT                   PNASSKEEVDAGKTNKGTDAAPDVYDLGLAVASTSTDNFASYKVQAWDKIPDSVKDKDG
FT                   KYYADYTGIMSIGWNADKYGDIKSINDLTDPKFAGTVALNGKPAEAGAAFNGYLMINQL
FT                   AGGDIKNLQPGLDFFKKLKDCGNLTTVDVTDGTIDSGQTGVVMDWTYNQASYQKSLKAK
FT                   GVNWKFKTFKNAQVVSYYNQAINVDAPHPAAARLWEEYLYSADAQNDWFKGGANPVLLD
FT                   SMKKDGTVDQTTLKNAITIDGDPVSYTNEDSTRITTWLQDNWDKTIGN"
FT   CDS_pept        255537..256451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0188"
FT                   /product="possible permease protein of ABC transporter
FT                   system"
FT                   /note="COG family: ABC-type spermidine_putrescinetransport
FT                   system_ permease component I"
FT                   /note="Orthologue of BL0343"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38969"
FT                   /db_xref="GOA:A0ZZT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT6"
FT                   /protein_id="BAF38969.1"
FT                   /translation="MTAVLTSGAHAKRAGSSAISFAAHRRELGTIAVSIPFFAYTACFL
FT                   LAPTVIVIVGAFQSADGSFTVANFNKLFEANTIAAFGTSILVSVASAVIGAIVGALASY
FT                   ALVIGSKPNGLLRRMISAISSVLAQFGGVMLAFAFIATIGINGVGTMLIKQLTGYVVNP
FT                   NWLSSLPGLITIYCYFQIPLMIIIFLPAVDSIRPQWREATESLGGNTFQYWTRVAGPIL
FT                   APRFISAFLLLFASAFSAYATAAALFSQRSILVPLMIQGAMRNEMDPNQQGFAQVLAFA
FT                   MIVVVAVVMMISHAVEKRAGRWQ"
FT   CDS_pept        256499..257356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0189"
FT                   /product="possible permease of ABC transporter"
FT                   /note="COG family: ABC-type spermidine_putrescinetransport
FT                   system_ permease component II"
FT                   /note="Orthologue of BL0342"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38970"
FT                   /db_xref="GOA:A0ZZT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT7"
FT                   /protein_id="BAF38970.1"
FT                   /translation="MQESQTMPPQLRAARLGKQRIVKTIILTVTLLFLFVPLVSMFLFT
FT                   IRHPLSGKWSFDPWIAIFTGDGSALGADLSTLWSGLGASLALCVVTVLIMLVLLVPTMV
FT                   IVHIRSRRLERAIEWVATLPLTIPAIVLVVGLGPIYRWLSADVLSTNPIWLCFAYVVLV
FT                   MPFAFRALAVGLNSIDVKTLCEASRSLGASWPRVFFRVLIPNLWQSILSASFISIAVVL
FT                   GEYTVASLLGRMNLQVALYQLGQSNSQISTAMSLLALLFGVILLVALDLISGAMRRNKE
FT                   GDNS"
FT   CDS_pept        257353..258540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msiK"
FT                   /locus_tag="BAD_0190"
FT                   /product="similar to ATP binding protein of ABC
FT                   transporter"
FT                   /note="COG family: ABC-
FT                   typesugar_spermidine_putrescine_iron_thiamine
FT                   transportsystems_ ATPase component"
FT                   /note="Orthologue of BL0341"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38971"
FT                   /db_xref="GOA:A0ZZT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT8"
FT                   /protein_id="BAF38971.1"
FT                   /translation="MTLAEQKAVVAHTSEAFSDTEPNVVTEAAKAVLKDSEARGGGVQM
FT                   LGVDKIYPGSTVKALDDFNLEINPGEMVVLLGGSGCGKSTALRSLAGLEDIQAGRILVG
FT                   GQDVTGVPVNKRDMAMVFQAYSLFPHMTALQNVEFGLEIRGVDRAERRRQAMEKLELVG
FT                   LADQAKKYTQQMSGGQQQRVALARALAVNPRVLLLDEPLSALDAKVRVQLRDEIRRIQL
FT                   EAGTTTVFVTHDQEEALAVADRIGVMNHGRIEQIADPQTLYRRPGTEYVATFIGLTNRL
FT                   PGIANGEEAVVFGQRVPLLDGSATDASTVLVRPENMTIELTDDADAVHGAGELGRVEMV
FT                   HFLGALARVDVRVACAGMGGTIRVTVQLPANELPAGLAIGAQVVVAPRPIPALAV"
FT   CDS_pept        258736..259854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0191"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted metal-dependent
FT                   membraneprotease"
FT                   /note="Orthologue of BL0340"
FT                   /note="PFAM_ID: Abi"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38972"
FT                   /db_xref="GOA:A0ZZT9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZT9"
FT                   /protein_id="BAF38972.1"
FT                   /translation="MTFPQQPQQPQYPQYPQGPAPQYPQSQFPQQLQQPNRNPFFEWLQ
FT                   RAKRDFSRIGASLCLMVIIWYAGVFLLKGVVRAVAGGVGAGGDMPNWMTFLISDVPLYL
FT                   IAMPVAVVLMGKSTVIETRKFNMKPGMFFKLLLMCLPMMWVGSMVGSMLSLALSDGEAT
FT                   NRVADLAMQTNIWNVVFLVILGPIFEEWMFRKQLIDHTRKYGEKTAILLSGLAFGLFHM
FT                   NLFQFFYAFLLGVMFGYIYMRTSKLRYSTAMHMIINFNGGVLAPWILTRVDLDQLDKVS
FT                   QAAENGNVAAMEQWASQNATGLAIMLVYFLLYGAVILAGFVLLIRNFRKAEFYIAPEEL
FT                   PRGTGARTVYGNVGMITFIVLTVLLTAISLFL"
FT   CDS_pept        complement(259963..260748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0192"
FT                   /product="hypothetical protein"
FT                   /note="COG family: small-conductance
FT                   mechanosensitivechannel"
FT                   /note="Orthologue of BL0339"
FT                   /note="PFAM_ID: MS_channel"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38973"
FT                   /db_xref="GOA:A0ZZU0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU0"
FT                   /protein_id="BAF38973.1"
FT                   /translation="MDPVEILMHWLAKNYSKLILLAVVLIVAALIDKALTKVVRRMLDK
FT                   SQVPNASIFVNILRVVVWVFAIGTLLQPVFGINPTTLFTALGIGGLAVSLGLKDTIANV
FT                   IGGFGLMLGRVIQPGDYVKVAGITGTVKDINWRQTIVRERNGNEMVIPNSILNTASLEK
FT                   LDPSNECLVSVPFTAKAGVDVERMKADIVSTVEHATVGLANPQYKPVVKLNGFTPYGID
FT                   GTIYAFAKNDLLLSTMADAVAQSIAHADYLEHRAVGSGE"
FT   CDS_pept        260880..262085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0193"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0787"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38974"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU1"
FT                   /protein_id="BAF38974.1"
FT                   /translation="MGNVVDYVRREFHGFAELPFGDVDSLVLAELSYMRLSGLVPAFGE
FT                   ARSVATVPIRELLRAESYDDMFVSNSSDMNEYRLALLRAVCESPRFRALRVGEYAERLS
FT                   EREQQQFAAMTFDVGCGPVDSLYVAFRGTDGTLVGWKEDFNMAVRCPVPSQESAYRYVN
FT                   SILDRSEGFLSSGDSPAVMLGGHSKGGNMAVYAAMRIAHDDIEVAGERARRLGLLPSLG
FT                   GPVRGRNRRISRIFSHDGPGLPKSTVRGQAYRAIESRIRKTVPESSVVGMLLQSNAPVR
FT                   IVKADAIGIMQHMGNSWQVAENGDFEQVDELTAGAQLIKRTLDGWLDTVSQEQRERAID
FT                   QIYGIFAAAGYGNIADLVEHWTDSLPKIVEAARNTDRETRGLIRAVIKAIPVSAAKAVR
FT                   EG"
FT   CDS_pept        262422..263630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0194"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0336"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38975"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU2"
FT                   /protein_id="BAF38975.1"
FT                   /translation="MGNIIDYARTETRDFGELPFREADALVLAQLSYDDVPECVPRLDD
FT                   IESRYGTLHDRVKQFDPRHPIRSVRMLRKPPFDGVTIARADDELHHGSAVPDHNVENVG
FT                   LVDPQVTHDFYHAIAANPRFSDIEMGAFLEQFDGDEQTQFAAVTYRLPSGMLVVAFRGT
FT                   DDSLVGWKEDFNMAFQYPVPAQVTAADYLARVAELWKDVPIVLTGHSKGGNLAVYAAMN
FT                   AEDGVKDRIERIYSLDGPGFPEAVVNSFEYASVSDRIVKIVPDSSVVGMVLETPERCIV
FT                   VKSDVEGIMQHFVFSWQMHGGEFDKVEDVASSSVTFNKALNKWLANLSKEQRERAVDAL
FT                   FAVLEASGAGSISAMMAAGPKVIPEMLGTYVGLSGEDRRNLNQALAIMLQAALARNPKV
FT                   RRK"
FT   CDS_pept        263786..264463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0195"
FT                   /product="hypothetical protein"
FT                   /note="COG family: transcriptional regulator"
FT                   /note="Orthologue of BL0337"
FT                   /note="PFAM_ID:tetR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38976"
FT                   /db_xref="GOA:A0ZZU3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU3"
FT                   /protein_id="BAF38976.1"
FT                   /translation="MPRPRRDSEILPAKERLENAFWELLSEREYRKITVTDIVRTADVN
FT                   RNSFYYHFTGLPELADSAILHAVENTPLPSAPNANFNPDNEWRKHVTALLREPEQRQRL
FT                   DRLALLAGPHSSPELVESLQDFGRLTLISVLGLDADHLDLKTDLMLDFTVGGMLAVLRR
FT                   WPKLHEQLPMDAVFNEDVAVLATGIFMSMSKTDMLGYWKRIFSSGFVAGQGVQSEAEQK
FT                   AEQ"
FT   CDS_pept        264568..265758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0196"
FT                   /product="probable aminotransferase"
FT                   /note="Catalyzes the formation of oxalozcetate
FT                   andL-glutamate from L-aspartate and 2-oxoglutarate"
FT                   /note="Orthologue of BL0783"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38977"
FT                   /db_xref="GOA:A0ZZU4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU4"
FT                   /protein_id="BAF38977.1"
FT                   /translation="MINEAYKAMLGGKSVIRELSEYATARGAEIGYENVFDYSLGNPSV
FT                   PCPQDYTDAVIDMYKTAEPVALHGYSPSLGISSVRKAIAESLNRRFDMDYTADYIFPTT
FT                   GAAGALTHALRVVTKPGDEVITFAPYFPEYQPYVNGTGAHLTVVPADTENFQINFDAFE
FT                   KALNPGTAAVLINTPNNPSGAVYSAETLTRLAEVLNAKQTEYGHDIFLIADEPYREIVF
FT                   DGGEQPYPSKFYDNTLSCYSYSKSLSLPGERIGYVAVNPRATDAKLIVPMCGQISRGTG
FT                   HNCPSSTAQLAVAKVVDETSDLSVYETNMNLLYDALTRLGFDVVRPGGTFYIFPKALEE
FT                   DANAFCMKAKDYDLILVPSDSFGVPGYFRMAYCIDTEKVERSIAALEKFVHEVYGR"
FT   CDS_pept        complement(266073..266966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0197"
FT                   /product="putative 6-phosphogluconate dehydrogenase"
FT                   /note="Catalyzes the formation of D-ribulose
FT                   5-phosphatefrom 6-phospho-D-gluconate"
FT                   /note="Orthologue of SCO3877"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38978"
FT                   /db_xref="GOA:A0ZZU5"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU5"
FT                   /protein_id="BAF38978.1"
FT                   /translation="MQLGMIGLGRMGGNMAKRIAAAGHEVVGYDHSPESDRTVASLKEL
FT                   VAALKAPRLVWVMVPAGEATDSTINELAELLQPGDMIIDGGNSRYTDDARHAAELEPKG
FT                   IHFMDCGVSGGVWGIDRGYALMVGGSQGDFESARPIFEALKPEGDSGLVLAGPVGGGHF
FT                   AKMVHNGIEYGMMQAFGEGFATMVKSDLVEDPAAVMSSWRDGSVVQSWLLDLLAIAFKS
FT                   DPTLKSMPPVANESGEAKWMIEAALELGVPTPATAAALYARQTSRGGADNILRVVSTMR
FT                   AQFGGHVTKIDEIATH"
FT   CDS_pept        complement(267153..268481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0198"
FT                   /product="gluconate permease"
FT                   /note="Orthologue of PPA0738"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38979"
FT                   /db_xref="GOA:A0ZZU6"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU6"
FT                   /protein_id="BAF38979.1"
FT                   /translation="MNLIAAAIIGIAVIVLLIAACKVHPFLSLLAGSFVMAVCAGVPFD
FT                   KAFDSFTSGVGGTISNVGLLIAFGSIIGTILFKSGGADTIVDTIMAKTPLQRLPWAMAL
FT                   IAFIVGIPMFFEVGVVILIPVVLFAARRSKSPVVLLGIPALAGLSTLHAFVPPHPGPLT
FT                   AIGALNANLGITLALGLIVAIPTVIISGPLFGRLAAKWVPIAAPENEAEAEAPKSAENR
FT                   PSFGTALSVILLPVVLMLAASIVDLTGQNTTAWGRVIAFLGTPLVALLITTVFAMVALG
FT                   YMQKFSRDAVNGMVGQSFGSVAGIILIVAAGGGFKQTLVDSGIGDVIANSITESAMNPL
FT                   IAGWLVAVLIRLATGSATVATVTASGIMVPLAAGMSPTHLALLVLAIGAGSVFFSHLND
FT                   AGFWLVKEYFGMSVGQTLKTWSLMETILSVVGLGCVMLLSLVL"
FT   CDS_pept        complement(268564..269100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0199"
FT                   /product="putative gluconokinase"
FT                   /note="Orthologue of SCO1679"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38980"
FT                   /db_xref="GOA:A0ZZU7"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU7"
FT                   /protein_id="BAF38980.1"
FT                   /translation="MSIHVVVMGVAGCGKSTVAEAIHERLGYVYAEGDDFHPQANIDKM
FT                   SAGIPLTDEDRWPWLKVINTWMVAREALDENTVVSSSALKRSYREVLAQNVPTFFVHLT
FT                   GSQELIQQRLNERKGHFMPPALLPSQFAILEPLQPDENGVEVSIEGSVEEMVERAVAAV
FT                   NEYAAKVASQSQQAE"
FT   CDS_pept        269371..270090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0200"
FT                   /product="putative transcription factor"
FT                   /note="Orthologue of CE2422"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38981"
FT                   /db_xref="GOA:A0ZZU8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU8"
FT                   /protein_id="BAF38981.1"
FT                   /translation="MAGNENGGELLQDAVCRTLAIEMLDGKWPAGESLTLEDVQNRFGI
FT                   SRTVAREVAKTLESMGAVTVRRRVGLVARPFSDWQALNHQVIEWRLHSTQRERQLSSLT
FT                   ELRLAVEPAAAASAARLASIDVKAKFPVYAAQMRQIAESNEEGAAGLTKFHDLDVEFHT
FT                   LILRESGNELFAALADTIATVLRGRVELGKYPMKPKPAALDAHDAVADAIAKGDPERAR
FT                   KAMFDIVDEVARALNFF"
FT   CDS_pept        complement(270134..270925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0201"
FT                   /product="hypothetical protein"
FT                   /note="Best Blastp Hit: gb|AAC95491.1| (U73025)
FT                   unknown[Staphylococcus aureus]"
FT                   /note="Orthologue of SMU.174c"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38982"
FT                   /db_xref="GOA:A0ZZU9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZU9"
FT                   /protein_id="BAF38982.1"
FT                   /translation="MSLANELVEAVSAWPEVEAITLGGSRATGDNDEKSDYDVYVYVTA
FT                   PVSAERRRRLLRNYCSHMEIDNDFWETEDDCTLNDGTNIDVLYRDLDQFAANVADVVER
FT                   FQASNGYTTCMWHNMLTSKVLFDRDGQYAATRQRFDVPFPEELRRNIINRNMRLLTGNL
FT                   PSYDAQIRKAASRGDKIAVNHRMAAFMESYFDVLFALNRRTHPGEKRLDKLAERDCAIL
FT                   PKDFRKNIDTLFDSMYADQAVFSETLGEIVDDLRQTVDANL"
FT   CDS_pept        complement(271142..272404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0202"
FT                   /product="hypothetical protein"
FT                   /note="COG family: permeases of the major
FT                   facilitatorsuperfamily"
FT                   /note="Orthologue of BL0332"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38983"
FT                   /db_xref="GOA:A0ZZV0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZV0"
FT                   /protein_id="BAF38983.1"
FT                   /translation="MMTPREKKWIVYDVGNSAFVLLSTAVVPIYANSLLKAAGETNIVS
FT                   TWGYAQTIASLVIAVLMPLLGSIADVQGMKIRFFTGFFLTGVVMCCAMAMPLGWLAFLI
FT                   VYVLSTIGLNGSLTFYDSMLVDTTSNERMDRISSHGYAWGYIGSTVPFIVCIALIFGGP
FT                   ALFGWSTTACTRASFVITALWWVAFTIPLLTSYKQVHYRATAGQAGEAIRGTFAELGST
FT                   FRAIRKNKPLWMFMIAFFFYIDAVNTVISMSTSYGTQLGIDSTQLVVALLVTQFVAFPC
FT                   SIIYGKLAGRFGSKTMITAAVVAYMCIVFFAAFFLRAALEFWILAILVGMFQGGIQALS
FT                   RSYYGKIIPKDHANEYYGFYDIFGKTASIIGTFLVATTTSLTGNASIGVLSIAILLAVA
FT                   LVFLLLQKDPTKGSTEAATVD"
FT   CDS_pept        272820..273014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="BAD_0203"
FT                   /product="50S ribosomal protein L28"
FT                   /note="COG family: ribosomal protein L28"
FT                   /note="Orthologue of BL0330"
FT                   /note="PFAM_ID:Ribosomal_L28"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38984"
FT                   /db_xref="GOA:A0ZZV1"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZV1"
FT                   /protein_id="BAF38984.1"
FT                   /translation="MAARCAVCGKGPQTGFTVSHSHIRNKRTFRPNLQPVRTTIDGENV
FT                   RVRVCVKCIKAGKVQRVEA"
FT   CDS_pept        273157..275838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="BAD_0204"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="COG family: RecG-like helicases"
FT                   /note="Orthologue of BL0329"
FT                   /note="PFAM_ID: helicase_C"
FT                   /note="PFAM_ID:DEAD"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38985"
FT                   /db_xref="GOA:A0ZZV2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZV2"
FT                   /protein_id="BAF38985.1"
FT                   /translation="MTQWSVMSTTWQTPISSFETNRRRVGALKSLGVVSVGDALTYYPF
FT                   RVTEPVPARALREAKIGENMAFAAHVRGVRVFPMARRGFRLIADVDDGDFARSRHMDAS
FT                   MASLVFFSYRKSYVDWIQRKLHEGALLVVAGEPSVYNDRLQFTHPDILTVDPAGEQLRS
FT                   RSSEEAAEWDDGFGTEQPAVVPQSSTMPNLKYDAASVPEAMRHVCRPRPVYHANSRISS
FT                   EHIHESIEKCMDRLCGDEYAAAQAARALHGADASDAQHGEFDAPQADRQARTEALAAAI
FT                   PDIMPEAFRMEHGLMHRAEAFRAIHDPQNRDGFNKALRTLRYEEALICQTALVQSRDSS
FT                   RKATATACADTRLKDDFVESLPFSLTDGQQQVIADISDDMARDYPMQRLLQGEVGSGKT
FT                   VVAVAAMMQAVGSGKQAVLVAPTQVLAEQHYSSIRGMVDRMCGTGEEADENAKSGESQT
FT                   KSTHRAVVDESGQVTSGNAPEPQNGGQSDGGQVEKLLDGQSNSLPDIPVLLLTGGMKLA
FT                   ARRRVLAQAASGKPCIVVATHAAFSKTFQAPNLALAVIDEQHRFGVEQRESLNAKGSTA
FT                   PHLLVMTATPIPRTAAMTWFGDLDISWLTELPGGRKPIRTFVVPEANGPLMAEMFGLIR
FT                   KRIDAGERAYVVCPRIDADAKDADDAGGSGDAEVGSAFDATYDLGEDDEQREQRPPLHS
FT                   VAEIAERLRSLPQFAGIRIATLTGRDDDETKSQIMADFEAGVTPILVATTVIEVGVDVA
FT                   QASCMVIFDADRYGLSQLHQLRGRVGRGGTESGAFLISRAPEGSDAAKRLDVIAGTLDG
FT                   AEIAQADLEFRGAGDVLGDAQSGGKSGLKLLRVVKDVKIIEEARAEAAKLVAEDPTLQG
FT                   YVQLAGAVLDFTRGNETFLTSN"
FT   CDS_pept        275844..276473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0205"
FT                   /product="hypothetical protein"
FT                   /note="COG family: N6-adenine-specific methylase"
FT                   /note="Orthologue of BL0328"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38986"
FT                   /db_xref="GOA:A0ZZV3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZV3"
FT                   /protein_id="BAF38986.1"
FT                   /translation="MVMRVISGRFKGMALTTPKPGTRPTTDRTKEAIFSHLDSWGVLDD
FT                   ARVLDLFAGTGALGIEALSRGARELVAVESAAPAAALIAKTLTALKHNRSWEPGMSARV
FT                   VKARAEKYAAAASAIAPFGVIFIDPPYAFETEACNRLLADLAGRESGELTGEGTVIVLE
FT                   RSTRSDEPTAPEGWDITDRRDYGETAVYYIEPAETAEPAEPVESAD"
FT   CDS_pept        complement(276548..277468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BAD_0206"
FT                   /product="tRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="COG family:tRNA-(guanine-N1)-methyltransferase"
FT                   /note="M1g-methyltransferase; tRNA [GM37]methyltransferase;
FT                   TrmD"
FT                   /note="Orthologue of BL0327"
FT                   /note="PFAM_ID: tRNA_m1G_MT"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38987"
FT                   /db_xref="GOA:A0ZZV4"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZV4"
FT                   /protein_id="BAF38987.1"
FT                   /translation="MKIDIVSVFPEYFEVLNLSLLGKAQEKGLVEVTAHNLRDWTHDVH
FT                   HSVDDTPVGGGAGMVMKPEVWSECLDELLHLEPTTVTCDSMVTCDSTADADDTASADAA
FT                   EPAESATEIAANADTVPATDRPVLIFPNPSAPLFTQQDATELSHANHLLFGCGRYEGYD
FT                   ARIPQYYRAQGVDVREYSIGDYVLNGGEVAVSVMLEAITRLLPGFMGNAASIVEESYTG
FT                   ENALLEHRQYTKPADWRGIKVPDVLLSGDHAKVDRFRRDEALAKTNELRPDLIEALDCS
FT                   KLDKADRKTLMALGWEVSGAHPRQR"
FT   CDS_pept        complement(277561..278148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0207"
FT                   /product="probable 16S rRNA-processing protein rimM"
FT                   /note="COG family: RimM protein_ required for 16S
FT                   rRNAprocessing"
FT                   /note="Orthologue of BL0307"
FT                   /note="PFAM_ID: RimM"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38988"
FT                   /db_xref="GOA:A0ZZV5"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZV5"
FT                   /protein_id="BAF38988.1"
FT                   /translation="MHSDDPQQLELLRVCRIGRAQGLKGEVTVQIFTDEPEYRFAPGAV
FT                   LYTKDGEEEYVVESSRTFKNRWIIKFEGIDDRDASEAANGVVLYGEADDPEEMLEADEW
FT                   YPKDLISLEARLAEGNTLGLAPGTVVGKVVDVIEVAQWLLKIRLANPVKDADGVVVENS
FT                   ALVPFVDELVPDIDLEGGYLTLDPPGGLIPGL"
FT   CDS_pept        complement(278170..278403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0208"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted RNA-binding protein
FT                   (KHdomain)"
FT                   /note="Orthologue of BL0306"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38989"
FT                   /db_xref="GOA:A0ZZV6"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZV6"
FT                   /protein_id="BAF38989.1"
FT                   /translation="MLAQAVEHLIKNIVDFPDDVSVKSHENPRGELIRVRVNPEDIGRV
FT                   IGRSGRTANAIRTVVQALSDHKVRVDIMDVRR"
FT   CDS_pept        complement(278406..278855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BAD_0209"
FT                   /product="30S ribosomal protein S16"
FT                   /note="COG family: ribosomal protein S16"
FT                   /note="Orthologue of BL0305"
FT                   /note="PFAM_ID:Ribosomal_S16"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38990"
FT                   /db_xref="GOA:A0ZZV7"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZV7"
FT                   /protein_id="BAF38990.1"
FT                   /translation="MATKIRLKRMGKKFYAFYRVVIMDSRTKRDGRAIEEIGTYNPNTQ
FT                   PSTININSERAQYWLGVGAQPTEQVLNLLKITGDWQKFKGLDGAEGTLKTVEAGPDAAA
FT                   RVEAVEAQAQKLKAAKSEADAKAKAEAEAAATEEAPAEEPAAEAE"
FT   CDS_pept        279222..280256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0210"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0304"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38991"
FT                   /db_xref="GOA:A0ZZV8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZV8"
FT                   /protein_id="BAF38991.1"
FT                   /translation="MSVALWIVLLVCVLWIALSEMPAGWDGHLPLPYLIALTPLLWIPT
FT                   LAIAIAGAVRHDTALAVVAAIACIASLLRKIAYWNNNLTSINTAQMVADNIAKKRETSR
FT                   GTHTSTAAEAAKHGRFRVMTLNCRYGRANAAAIVSAVKEHDVAVLALQELTDDLVAALD
FT                   EAGLSDLLPYRQLGENKDTDNGGFNGIWIRIEPSDTSPITAVIPAADVPGVCFPIDAMR
FT                   GITFVSAHPKSPMRGCRDWSAGIIGLGELATSQKQGDITVVLGDLNSGTDHPSFRKLLD
FT                   AGFQDAALTEAKGRRATFPSWLPWPRLILDHILFTAGLTASDVRSFTVNGTDHLALAAT
FT                   LTLK"
FT   CDS_pept        complement(280400..282049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BAD_0211"
FT                   /product="signal recognition particle protein"
FT                   /note="Identified by sequence similarity"
FT                   /note="Orthologue of Lxx14950_BL0303"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38992"
FT                   /db_xref="GOA:A0ZZV9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZV9"
FT                   /protein_id="BAF38992.1"
FT                   /translation="MAAFSSLTDRLSNAFKHLKSKGKLSEADIDGTIREIRRALLDADV
FT                   ALDVVRSFTSRIRERALGTEVSEALNPAQQVVKIVNEELTAVLGAGVDRPLNFAKNPPT
FT                   IIMLAGLQGAGKTTLAGKLGYWLKDSGHTPLLVAADLQRPNAVTQLQVVGERAGVPVYA
FT                   PEKGVQSDGGEAVVSPGQTTGDPVKVARDAVELAKQKLYDTVIIDTAGRLGVDEELMKQ
FT                   ARDIRDAVQPNEILFVIDAMIGQDAVQTAKAFDEGVDFTGVVLSKLDGDARGGAALSVA
FT                   SVTGKPILFASTGEGLKDFEVFHPDRMASRILDMGDILTLIEQAQKQFDEEEARKAAVK
FT                   ISDGSFGLDDFLDQLQQVRKLGPMKNLLGMIPGMAAHRKELEQFDEREIDRTEAIIRSM
FT                   TPAERRDPSIIDGSRRARIAYGSGVTVSQVNALLQRFDQAAKMMRRMSNKVGAGVPGFG
FT                   GPAMGGGKGKGKGKKNKKKSGKSGNPMKREAEEKALRDKLAGKASDGASSGGSAFAKKP
FT                   QNPALPAGLQDMLGDSGELPPNLGGGLSGLLH"
FT   CDS_pept        complement(282105..283736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BAD_0212"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="Catalyzes a two-step reaction_charges a cysteineby
FT                   linking its carboxyl group to the alpha-phosphate of ATP
FT                   then transfers the aminoacyl-adenylate to its tRNA"
FT                   /note="Orthologue of BL0301"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38993"
FT                   /db_xref="GOA:A0ZZW0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW0"
FT                   /protein_id="BAF38993.1"
FT                   /translation="MTNTQEPQNTNTSGALAVAKAAAGLKLYDTASHAVSSFTPIKPGQ
FT                   VGIYACGATVQSSPHIGHIRAAVAFDVVRRWFERLGYKVTFVRNVTDIDDKILDKAAAA
FT                   GQQWWERAYIYEREFTEAYSKLGVEPPTYEPRATGHMIDMIDLIKKIIDNGHAYVVRDA
FT                   DGNPTGNVYFDVASWPHYGELTHQKQTAVSDAASEVTDAMGPSVDNAGNDKYNPVDPAD
FT                   MSPDKHDPRDFALWKAPKDSDPLDARWNTPFGTGRPGWHIECSAMSHRYLKDMFDIHGG
FT                   GLDLRFPHHENEMAQTRAAGYDSAARWMHSAWVTAKGEKMSKSLGNGLSVPAVLAEHSA
FT                   WVVRYALGSVQYRSMLEWSDQTLAEAQSAYDRVANFIERAGAAVGEQPSREEIMAISAD
FT                   ALPADFVAAMNDDINVSGASAAIFTAIRSGNTLLSKLADRADSDVAKAEVREALVNVRA
FT                   MLDTLGLDPLAEPWVSDGAAGGAAGAGADSAEHDALDKLVSEQLAERAEARKAKDFARA
FT                   DAIRDALGAAGIAIEDGPQGSTWSLK"
FT   CDS_pept        283872..284600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0213"
FT                   /product="possible amidotransferase"
FT                   /note="COG family: GMP synthase - glutamineamidotransferase
FT                   domain"
FT                   /note="Orthologue of BL0300"
FT                   /note="PFAM_ID: GATase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38994"
FT                   /db_xref="GOA:A0ZZW1"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW1"
FT                   /protein_id="BAF38994.1"
FT                   /translation="MTQSHVLILQHVPWEKPGRILDSLDDLGMSYEVMNIAKEKKPDLP
FT                   DFSDVSGIVIMGGPMGALDIDKYPGLKAESKLVRAAVSVGKPLLGVCLGHQIIATALGA
FT                   KLKKGSEPEIGFAPIKRIDKHDYFSMWNKTLDVLHWHNDVVTLPEGAQPLAKSAKTKNQ
FT                   AFRFGSALGLQFHLEVTPTLLDEWLDEPCMVKDLKAAGGSKSQLRDAFAEYNPQLQPMA
FT                   DQVFSGFAARCNTYAATLER"
FT   CDS_pept        284912..287068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0214"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG family: ATPase components of ABC
FT                   transporterswith duplicated ATPase domains"
FT                   /note="Orthologue of BL0299"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38995"
FT                   /db_xref="GOA:A0ZZW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW2"
FT                   /protein_id="BAF38995.1"
FT                   /translation="MPTYDLGLEHVSLAFATKNIFTDVTQGVFEGDRIGVVGKNGDGKS
FT                   TLLHLFKGTQEPDSGRVTMRNGLTFGMLDQRDPLDDNATVREAALEGREDYEWAAETKS
FT                   REIVEALLGGISLDAKIGSLSGGQRRRADLARLLLKDWDILALDEPTNHLDVVTIHWLA
FT                   EHLKNRWPSGQGALLLVTHDRWFLDEVCESMWEVHDGVIDPFEGGYSAYMLQRVERDRQ
FT                   ADVRETKRRNLARKELAWLTRGARARSTKQKFHVKAARELIADVPPVRNTLELKQMATS
FT                   RLGKQVVDLIDVTQIFEHAQGEADIDPDVAEMEASASRVDVVPAMYAEPQAHGSVEVAV
FT                   DDLTDPRLVDAGVPEARQAAQAARQAEEESHESGDDADESTPEVTSAAQKVTVTGRKIL
FT                   DDVTWLIGPGDRFGIVGANGAGKSTLLKILDGTITPTAGHVNIGKTVKFAVLSQRLDEL
FT                   EKLGKYKIKEVLSRYKPSYIVDGKETTPGQMMERLGFESAQLMTPIKDLSGGQKRRMQL
FT                   LLILLDEPNVLIMDEPGNDLDTDMLAVMEDLLDTWPGTLIVVSHDRYLLERVTDQQFAL
FT                   IGGKIRHLPGGVQDYLDMTEAIKNGKDPFVDEKAGKASKGGNAAASTGAAGDSSSVSAD
FT                   GDSTASAPKLTGKAFHEASKRVAAIERKLAKLEEQKADLEAQMAAHDPSDYEGLGKLNE
FT                   QLQSVTDESESLEMEWMELSEQLE"
FT   CDS_pept        287356..287994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0215"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of STH1505"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38996"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW3"
FT                   /protein_id="BAF38996.1"
FT                   /translation="MRQQGVALEISVSYSCSYGGGAVLRKNNQWGCLMNQVMRRSVCCL
FT                   LSALLLCSCAGCANSVHETSDGDAARSSSKNDDAAEQAYKAFTVDALDRVAADDLNNSD
FT                   KLVLVNKLGAKSVHGDGAIPFAKKVDENHMYYVVSMCKQKEQAPYSLVLYKDGQPHTLT
FT                   TRESCTSNGVETVSLPAKNFLGATSLSIINIGNTDLVVSVYEVKESHRE"
FT   CDS_pept        complement(288010..289137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0216"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of MAP4318c"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38997"
FT                   /db_xref="GOA:A0ZZW4"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW4"
FT                   /protein_id="BAF38997.1"
FT                   /translation="MRLPQQIMSLAKAVRKPYLAGSIICICFFLLELTAWPNMSPWSWL
FT                   YLAPYCIALLLLAWFPVPASMAILVTHIACAIIPAICDGPSTLYGTWLACGIIAFEIKR
FT                   FEFAIMGPLLCALALPLGYWTGGIDYNPSIPVLACSYIGAFCVGFAVRWKAQTAQRKMD
FT                   LAIAQEQVRRQQKRLKEIHILHDSIAGAMTYAILLCRKKESSESSDTLPQIEQVLMQAL
FT                   HELRTQIISPMTDELKTDKEEDADELFQQHIEAQCKRLRILGFTGTPIIRGNLNAMDKS
FT                   LLPSLQTVCTEILNNIAKHGKPGAFAFILSVGPDAVRIFASNLYNAAINSAPENHYGTA
FT                   LIQDFAQQHNGTMTINSENEEWSLSLAIPLTHQTH"
FT   CDS_pept        complement(289140..289769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0217"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain and a HTH DNA-binding domain"
FT                   /note="Orthologue of CP000255.1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38998"
FT                   /db_xref="GOA:A0ZZW5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW5"
FT                   /protein_id="BAF38998.1"
FT                   /translation="MRTIVNDPTLGIVDNDPLVASAIQSLLVETCAPIRILWTVTSAEQ
FT                   ALEAMRDSAQRPQAVLTDIAMPGMNGSELAHHIKEQHPDIAVIGISAFLDDENEKRYGA
FT                   QWSDAFYAIIPKEIPTIQLVRIIGKATGNDEVASWAGKSINSMRLSGKELQIIAGYARG
FT                   FTTSTIAHQLNISEASVKTYARRAFEKLHAHSRAEAVAMCVRNGWI"
FT   CDS_pept        289936..290547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0218"
FT                   /product="ArsR-family transcriptional regulator"
FT                   /note="Orthologue of SAV6161"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38999"
FT                   /db_xref="GOA:A0ZZW6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW6"
FT                   /protein_id="BAF38999.1"
FT                   /translation="MNDTNSNEGQLPEDAAVTVTSADTLRAMASPIRMRILGTLRVNGE
FT                   QTVGSISEQLGEAPGAISYHLGQLAHAGLVKKVESPDGDRRKSWWKACQSAIRLGRPEE
FT                   KNGTDESKAMDLFRRSAALSYEMAYERFLDRLPELPREWADSCTSDDHVLNLTAEETSS
FT                   MIEELNEVVRRWQIKAGMHGDDELGVEPVALILQAFRWVS"
FT   CDS_pept        290625..291896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0219"
FT                   /product="hypothetical protein"
FT                   /note="COG family: permeases of the major
FT                   facilitatorsuperfamily"
FT                   /note="Orthologue of BL0759"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39000"
FT                   /db_xref="GOA:A0ZZW7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW7"
FT                   /protein_id="BAF39000.1"
FT                   /translation="MEQSMSETTKSFWHSAGYIPWFTADTASAVGAALRALAISLLGYA
FT                   VSGSTIAAGWLGTSSMIAQQVASVFGGTFVDRHDRKRLIVANAVVGVLAWGAIAVLLLC
FT                   GALSFPVLLLIAVLASGINGFLGSATDAMLRSIIDIRYYPKARSLNEGRDATITMVGGP
FT                   IGGFLYSVAPWLPFLASACMYAVAGVAATGVREYGSDGGRIGEPDGDAAKGGFCHDFLE
FT                   GWSWSLHRKTLVIVLIVAALVNFGVNGIQYAIQLHLVSCGTNATLIGFISGGISLTMLV
FT                   GSLLAGKLSDKVPVGPTVCLAYLFICLCALPMALTDNYWVMLVANSLVGLPFPLINAML
FT                   LGFIFAKSPTSMQGRITVTLTVPAQVLSMFCSAVAGTLLPVFGFHGAVLLFLAVLVASA
FT                   VLVICSRSIRSIPKAAQWEHTMLR"
FT   CDS_pept        complement(291973..292527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="BAD_0220"
FT                   /product="acetolactate synthase small subunit"
FT                   /note="Orthologue of BL0297"
FT                   /note="With IlvI Catalyzes the formation of
FT                   2-acetolactatefrom pyruvate_ the small subunit is required
FT                   for fullactivity and valine sensitivity"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39001"
FT                   /db_xref="GOA:A0ZZW8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW8"
FT                   /protein_id="BAF39001.1"
FT                   /translation="MANYPASQPGSKRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRVTVTADVEEVPLEQIIKQLNKLLHVLKIVDLDPETTVERELVLIKVAA
FT                   DESNRSDVLEIVRLFRVRVVDVNPESLTIEATGAEGKIDALLGLLEHYGIIELVRSGAV
FT                   AVTRGPKALSEKVLGSEITGR"
FT   CDS_pept        complement(292560..294422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB1"
FT                   /locus_tag="BAD_0221"
FT                   /product="acetohydroxy-acid synthase"
FT                   /note="Catalyzes the formation of 2-acetolactate
FT                   frompyruvate"
FT                   /note="Orthologue of Rv3003c_BL0296"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39002"
FT                   /db_xref="GOA:A0ZZW9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZW9"
FT                   /protein_id="BAF39002.1"
FT                   /translation="MVLPTPLQAFSGMPKASATTEKQTIVDGEKMTGAEALVRSLEDLG
FT                   VKDVFGVPGGAILPVYDSIKDDTKFRFVLMRHEQAAGHAAEGYALTTGQVGVCIVTSGP
FT                   GATNMITPIADANMDSIPMVVITGQVGVNAIGTDAFQEADIVGATYPVVKHSYLVTRAQ
FT                   DIPRVLAEAHYIARSGRPGPVVVDVTKTAQTGEMYYSWPQRMILPGYNPTTKAHGRVLS
FT                   DAAKLFEQSYRPVLYVGGGAVRSDAGELVEELAEVTGAPIVTTLPARGIVPDSDPKVLG
FT                   MLGMHGTIAATGAVQRCDLLVAIGARFDDRVTGKLDAFAPGARVIHIDIDPAEIGKNRQ
FT                   PDVPIVGDVATVLKDLIPEIKREQAVHGKPDTSHWWDVINKWREEYPITWDEPTDGSLA
FT                   PQWVVKQLSDMADPNTVWVSGVGQHQMWATQIIEFNKPHSWLSSGGLGTMGFGLPAAIG
FT                   ARVGSAREFDDKKPVWLIDGDGSFQMTSEELAAAFLDHAPVKIALLNNSVYGMVRQWQT
FT                   LFYNHHYSATNLLDGENMSDIVDVPDFVKLAEAYGCVGMRAFTKDEAIECIKKANEIND
FT                   RPVLIDFRVWKDAMVWPMVAAGDSNDNVTYMPGVKPLQRAGENE"
FT   CDS_pept        complement(294724..295512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rncS"
FT                   /locus_tag="BCD_0222"
FT                   /product="ribonuclease III"
FT                   /note="COG family: dsRNA-specificribonuclease"
FT                   /note="Orthologue of BL0295"
FT                   /note="PFAM_ID: Ribonuclease_3"
FT                   /note="PFAM_ID: dsrm"
FT                   /db_xref="EnsemblGenomes-Gn:BCD_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39003"
FT                   /db_xref="GOA:A0ZZX0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX0"
FT                   /protein_id="BAF39003.1"
FT                   /translation="MTANVLLEALGTTIEPDLLVEALTHRSFSHEHEGAKNYERLEFLG
FT                   DAVLELVSTETLYKVHPDMNEGQLAKMRAKAVSEESLSKIAREKLHVGPYILLGHGEAE
FT                   QGGADKSSILCDIVESLIGATFIQHGIDEARRVVHHLVDDTLAEVATEGPALDWKTSLT
FT                   VKAHEMGLPDPHYQTSVAGPEYALEFTARAILGDGGEVIGVGTGSSKRKAQLAAAEMGW
FT                   KALDSRKGEMGGKQNGKTHKSHHRSHRKSNGGTQDAAQGK"
FT   CDS_pept        complement(295509..295640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0223"
FT                   /product="putative serine-threonine protein kinase"
FT                   /note="Orthologue of nfa46680"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39004"
FT                   /db_xref="GOA:A0ZZX1"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX1"
FT                   /protein_id="BAF39004.1"
FT                   /translation="MNGKEHPWPKRPIRTTRRTTPKPKTATIPTPAASAPPSPPKAR"
FT   CDS_pept        complement(295864..296058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="BAD_0224"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39005"
FT                   /db_xref="GOA:A0ZZX2"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZX2"
FT                   /protein_id="BAF39005.1"
FT                   /translation="MALPKYKTSRANTHSRRANWKAKAAQTVTCPNCGAPTLPHMACPS
FT                   CGSFRGRVYREAVRSIHTK"
FT   CDS_pept        complement(296154..296768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0225"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted metal-binding_ possiblynucleic
FT                   acid-binding protein"
FT                   /note="Orthologue of BL0293"
FT                   /note="PFAM_ID: DUF177"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39006"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX3"
FT                   /protein_id="BAF39006.1"
FT                   /translation="MARTEDSPWAVSVAQVASRPGQSKEIDATFPAPSGIGDEIVGVDE
FT                   GADVSVVGSFDSIVDGLILNARISAPVHAECTRCLKPIQRDWTVNVTSFFPYEDKSAAG
FT                   KGGKAGKNGKEEEVDIIAGEDEAEDTYPLLDGGAWADLEALLRDTLVEELPLQPLCKPD
FT                   CKGLCSQCGIDLNENPDHQHDMTDIRFAALEGLKAKLEGKE"
FT   CDS_pept        complement(296824..297654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0226"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0292"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39007"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX4"
FT                   /protein_id="BAF39007.1"
FT                   /translation="MMSEETNDFKPLADADDATSQQPVTPAADYPATGAVAGTAATNNS
FT                   ATGNAADRATDEPAKPAKSSKPSISMSDLPDLRATFDPDAPLDDSSDRSRDEFTTVYDI
FT                   IDSIEEELDEAKPILFAPSSVRVDRESFTGKLDKLKKMLPVQLERASALMRESERRLES
FT                   AQTQANVIIASAQSRAADTVREANEQAQFLAGQENVTELARQKARGILDQAQAKADKLT
FT                   QNADKYCITMMESLQQQVDKIGTGVQAGLNVLYDRQREAGAHLDHLDADDYPEN"
FT   CDS_pept        298301..298618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0227"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of Tfu_2388"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39008"
FT                   /db_xref="InterPro:IPR021400"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX5"
FT                   /protein_id="BAF39008.1"
FT                   /translation="MVFAIFDGLFGSDDPVSPLSNPDAGTGTAVLERPEEETKLDDGGN
FT                   GDADRFAHYVSRDRIAESKMTGRPVVALCGKVWVPKRDPTHYPVCPDCKRIYDEMMNSS
FT                   F"
FT   CDS_pept        complement(298805..300202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0228"
FT                   /product="hypothetical protein"
FT                   /note="Catalyzes the formation of
FT                   5-phospho-alpha-D-ribose1-diphosphate and nicotinate from
FT                   nicotinateD-ribonucleotide and diphosphate"
FT                   /note="Orthologue of BL0287"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39009"
FT                   /db_xref="GOA:A0ZZX6"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX6"
FT                   /protein_id="BAF39009.1"
FT                   /translation="MQPKIGHRGSYTYGQFHQKSRKALEMLDYSPALMTDMYEYTMLDA
FT                   CLKDGTANRKCVFEIFTRHLPLGRHYGVAAGQGRILDALEKFHLDDNDLKFLADRKVVS
FT                   PETIKWLENFHFSGSIKGYHEGEMFFPNSPILQVEGTFGECTLLETLLLSILNYDSAVA
FT                   SAASRMVSAAKDRPCMDMGGRRTNEWAAVAAARAAVVGGFKGTANLLAAQMYGLKAIGT
FT                   AAHCFTLVHDDERSAFESQIAALGKNTTLLVDTYNIEEAVKTAVDVAGPELGGVRIDSG
FT                   DLASLAQRVRNQLDALGATNTKITVTNDLDEYALASLQTAPVDSYGVGTMLVTGSGAPT
FT                   CAMVYKLTERENSAGEMQPVAKKSKDKATVPGRKLAFRSYEYSLADCEHVISGSEDKLA
FT                   AYQPEDGWKDLLVDYVTNGENHSEYQGHDAIVNAHNYRAQALAELPIGAQSLMKGDPVI
FT                   PTEVTVL"
FT   CDS_pept        complement(300207..300995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0229"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /note="Orthologue of BURPS1710b_1866"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39010"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX7"
FT                   /protein_id="BAF39010.1"
FT                   /translation="MLGGALDLDEIAGTGHGHVHVGHGLAVFDVRQVQHRLAVDHADGD
FT                   GGDPVLEHAVGGLDVLVFLGPMHRVDERHVRAGDRSGAGAAVGLQHVAVDLHLVFAERL
FT                   HIDDATQAAADQTADLVRTAADLAAHGLAVGAVGGGARQHRVFRGDPAQAGVLAPARHA
FT                   GGERGGAHHARVAAFDEHGAFRNVREMAGDAHRAQFVDLASVRTHHGLVAQHILNRYHC
FT                   CSALRFPLISAFAAVRLLVFSAFDPITSQARRASRPLLHV"
FT   tRNA            302036..302111
FT                   /gene="thrU"
FT                   /locus_tag="BAD_t0009"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:302069..302071,aa:Thr,seq:cgt)"
FT                   /note="codon recognized:CGT"
FT   tRNA            302204..302284
FT                   /gene="leuT"
FT                   /locus_tag="BAD_t0010"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:302238..302240,aa:Leu,seq:tag)"
FT                   /note="codon recognized:TAG"
FT   CDS_pept        302286..303293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0230"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted permeases"
FT                   /note="Orthologue of BL0281"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39011"
FT                   /db_xref="GOA:A0ZZX8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX8"
FT                   /protein_id="BAF39011.1"
FT                   /translation="MSTLIQPIALLAIILTGYLFKRAGKFKNRDYRIMQVALFNLVLPC
FT                   AIIYSFATNPHDSSMLWISVFGFVVAFIPPVLIFLTTRHTPVQDRAFTMLNGSGFNIGC
FT                   FCFPVAQAFLGTAAIVPAAMFDIGNCVMVAAGTNVMTQTLLHIQPGKTLDEQYQGHAPV
FT                   LPYTKPKDRDARRLARHALLRNVAKGFFGSIPFDTYLVMIVLMLANVKIPAVVATFVEP
FT                   LANANSFVAMLMVGMLMDLPAGRDDVMKLLKIIGLRLPFGLLSAVCAWFVLPFGANVRE
FT                   AVVMCCLAPIAVFSTLFTDEVLGNAKLAGFSLSVSAIIGLVMMTGAHFLLAAIA"
FT   CDS_pept        303566..305335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="BAD_0231"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="Orthologue of Rv0946c_BL0279"
FT                   /note="Probable pgi_glucose-6-phosphate isomerase (EC
FT                   5.3.1.9)"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39012"
FT                   /db_xref="GOA:A0ZZX9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZX9"
FT                   /protein_id="BAF39012.1"
FT                   /translation="MPWKIERDSTVTFRFTVMMKGPINMAINPPVDATKTPEWAALQKH
FT                   YDELQSEGISLKQWFADDAERVEKLSFDAGDLHFDLSKNLIKPETLQLFADLAKAVKLD
FT                   ERTKAMYTGVHINNTEDRAVLHTALRRPVEDEGKYIVDGQDTVKDVREVLDRIYAFADK
FT                   VRSGEWTGVTGKKIETVVNIGIGGSDLGPVMVYEALKPYADAGISARYISNIDPNDLAE
FT                   KTKGLDPETTLFIIVSKTFTTLETLTNAREARTWLLEELKAKGAIDGSDAKNAEAIKKH
FT                   FVAVSTNLEKVAEFGIDPNNAFGFWNWVGGRYSVDSAVGTSLAVVFGPARFEEFLHGFH
FT                   EIDEYFANTPFEKNVVVLLGMLNVWYRNFFKVASHAVLPYDQYLHRFPAYLQQLTMESN
FT                   GKSVRWDGTPVTSETGEIFWGEPGTNGQHAFYQLIHQGTQLIPADFIAFVNTPNPTKDG
FT                   DQDVHELFLGNYFAQTKALAFGKTADEVRAEGTPEEIVPARVFTGNRPTTSIFGVALTP
FT                   FALGELIALYEHITFVEGTVWGLDSYDQWGVELGKQLAKQITPAISKDDDALAAQDPST
FT                   QSLIKFYRANREF"
FT   CDS_pept        305697..306098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0232"
FT                   /product="putative 50S ribosomal protein L19"
FT                   /note="Orthologue of CE1932"
FT                   /note="This protein is located at the 30S-50S
FT                   ribosomalsubunit interface and may play a role in the
FT                   structure andfunction of the aminoacyl-tRNA binding site"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39013"
FT                   /db_xref="GOA:A0ZZY0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZY0"
FT                   /protein_id="BAF39013.1"
FT                   /translation="MRRYAAATRGNTMVNAIEAFDAKHMKPAEEIPAFRPGDTVEVNVK
FT                   IKEGNNSRIQAFTGVVIARQGGGVRETFVVRKISFGTGVERRFPLHSPAIDSIKVVRKG
FT                   RVRRAKLYYLRNLRGKAARIVERRDNSEK"
FT   CDS_pept        306165..306539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0233"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /note="Orthologue of BURPS1710b_3413"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39014"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY1"
FT                   /protein_id="BAF39014.1"
FT                   /translation="MGRYDRGQCVKPDGKESHEACQKKSRKRGKLRLTRHPDLVRHTHR
FT                   HRAAGAHVPVRLLRDSVRLHAEHHRTGRPGHHQQTHPQSLQAPARRRGGLQGPRPLAAA
FT                   GEQRPIRRRLPHQTTYRPAR"
FT   CDS_pept        306786..307580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0234"
FT                   /product="ribonuclease"
FT                   /note="COG family: ribonuclease HII"
FT                   /note="Orthologue of BL0276"
FT                   /note="PFAM_ID:RNase_HII"
FT                   /note="RNase HII"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39015"
FT                   /db_xref="GOA:A0ZZY2"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY2"
FT                   /protein_id="BAF39015.1"
FT                   /translation="MAAEPHQHAGRASRRVQGRAGRICRLMSVSIVPTLDMERAIAASG
FT                   YDVIVGFDEVGRGSLAGPVMVGAAAIRTCDLSGPSPLAVPDGVADSKMLTEHRREAIFE
FT                   ELKSWCASWAVGSASNTEIDDWGISYALGVAALRALSEAETRLGIDGNGLLDGRPVKVG
FT                   AILDGPNDYITKALNTFDAPDVPVPAEVSTKVKGDRYCATVATAAVIAKVTRDRLMVEL
FT                   GAQPQYEPYEWAHNKGYGSAAHRDAIAEFGPSDLHRLSWHLV"
FT   CDS_pept        307709..308434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0235"
FT                   /product="ATP-binding protein of ABC transporter system"
FT                   /note="COG family: ABC-type transport systems_ involved
FT                   inlipoprotein release_ ATPase components"
FT                   /note="Orthologue of BL0932_BL1277"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39016"
FT                   /db_xref="GOA:A0ZZY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY3"
FT                   /protein_id="BAF39016.1"
FT                   /translation="MEHILHATDLVMDYSTQQATPNATHMLALNHVDFGIQAGESIAVM
FT                   GPSGSGKSTLLHALAGIITPTAGNVMFRGANLARLSDADRTKLRRSAFGFVFQSGQLLP
FT                   ELPAIENIALPMMLGGASYQQATDTAMLWLERLGLRQLAQQRPGEMSGGQMRRIAIARA
FT                   LAAQPAVIFADEPTGALDQTTGHEIMSILMRTARQTGAAVVVVTHDSNVAAFCDATVTM
FT                   RDGRLSSPQQSQPTAGGAR"
FT   CDS_pept        308431..309936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0236"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1278"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39017"
FT                   /db_xref="GOA:A0ZZY4"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY4"
FT                   /protein_id="BAF39017.1"
FT                   /translation="MNMFRLWRLFHRSGTRGTSSRTSALAIVAFASATAVFLTVLGGLH
FT                   GFIWRASADHTFGCMINSNRCAPGTYETWSKTLAHADKLVATVGDGHWTADQATAVMNT
FT                   YSDGYVLLAAFASLLLIVPFVALAGSAARLAASRRDARLAALRLAGATTAQVTKLTALD
FT                   AGGQALLGALVGMAGYFALIPAIMLLDFQNQHFTFEQLWVGLPALAAVTVGVTLLALVS
FT                   ALVALRRVAITPLGVMQRTGQPMPSAWRALIFLAVLAVGYLLLNSISAFAHLGQMVVYA
FT                   IIFGVFFLGFAMVNVVGTWVVAMRARSRAKHPKDAATMIAMRRILDNPKRAWRNVSGVA
FT                   LAVFIAGMTSVCGLLATGIGGNHDPFDPSMLYMRDIAMGGFLTLAFAAVLAAVSSGVMQ
FT                   TGNVYDQADEYRMLALEGTDEATLDKARMMEVITPLNTVMAVSLGCSVLLLFPILATSL
FT                   LNPASLLTLAAGIGLCYALMVLGGCAANHAAHGLGHAGYRMDD"
FT   CDS_pept        complement(309984..310928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0237"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted permeases"
FT                   /note="Orthologue of BL1279"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39018"
FT                   /db_xref="GOA:A0ZZY5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY5"
FT                   /protein_id="BAF39018.1"
FT                   /translation="MPGLLSAMEGFCVIGIVIATGYVAARMRIGGPTAQMVLNRFSFFV
FT                   SSPCLMFAILSKEKIFEIFHSSIVVAFFSALLVGVVFLILNRLFFHMKAADATIGALNS
FT                   LYLNSNNIGLPIATYILGNPALVAPILVMQQAVFTPIGLTVLDVTTKGKVSAKEILKQP
FT                   LHQPLLIGSLLGIVVSAISAKVGYFVVPDCIYDPIDMIGNSAVPMILMAFGMSLHGTKP
FT                   LQDKSNIPAVFTVAALKNIVMPIIAFLLSYFVMGFRGATLYACVVLAALPTGQNVYNYA
FT                   ARYNVGLSFARDGILFSTLSSPIFIAIIAVLLG"
FT   CDS_pept        311057..312262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="BAD_0238"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="Catalyzes the formation
FT                   ofLL-2_6-diaminoheptanedioate and succinate
FT                   fromN-succinyl-LL-2_6-diaminoheptanedioate"
FT                   /note="Orthologue of BL1280"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39019"
FT                   /db_xref="GOA:A0ZZY6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY6"
FT                   /protein_id="BAF39019.1"
FT                   /translation="MDGMNELTIGFSASASKQEQLNELMRQIMGCYSVSDDEGPLTDAV
FT                   EVFLKKQPHLTVRRHGDTLVASTDFGRERRVILAGHLDTVPVIDNFPPKWLQPGDPLIR
FT                   EDVAAGHEHERVIWGRGATDMKGSDAVMLYLAATLTDAKYDLTYVFYDHEEVAAEKNGL
FT                   RKVVESHPDWITGDFAIIGEPTDCGIEGGCNGTMRFDVITHGVAAHSARAWMGKNAIHA
FT                   AAEILNRLNAHENRAIEVDGLTYQEGLNATLISGGKGTNVIPDECRVHVNYRFAPDKSL
FT                   AEAKALMIGADAGAKLGNGEHQATGGVFEGFGIEMKDESPSARPGLNSPLAQSLVSLVK
FT                   ERTGRDPLAKLGWTDVARFAILGIPAVNLGAGSPLLAHKQDEQLPETDLLLMADLLEDW
FT                   LR"
FT   CDS_pept        312697..315510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0239"
FT                   /product="ribonuclease G"
FT                   /note="Orthologue of SCO2599_BL1281"
FT                   /note="SCC88.10c_ hypothetical protein;N-terminal region
FT                   similar to TR:P71905"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39020"
FT                   /db_xref="GOA:A0ZZY7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZY7"
FT                   /protein_id="BAF39020.1"
FT                   /translation="MPRSVVPTTNEGLDQVEAVVSSDNSTNNAASSAGSVSADPAPRRR
FT                   RGGRRVVRGVGAAGASLELKVEEHAKAPLFEEPKLEPVQPARDSADFNDADDAEPSRPR
FT                   RRRVTRYDDDDEMRDERPRRRRRSSVDVQDEDDRPSRRRRRISDEPRDDRDDRDDYGNR
FT                   GNRDESSEDRALDAVSALPEGHETRHNPRPMTSLLFQEPILPAAPAGRGSSDDDDADDT
FT                   GRRGSDDARDSRDDRDDDRPTRRRRRRSHDTADTDRTDASNDGRGRDDGNDRNNDAEDD
FT                   DHGDSRRSRRSRRLNAQERRAAAEVEQIEEDLVLDGITYAPIDDESRNGNDDDDEQPTR
FT                   TRRRRRGRGNHEEADEQQTSERESRRRHEDDDEEEGTVTRRRRRRRGGSKAEESDETMS
FT                   RRSRKQQYIDEITDVEGSTRLEAKKQRRRDNRRERSRQNQLMEQDFLARREHVERLMVV
FT                   RERERHTQISVIEDNVLVEHYVSDIQEVATVGNIYLGRVQNVLPSMEAAFVDIGQARNG
FT                   VLYAGEVNWDSARLEGQPRRIELAFKSGDPVLVQVTKDPIGHKGARLTSQVTLAGRFLV
FT                   LVPSGGMTGVSRKLSERERARLKNIVSKIAPKDMGVIIRTAAEGASEEAITKDLENLVR
FT                   QWERITAKRDEFLHGKRPKLLQGEPDVAIRVVRDIFNDDFSKMIVEGDRVYERIEEYLD
FT                   TMAPDLKDKLEKWDPAEHDGKDVFDKWQIDSQLRKGMERQVYLPSGGSIVIDRTEAMTT
FT                   IDVNTGRFIGRGKSLEETVTRCNLEAAEEIARQLRLRDIGGMVMIDFVDMVMPANRDLV
FT                   LRRLVECLARDRTKHQVAEVTSLGLVQMTRKRIGQGLVEAFSEECPTCKGRGFILHDEP
FT                   TVSADYDDPYALKGGDPFVKTNKHGHGTDVQVPKGSSPDVKAKLAQIAAAAVAANNADL
FT                   GEEEQEE"
FT   CDS_pept        315655..315963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BAD_0240"
FT                   /product="50S ribosomal protein L21"
FT                   /note="COG family: ribosomal protein L21"
FT                   /note="Orthologue of BL1282"
FT                   /note="PFAM_ID:Ribosomal_L21p"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39021"
FT                   /db_xref="GOA:A0ZZY8"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZY8"
FT                   /protein_id="BAF39021.1"
FT                   /translation="MYAIVKAGGHQEKVEVGDVILVNRLNAKKGDTVEFPAALVVDGSK
FT                   VILGAKDLAKLTVKAEVVNDEAKGPKISIMKYKNKTGVARRKGHRQQLTLVKITAIA"
FT   CDS_pept        316003..316254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BAD_0241"
FT                   /product="50S ribosomal protein L27"
FT                   /note="Orthologue of BL1283"
FT                   /note="The function of this ribosomal subunit is unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39022"
FT                   /db_xref="GOA:A0ZZY9"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZY9"
FT                   /protein_id="BAF39022.1"
FT                   /translation="MAHKKGASSSRNGRDSNAQYLGVKKFGGEAVVAGNIIVRQRGTKF
FT                   HPGENVGMGKDHTLFALKDGSVKFGVRRDRKVVDVIAA"
FT   CDS_pept        316331..318022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="BAD_0242"
FT                   /product="GTP-binding protein"
FT                   /note="COG family: predicted GTPase"
FT                   /note="Orthologue of BL1284"
FT                   /note="PFAM_ID:GTP1_OBG"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39023"
FT                   /db_xref="GOA:A0ZZZ0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZZ0"
FT                   /protein_id="BAF39023.1"
FT                   /translation="MSDFVDRVTVHVKGGDGGNGSAGIRREKYKPLAGPNGGNGGDGGS
FT                   VIFMADSNANSLLDYRFMPHREAESGTMGLGDTKDGSKGADLILPVPVGTVVFEAKGPQ
FT                   GKPKHPGEQLADLRHAGDKFVVAAGGNGGLGNAALANRTRRAPGFALLGEPGEERDVIL
FT                   ELKSIADVALVGFPSAGKSSLIAAMSSAKPKIADYPFTTLVPNLGVVVAGDMRYTIADV
FT                   PGLIPGASQGKGLGLEFLRHIERTEIIAHVIDCATLEPGRDPMSDYQALEHELAEYAGK
FT                   LELPLGAIPIPERPRIIILNKVDVPEAKELAEFVKPEFEKLGLKVHIISTASHEGLKEL
FT                   NWALADLVTNMRAEVAKREQAEEEARVVIKPLEEPRNRRRRNDEGGNALDFTVERKENG
FT                   NGEVWYEVLGTKPERWVMQTNFDNDEAVGYLADRLAKLGVEDELRHKGAKPGDEVRIGR
FT                   GDRAVEFDWDPTIAAGAEMLDGTQLGARGVDLRLQESDGRAQRRSNTERRRQYHEMMDA
FT                   RQAVREAMMAERKAGHWADPSVDDDRHDETSLFGRGETADDEDVEQ"
FT   CDS_pept        318105..319238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BAD_0243"
FT                   /product="glutamate 5-kinase"
FT                   /note="Catalyzes the formation of glutamate 5-phosphatefrom
FT                   glutamate in proline biosynthesis"
FT                   /note="Orthologue of BL1285"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39024"
FT                   /db_xref="GOA:A0ZZZ1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZZ1"
FT                   /protein_id="BAF39024.1"
FT                   /translation="MNTPSQAQVRRAIAEAQTIVVKVGSSSLTEPSGHLDPQRLNALVA
FT                   AIARVRLMGGRVVLVSSGAIAAGFGTLGFDKRPTDVADQQACAAVGQGLLMAQYEAAFA
FT                   RYGLRVGQILITVSDTIAPQQYRNVRRTLDRLLDLGAVPIINENDSLASNEIRFGDNDR
FT                   LSALIANIVVADALVLLTDVDALYTAPPSEPGSKRISYVPNVEDALAKVQVGGTGSNVG
FT                   TGGMVTKMEAARVAAVSGIPAVLTCASNAGPAMMGDPVGTAFAPINDRGSSRRLWIGFA
FT                   SHPQGTLVADSGAAKAVRGGAASLLAAGVVEVKGDFAAGDAVWVDDEQGNHLAKGLVGF
FT                   DSEEIPQMLGRNTAQLKRFLGEEYAHPLVHRDNLVLV"
FT   CDS_pept        319362..320570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="BAD_0244"
FT                   /product="aspartate aminotransferase"
FT                   /note="Catalyzes the formation of oxalozcetate
FT                   andL-glutamate from L-aspartate and 2-oxoglutarate"
FT                   /note="Orthologue of BL1286"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39025"
FT                   /db_xref="GOA:A0ZZZ2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZZ2"
FT                   /protein_id="BAF39025.1"
FT                   /translation="MADWQTLSDRINHVAPSATLAVDSKAKAMKAAGIDVIGFGAGEPN
FT                   FPTPAPIVAAAAAAVQDPKNYRYTPTAGLPELRQAIADKTLRDSGYEVDPSQVIVTNGG
FT                   KQAVYESFQILLNEGDEVIIPTPYWTSYPEAVKLAGGVPVTVFAGADRNFEPSIEAIEA
FT                   ARTEHTKAIIVNTPNNPTGAVWKPETVKAIAQWAIEHHVWVISDEIYEHLNYDGAKTTY
FT                   IGAAVPEVRSQLLVLNGVAKTYAMPGWRVGWMIAPVDVAKAASKLQGHMTSNVNNISQR
FT                   AAIEAVSGSLDAVYEMRAAFDKRRQTIVAALNDIEGVNCPTPTGAFYAFADVTALLNKP
FT                   IGTNKTTFANTSELAAALLDEGHVAAVPGEAFGAPGYLRFSYALADDDLVEGMRRMKRW
FT                   IED"
FT   tRNA            320827..320902
FT                   /gene="trpT"
FT                   /locus_tag="BAD_t0011"
FT                   /product="tRNA-Trp"
FT                   /anticodon="(pos:320860..320862,aa:Trp,seq:cca)"
FT                   /note="codon recognized:CCA"
FT   CDS_pept        320936..321163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BAD_0245"
FT                   /product="preprotein translocase SecE subunit"
FT                   /note="COG family: preprotein translocase subunit SecE"
FT                   /note="Orthologue of BL1287"
FT                   /note="PFAM_ID: SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39026"
FT                   /db_xref="GOA:A0ZZZ3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZZ3"
FT                   /protein_id="BAF39026.1"
FT                   /translation="MAKAKNSEKAIKPNIFMRIGLFIKQIIDELRKVVTPTSKELFFWS
FT                   LAVFIFVLLLMALVTGMDYGLGKLTLWIFG"
FT   CDS_pept        321188..322012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BAD_0246"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="COG family: transcription antiterminator"
FT                   /note="Orthologue of BL1288"
FT                   /note="PFAM_ID: NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39027"
FT                   /db_xref="GOA:A0ZZZ4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZZ4"
FT                   /protein_id="BAF39027.1"
FT                   /translation="MTDEVFSDNLDEASKADTEAAAAVEALPAEGEAVQAVAADQATDE
FT                   QAQSEQDAPEEQTAETTEDEDTEQDAGAKAVEEFSKSLRTLEGKWYVLHTYSGYEKRVK
FT                   TNVESRVASFGMEDKIFQVEVPMEEVEKHTEKGKKVITRVRVPGYVLIRMLPDENARRI
FT                   VRETEGVTGFVGPTKDPAPLTRKEVVSMMAPMIASEALKAAGDKPAAAKKRKLEVSYAP
FT                   GDQVTVTDGPFTTMAAVVSEVDPSTQKLTVLVSIFGRDTPVELGFNQVEKLA"
FT   CDS_pept        322357..322788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BAD_0247"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG family: ribosomal protein L11"
FT                   /note="Orthologue of BL1290"
FT                   /note="PFAM_ID:Ribosomal_L11"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39028"
FT                   /db_xref="GOA:A0ZZZ5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZZ5"
FT                   /protein_id="BAF39028.1"
FT                   /translation="MAPKKKVSALLKLQIQAGKANPAPPLGPALGSHGVNIMDFCKQYN
FT                   AATQDKMGQVIPVEITVYEDRSFTFILKTPPAAALLKKAAGIQKGTENPLTHKVGSVTK
FT                   AQVREIAEIKMADLSARDVEAGMKIIAGTARSMGITVTD"
FT   CDS_pept        322803..323495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BAD_0248"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Binds directly to 23S rRNA and is located proximalto
FT                   the site where elongation factor Tu is bound to
FT                   theribosome"
FT                   /note="Orthologue of BL1291"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39029"
FT                   /db_xref="GOA:A0ZZZ6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZZ6"
FT                   /protein_id="BAF39029.1"
FT                   /translation="MVQRSKKYREAAEKIDRNNLYTANEAIALLKSMPEYKFDQTVEAV
FT                   LRLNVDPRKADQLVRGSVNLPNGTGKTAKVLVFARGPKATEALEAGADIVGDDDLVQKV
FT                   ADGFLDFDSVVATPDMMGKVGRLGRVLGPRGLMPNPKTGTVTMDVTKAIKDIKGGKVDF
FT                   RVDKNGNLSFLIGKMSFTEQALDENFKAVADEVKRLKPSTVKGRYVTKATITSTMNPGV
FT                   PVDPAVVA"
FT   CDS_pept        complement(323643..324422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0249"
FT                   /product="hypothetical protein"
FT                   /note="COG family: regulator of polyketide
FT                   synthaseexpression"
FT                   /note="Orthologue of BL1531"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39030"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="PDB:3ONQ"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZZ7"
FT                   /protein_id="BAF39030.1"
FT                   /translation="MNSEQADILDLLSGHTDDTTIERLAFECLLTNMTDDRVVSLMNIL
FT                   GWQGDFNCFAIGGVPSASLASTSLAIRKAVRDLGGEHVVIGTYGTFLLALACQMGAVTP
FT                   EVTCTAVMPAFSEDEPLYLSPVRSGVAGASHALRETMFSLQAAPALSTPSRPLRADELL
FT                   PERALLGDDYAREELYRNVYQVLRGENPDDPTYLTVSTFLKYGSSLENTAKELNVHPNT
FT                   VRYRLKRAAETTGWDATDPRDAYVLTTALAIGRMRDR"
FT   CDS_pept        324506..326611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0250"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1532"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39031"
FT                   /db_xref="GOA:A0ZZZ8"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZZ8"
FT                   /protein_id="BAF39031.1"
FT                   /translation="MPTMSENKKAGKADTFLSWTLGVLACLWVAWCCGIGPLYWFGTGL
FT                   ADFGWANVLYMAIAFVVSFAILWSLVRYGRGERVLPTYFSRRYVKLCQEVSGTPTTVLG
FT                   IMLRHLSDAAHSRPGRAIHAVIVWIGRKLTRCTDCWWKLMLLFVIGWLWIPTILLAAYG
FT                   ADIRSQIREFSWALNQWTGLKQPYIGFFSFVPMDIYPTAHYMWPANPTYLTDQHNIVLT
FT                   VFYGAFAAVSRYFTDSNDAGIVALAALQWLFAAFCCAATANRFFNLPWRRLGVGTFDFS
FT                   HPERHDCWNMRDFTHPEAGVVARPSRLRAGAKTRFVILLFFMVCPLAVFATISLTKSPL
FT                   FAFAFVWWFGVWYELHMTHIKALPTINGKPMKLRKRSLAALFMSSCVMLISAKYAWYII
FT                   LFAALLAIINDRKRWKTYVVALMLPTVLIHGGLVYLVNSGAVIGGDPIESRGIQLQQIA
FT                   RVAKYNPQGIPEDAAKKLAPVFNLDQMAESYFQQDADPVKSSGIQSKKVSYKWRTVTKD
FT                   DMKDFNDAWWQIVKANPQIALDALFAECFGYFNVTDLPYVSMDYYVNNDYVQSDNEWIH
FT                   LYNHQWRNQVAGFAKKWGQIPVLGWVTHGNLYVTLTLLIGAAEVVLRRWRSLSWHLPLL
FT                   LLMGVMITAPANNFERHMLPIAFVFGFLCLEFWRESRAARLAAREASYVGTSTAGKRRI
FT                   GGHRIDR"
FT   CDS_pept        326683..327633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0251"
FT                   /product="hypothetical protein"
FT                   /note="COG family: biotin-(acetyl-CoA carboxylase) ligase"
FT                   /note="Orthologue of BL1533"
FT                   /note="PFAM_ID: BPL_LipA_LipB"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39032"
FT                   /db_xref="GOA:A0ZZZ9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZZ9"
FT                   /protein_id="BAF39032.1"
FT                   /translation="MTTILDSALTMPRTCVAADQVIALDSVGSTNTYAAELVRKGALFG
FT                   SARRDGLDGCDGRDWTGREIVAICADEQTAGRGRLDHQWTSAVGESFIVSLVVSVPTAI
FT                   VRDTSVNGWLQMIAGCEARNAIIAAIRDCGGPLGKDIVLKWPNDIFVDGKKLGGVLAEM
FT                   VPLAATPIADGATGTTDVAAATERVGIVFGIGLNLTVPEDHLPTDKATSLQLVAHGLPD
FT                   SMTLRDMIAAHLVDGLRSRLADFEADPHREATRAMEEMRPVCWTLDKPCEAHFVDGTTL
FT                   RGTALELNPDASLTIRDDNGNLHTVHTADVGVLPQ"
FT   CDS_pept        complement(327691..327972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="BAD_0252"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="Orthologue of Reut_A0577"
FT                   /note="Site-specific tyrosine recombinase_ which acts by
FT                   catalyzing the cutting and rejoining of the recombining DNA
FT                   molecules."
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39033"
FT                   /db_xref="GOA:A1A000"
FT                   /db_xref="UniProtKB/TrEMBL:A1A000"
FT                   /protein_id="BAF39033.1"
FT                   /translation="MRISAVISGFLRDFRVLIQSSVFAVIFVFAVSGGAGGYQRATRSG
FT                   PLRPSFLRSYVGIRRPHLVLGECCVCGWRGFWILRFWEMPFFSNIAFF"
FT   CDS_pept        complement(328048..328641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0253"
FT                   /product="hypothetical integral membrane with weak
FT                   similarity to proteins in BioY family"
FT                   /note="COG family: uncharacterized Acr"
FT                   /note="Orthologue of BL1534"
FT                   /note="PFAM_ID: BioY"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39034"
FT                   /db_xref="GOA:A1A001"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A1A001"
FT                   /protein_id="BAF39034.1"
FT                   /translation="MRNAILTISSAAKTATSGKFGAVLKSTLFAVLLAAASMAGAVPIP
FT                   GTPVPITLQTFVVMLAALMLPWKQAGAAVLMYLAAGAAGLPVFAGGASTMALVGPSAGF
FT                   LIGFLPAAVVTSLLKGKARVDSPKHAALTAARYLFACVAGCIVLDYLLGFIVQSAITGV
FT                   AMPVVAIASMGFIVGDCIKAVVASLVASGLAKLQ"
FT   CDS_pept        328837..330741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0254"
FT                   /product="JadJ"
FT                   /note="COG family: biotin carboxylase"
FT                   /note="Orthologue of BL1535"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39035"
FT                   /db_xref="GOA:A1A002"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1A002"
FT                   /protein_id="BAF39035.1"
FT                   /translation="MPKNVNKLLVANRGEIALRVVRTAREMGIPTVAVYAEQDRHAQYV
FT                   QMADDAYLLSGDTYKDTYLNEDLLIDILQRSGADAVHPGYGFLSEVASFAQKVLDAGAT
FT                   WVGPNPKALVDLGDKITARRVATFAKVPPVPGISQSISDMRLLLDFAHTHGYPLMLKRT
FT                   DGGGGRGITLVHNDDELRGFYMNHDALQGGDLDEYFVERFIDKGRHVETQCGRDSHGNF
FT                   TVYSTRDCSVQRRNQKLVEEAPASFLPDGVLEQLETYSRRLFDAVDYVGLGTCEFMVTE
FT                   QGKVYFLEVNPRLQVEHTVSEEVCGLDLVREQLTIANGGELTVDHPLRGHSFELRLTCE
FT                   DPAKNLAPSSGTLTKLAWPSGPGIRVDSGVVEGDTVSPKFDSMMGKLVVTASDRATAVA
FT                   RVRRALEELKVEGVPTPASLFEQIFNDDEFTAEHGVAYDVSTKWLERKYLNKEASSTKG
FT                   GQPASMAGASGAKEAEQKESSETFVIEVNNHRVSLTVPNDIVANLTGGAKARDAKRAIQ
FT                   PLRGQGLHHVEKKQQGNDGQSGVIASPMQAVVTRINVVEGQDVAKGDLLVVLESMKMEN
FT                   YVYAPVKGTVTKIFVGPAAGIEAGETLMTIDVNGASKAADGKPATDGNTETKTEGGAK"
FT   CDS_pept        330738..332384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="BAD_0255"
FT                   /product="propionyl-CoA carboxylase beta chain"
FT                   /note="COGfamily: acetyl-CoA carboxylase alpha subunit"
FT                   /note="Orthologue of BL1536"
FT                   /note="Propanoyl-CoA:carbon dioxide ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39036"
FT                   /db_xref="GOA:A1A003"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A1A003"
FT                   /protein_id="BAF39036.1"
FT                   /translation="MTDIIASPAVKEAVKVVMEQQERLGDEAAAEARESQPIRTSVLRA
FT                   AQLAAEAEDHARGRQHVKGKLTARERLDLLLDTGSFEEIGRFRGGDINGGRAGSAVITG
FT                   FGEVFGRKVAVYAQDFSVKGGTLGVAEGRKICHLMDKALDLKVPIIALIDSGGARIQEG
FT                   VAALTEYGHLFRKTCDASGFVPQLSLILGPCAGGAVYCPALTDLIIMTRENSNMFVTGP
FT                   DVVKAATGEVISMDDLGGGYVHNATSGVAHYLGEDEADAIDYARTVLAYLPSNSDQQPP
FT                   VYAYAATRADRDVAKRLATLVPDNDRQPYDVLDVIRCIVDYGEFVQVHELFAASAVVGF
FT                   ACIDGHPVGIVANQPNVNAGILDVDSSEKVARFVRLCDAFNLPVVTLVDTPGYKPGAEQ
FT                   EHAGIIRRGAKVIYAYANAQVPLVTIILRKAFGGAYIVMGSKSIGADMNFAWPSSQIAV
FT                   LGAAGAVNIIHRKDLQKAKDNGKDVEALRAKYIADYERTTVNANLSLEMGEIDAMIDPE
FT                   QTRETIIESLRLLASKKRVRRTSKHHGNQPL"
FT   CDS_pept        332459..341794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fas"
FT                   /locus_tag="BAD_0256"
FT                   /product="probable fatty acid synthase Fas"
FT                   /note="Orthologue of Rv2524c_BL1537"
FT                   /note="Probable fas_ Fatty Acid Synthase (EC 2.3.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39037"
FT                   /db_xref="GOA:A1A004"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR032088"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1A004"
FT                   /protein_id="BAF39037.1"
FT                   /translation="MNTFFLDRLNSEPHALAFAGQSTPWPVALADQSANPALDEVLHTH
FT                   AAAAQALLYPVSAELLATTGRPVDLFGFEPNPARLGAAAAASASVPGIALTQLGALLDA
FT                   AALGYNPAQAKPVVVLGHSQGVLAVHMVQAICEAGSIDAAAAKIDEILAIATLIGVAGT
FT                   RQARQLGLAARHGEATPMLSVKDITRAQVDALIERVDGARGPIAVAVTNSATHYVLSGY
FT                   PEDLAAFGVEVAKEHKRQAKLREEKVRGGRVFDPTLEYLDVTLPFHSPLMADAVSQAVA
FT                   WAEACGINADHARELAAEVLLNHVDWAARVRALMKSTDPSALWVLDFGPGNTVGKLFST
FT                   VAQGTGVGVVEASTVADRGALSTLETLPERTQNWTRFAPSIIHTSAGDKVRTAFTELTG
FT                   KAPVLLAGMTPTTVEPEIVAAAANAGYWAELAGGGQVTASVFDRHVAKLEEELEEGRTV
FT                   EFNAMFMDRYLWNLQFGSQRIVPKKRASGTPIDGVVVSAGIPEFDEAVELIHNLNADGF
FT                   PYVSFKPGTVDQIRQVVRIAKAVAPTKVLIEVEGGSAGGHHSWESLDDLLLSTYAEVRE
FT                   QANLVLVVGGGIGTPERGADYITGEWAAEYGRPLMPVDGVLVGTAAMTAKEAHTNPEVK
FT                   QMLVSTPGIPAKGDDNDPFAPLGEQWVPSGQAKGGVTSGLSHLHADIYELENSSARCGR
FT                   LLVRVMKHPEELESRRDEIIAALNATAKPYFGDLKTMTYLEWAQRFADLSFPWVDETYA
FT                   DRFLHLLQRIEARVTTQESGEFASLFASRADVEADPNAAIAKLAETYPQAGKLTVTPMD
FT                   EAWFPVLVREYPKPMPFVPVIDNDLLRWWGQDQLWQSEDSRYSADSVRIIPGPISVAGI
FT                   TTVDEPVADILGRFEAAMVKRVSAESASADKTAFAQLGAAVSAEEFIRKSPNISWVGHL
FT                   MANPAYGTANGDANYEIRKVAVEGSVEKYDLDIHLDTFWDNDPDGGASKHAVRDIVIPL
FT                   NVDGNESGLFPVVDRDRLPEHVYRMLADTAGIGNTAITGDKLTAMPQIEEVSDKTAFPF
FT                   GQAHTGYTLSANLGFDHEAATGGALPSDLVPSRIAPDALVGPAWPAIYAALGSVYVNGF
FT                   PVIEGLLNAVHLDHLIELEVSEDELLKHTGERIELTSWADDYFESASGRVVTIHVTHTA
FT                   QDGTLLANETERFAIRGRAYSDALPPEAPDYGGIEAEIESTPRRLLRRVKVVAPHEMTA
FT                   FARTSGDFNPIHTSHRGAAVSGLAAPLVHGMWLSATAQYAVQALDEKGAHYEIAGWTYN
FT                   MYGMVQLDDEVEISIERVGRVAHAGMVLEVTSRIDGNIVSRGTAIVRAPKSAFVYPGQG
FT                   IQKQGMVLDERAKSPAAREVWERADKVTREKLGFSILAVVRDNPKELTANGVTYRHPEG
FT                   LLNLTQFTQVALATVAFAQTARLREAGADIWPAYFAGHSLGEYNALSSFAGVIPLETVL
FT                   ELVFHRGSTMHHLIPRDEKGRSNYRMGALRPNQFGVGDDGVREYVESVSKASGEFLEIV
FT                   NYNLAGQQYAVAGTIAGLKALKADSARRVAEYGGKPAFMLVPGIDVPFHSTLLRKGVPE
FT                   FRDKLDALLPKHIDYRGRLVGRYIPNLVAVPFEMTKEFAAKILEVVPSERIKAALDDPK
FT                   VWDSYAEDDQKLGRLLLTELLSWQFASPVRWIETQALLFGSAEQGGLGVEEYVEVGLGN
FT                   APTLANLGAKTLRLPQFAGRDVTVYNVGRDEGRVYMTDSDSLVADDDADDSVAAPAAAS
FT                   APAAAAAAPAAVAAAPVAAAPAAAAPVAPAGAPSGAAVADIPFNASDAIAMLLAYSAKV
FT                   RPDQIGESDTTDTLTNGVSSRRNQLLMDISSELGVASVDGAAEATVKALSALVDKVAPN
FT                   YKAFGPVLSDIVRDRVRGLFGAAGVKLGQITKRVTDTWQLGEGWASHVVAALVLETREG
FT                   ASSRGGDLASLSTEAASNAAAANALIDAAVQKVASDKGVAVAMPSAGGAAGGAVVDSAA
FT                   LDAFAAKVTGADGVLASTAKFVLNQLGVTASVADDSADENAAVVAAVEAELGSDWPKQV
FT                   EPRFDERKAILFDDRWASAREDLSRAYYDNDASALDGSFIGLGKAVADEAAWYAGKTAD
FT                   VELAAAFKRVADEALEQTNDSAEASRFAGDIAVVTGVAPNSIAAQVVNGLLAGGATVVA
FT                   TSHSFRQSVKAWAKQTYREHAAGDAKLWLVPANLSSYRDVDALVAWVGNVQKKTSGATT
FT                   TILKPAYEPSLFFPFAAPPVHGTLADSGELFESQARLMLWGVERAITGFAKIGADTDVQ
FT                   HKLHVILPGSPNRGVFGGDGAYGEVKSAFDAIVNRARAEKVWSSRVTFAHPKIGWVRGT
FT                   GLMGGNDPLVEVVERHGLKTYSTAEIAVKLLELSTKESREQAVKAPLDVDLTGGLGSEP
FT                   IDIKALRAEAMEDAAKAAAAEAGDEDKQGDCAAAATLIKALPSPRAPRQAKVDLKDWQH
FT                   VTARPEDEIVIVSIGELGPWGSGRTRFEAELGIHSDGKVDLSAGAVLELAWNMGLLTWN
FT                   DSPKPGWYDTDGNLVPEEDIAERYHDEVVARSGVRPFEEGMGNDYKDGADEEEAEVFLD
FT                   HDVTFSVPTREIAEEYVKLDEAHTSYAADAESGEWNVTRHAGSMIRVPRRAAMTRTVGG
FT                   QFPKGFDPVKWGIPASMVGDVDKIALWNIVTTVDAYLSAGFTPAEILEAVHPSMVASTQ
FT                   GTGFGGMASMRKLYLDRFLNHEIPTDILQEALPNVVAAHVMQSYIGGYGNMIQPVSACA
FT                   TAAVSLEEGADKIALGKADFVVTGAIDDIGVESVIGFGNMNATANSEEMYAKGIDARFF
FT                   SRANDRRRGGFVESQGGGTILLTRGDIALKLGLPVAGVVGFVHSYADGAHTSIPAPGLG
FT                   ALAAGMGGKDSKLVHDLAKLGVTPDDIAVVSKHDTSTNANDPNESELHNTLAHAIGRTD
FT                   GNPLFVISQKSLTGHAKGGACIFQVNGLTQLFKSGVVPANAALDCVDPKLKRDDHMVWL
FT                   REPLKVGSVKAGLATSLGFGHVSGFAAIVNPGAFEASVANTAGEDALNEWRDRANARLA
FT                   AGQRRLEEGMMGRAALYEPIDNRRFHEDGRGYDAHEVEKAMLLDPNARLASTGYFEA"
FT   CDS_pept        341953..342411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0257"
FT                   /product="protein with similarity to holo-[acyl-carrier
FT                   protein] synthase"
FT                   /note="COG family: phosphopantetheinyltransferase (holo-acp
FT                   synthase)"
FT                   /note="Holo-acp synthase"
FT                   /note="Orthologue of BL1538"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39038"
FT                   /db_xref="GOA:A1A005"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A005"
FT                   /protein_id="BAF39038.1"
FT                   /translation="MLGLGHDVVDVPAFAKQLNEPGTRMRNLFSMREIWQTAQRSQLKH
FT                   DDEAVHLAARWAGKEAFLKAWCAAISRHAKDGAEVAYPYTLDNFPWVRIEILDDSHGVP
FT                   RVILSSEVQRKVQQSLGLPLDPVCQSYDISISISHDGPIASAVVMLEI"
FT   tRNA            342497..342570
FT                   /gene="glyU"
FT                   /locus_tag="BAD_t0012"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:342529..342531,aa:Gly,seq:tcc)"
FT                   /note="codon recognized:TCC"
FT   CDS_pept        342720..343397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0258"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1545"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39039"
FT                   /db_xref="GOA:A1A006"
FT                   /db_xref="UniProtKB/TrEMBL:A1A006"
FT                   /protein_id="BAF39039.1"
FT                   /translation="MGQKERNKATEVVDGVVETVDVSKHPTASIEPSDLSLADIERRKS
FT                   HPVRWILFMALVLLAMIAPYWWGRDIAVRDASWMVANLNFLDPKGVALISWTVTIVALT
FT                   GLGLMVADAKKWLWGTIFVIGLAAEQFVAGMCLLSFNFWNATYVMYGEAAGLANAANLG
FT                   IIAAGFGVAVYAVLWVGLLVCIKKESKLNVLTRSWASFLLFFAIELVALAVVLFGGLLM
FT                   SMA"
FT   CDS_pept        343552..343821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="BAD_0259"
FT                   /product="30S ribosomal protein S15"
FT                   /note="COG family: ribosomal protein S15p_S13e"
FT                   /note="Orthologue of BL1545a"
FT                   /note="PFAM_ID: Ribosomal_S15"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39040"
FT                   /db_xref="GOA:A1A007"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A007"
FT                   /protein_id="BAF39040.1"
FT                   /translation="MALTAEEKQEIIKTYATHEGDTGSPEVQVALLTKRIADLTEHLKE
FT                   HKHDHHSRRGLLLMVGDRRRMLDYLKRVDINRYRSLIERLGLRR"
FT   CDS_pept        344051..346729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnpA"
FT                   /locus_tag="BAD_0260"
FT                   /product="polynucleotide nucleotidyl transferase"
FT                   /note="Orthologue of Rv2783c_BL1546"
FT                   /note="Probable gpsI_polyribonucleotide
FT                   nucleotidyltransferase (EC 2.7.7.8;2.7.6.-)"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39041"
FT                   /db_xref="GOA:A1A008"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014069"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A008"
FT                   /protein_id="BAF39041.1"
FT                   /translation="MEGPEIKAVEAVIDNGSFGKRTLRFETGRLAQQADGAVAAYLDDD
FT                   SMILSTTTAGSSPKENYDFFPLTVDVEEKMYAAGKIPGSFFRREGRPSSEAILACRIID
FT                   RPLRPLFPHTLRNEVQVVETVLAVNPDDAYDVVALNAASASTMISGLPFEGPVSGVRLA
FT                   LIDGQWVAFPRWSERERAVFEIVVAGRVVENGDVAIAMIEAGAGKNAWHLIYDEGQTKP
FT                   DEEVVAGGLEAAKPFIKVICEAQAELKKIAAKETKEFQLFPEYTEDLYNRIDEIAHADL
FT                   DEALSIAEKLPRQDRIHEIKEGVKATLAGEFTDMEDAEKDKEIGNAFKELQRQIVRRRI
FT                   LTQDYRIDGRGLRDIRTLSAEVDIVPRVHGSALFQRGETQILGVTTLNMLKMEQQIDAL
FT                   SGPQSKRYMHNYEMPPYSTGETGRVGSPKRREIGHGALAEKALVPVLPSREEFPYAIRQ
FT                   VSEAIGSNGSTSMGSVCASTLSLLAAGVPLKAPVAGIAMGLVSGDVDGQHIYKTLTDIL
FT                   GAEDAFGDMDFKVAGTSEFITALQLDTKLDGIPADILASALQQAKEARTTILEVINECI
FT                   DGPAEMSPYAPRIITTTVPVDKIGEVIGPKGKMINQIQEDTGAEIAIEDDGTVYISSEG
FT                   GEAAEKAKEIIDQIANPHVPEAGETYNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLA
FT                   NGERIDAVEDVLKEGDTVEVVVQGVDDRGKISLAIPGFEDQESSAPRRDRGDRDDRRGG
FT                   RGRRDDRRRSDDRDDRDYDDRPRRRRSDRDDDRDYDDRPRRRRSDRDDRDYDRDDRRSS
FT                   RSDRDDRDYDDRPRRRRSDRDDRDYDRDDRRSDRRRGSRRDDRNPRYAADENYDEYRAD
FT                   REERSERPRRRVRRDFDPFED"
FT   CDS_pept        347032..347592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="BAD_0261"
FT                   /product="LemA-like protein"
FT                   /note="COG family: uncharacterized Acr"
FT                   /note="Orthologue of BL0311"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39042"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A1A009"
FT                   /protein_id="BAF39042.1"
FT                   /translation="MIVAIIIVVIIVLVLLWAMSAYNGLVTLRNRVKNGWAQIDVQLKQ
FT                   RADLIPNLVETVKGYAAHESNVFTQVTQARAGVIQAAQSGDVQQRIQAENQLSRALVNL
FT                   QATAEAYPQLQANQNFMDLQGQLKGLEEKIAYARQFYNDVVQKYNTKIEVVPTNIIAGL
FT                   FHFEQAAYFQVDEADRQAPQVKF"
FT   CDS_pept        347731..349953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0262"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0310"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39043"
FT                   /db_xref="GOA:A1A010"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:A1A010"
FT                   /protein_id="BAF39043.1"
FT                   /translation="MNIRRTLVSLLSTIVVTLTMLGIVLINAQTSDEEPDLSYRTLDYD
FT                   VAVQRNGDLKVTQHIDMRLKDRGRDWKQMYQRYTLKSKNLTDISDIGVKDVSNGETYRQ
FT                   GDFVFPDNADNWNDEHAGRWYIVDVTEDENDPQPFNPQTDGLSDDGQADKTLEIGWNIP
FT                   QTVSEDSLKFDVSMTLHGVSTAYDDVVSFQWEPFGEENQIPIGTVTGKVTFPNGINGKN
FT                   SWAWLHTKNTSTTNRGDNGSLMFSANDVRAGDYLDVVAMFDASQAQGVARTKSGAYKQR
FT                   LIDDETKQEREWRSSQHTKAVKRVAGWIFAALIGIALAVAALYFAIVSFRKSQYKGDIE
FT                   YWRDLPDLSPAAAAKMEDIMSASSSIFGSGKTKNADKLANRQMSATVMSLASKGAIAIY
FT                   PGPVDLYNGIDLTTTSAASVAGMLGSNAASARKLKKTSTIAIMPVVCDDIGSLLLSSSE
FT                   RAVLDILLKASSRLHDAQVFDLKQMSKAFKHYSSGYKLLETFDNACSMEFDDLHAVKPM
FT                   GLLSYLFSGLGIAFAFFLALKYVQDGELAVALVVCVPVVALCAFAAAYGKRYVLTDEGQ
FT                   RYGGQVAGLKRYLTDFSDFTDRGVLDMTLWGRYMVYATAFGISKKAMAQLARAYPEVAD
FT                   PQWLDEHAGTSYMYMPLRSSSLLGASVGTSLGASTIDPAAFSANFGDLGAQLSSSFADV
FT                   RSTISAAAPSSSSGGSGSSGGSGGSFSGGGFGGSSGGSGGGSFGGR"
FT   CDS_pept        350021..352213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0263"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0310"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39044"
FT                   /db_xref="GOA:A1A011"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:A1A011"
FT                   /protein_id="BAF39044.1"
FT                   /translation="MNGKRYGRGLIAAFSALVAVVAIILAVFVISGDEADLSYRSVDFD
FT                   ARLQSNGDIRFTEHLDYQLKRREDGNGDTKPWKQLYLTFKLRNQDLTNITDISVTNAST
FT                   GEEYTQTDPQLPSGISDGTWDSTYAGHWYIADTTAGSDSPQPFDPTTDGIDPNGSGEQK
FT                   NIEIGWNIPATVKQSSLKFDVSMTFHDMGTRHSDVTNLMWEMFPENNQVPAGKVTGTVR
FT                   FPKGIASNNSWAWLHTEATSQTSRDADGTLHFTISDLRTNQYVDLVAAFDNTGAAGVER
FT                   TQSGDYLDELKSTEAAKERQWRDRQRLKAQLTVAGWLICLIIGVLCCVLAIRGVLSANR
FT                   EARYQGGIEYWRDPPQVSPAASAYLIDVVDESVGDRSSRAMTATILALVVKKALAVYPG
FT                   PSSLYQGIDLSQANASDLARMIASDPNRAKATASSSTLVIMPAALSHRNTLGLSQSEEA
FT                   CLELLIGISMRVGSPVFDFNQMDTACSDWEEGYQSLNRFKSACGLEFGALGAVKSVNGR
FT                   WLVPSLCLMVIGAIGIFANGASNIAMALCLGVPFICIGVFCMAAGRSEGITERGQQYAG
FT                   ECLGLKRYMEDFSNFSNRGALDLTLWNWYMVYAAAFGISEKVAREFARAYPEVNDPQWL
FT                   DTYGYDSLGYWTYRSQAWNGPINTNGMMPGGMYGGTQFMGGVGDIGSQISSGFASVSST
FT                   ISAAAPSSSSGSGGSFSGGGFGGGGGGGGGGGGGGR"
FT   CDS_pept        352451..353314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0264"
FT                   /product="possible oxidoreductase"
FT                   /note="COG family: predicted oxidoreductases (related
FT                   toaryl-alcohol dehydrogenases)"
FT                   /note="Orthologue of BL0309"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39045"
FT                   /db_xref="GOA:A1A012"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1A012"
FT                   /protein_id="BAF39045.1"
FT                   /translation="MTLFRDLGPFHTTAIGHGEMPLTIENNRGHDVGIETLHASLDAGC
FT                   RHIDTAWAYYTPGEEEQTGEKLVREALETWKGPREEVTVATKVGLRRAWDGDKPIWPRD
FT                   GKPEHLIEYGKQSAQALGVDSIDLLYLHRHDPEVPYNESCEGIKALLDQGVAQWAGVSN
FT                   VSIEQLKIAQEILGDKLVAVQNQYSPIHLETQDTLEYCAKEGLAFVCWSPLGGYRHPYD
FT                   EHLFDPFREVAAKHGVSYQRVVLAWELAKGDHMFVIPGAHRPETILDSLKADELELTDE
FT                   ELAFLG"
FT   CDS_pept        complement(353416..354093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0265"
FT                   /product="L-lysine permease"
FT                   /note="Orthologue of FN1861"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39046"
FT                   /db_xref="GOA:A1A013"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1A013"
FT                   /protein_id="BAF39046.1"
FT                   /translation="MGFFFQGLTLGLAYVAPIGMQNLFVIDSALTKPRRRALLTALIVL
FT                   FFDVSLSLSCFFGIGKLMQDHAWLKLAILAIGGLVVIRIGAGLLFPGKGGDDGAAQTPQ
FT                   SQTSQSQGLAQRVTSKFGGDSELLHTIVTAGVVTWCNPQAIIDGTLMLGAFSATLTVGQ
FT                   STPFITGVETASALWFFGITLLVSLFSHKFSPRIITAMNRVCGAVVVLYGVKLLADFAM
FT                   AVL"
FT   CDS_pept        354368..355879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yisV"
FT                   /locus_tag="BAD_0266"
FT                   /product="probable transcriptional regulator(GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39047"
FT                   /db_xref="GOA:A1A014"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1A014"
FT                   /protein_id="BAF39047.1"
FT                   /translation="MARIAPLNIDWKPDRTTGEPVTEQIVGYMCEQVHSGNWPIGSRLP
FT                   SQRALAEWFGVNRSTVIAAINELSDYGIVEGQHGAGTRIVSNTWSLMLPGAPDWADYVD
FT                   SGFFKANNDTIQAINRYEFTPNMTRIGTGELDPRLFPKAMWRQVLGEAADEIETLGYPP
FT                   PEGLPELREAIAAHMRATGVDCTASQVLVTSGALQALQMISVSLLPAGTTVYAESPSYI
FT                   KSLQVFQSAGMHLEGVPMDDDGLNVQALRGLLAEGELDTGRPAPLNARNRKGNAILYTI
FT                   PTNHNPTGVTMSDKRRHELVELSVDSRLPIIEDGAYRDLYFEDDAPLPSLKALDETGMV
FT                   ITLGSASKSLAPGLRIGWLVAAEPIVQRLADVKMQMDYGASVLSQWTFARFLTNGMYDE
FT                   YVAGLKRELRHRRDRALVTLQEKMDGLAHWNVPSGGFYIWMTFDRPIRMNRLFQLAAER
FT                   GVLLNPGDIYDFAADNSLRLSYSYTTPEEFADAVDVLAAVARELA"
FT   CDS_pept        355898..357559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0267"
FT                   /product="possible protease"
FT                   /note="COG family: collagenase and related proteases"
FT                   /note="Orthologue of BL0326"
FT                   /note="PFAM_ID: Peptidase_U32"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39048"
FT                   /db_xref="GOA:A1A015"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:A1A015"
FT                   /protein_id="BAF39048.1"
FT                   /translation="MDGLCLSRESTTISDGLLRVRGTSVQRRNKPEVLAPAGNLRGLKT
FT                   AVDYGADAVYCGGKAFGMRSAPKNLSLEDFEEGARYAHERGARVYVTFNVLPRNNEVEA
FT                   MREYLGKLKDTGVDALIVSDIGVMLMAKQVAPNLELHVSTQAGVTNYQAANAFYELGAR
FT                   RVVLAREMDLQAVRDIRARIPDDLDIECFVHGAMCMAFSGRCLFSNYLTGRDGNHGECA
FT                   QPCRWKYSIVEEKRPGQYFPIEQTAEGAYLFNSQDMNMLAHIDDLLDSGATSLKIEGRS
FT                   KSAYYIAAMTNAYKTAVNEYMVQRGFEDADGNVLKPFRDRVIRPGDPEYGKPDTEDAIM
FT                   ANADGAFAGKPDIDAVPVGGVPSGNVSAGNVSSGNIAIGEPDNLSYHARSTRRKSNTAA
FT                   EILPEGWHHAGVRPAPHVTLPDWLLDEPDKVAHRDYSTGFYYPEHKVRQSTDRSAYFRA
FT                   WLVVGEVLSWSPEDGGRVTIMSRNKIEAGQEVEFVLPGAAPFAYTVPAGGFRDADGHWV
FT                   EAINNPAHVFSMPCPQEVPVNAAIRSRTKKPTLKAE"
FT   CDS_pept        357614..358645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0268"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Acr"
FT                   /note="Orthologue of BL0325"
FT                   /note="PFAM_ID: DUF152"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39049"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A1A016"
FT                   /protein_id="BAF39049.1"
FT                   /translation="MSSTQYDDAILDSNAIDPTDKNGNPIPVTIPIMLAPGIKVVYTTR
FT                   LGGTSEGDFAHFNLGGKSGDKPEHVLANRKALADVLGAKISLISQVHSGDAVDVDESFV
FT                   INQPFGFDVSGTKKPEDETDGENNATGNDGEPTVIEADGQVTSRKNVALGMFAADCLPV
FT                   LMADPEAGVIGAAHCGRRGLQKGVIGATIEKMVSKGAQPERIVATLGPCICGDCYEVGG
FT                   DIADEFDAQFPGTFTLSRFGQPGIDIAAAALQELAKAGVPADNIVSSRPRVNAATQYLS
FT                   EDEELAGICAADGEGDPKLSERFNKIRRSLCTLENPLWFSHRRASLAKKQHEGRMLALI
FT                   VRE"
FT   CDS_pept        358689..359603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BAD_0269"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /note="COGfamily: 4-diphosphocytidyl-2-methyl-D- erithritol
FT                   synthase"
FT                   /note="Orthologue of BL0324"
FT                   /note="PFAM_ID: UPF0007"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39050"
FT                   /db_xref="GOA:A1A017"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A1A017"
FT                   /protein_id="BAF39050.1"
FT                   /translation="MIRVATVADCVQNPPWNGVACGRGFTVEHMSKGEQMQEQKMPVVA
FT                   VVLAAGFGTRFDENNPKQLVSVGGKPIVCRSIEAFENNDRISDIIVVVNERVEETVNEL
FT                   IDEAGYAKVRAIVPGGAERVDSTLAALDLLKQAGIPSGAKILIHDGVRPFVEERSIDGC
FT                   IDSLDQFNAATVAYASTDTILLTEDLGDRKVVKSVPERPNTFRAQTPQAFRFGTIVKAY
FT                   ELAAADPDFHPTDDTRVVVDYLPDEPVAIVDGSETNLKITTPSDMPIAEGIARSLDPEH
FT                   AKEEAKARMHAVFAEAFSQMHSR"
FT   CDS_pept        359671..360366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="BAD_0270"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /note="5-oxoprolyl-peptidase"
FT                   /note="COG family: pyrrolidone-carboxylatepeptidase
FT                   (N-terminal pyroglutamyl peptidase)"
FT                   /note="Orthologue of BL0323"
FT                   /note="PFAM_ID:Peptidase_C15"
FT                   /note="Pyroglutamyl-peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39051"
FT                   /db_xref="GOA:A1A018"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:A1A018"
FT                   /protein_id="BAF39051.1"
FT                   /translation="METMQQINIVISGFTPYEGIDVNPAVLVPAAVAKQWGDPAQSQAI
FT                   SEELLQDIAVTVTNVTLPVSFAKAWPTLLEAIEQAKPDIVIATGLKRTSRGILLERCAT
FT                   NLMDAAKPDADNVIPPRRPIDPEGPAAYWTRLPLRSILHDFAKHEIPAALSSDAGTFVC
FT                   NSLFYHLLNWSAGQERRILSGFVSLPIVNGRPHERGLPIEQQTAAVDDVLRESVRYFLQ
FT                   PSSSDILLG"
FT   CDS_pept        360601..362034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0271"
FT                   /product="hypothetical protein"
FT                   /note="COG family: methyl-accepting chemotaxis protein"
FT                   /note="Orthologue of BL0322"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39052"
FT                   /db_xref="UniProtKB/TrEMBL:A1A019"
FT                   /protein_id="BAF39052.1"
FT                   /translation="MVEQFPIVLRGYDKDRVDEAFASAQETVNRLREQVKADDQTILEL
FT                   QAQLQEEKNKKAAPKSFASLGANAQQMLASAEQTSAELLERAKKDASAARATVQLQAET
FT                   LLNNAKIDAKRIMDDANAKAAKVLGDAKDESEAMRANAQHEVDQMRSEAQKAVVAQRQT
FT                   VDLELTNSREEHGKRLAAERATQEREISDMRTEATSKIAEQRKNANEEISRLKSETNDQ
FT                   IESALAEANKKLADVREQVSKMMTDAQRRAAEITDTAKAKAQEITDEAEVHRTKTISQV
FT                   NAEVEQIRADISAQQEEATKKVNELLTDLNERREAANKQASELISSAQKTRDEAEAYAS
FT                   SKRDEADANAASILKQATEDADEQINERREAAKKELDGVQQRIADLQSREAQITQRVSE
FT                   LRAMFSNAFSGFGMNDLSVVNAVDEGEPSDAQSDDDAQHDDETAAPADADTQDAVENDS
FT                   AAETEPEGDAESADASQNN"
FT   CDS_pept        362057..363394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC2"
FT                   /locus_tag="BAD_0272"
FT                   /product="aminopeptidase C"
FT                   /note="COG family: aminopeptidase C"
FT                   /note="Orthologue of BL0321"
FT                   /note="PFAM_ID:Pept_C1-like"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39053"
FT                   /db_xref="GOA:A1A020"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1A020"
FT                   /protein_id="BAF39053.1"
FT                   /translation="MTDITPLSGDELNKLVDDFEASEHNRMAMNAVTTAGIDKVARNYD
FT                   RARLMQRRFSTVVDNGTVTHQDRSGRCWLFSSLNVARFVAKQNMGLKEFEFSQNYAMYY
FT                   DKLERVNYFLKDVAKLVRAGEPADSRLMQHLLSDVMGDGGQWTMAMNVYKKYGAVPKDL
FT                   FPETESSRNTGEMNVQLRRMLHTAVAHMYADPSAIDAIIADAVAAGHRILTIHLGEPPK
FT                   SFDWEWTDKDGEFHRDGEITPVEFWKKYVGSADLESYVCLVDDPRQEHVKGKKIGIEHL
FT                   GNVAGGDPTEYLNVPNQFMKDCVRQILQEQGIPVWFGADCHPMMDRENGAWATDLFEYG
FT                   RVYGVDFDLDKEQRVRFGDSAMNHAMAFVGVDVDEDGHTTRRWRVENSWGDKIADKGYF
FT                   TMSDDWFTEYVYEVAVPKVLLPAEYLKALEEPATMLPAWDPMGALA"
FT   CDS_pept        363824..364957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG2"
FT                   /locus_tag="BAD_0273"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="Catalyzes the formation
FT                   of3-deoxy-D-arabino-hept-2-ulosonate 7 phosphate
FT                   fromphosphoenolpyruvate and D-erythrose 4-phosphate"
FT                   /note="Orthologue of BL0320"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39054"
FT                   /db_xref="GOA:A1A021"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1A021"
FT                   /protein_id="BAF39054.1"
FT                   /translation="MAGLRGPDSSKDAQLLDERAVFPETVDVNIRQLDPIPAPRYFLKE
FT                   LPLTNEMSDLVLKSRQEIRDVLHGRDDRLLAIVGPCSIHDPKAAHEYAERLAAVKKELD
FT                   DRLVIVMRVYFEKPRTTIGWKGLINDPDLDGQFNIRKGMFMARKVLTDVLGLGLPAATE
FT                   WLDPITPQYICDLISWGAIGARNTESQVHRELASGMSMPIGFKNATDGSIKPAADSCFA
FT                   AAFEHHFLSINLDGRVISAETKGNPDCHLVLRGSSHGPNYDAASVAQALADLKASKASG
FT                   PSEHGLIIDAAHGNCGKNEVREAEVVEEIAARVAAGEQGILGIMMESFLKAGNQKPAPL
FT                   DQLEYGKSITDACVPWDRTEQLLHTLADAVDARRKLG"
FT   CDS_pept        365015..366199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="BAD_0274"
FT                   /product="phospho-2-keto-3-deoxyheptonate aldolase"
FT                   /note="Catalyzes the formation
FT                   of3-deoxy-D-arabino-hept-2-ulosonate 7 phosphate
FT                   fromphosphoenolpyruvate and D-erythrose 4-phosphate"
FT                   /note="Orthologue of BL0319"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39055"
FT                   /db_xref="GOA:A1A022"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1A022"
FT                   /protein_id="BAF39055.1"
FT                   /translation="MQQQLNTPEDLRAIRQAMDEGKNPLVETDVPRWEDQVGISRIVNR
FT                   RVLEFEVLPTPAQVLGDLPLSEQAQEIVAYSRDEIRACLYGQDDRLLVVVGPCSVHDPK
FT                   AALDYARRLSALKGELDGELLIVMRVYFEKPRTTVGWKGLINDPDIDGSCNIRKGLLLA
FT                   RRTLLGVLDEGLAAATEFLEPTSPQYISDAISWGAIGARNTESQVHRQLASGLSMPIGF
FT                   KNATDGSIKAPADSCFASAQQHTFFGIDHLGRAAVVKTLGNPDCHVVLRGSSHGPNYDA
FT                   ASVAKAMDTIRAEMPADSAAAHGLIVDCSHGNSGKDEHRQAQVVRDIAGRIAKGEQGIT
FT                   GIMMESFIEGGNQKAAPLGQLVYGKSITDKCLSWNTTEQLLRELAHAVAVRRWK"
FT   CDS_pept        366303..367010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="BAD_0275"
FT                   /product="5'-methylthioadenosine nucleosidase"
FT                   /note="COG family: nucleoside phosphorylase"
FT                   /note="Orthologue of BL0318"
FT                   /note="PFAM_ID:PNP_UDP_1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39056"
FT                   /db_xref="GOA:A1A023"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A1A023"
FT                   /protein_id="BAF39056.1"
FT                   /translation="MTAIAIIGAMDEEVANIATALSNVTVTEEAGVKVTRGTLETNKGT
FT                   AVNVAATVGGMGTVNIAATTQHLIDADQPDAVIFSGIAGNLNTNLHINDVVLGGTLRYL
FT                   DTDMRLVGQFKPGTADRPIEEYHSDDRLLELADQALNDLNIHHIVGIIATGNYFVDDPQ
FT                   KVEQVIRETGADAVEMEGAAVAHVAARNDVPALVIRALSDNADTDYEDFKTFDISEYAD
FT                   TAAKLTVNIAKRM"
FT   CDS_pept        367254..368663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0276"
FT                   /product="sensor protein"
FT                   /note="COG family: sensory transduction histidine kinases"
FT                   /note="Orthologue of BL0317"
FT                   /note="PFAM_ID: HATPase_c"
FT                   /note="PFAM_ID: signal"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39057"
FT                   /db_xref="GOA:A1A024"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1A024"
FT                   /protein_id="BAF39057.1"
FT                   /translation="MTLEQMLATPSVVAALVVVAVVVFVVAFLLGRRRGFQDVQDSVDP
FT                   NDPSLFGAAKNTSLFGPRVPVQSTERQLVAVMPEALVVVDSLATVQYASPAARRFGIIH
FT                   DQAMALAEIRDIVKLVSTDSVVRERELTIPLHGRTRTGVVNTNGKGVEAGKPLPEDTLY
FT                   LHVRVGQIADNLFAIFISDMSEQRRFEIMRRDFVTNVSHELKTPAGAISLLAETIGDAA
FT                   DDPDAVKYFSGRISKESERLTELVHRLIDLQKAQSAAAMLNAERLSVLPVAREALAENQ
FT                   VKAESKHISLVLSVNGRQVLVHANAEELAKEAEQNLDVFVVADHETIKTAVKNLVENAI
FT                   NYSPEHTTVAVGIGIESGKVAIRVVDQGIGIPAASLSRIFERFYRVDPARSRETGGTGL
FT                   GLAITKHCVEDCGGTISVWSREGEGSTFTITMPQASGAAEPDHPADSANDNTREKKQSG
FT                   HSTTTENEENH"
FT   CDS_pept        368660..369367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0277"
FT                   /product="response regulator of two-component system"
FT                   /note="COG family: response regulators consisting of
FT                   aCheY-like receiver domain and a HTH DNA-binding domain"
FT                   /note="Orthologue of BL0316"
FT                   /note="PFAM_ID: response_reg"
FT                   /note="PFAM_ID: trans_reg_C"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39058"
FT                   /db_xref="GOA:A1A025"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1A025"
FT                   /protein_id="BAF39058.1"
FT                   /translation="MMTRILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKG
FT                   GIDLVLLDLMLPGLDGTALCRRIREQSRVPIIMLTAKSAEIDKVVGLEIGADDYITKPY
FT                   SFRELLARIRAVLRRNQMVAESGEAADDDIPLVCGDISMRIGQHEVTVRGENVFFPLKE
FT                   FELLEYLMQNKGRVMTRHQLIDRIWGSDYVGDTKTLDVHVKRVRAKIEEDPGHPKYLTT
FT                   VRGLGYKIDTPSE"
FT   CDS_pept        369534..370730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="BAD_0278"
FT                   /product="phosphate-binding transport protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type phosphate transportsystem_
FT                   periplasmic component"
FT                   /note="Orthologue of BL0315"
FT                   /note="PFAM_ID: PstS"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39059"
FT                   /db_xref="GOA:A1A026"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A1A026"
FT                   /protein_id="BAF39059.1"
FT                   /translation="MATTENRKIRNIRHLNVDRGKRIMRNSILVRSIAAVSGIVMLASV
FT                   AACGDNITASTDSSAKSDTKTETVSGNFSGAGASSQQAAVEAWIAGFQGTNPDAKVAYN
FT                   PSGSGAGVSTFLTGATAWAGSDASLADNEVEQSKSVCASGTAFDIPVYISPIAVVFNLQ
FT                   GVSGKGKTLNMDAETIAKIFDGKITKWNDDAIKKQNPKVDLPDLDITVVHRSDKSGTTK
FT                   NFLSYVKDAAGDAWSYDLGENWPNEVGQGAKGTSGVISTVQQADGTIGYADASQAGDLG
FT                   TVAVKVGDDYVPFSAEAAAKVVDASPLDDSAKGDNRVVVKLDHNTTEKGAYPIVLVSYD
FT                   VACPAYKDANTAKFVKSWLTYVTSDEGQQTAASAAGSAPMSNTLRQKVVKSIDAIKTK"
FT   CDS_pept        370893..371846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="BAD_0279"
FT                   /product="probable phosphate permease protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type phosphate transportsystem_
FT                   permease component"
FT                   /note="Orthologue of BL0314"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39060"
FT                   /db_xref="GOA:A1A027"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A027"
FT                   /protein_id="BAF39060.1"
FT                   /translation="MSSQSKTAQQPVSGKNADKVFKGVAYACGILILVVLAAVALFLLF
FT                   RAWPLIGGDQKANSATISNFTGGKASSFWGYVGPLLFGTVLISALALLISFFVSVGIAL
FT                   FISHYAPKKLATALSYVVDLLAAIPSVIYGLWGGLVLVPAIYPFWNWVAKYLGWIPIFA
FT                   GPAANPSRTVATVSVVLAVMILPIITSMSRDIFLQTPRLQEEAALALGATKWEMVKLAV
FT                   LPFGKSGVVSASMLGLGRALGETMAVLMILSPGLNYSVKLLQASQNQTIAANIAAQYPE
FT                   ANDLGVSVLIGTGLVLFLITFVVNFIARKLTEKASA"
FT   CDS_pept        371843..372841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="BAD_0280"
FT                   /product="probable phosphate binding-protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type phosphate transportsystem_
FT                   permease component"
FT                   /note="Orthologue of BL0313"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39061"
FT                   /db_xref="GOA:A1A028"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A028"
FT                   /protein_id="BAF39061.1"
FT                   /translation="MMTAANNDASPMDGAPVIDFDKFKPTRSFTSARKRKDFAMKALIS
FT                   CAFIVALIPLFSVLLTTIINGVKRLNLNFLSYNMTGVVGGNSTPSGGYGGILHAIIGTL
FT                   EITFGAMLISIPIGLMCAVYLVEYSNRGKLAQVITLLVDVMSGIPSIVAGLFAFSMFTI
FT                   LIGPGTINGFEGSVALSLLMLPTVVKSSEEMLKIVPHDLREASYALGVTKQRTITKIVL
FT                   RTALPGIVSGAILAVARVIGETAPLLMTAGYIASTNVNLFSGQMTTLPVYVYQEYSKLN
FT                   ANCPANASAACVTTIPMERAWAAALVLILIVLILNLIGRLVAKIFAVKSER"
FT   CDS_pept        372886..373665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="BAD_0281"
FT                   /product="phosphate import ATP-binding protein pstB"
FT                   /note="COG family: ABC-type phosphate transportsystem_
FT                   ATPase component"
FT                   /note="Orthologue of BL0312"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39062"
FT                   /db_xref="GOA:A1A029"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A029"
FT                   /protein_id="BAF39062.1"
FT                   /translation="MGQRIDVNHLNIFYGDFLAVEDVNINIEANKVTAFIGPSGCGKST
FT                   VLRTLDRMHEIIPGAHCEGEVLLEGKNLYDKDVDPVAVRRDVGMVFQRPNPFPTMSIRE
FT                   NVLAGVKLNNRKISKSDADDLVEWALRGANLWNEVKDRLDNPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLINELKNEYTIVIVTHNMQQAARIADYTAFFN
FT                   LKAVGQPGHLEYFTDTTTMFNNPQNEEAERYVSGRFG"
FT   CDS_pept        373897..374838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0282"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type Mn_Zn transport
FT                   system_periplasmic Mn_Zn-binding (lipo)protein (surface
FT                   adhesina)"
FT                   /note="Orthologue of BL1126"
FT                   /note="PFAM_ID: Lipoprotein_4"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39063"
FT                   /db_xref="GOA:A1A030"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A1A030"
FT                   /protein_id="BAF39063.1"
FT                   /translation="MMDSPKHEAYENGGTIVNRYARIAIAVLASVGLLTSASACGTSQN
FT                   GAGSAHGAISVVSSINQWGTLAEQLGGSGVQVTSIINSTNVDAHDYEPTTSDIAKLQKA
FT                   RIVIVNGAGYDSWAVKAAQSAKSQVINAAEIGGVKDGGNPHVWFSAAVRKAVAQAITRA
FT                   YEGTRPDGKADFDKLNQQWRSKEDEVARKITETKRKADGEAYAATESVAEYLAGDLGLK
FT                   DATPTGYMRATANESEPTPTDIKQFTDMLEAGKVGLLVVNIQEETELTGKIVTAAKSSN
FT                   IPIVELTEQMPEQYDSLTDWMAALVDAFSQAI"
FT   CDS_pept        complement(374928..376430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0283"
FT                   /product="hypothetical protein"
FT                   /note="COG family: permeases"
FT                   /note="Orthologue of BL1547"
FT                   /note="PFAM_ID: xan_ur_permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39064"
FT                   /db_xref="GOA:A1A031"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A1A031"
FT                   /protein_id="BAF39064.1"
FT                   /translation="MLRLLCSGTHVPGESRFSPAHATIWHAPTNPRKMRKEKMEKFFHL
FT                   KENGTTVSTEIMAGLTTFFAMSYIIIVNPQILSSTGMPWGGVFLATIIAAIIGTLVMGL
FT                   FANVPYAQAAGMGLNAFFTYTVCFGLGFKWQETLCMVFLCGLINIIITVTKIRKMIIQA
FT                   IPEVLQNAIGGGIGLFVAYVGFLNVGFFTFTTKSAAKSGDTVQATPGLAVMNNPTIWLF
FT                   IIGLVLAIVLTVLKVRGGMLIAIAVTAVVGIPMGQTTMANSVSIADTFAQLPQTFGVIF
FT                   TKDGFPALFSDVSKLPIILLTIFAFSMSDTFDTIGTFIGTGRRTGIFSAEDEKALENGS
FT                   GFSSKMDKALFADSIATSIGAICGTSNTTTYVESSAGIAAGGRTGLTSVVVAICFALSA
FT                   FLSPVISAVPSAATAGVLVVVGCMMASSLKEIEWGDISEAIPAFFASVFMAFSYSISYG
FT                   IAGGFITYCIVKTCKKQAKDVHPVIWVVAVLFILDFIITAVL"
FT   CDS_pept        376738..377259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BAD_0284"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Binds the two ribosomal protein L7_L12 dimers
FT                   andanchors them to the large ribosomal subunit"
FT                   /note="Orthologue of BL1549"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39065"
FT                   /db_xref="GOA:A1A032"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A032"
FT                   /protein_id="BAF39065.1"
FT                   /translation="MKRPEKEAVVAQLTDKFRNADAIYLTEYRGLTVPQISELREKLGR
FT                   DTSYTVAKNTLVRIAAKEAGIEGLDELLAGPTAVTFVKGDFIEAAKTLRDFAKTNKALI
FT                   IKGGFADGTVYDAEGAKKLADLKSRPQLLAEFAGDIKATMSKAAYLFNALPTKAVRTID
FT                   ALREKQEKAA"
FT   CDS_pept        377373..377753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BAD_0285"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG family: ribosomal protein L7_L12"
FT                   /note="Orthologue of BL1550"
FT                   /note="PFAM_ID: Ribosomal_L12"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39066"
FT                   /db_xref="GOA:A1A033"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A033"
FT                   /protein_id="BAF39066.1"
FT                   /translation="MAKYTNDELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPVAAVAA
FT                   APAAGAAAEEEKDEFDVILSAVGDKKIQVIKAVRAITNLGLAEAKALVDGAPKAVLEKA
FT                   KKEDAEKAKSQLEEAGATVELK"
FT   CDS_pept        377968..379473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0286"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1551"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39067"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A1A034"
FT                   /protein_id="BAF39067.1"
FT                   /translation="MSEDRRMTRQWTVKVDGNNVKTLHDGESVEIGRKPLRPLSDDGFA
FT                   RLDIMDPGKSMSKRHAVLSVDKQGNCSVRDLHSTNGSFVVTNNGQLMRLPAGEDIKLPI
FT                   DSMTLQFGDVRLTLESAFEHDDEDDDATSGVSDDTSQPVSNLFEYAVSDEAPQEPDAAD
FT                   MSVDDILNLRAGEPTTFFHARNVTDRADALHQAERQTFTPEHADKPELEDAFPSVSLVQ
FT                   ETVVAADKPRDLFADAAAQAEAEAEIEADAADSADAAATDAEVAAVSTETAAQPLEASH
FT                   DGNKNNLIPVDKLFSARPSTPIAVALPDRNDTGDNTGNVDKADNAADASAQEQTQSAEQ
FT                   SQMAEQPTSETAEQQPAEQQSKPMHATQPQTEQPGTVTAEDDDERFRPQNSQSQPAPDE
FT                   TAAFKPIFEPGSVFDRVSKGGLAKQEQTIEVDGLTSDDAKRTDDFTVQFQMARHPELLP
FT                   FLAMNPSLYDDLYAWLGALGNQDIDAALAHNPGYEEYRKAVGK"
FT   CDS_pept        379470..383102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0287"
FT                   /product="hypothetical protein"
FT                   /note="COG family: superfamily I DNA and RNA helicases
FT                   andhelicase subunits"
FT                   /note="Orthologue of BL1552"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39068"
FT                   /db_xref="UniProtKB/TrEMBL:A1A035"
FT                   /protein_id="BAF39068.1"
FT                   /translation="MSRYMSENEETATALDRIRGWREEYRLGLAPSPLEDVTQLSAQLD
FT                   LTHAHPSGIAQLFAKGHVTLDSLFRDNGMLRAAGRRVERVLDDRDAKSRVSGVGELSLV
FT                   VGVAIWKGNQMPVLMYPVEVRKEGRNIENGTVIAFTGRVRLNAAFAAVMRENNVTLDET
FT                   KLFDGSNYESGTPETSAVFAAITARASSVFPDFEIERHIILGCFMDPSSQMLVESRQII
FT                   NQLSQGPTGNTVLDALAGNKEAADALKDAQIPEYSPFDADPHGEYEIGDVDNTVRYAAQ
FT                   LAASGHSIFVDSAISGNTAEQAAAIASRCVMGGHSVLYVPCVTDQKRRFMQTIAANEMS
FT                   GQLLDIADDGANAAIDRQLIAAVGFQSGVATSRFDQISDELVGVRSRLARYLGDLHGVS
FT                   QEWGVSAYQTIQNLAQIAVLPTHPTTHVRLTKQSAHSIADKMEEWAQKLYRAGELGEYT
FT                   IGAQDTAWYKASLYSEEEAISAYQRVVELLRKVLPATRKQVSSTVQTCGFPIPTTAQEW
FT                   GRQVMVLKNLRRVLDVFQPEIFERDIDSMIEATKPKAQRKAEGSSMGFWERRRHIKEAK
FT                   SMLRVGAQVENLHEALLVVAKQAEQWHMFVPHGGWPVLPAKLDDIINTQDQLTNDMTAL
FT                   NVALATTPQGGNLDTVDLNQVEERLKALYDDKQALDTLPERARLEREFHSAGLDELVAD
FT                   LSNRGVPNDAVAGELQLAWWTTAFEDIVKSSAIISNQDGSAMQSAADRFTQVDVEHVRS
FT                   IGPMVAQESVRRLCDMLFSRTQEANLLHTTLAGSRNVPLNRLRREHPQILAAAKPILVA
FT                   TPATLAAITDPAPLADTVIIDTAAHIPSIELLSIIARAKQVVVIAHRKTVTSDGLQRLI
FT                   ALLPSVKITDRPVRRAPKLNAFLESEGYGSVPCDVAREGYQGEVAYHFVPDANGVPVIN
FT                   SGLVESSQQEIDEVVSIIRKRAAGFTIVPASYVLTVVALTHTFRIRLGAELKSLANKDK
FT                   AMGMFLRHVRIVDIVDVAGAHATDAILAMCYAKTSHGRLLQQFGALESDGGRGMLLDAL
FT                   AVPDRHLDIVSSFASDDMDDERLHQDGPKALKTVLRWAEQLDDSMVRPAIKESGENVLF
FT                   NDLAERIRERGLDVAVDYGFDDGLKLPLVVGLKGEPFALAVLTDDAQFMGLQSTRERHR
FT                   VLLQDIESLGWSVMTVWSVGAFVNPDKEVDRIVARLGSLYREER"
FT   CDS_pept        complement(383415..384215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0288"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1553"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39069"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A1A036"
FT                   /protein_id="BAF39069.1"
FT                   /translation="MMTFFHSLMDRRPHSSLRTSTASEGRTARTTRLQRDRHGSTAASL
FT                   EARRSNARLHRFLAALCAGLTVFATLQCVRAAIATQPIVVAVRNVAKGTAITREDVELR
FT                   EAPSDGSLSNAFHTLDDAVGLIAQVGIGAHDVLMSGMARASPVVPQGHTSIEVRLASVA
FT                   GGLIPGDKVTLSSATMTDAEMQSGTPNVADMPNGTETPSGMANDMPDGGVDAQLHTICA
FT                   EALLTGKPAKDAQGNTIAVFAMPPNEAAVVLRVQEYSAVIATIN"
FT   CDS_pept        complement(384596..385216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0289"
FT                   /product="hypothetical protein"
FT                   /note="COG family: 5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="Orthologue of BL1555"
FT                   /note="PFAM_ID: 5-FTHF_cyc-lig"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39070"
FT                   /db_xref="GOA:A1A037"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1A037"
FT                   /protein_id="BAF39070.1"
FT                   /translation="MDMCKQQRELKRHWRAAAIERRKRTSADQRREAGRLLAEHALEAS
FT                   LIRPRSTVAAFASMGSEISMMPLLEAMFDTDCRVLVPRLGAGMEVGWSELNGLDDLRDQ
FT                   RNADGSINTHRPQEPENAAEGPEVLTSAELIIVPAFAVDEHGFRLGRGGGWYDRALEHR
FT                   SSTARVVAVCWPWEPTDETVPHEPHDIPVDGVLTPDGYADVRG"
FT   CDS_pept        385375..385953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0290"
FT                   /product="possible acetytransferase"
FT                   /note="COG family: acetyltransferases_
FT                   includingN-acetylases of ribosomal proteins"
FT                   /note="Orthologue of BL1556"
FT                   /note="PFAM_ID: Acetyltransf"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39071"
FT                   /db_xref="GOA:A1A038"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1A038"
FT                   /protein_id="BAF39071.1"
FT                   /translation="MRVPVSLRPLTGADYDEWNEVRWRNDAWLKPWESGDPLHGAPITY
FT                   KEWMKQLRRNERAGTGAVFAIEQHGRIVGQISLGAICYGAMRSGVVGYWVDERCAGRGY
FT                   APMAVALLADWAMFDPAGPRLHRMEIDILPENKRSRAVARKVGATLEGVRRAYMYVNGQ
FT                   WRDHESYVLMAEDVPNGFTARLMTGNSPS"
FT   CDS_pept        386013..387209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0291"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1557"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39072"
FT                   /db_xref="GOA:A1A039"
FT                   /db_xref="UniProtKB/TrEMBL:A1A039"
FT                   /protein_id="BAF39072.1"
FT                   /translation="MGYESLSTVVVLAIVVILMLIWLPRRTIKGMKRVIEHREDRFSPS
FT                   LHLVDADSGTRFSDETVAAAKGVLMQSTEAHKGATSEERIAEIRALRHAAVRRRRAIAV
FT                   SLLTITVVVLVCAFALHFSPLFALIPAALLAAVLALGVRASKQAVAWERKVARYHAKVK
FT                   KRVAAERKRAQAEQAERARLRAQELAEARKVVDEQLKTDVVPEGEIRQAIARGKADRDA
FT                   AVKRRKEEMSSKEETQTAEKAVDQTTERADAAPADVKEVGLSIHDERDNMAEEAKTVAV
FT                   KSTQDLISFSLGAPRDGADVEVDAPESMEIKSTKQVAKAVPVETPSDEAEPLIPPNDAM
FT                   GSMDADEAAARVDEGVHLREVDVPGFHDAEVRADVEAPDVTSDSLGTGLEAILARRSA"
FT   CDS_pept        387432..387725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BAD_0292"
FT                   /product="groES protein"
FT                   /note="COG family: co-chaperonin GroES (Hsp10)"
FT                   /note="Orthologue of BL1558"
FT                   /note="PFAM_ID: cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39073"
FT                   /db_xref="GOA:A1A040"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A040"
FT                   /protein_id="BAF39073.1"
FT                   /translation="MSISLTPLEDKIIVKQAEAETQTASGLFIPDNAKEKPQQGEVLAV
FT                   GPGRRNDAGERIPVDVKVGDKVLYSKYGGTEVHYQGEDYLIVSARDILAILG"
FT   tRNA            387948..388029
FT                   /gene="tyrT"
FT                   /locus_tag="BAD_t0013"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:387982..387984,aa:Tyr,seq:gta)"
FT                   /note="codon recognized:GTA"
FT   tRNA            388031..388103
FT                   /gene="thrV"
FT                   /locus_tag="BAD_t0014"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:388063..388065,aa:Thr,seq:ggt)"
FT                   /note="codon recognized:GGT"
FT   tRNA            388109..388185
FT                   /gene="metU"
FT                   /locus_tag="BAD_t0015"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:388143..388145,aa:Met,seq:cat)"
FT                   /note="codon recognized:CAT"
FT   CDS_pept        388234..388404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BAD_0293"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39074"
FT                   /db_xref="GOA:A1A041"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A041"
FT                   /protein_id="BAF39074.1"
FT                   /translation="MASKSADIRPGITLACTECKERNYITTKNRRNTPDRLELKKFCSR
FT                   CGKQTVHRETR"
FT   CDS_pept        388595..389665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="BAD_0294"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="Orthologue of BL1561"
FT                   /note="PFAM_ID: MurB"
FT                   /note="UDP-N-acetylmuramate dehydrogenase; MurB; COGfamily:
FT                   UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39075"
FT                   /db_xref="GOA:A1A042"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A1A042"
FT                   /protein_id="BAF39075.1"
FT                   /translation="MIGGGSNMLVSDTPFEGVVVRDARRSIGVLDEAAPVEDDGRVVHV
FT                   NAEAGCNWDDFVDYCVRLGLEGVEGLSGIPGTVGASVVQNIGAYGQEVATSVDSVEVWD
FT                   RKERAVKALRNDQLAFGYRMSALKASMYSAPATPAAEFFPTPRYVVLSVTFALRHSDTG
FT                   VVGYGQLAKALDVAVGDRMNTADIRNAVLKVRAAKGMLEDAHRYASPAMQGTKKTNLVD
FT                   VALESQSKQNGDDGPDFNRHSCGSFFMNPILTPQQAETLPEDAPRFDAALPGGGQGVKT
FT                   SAAWLIDHAGFHKGFKINENAPAGLSTLHTLALTNRGGASAEDIARLAKTVQDGVEAAF
FT                   GIRLVPEPVVIGMNLK"
FT   CDS_pept        389726..391270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0295"
FT                   /product="possible cationic amino acid transporter"
FT                   /note="COG family: amino acid transporters"
FT                   /note="Orthologue of BL1562"
FT                   /note="PFAM_ID:aa_permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39076"
FT                   /db_xref="GOA:A1A043"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1A043"
FT                   /protein_id="BAF39076.1"
FT                   /translation="MERETARAERREGRDMNVFRKKSVEQTLAETGESGHALKRDLTWW
FT                   DLAIMGVAVAVGAGIFSIGAQAAAFHAGPAVVLSFLIAGVVCGAAVMCYAEFASMIPVA
FT                   GSAYTFTYTTVGEIVAWVIGWDLILEMLMAGSVVSKYWGVYLNQFFELIGWNINTNIAI
FT                   GSFNFDLAPVIIVAFFTALLVMGTKIGARVDGALTILKIAIVVFIVVVGFFYIKAENFT
FT                   PFIPPSEPAASTDGSGVSAVMEQPLWQWATGMAPSIYGVTGIISGAALVFFAFLGFDVV
FT                   ATASEETINPKKNVPLGIGVGLGLIIVLYTLVAIVTTGMVSYKDLAKQSDPSLAVAFKM
FT                   VGADWAAKIISLGIVIGMATVVMVLLLGLTRVVFAMSRDGLLPRGLSHTGKHGTPVRLQ
FT                   IIVGVVMALIAACCNVGILSDMVNIGTLSAFTLVAISIPIMRKKRPDLERSFKIPGNPW
FT                   VPILIALANLWLMVNLSVLTWIRFVVWLIVGFAIYFGYGYRHARLGAGELEVAAQE"
FT   CDS_pept        391307..391627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxC"
FT                   /locus_tag="BAD_0296"
FT                   /product="ferredoxin"
FT                   /note="COG family: ferredoxin 3"
FT                   /note="Orthologue of BL1563"
FT                   /note="PFAM_ID: fer4"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39077"
FT                   /db_xref="GOA:A1A044"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1A044"
FT                   /protein_id="BAF39077.1"
FT                   /translation="MPYVVAQPCVDVKDKACVDECPVDCIYEGSRSLYINPNECVDCGA
FT                   CEPVCPTEAIFYEDDLPDEWAWYKDAAVSFFAEVGDMGGASAAGPIGKDPEQVAALPPQ
FT                   NQ"
FT   CDS_pept        391828..392976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0297"
FT                   /product="probable aminotransferase"
FT                   /note="COG family: PLP-dependent aminotransferases"
FT                   /note="Orthologue of BL1564"
FT                   /note="PFAM_ID: aminotran_1_2"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39078"
FT                   /db_xref="GOA:A1A045"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019880"
FT                   /db_xref="UniProtKB/TrEMBL:A1A045"
FT                   /protein_id="BAF39078.1"
FT                   /translation="MGFHEFSSPYDWSRIASYKRTAKAAFGGMVDLSVGSPVDPVPDSV
FT                   RKALAVSSNDPNAYGYPVTAGTADLRDAIHEWFAAARNVDLRAIGADAVPTVGSKEGVA
FT                   LMASLLHFGEGDVVVQPKVSYPTYEIGTQLAGAQTLKVDDVADADSWKDVPGVKAVWVN
FT                   SPCNPTGEVLSAEQMAGIVRAARAIGAVVLSDECYALMQWEDDVAEADADTLASTPCAL
FT                   RADVCGGSAEGVLVLYSLSKQSNMAGYRTALIAGDQSLIGPMAAYRKQIGQIIPGPVQA
FT                   AMAAGLRDFDAVKTQHSRYQERLGMLVSALRAYGYCTDMPQGALYVWVKAKSGDCWEDL
FT                   RQLAEIGIVASPGEFYGAPEYLRFSATASDAAIASAAERLAR"
FT   CDS_pept        complement(393161..393760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0298"
FT                   /product="hypothetical protein"
FT                   /note="Identified by Glimmer2; putative"
FT                   /note="Orthologue of CPS_1689"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39079"
FT                   /db_xref="UniProtKB/TrEMBL:A1A046"
FT                   /protein_id="BAF39079.1"
FT                   /translation="MQLFTKLSNRFKYSKRRKLQASAQTRLTAKTIYAVPGNSVIIDAS
FT                   LADKLTLYWGELSHCATRTPGSVTAIAIVPTSLHPIYRASRLQDVKRHVACADQSPSRM
FT                   DEGDLNAVILVNRHDRKRPHRLAITSINQRLGSRCQALRDMALIQRMQVIILSISDRHH
FT                   HRRVPQRQSAPLFITQPWPIAIGFQSIVRQLGEYEW"
FT   CDS_pept        393958..396000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0299"
FT                   /product="putative outer membrane protein"
FT                   /note="Orthologue of BF2899"
FT                   /note="Very low similarity to the C-terminal region
FT                   ofCytophaga xylanolytica ArfI"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39080"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011459"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A1A047"
FT                   /protein_id="BAF39080.1"
FT                   /translation="MKFEYHVKPTGNDAACGDTEHPFATISKAAQMASPGDTVIVHEGV
FT                   YREQVNPRRGGLSEHERITYCGAEGEARPVIKGSECVQGWTELADHPHVWTVVLDNTMF
FT                   GDFNPFATPIFGDWLEMPKFGKDPDKHLGDVYLNGVSFFESTTLEGVYDPQPRDTDEDF
FT                   ALKIPCPVPDVDRTRYVWHAEVDENAGTTTIWANFQGADPNEELVEVSVRRTCFFPSRN
FT                   HVNYITVRGFEMAQATGDWAPPTSQQWGMIGPNWSYGWIIEDNVLHDAKFSAVSLGKEI
FT                   SSGDNEWAKTERKTGYQYQLEAVFKARRIGWEKGLIGGHIVRNNDIYECGQNAIVGHMG
FT                   SAFCRIEHNHVHHIALKREFFGWEVAGIKFHAALDTVIANNNIHDCSLGMWMDWQTQGT
FT                   RITRNVFHDNVRDLMIEVSHGPYLVDNNVFASPVMFQNWSQGGAFVNNLICGGIEPHTV
FT                   PDRSTPYHYPHTTEVAGCAVVSGGDERWLNNMFAPQPVKPTVGEYGLSAYSDCPMSMHE
FT                   YLERQRAMWADPSQGGGERNPLQSLYAGGNIYLSGAQGLNKQEGAADDSERMQEDAPFF
FT                   GGTASTSVACDEPMPVTLVEEPDGLYLQCTVPQAVTDTRMQVVTSDMLGVPRIVEERYE
FT                   QPDGSDYVLDTDLLGQALTATERKAGALNGLVSGENHIRIWEWNN"
FT   CDS_pept        396002..397141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0300"
FT                   /product="xylanase Y"
FT                   /note="Orthologue of BH2105"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39081"
FT                   /db_xref="GOA:A1A048"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A048"
FT                   /protein_id="BAF39081.1"
FT                   /translation="MTNATDTNKTLGESMFAQCGYAQDAIDKRVSQVWHEIFEGPNKFY
FT                   WENDEGLAYVMDTGNNDVRTEGMSYAMMIALQYDRKDVFDKLWGWVMRHMYMKDGHHAH
FT                   YFAWSVAPDGTPNSNGPAPDGEEYFAMDLFLASRRWGDGEDIYEYSAWGREILRYCVHK
FT                   GERYDGEPMWNPDNKLIKFIPETEWSDPSYHLPHFYEVFAEEADEEDRPFWHEAAAASR
FT                   RYLQAACDERTGMNAEYADYDGKPHVDESNHWHFYSDAYRTAANIGLDAAWNGPQEVLC
FT                   DRVAALQRFFLTHDRTSVYAIDGTAVDEVVLHPVGFLAATAQGALAAVHSAQPDAEHNA
FT                   REWVRMLWNTPMRTGTRRYYDNFLYAFAMLALSGKYRYE"
FT   CDS_pept        397141..398727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0301"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /note="Orthologue of BF0575_BH2105"
FT                   /note="Similar to Caldocellum saccharolyticum xylanaseXynF"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39082"
FT                   /db_xref="GOA:A1A049"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:A1A049"
FT                   /protein_id="BAF39082.1"
FT                   /translation="MITSTNPMVYTDFPDPDIIRVGDVYYMATTTMHFTPGCDILRSYD
FT                   LVHWEFIAHALNIVADTPEERLECEGANAYGRGMWAPSLRYHRGTWYVLFAANDTHTSY
FT                   LLTADDPCGPWRKRELDGFYYDSGLFFDDDDRAYVVHGQSTLRITELNPELSGPMPGGL
FT                   DRVIVQDDPQADLGYEGSHLYKHDGRYYVFTCHFPQGKGKTEACLMAESLDGAFEVREI
FT                   IEDDLSFHGYGVAQGGMVDTPDGDWYAFMMQDRGGVGRVPILMPMRFGEDGFPVVGENG
FT                   KVPQSVSVPAASCAEPVTPINGSEFIARYNAEGGVDANCLQPYWQFNHISHNEYWSLTE
FT                   RPGAFRLHSGRISSNLNHAWNTLTQRTMGPVTVAEVTVDASTLHDGDFAGLAAFQGCYS
FT                   YIALTRRNGRTMLTVQYKPANDDSIFSDNDWDSPAVTDAEIMADADCMRLRAVYDFTDC
FT                   KDEVTFFYRDADTPESEWCPLGTAHRMIFKMDHFTGCRIGLFLYSTKETGGIADFYDFA
FT                   YSTPNTKEREQ"
FT   CDS_pept        398724..400175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0302"
FT                   /product="probable esterase"
FT                   /note="ORF_ID:slr8023probable esterase"
FT                   /note="Orthologue of slr8023"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39083"
FT                   /db_xref="GOA:A1A050"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1A050"
FT                   /protein_id="BAF39083.1"
FT                   /translation="MKRQVIVAQGTVEGLAAEDQGITVFRGVPFAQPPVGGLRWRAPQP
FT                   ALPWDGVLQAFDFGPTAMQPTPGASDDFYDREWGTDPAVPMSEDCLYLNIWTPALRGYG
FT                   ADSMVTSEKLPVMVWIYGGAYQCGGTFEKEFDGTHLAANGVVVVSVAYRLNAFGFMTHP
FT                   LLHEEAVERGDGEPYANFGFLDQRAGIQWVKENIAKFGGDPENITVFGQSAGAASVLAQ
FT                   ICSPMNHGLFQKAIMQSGAGLGYFNARQDTLEHAQANGIRLFEALGVSTLEQARAIPAR
FT                   TVLEAAESLPVPPDSGREDDWSMIVNWVPCVDGLFLPDQEERIVEGCKANNVDMLVGNT
FT                   TNEFIASTEDGKPVHVGQLGNLTLIRKWTASGGTAPYYYHFDVAMLGDDAGAFHSSDLW
FT                   FSFGSLAKCWRPFVGWHYDLARRMGLYWTNFAANGDPNGTDRDGTPLPVWDPCIGEECP
FT                   AMHLCQEPGMRTDWLTETDRKAFGL"
FT   tRNA            complement(400738..400828)
FT                   /gene="serV"
FT                   /locus_tag="BAD_t0016"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:400792..400794,aa:Ser,seq:gct)"
FT                   /note="codon recognized:GCT"
FT   CDS_pept        400971..402386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0303"
FT                   /product="DNA-damage-inducible protein P"
FT                   /note="COG family: nucleotidyltransferase_DNA
FT                   polymeraseinvolved in DNA repair"
FT                   /note="Orthologue of BL1565"
FT                   /note="PFAM_ID: IMS"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39084"
FT                   /db_xref="GOA:A1A051"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A1A051"
FT                   /protein_id="BAF39084.1"
FT                   /translation="MRHAGMPAGFAIFEHLFQNCRIVVYHGIMSTAPRIAAAKRDWGHD
FT                   EVGCTVLHIDMDAFFASLEVARHPEYADKPVIIGIGNRSVVSAANYEARKYGINSAMAS
FT                   SRARKLCPNGVFLPVDIHYYREMSRRIFTEVFSRVTDRIEQVSVDECYMDVSGALLRWK
FT                   SPRAIGAWIRDQVARRYHITCSVGIAANKLVAKMASTNAKPDGMLMIPVARHAEFVQMM
FT                   PLRGIPGIGPSLEKRLNAWGVDSVADLAKMSMESLEQATGSAISARGLYMAARGLDDRP
FT                   VAPRAQGKSVGAERTFDKDTQDMRQVTSMLRWCCDDVAGTLRRRGLMARKVMVKLRFPD
FT                   LSYATKGHTLDCPTDAASMLYPQCVALLLAMMGMPESSIDAISLTRPVRLAGMSAGGLV
FT                   EAADAAVQLSLDDMLEEQNEAQRGRGTDTEPSTQSERLRGAEAALDAVRLKYGKGSVRL
FT                   GIWRTGPSGNLEH"
FT   CDS_pept        402392..403792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0304"
FT                   /product="hypothetical protein"
FT                   /note="COG family: putative enzyme of
FT                   poly-gamma-glutamatebiosynthesis (capsule formation)"
FT                   /note="Orthologue of BL1567"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39085"
FT                   /db_xref="GOA:A1A052"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1A052"
FT                   /protein_id="BAF39085.1"
FT                   /translation="MWSMRRNRGSAMRYRDKAVHARNPEVLVAGRRRLAIVAAVVLVVL
FT                   LAVGGWFLTRCLHSSQSQAGQGAATQMDVAKQKKHVVKKAEPKEHHGNSPDCPDTDCIA
FT                   MMVNGDLLFHPGLWDNFAGPNTAATDGTAYDFTSLFEPMRKYIDASDIAVCEFETPIAP
FT                   RGGPYTGYPVFNIPSEVADAAAKVGYRACTHASNHSWDQGADGITRLWDTLDQDGIAQT
FT                   GSYKTEEDSTKPLVIDSPTGGGKLGLIAGTVSLNAQTPDYDWRVDRLRESGDPNHQADI
FT                   DKAVAKAKEARKQGADVVAIAMHSVQEYLDYADSWQQSEAHELADTGAFDVIYGAGCHC
FT                   AQPVENYNGTWIIYGLGNAVTVTSYIPGNEVNNQGVTARVQFAGKKGVAGSWRVNRIDW
FT                   VPTANVRQGQYQWCPISDDHPDGACWNETEDANQRQRIWNVIYSMGADQNVVREWNITA
FT                   EQAGSSGK"
FT   CDS_pept        403871..404860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0305"
FT                   /product="possible 2-hydroxyacid dehydrogenase"
FT                   /note="COG family: phosphoglycerate dehydrogenase
FT                   andrelated dehydrogenases"
FT                   /note="Orthologue of BL1568"
FT                   /note="PFAM_ID: 2-Hacid_DH_C"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39086"
FT                   /db_xref="GOA:A1A053"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1A053"
FT                   /protein_id="BAF39086.1"
FT                   /translation="MDGVFETQPDRTDLPLVVMPVVIESMIGPFKQNFTMLENVARVRM
FT                   YEDFTLDEDTIVERCKDADAVMVIGFHCADAILDRLDAKCYAFGGTGVASYINLEKTKE
FT                   RGIRVCNVLHYGDHAVAEHAMALLMELTRHAGALDMQVKQGDWDGADGFELFGKKLGII
FT                   GLGGIGQTVAGIANAFGMKVSAWNSHVPAQVFENLNVTPVEDMNELISNSDVVSVHMPL
FT                   LDSTRGIITAKNLDALRPGTLFVNTARAEVIEPGALLARLQRGDIPAALDVFDHEPLAA
FT                   DDPLCKIPGIVLTPHIAWRTDGAYIGMTKQVVQSIAAFFKGEEFNVVV"
FT   CDS_pept        404920..405558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0306"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Acr"
FT                   /note="Orthologue of BL1569"
FT                   /note="PFAM_ID: UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39087"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A1A054"
FT                   /protein_id="BAF39087.1"
FT                   /translation="MQTILDSADRPAHDAFVEKKSEFIGDACHISSLDEALAFVQTIRD
FT                   QHPKARHVAYAAVCGGSDGRLAERMSDDGEPSGTAGKPILDVLRANEMTDCVVAVTRYF
FT                   GGILLGSGGLIRAYSTGASIAVKAASKAKIVPCGEYQVTLDYPQLGSFQNLLSTVEGEQ
FT                   TDAQYTDRIALTVVVPQEQANVFESRVVETFNATVVPQLVGTSNRPVKV"
FT   CDS_pept        405604..406266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0307"
FT                   /product="AbrB family trancriptional regulator fused to LRR
FT                   containing domain"
FT                   /note="Ccontains a conserved domain in cyanobacteria.
FT                   Samedomain in Pro0575_ Pro0618_ Pro01459"
FT                   /note="Orthologue of Pro0615"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39088"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A1A055"
FT                   /protein_id="BAF39088.1"
FT                   /translation="MSDENEQHENDSQADASNADETVDFEPLTATYERLRHSTDSAALS
FT                   EFARRPLPDRSDQAAFSRATALLEAVAGNAHTPVEDRVFLAETMPFPNILVKLSTDESP
FT                   EVRKAVAGNADDKNWLVGRLTKDESPEVRATALRNKRTSWKMRLEGAEDSTMDSDTLDF
FT                   LGSLGTQVEPDAPVVLATMVRRAVALNPNVSDRMLQQLAQDASSDVQKAAQRQLAEK"
FT   CDS_pept        406327..408498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ1"
FT                   /locus_tag="BAD_0308"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="Amylomaltase"
FT                   /note="COG family:4-alpha-glucanotransferase"
FT                   /note="Orthologue of BL1570"
FT                   /note="PFAM_ID: 4A_glucanotrans"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39089"
FT                   /db_xref="GOA:A1A056"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1A056"
FT                   /protein_id="BAF39089.1"
FT                   /translation="MGTMTEQTENATRLARPLIRLAKLVGVATSYVGMSHDYHEIEDDV
FT                   LVAVLKALGIDASNDEAINQSITSIKSERETRVVAPTVLHIVGKESKVEVHGGMFDVPE
FT                   ASITLENGKQFTGKISHEGGEKIAHEIDSSFFFTSYLVLPADLPEGYHTLEVTVGNEAE
FT                   TATVISAPEKIELLDDMKNGSLWGWMSQLYSIRSKGSWGVGDFEDLKTMLVEAKKKTGS
FT                   DFMLINPMHAAEPVPPLTPSPYLPISRRFINFSYIRPESMPEYLTLSHEDRAEVDALHE
FT                   QVESLNDDARLIDRDAMWRVKKHALWVIYKAGRTKARQAEFDRYLAECGDEIESYATWC
FT                   LCYDKWGAPSDDADNWVRKYNRDSEEVAQLREKFPDTLEFYRWLEWVATDQLHAAQQAA
FT                   RKAGMKIGIVADMAVGVHPAGSDVWWNPERFAKGATVGAPPDMFNQQGQDWSQPPLNPI
FT                   ALEQTGFKVYRDMVHDMFANAGAVRIDHILGLFRLWWIPEGKPATDGTYVHYDSDVMLG
FT                   ILALEASRAGGVVVGEDLGVVPAYVSKSLSEHGILGCAVEWFEQMDGVFRTPKDWRPYA
FT                   LASVNTHDMPPAAGYLEYGHVKLREQLGLLSGPVEEFQKSATAEHNAMLNMLVEEGYLD
FT                   KAALDDEAANENEIVDALYRGLKGSPCKLMAASIVDAVGEKRTQNQPGTNNEYPNWRIP
FT                   LADGEGNVVPLEKLFDEPRLQEITAIMRG"
FT   CDS_pept        408770..409219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0309"
FT                   /product="50S ribosomal protein L13"
FT                   /note="L13 is associated with the antitermination complex"
FT                   /note="Orthologue of BL1571"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39090"
FT                   /db_xref="GOA:A1A057"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A057"
FT                   /protein_id="BAF39090.1"
FT                   /translation="MKTFTPKPADLTHDWYVIDATDVVLGRLATQAATLLRGKNKPTYA
FT                   PHADSGNHVIILNADKIALTGNKLGKELYMHSGRPGGLRRDSYAQLLKTNPERIIKSAI
FT                   KGMLPKNRLAKVQLDRLHIVRGAEHPYAGMKPQVFEIAQVSQQAK"
FT   CDS_pept        409240..409731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BAD_0310"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG family: ribosomal protein S9"
FT                   /note="Orthologue of BL1572"
FT                   /note="PFAM_ID:Ribosomal_S9"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39091"
FT                   /db_xref="GOA:A1A058"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A058"
FT                   /protein_id="BAF39091.1"
FT                   /translation="MAENTNDSAVLETEEELTSYTTETNAGAGTGTSTIAPGYGTGRRK
FT                   EAVARVRLVPGTGKWTINGRTLEEYFPAKLLQREVNSPIVLLKLEGKFDAIVLVDGGGT
FT                   TGQAGAIRLGVARALNAIDRDANRAALKKAGFLTRDARVVERKKAGLHKARRAPQFSKR
FT                   "
FT   CDS_pept        complement(409824..411839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0311"
FT                   /product="probable glycogen operon protein GlgX"
FT                   /note="COG family: pullulanase and related glycosidases"
FT                   /note="Orthologue of BL1573"
FT                   /note="PFAM_ID: alpha-amylase"
FT                   /note="PFAM_ID: isoamylase_N"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39092"
FT                   /db_xref="GOA:A1A059"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1A059"
FT                   /protein_id="BAF39092.1"
FT                   /translation="MKLDPGAFAYECEIVNGKVKGSPFGPMSTIDSVGRMPVSVAIDDR
FT                   AIDKHAGEPSHPHVPWSKTVIYELHVKGFTANAPWLPKELRGTYAGLAHPATLSYLQDL
FT                   GVTSIELLPIQAKQSELFLQERGRTNYWGYSTLGYFAPESSYATKRSQEAGAAAVRQEV
FT                   INMVRALHEAGFEVIMDVVYNHTCESGPEGPTICWRGLDNLSYYRRTKDKISRLYDTTG
FT                   CGNTLDFTNTHVTTFAVDSLRYWAKRIGIDGFRFDLAATLARLDGEFTRYHPFLYALRS
FT                   DILLGNLKMIMEPWDCGPNGWRTGEFGIPFAEWNDRFRDCTRKFWLTDVDRTRSGEYGE
FT                   MTMQDMATRLCGSSDLFATDPGRGSTASVNYVACHDGFTTADLTMYKSKHNEANGENNH
FT                   DGTNDNHSINFGHEGPSSDQIIVQQRQRATMNLLGTLLLSLGTPMLLAGDEFGNSQNGN
FT                   NNAYTQDNDITWLDWDWLYSTEQTPELKQFNLTSRLITLRKSHDLYSHEDFFTRLSKIG
FT                   LLKKSDRVHWYLPNGQMPDDSDWTNPAVRSFAMQLLSPDEPSLLILINGSDEVTRFHLP
FT                   KGIEWEMVWSSSEIVGEYPGLGTSIERVSEFDAESENKPAGRLRNHLHRINMMYWQMQD
FT                   NEANLQSADDGLSEDDPTLWTLPALSISAMRQMPTA"
FT   CDS_pept        complement(411915..412271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39093"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A1A060"
FT                   /protein_id="BAF39093.1"
FT                   /translation="MKNPPLHRYATRPGLYFTDDGGADAVVRSETADQVWFCVLEPLDQ
FT                   PSAFYADAARLFNEPGLTFIDQAKKQRICTRRIPSLNLRETLFRMDGPNYGLWYVHVPQ
FT                   AWDGMQYGYRVNGP"
FT   CDS_pept        412571..413575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0313"
FT                   /product="zinc-binding dehydrogenase"
FT                   /note="Orthologue of SCO1901"
FT                   /note="Probable zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39094"
FT                   /db_xref="GOA:A1A061"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1A061"
FT                   /protein_id="BAF39094.1"
FT                   /translation="MKALVLTGVKEFEIQNMPTPQIEPNEVLINTAYAGVCGTDHDLYD
FT                   GRPGSAAAVPPIVLGHENSGIVAAVGADVTNVNPGDRVAVDPNIYCGQCEFCLTQRPEL
FT                   CDHLSAVGVTRNGGLAEQFTAPASVVYKLPDNVSLRDAAAVEPVSCAVHGLDLLELRPY
FT                   QKALVIGDGFMGQVFAQLLQAYGVHQVDLAGIFDEKLQRNKEQFGVTETYNTTREQIPE
FT                   DSYDVIIEAVGLPATQAQAVAAAKKGAQVLMFGVGPQEAHFEMNTYDIYKKQLTIQGSF
FT                   INPLTFRDAISLVSSGKMNIGGLISHELELEQVQDFLDGKITGVSKAVVKIGA"
FT   CDS_pept        413861..414349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywbC"
FT                   /locus_tag="BAD_0314"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BLi04061"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39095"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1A062"
FT                   /protein_id="BAF39095.1"
FT                   /translation="MHSRHRRIAHILITKGENQSYSSLSGGNFMAKAMSEFTTDLQHSG
FT                   MPAKDLDETIEFYTKKLGFELAGLFHNGENRCAFLRYGHLTIETWEGDPAPLTTGAINH
FT                   WAFDTPDIEAAFENAKELGLNFKDNEIQHIDSFWEHGIRYFNVYGPNGETIEFCQIVK"
FT   CDS_pept        complement(414511..415641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0315"
FT                   /product="probable repressor in the Rok (NagC/XylR) family"
FT                   /note="COG family: transcriptional regulators"
FT                   /note="Orthologue of BL1574"
FT                   /note="PFAM_ID:ROK"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39096"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1A063"
FT                   /protein_id="BAF39096.1"
FT                   /translation="MKAQSALSVKEANFKAMTTFIYTQGSATKQMFEHELGLSLPTITQ
FT                   NLRAMEADGLIVKGEMQKSTGGRKAQIYEFAAHSSVAIGVRIQTTRITAIAIDLNGKSV
FT                   ATRQRTLPYRNNDAYYQRMNDIINGFAQELAKQGSTVLGVAFCMQGIVSADGQSITFGK
FT                   IMNNTGLKLSELSHGLNYPSLMIHDSDASAMAELWFDHNLKDAVCIYLERRPGGAVIVD
FT                   GSLYQGPNQCNGSIEHMTLIPGGNTCYCGQQGCMDTYCSPETLMEDGESLPGFFSVLEQ
FT                   GEQEHRKRFSQWLDYVALAVTNIRSVLAGDVIISGEAAQYLDDDDMAGLRERVVEHTPF
FT                   GTTDFTLRKGMALDHQDIIGAALRFVEPYVRELCDM"
FT   CDS_pept        415824..417128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbtT"
FT                   /locus_tag="BAD_0316"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of SH0209"
FT                   /note="Ribitol transporter homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39097"
FT                   /db_xref="GOA:A1A064"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1A064"
FT                   /protein_id="BAF39097.1"
FT                   /translation="MTTTFYQEKRHVMKIGLPRTLLAGLVAIAVFMTGDGFELTFLSKY
FT                   IVDQGFSSSQSSLMFTMYGLVAALAGWASGVLAEMFGAKRIMLIGASAWVVLHLLFVGV
FT                   ALPSGVYPLMLGVYALRGVGYPLFIYSFVVLMAQTIDPAKLASAMGWFWAAYSFGIGVF
FT                   GAYLPSFTIPMVGEYYSLWLSLPFSIAGLLICLLMVPKSKGSGNSSMSNADKLRELSRG
FT                   VTILVHNRQIALAAVVRVICNLTLYGFPVIMPLYLATTNNGGGAWFKVSQWSQIWGFQF
FT                   VVTIFGNVFWGRMGDSHGWMRQMRWFGCWFCVIGTLGMYYIPQFFGANMVLMCADAVVL
FT                   GLGISAFVPMGAVFPALALEHKGAAISAHNFASGLATFFGPLIATVLVSTIGFGGVCWT
FT                   YAICYAIGSLVTFGIHPHQPGFDDRGHRIAAIERN"
FT   CDS_pept        417135..418241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0317"
FT                   /product="xylitol (sorbitol) dehydrogenase"
FT                   /note="Orthologue of mlr4915"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39098"
FT                   /db_xref="GOA:A1A065"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1A065"
FT                   /protein_id="BAF39098.1"
FT                   /translation="MNINCSIIIFLKKHHYPQRRIIMKAVVLEEQGVINVREVPDVPAP
FT                   GLGELKIAPHTVGVCGSDLHYYTHGRVGKYVVEQPMILGHEASGTVVEVGPGVEGFKVG
FT                   DRVAMEPGIPDMSSRASKLGMYNVDPAVRFFATPPIDGCLCETVNHPAAFTYKLPDNVS
FT                   FGEGALLEPLAVGMWSATKARIKPGDVCVVTGSGTVGMLTASCALAGGASKVLISDVSA
FT                   IKLAIAAQIPGIIPVDLTKEDLVERVREETGGWGADVAFECSGSPKSYETFWKLIAPGG
FT                   AAVIVGIPVSPVAIDITELQATEVRIENIFRYANVYQKAIDLVANGKLNLKPFITDTYA
FT                   MEDAKAAFDRMAEGRPGDIKLQITVNND"
FT   CDS_pept        418281..419252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0318"
FT                   /product="transcriptional regulator"
FT                   /note="AraC family"
FT                   /note="Identified by match to protein family HMM PF00165"
FT                   /note="Orthologue of PSPPH_4841"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39099"
FT                   /db_xref="GOA:A1A066"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1A066"
FT                   /protein_id="BAF39099.1"
FT                   /translation="MGAVVQVNDNRHGKTALAQTSFGGFVPKGGSSNDSGVLEIIVPDA
FT                   QASVRWVKHGYPSSLAKWHHHPHIEIHLIREGTGLMMAGNAVVPYEAGQVALIGSNLPH
FT                   NWVSDIAPGERLRQRDVVCHVRPETIRLLMSGFPETSGFAMVLRRAGQALVLSGESARQ
FT                   AGSILESMEEHSLACRVSDLIRVLDVFAHASADESYTVVASGYDPAVCSGAESVVNDAI
FT                   EYISSHLSGEISLDLAARQAGMSVSAFSRLFKRAAGIRFSDFVRRLRIGHACRLLTTTN
FT                   QSVASIRRACGYGNASNFNRRFFEETGETPTGWRKKYIGRTR"
FT   CDS_pept        419606..422338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0319"
FT                   /product="alcohol dehydrogenase"
FT                   /note="Acetaldehyde dehydrogenase"
FT                   /note="Orthologue of ECs1741"
FT                   /note="Similar to ADHE_ECOLI gi|1787493 (conserved in
FT                   Escherichia coli K-12)"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39100"
FT                   /db_xref="GOA:A1A067"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A1A067"
FT                   /protein_id="BAF39100.1"
FT                   /translation="MADAKKKEEPTKPTPEEKLAAAEAEVDALVKKGLKALDEFEKLDQ
FT                   KQVDHIVAKASVAALNKHLVLAKMAVEETHRGLVEDKATKNIFACEHVTNYLAGQKTVG
FT                   IIREDDVLGIDEIAEPVGVVAGVTPVTNPTSTAIFKSLIALKTRCPIIFGFHPGAQNCS
FT                   VAAAKIVRDAAIAAGAPENCIQWIEHPSIEATGALMKHDGVATILATGGPGMVKAAYSS
FT                   GKPALGVGAGNAPAYVDKNVDVVRAANDLILSKHFDYGMICATEQAIIADKDIYAPLVK
FT                   ELKRRKAYFVNADEKAKLEQYMFGCTAYSGQTPKLNSVVPGKSPQYIAKAAGFEIPEDA
FT                   TILAAECKEVGENEPLTMEKLAPVQAVLKSDNKEQAFEMCEAMLKHGAGHTAAIHTNDR
FT                   DLVREYGQRMHACRIIWNSPSSLGGVGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLI
FT                   NIKRIARRNNNMQWFKIPAKTYFEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKIID
FT                   QLRARSNRVTFRIIDYVEPEPSVETVERGAAMMREEFEPDTIIAVGGGSPMDASKIMWL
FT                   LYEHPEISFSDVREKFFDIRKRAFKIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKT
FT                   GYKYPITDYALTPSVAIVDPVLARTQPRKLASDAGFDALTHAFEAYVSVYANDFTDGMA
FT                   LHAAKLVWDNLAESVNGEPGEEKTRAQEKMHNAATMAGMAFGSAFLGMCHGMAHTIGAL
FT                   CHVAHGRTNSILLPYVIRYNGSVPEEPTSWPKYNKYIAPERYQEIAKNLGVNPGKTPEE
FT                   GVENLAKAVEDYRDNKLGMNKSFQECGVDEDYYWSIIDQIGMRAYEDQCAPANPRIPQI
FT                   EDMKDIAIAAYYGVSQAEGHKLRVQRQGEAATEEASERA"
FT   CDS_pept        422798..423106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BAD_0320"
FT                   /product="30S ribosomal protein S10"
FT                   /note="COG family: ribosomal protein S10"
FT                   /note="Orthologue of BL1577"
FT                   /note="PFAM_ID:Ribosomal_S10"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39101"
FT                   /db_xref="GOA:A1A068"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A068"
FT                   /protein_id="BAF39101.1"
FT                   /translation="MAGQKIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTE
FT                   KNVLVVIRSPHKYKDSREHFEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL"
FT   CDS_pept        423124..423765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BAD_0321"
FT                   /product="50S ribosomal protein L3"
FT                   /note="COG family: ribosomal protein L3"
FT                   /note="Orthologue of BL1578"
FT                   /note="PFAM_ID:Ribosomal_L3"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39102"
FT                   /db_xref="GOA:A1A069"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A069"
FT                   /protein_id="BAF39102.1"
FT                   /translation="MSNRTALLGKKLGMSQVWDENGFFVPVTLVDVSTNVVTAVKSEES
FT                   DGYKAVQLGYGQVDPTKVTKPLAGHFAKAGVTPRRHLAEVRTDNAEEFEPGQELTAELF
FT                   PEGTLVDVTGTTKGKGFAGTIKRWGFKSYRRTHGSHKNERRPGSVGACATPSRILKGKR
FT                   MAGRMGHVTNTALNLTIVSSDVENGVLAIKGAIPGPKGSIVLVRSAVKGA"
FT   CDS_pept        423772..424437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BAD_0322"
FT                   /product="50S ribosomal protein L4"
FT                   /note="COG family: ribosomal protein L4"
FT                   /note="Orthologue of BL1579"
FT                   /note="PFAM_ID:Ribosomal_L4"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39103"
FT                   /db_xref="GOA:A1A070"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A070"
FT                   /protein_id="BAF39103.1"
FT                   /translation="MANVTLNVTDNQGKATGTVDAPAEIFGFSAEEVQSRIPLIHQVVI
FT                   AQLAAARQGTHATKTRGMVSGGGRKPWKQKGTGRARQGSIRAPQWYHGGTVFGPQPRDY
FT                   SQRTPKKMKAAALKYVLSDRANAGHVAVVDFGVSEAPSTKAAVAALTPVTENKFTTVVL
FT                   SRENVNEWLSVRNIPTVHPIFADQLNTYDVVTAQYVVFSKEGFDAFLAAKAEPAAKEA"
FT   CDS_pept        424434..424739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BAD_0323"
FT                   /product="50S ribosomal protein L23"
FT                   /note="COG family: ribosomal protein L23"
FT                   /note="Orthologue of BL1580"
FT                   /note="PFAM_ID:Ribosomal_L23"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39104"
FT                   /db_xref="GOA:A1A071"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A1A071"
FT                   /protein_id="BAF39104.1"
FT                   /translation="MIFMVAIHKPAHDIILKPVVSEKSYALSDRGQYTFVVAPNANKVQ
FT                   IKQAIEEIFNVKVTNVNTLNRAGKRQRTRNGFGQRVNQKRAIVTVAEGQTIDIFGN"
FT   CDS_pept        424776..425606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BAD_0324"
FT                   /product="50S ribosomal protein L2"
FT                   /note="COG family: ribosomal protein L2"
FT                   /note="Orthologue of BL1581"
FT                   /note="PFAM_ID:Ribosomal_L2"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39105"
FT                   /db_xref="GOA:A1A072"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A072"
FT                   /protein_id="BAF39105.1"
FT                   /translation="MAIRVYKPTTAGRRNASVSDFSELTRSTPEKSLVRKLSKTGGRNS
FT                   YGRMTSRHRGGGHKRQYRLIDFKRWDKDGVPAKVAHIEYDPNRSARIALLHYADGEKRY
FT                   IIAPEGIKQGDVIETGAQADIKPGNNLPLRNIPTGTVVHAIELRPLGGAKIARSAGAAV
FT                   QLVAKDGAYAQLRMPSGEIRNVDARCRATVGEVGNSDHANIQLGKAGRARWMGKRPITR
FT                   GESMNPVDHPHGGRTRGGKPPVSPWGKGEVRTRRPKKASNKMIVRRRPNGKNRK"
FT   CDS_pept        425622..425900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BAD_0325"
FT                   /product="30S ribosomal protein S19"
FT                   /note="COG family: ribosomal protein S19"
FT                   /note="Orthologue of BL1582"
FT                   /note="PFAM_ID:Ribosomal_S19"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39106"
FT                   /db_xref="GOA:A1A073"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A073"
FT                   /protein_id="BAF39106.1"
FT                   /translation="MTRSIKKGPFVDAHLQKKVDEQNEKGTHNVIKTWSRRSMITPDFI
FT                   GHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTKTFKGHVKDDKKARR"
FT   CDS_pept        425917..426276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BAD_0326"
FT                   /product="50S ribosomal protein L22"
FT                   /note="COG family: ribosomal protein L22"
FT                   /note="PFAM_ID:Ribosomal_L22"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39107"
FT                   /db_xref="GOA:A1A074"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A074"
FT                   /protein_id="BAF39107.1"
FT                   /translation="MEAKAIARHVRVTPRKARRMVDLIRGKKATEAITILKFAPQDASL
FT                   PVRKVLESAIANARVKADKAGEPFRENDLVVKETYVDEGVTLKRFRARAQGRAARINKR
FT                   TSHITVVVANKEGNR"
FT   CDS_pept        426279..427082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BAD_0327"
FT                   /product="30S ribosomal protein S3"
FT                   /note="COG family: ribosomal protein S3"
FT                   /note="PFAM_ID:Ribosomal_S3"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39108"
FT                   /db_xref="GOA:A1A075"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A075"
FT                   /protein_id="BAF39108.1"
FT                   /translation="MGQKINPFGYRLGITENHRSKWFSDSNKVGERYRDFVLEDDAIRK
FT                   AMSKDLERAGVSRIVIERTRDRVRVDIHTARPGIVIGRRGAEAERVRAKLEKLTGKQVQ
FT                   LNIFEVKNAALDAQLVAQGIAEQLTNRVTFRRAMRKAQQDAMRAGAKGIRIKLSGRLGG
FT                   AEMSRSEFYREGCVPLQTLRALIDYGFFEAKTTYGRIGVKVWIYKGDMTEREFEEQQAQ
FT                   QSNNRQGRRGDRRPRRGQRNAAPQQNAAAEAPAAAEAPAATETKE"
FT   CDS_pept        427090..427509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BAD_0328"
FT                   /product="50S ribosomal protein L16"
FT                   /note="COG family: ribosomal protein L16_L10e"
FT                   /note="PFAM_ID: Ribosomal_L16"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39109"
FT                   /db_xref="GOA:A1A076"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A076"
FT                   /protein_id="BAF39109.1"
FT                   /translation="MLIPKRTKYRKQHRPVRRGMSKGGNEIAFGDFGIQALAPAYVTNR
FT                   QIEAARIAMTRYIKRGGRVWITIFPDRPLTKKPLGTRMGSGKGTPEFWIANVHPGRVMF
FT                   EIGGVSEDVAREALRRAIDKLPMKCRVIAREGGDI"
FT   CDS_pept        427509..427766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BAD_0329"
FT                   /product="50S ribosomal protein L29"
FT                   /note="COG family: ribosomal protein L29"
FT                   /note="Orthologue of BL1587"
FT                   /note="PFAM_ID: Ribosomal_L29"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39110"
FT                   /db_xref="GOA:A1A077"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A1A077"
FT                   /protein_id="BAF39110.1"
FT                   /translation="MAVGTADYTMKNLNEKTNEEIEGFLKKSKEELFNLRFQSATGQLE
FT                   NTARLKAVKHDIARMYTILRERELGISQAPEATETKAEEK"
FT   CDS_pept        427766..428026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BAD_0330"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG family: ribosomal protein S17"
FT                   /note="Orthologue of BL1589"
FT                   /note="PFAM_ID:Ribosomal_S17"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39111"
FT                   /db_xref="GOA:A1A078"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A078"
FT                   /protein_id="BAF39111.1"
FT                   /translation="MAEERNFRKVRRGYVVSDKMDKTISVELEQRSTHPLYGKVVRSTR
FT                   TVKVHDEHNEAHIGDLVSIMETRPLSKTKRWRLDSIIERAK"
FT   CDS_pept        428118..428486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BAD_0331"
FT                   /product="50S ribosomal protein L14"
FT                   /note="COG family: ribosomal protein L14"
FT                   /note="Orthologue of BL1590"
FT                   /note="PFAM_ID:Ribosomal_L14"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39112"
FT                   /db_xref="GOA:A1A079"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A079"
FT                   /protein_id="BAF39112.1"
FT                   /translation="MIQQETRLHVADNTGAKELLAIRVLGGSKRRYAGIGDVIVASVKD
FT                   AIPGGSVKKGDVVKAVVVRTVKEHRRVDGSYIKFDENAAVILGSGREPKGTRIFGPVGR
FT                   ELRDKRFMKIVSLAPEVI"
FT   CDS_pept        428488..428823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BAD_0332"
FT                   /product="50S ribosomal protein L24"
FT                   /note="COG family: ribosomal protein L24"
FT                   /note="Orthologue of BL1591"
FT                   /note="PFAM_ID:Ribosomal_L24"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39113"
FT                   /db_xref="GOA:A1A080"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A080"
FT                   /protein_id="BAF39113.1"
FT                   /translation="MAAKIKSGDLVKVIRGKDRGKEGTVKQVLKDDRLIVEGVQIVKKH
FT                   VRATQQGQQAGIVAVEAPIHRSNVMVIDPETKQPTRVRIVEKEEARDGKVKTVRVRVAK
FT                   KSGKELA"
FT   CDS_pept        428820..429392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BAD_0333"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Mediates the attachment of the 5S RNA into thelarge
FT                   ribosomal subunit_ where it forms part of thecentral
FT                   protuberance"
FT                   /note="Orthologue of BL1592"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39114"
FT                   /db_xref="GOA:A1A081"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A081"
FT                   /protein_id="BAF39114.1"
FT                   /translation="MTDTTVEAPATPRLKQKYNEQIVPELEKEFHYSNPMQVARVQKVV
FT                   VSMGVGAAARDSKLIEGAVKDLTLITGQKPKITKAKKSVAQFHLREGQAIGAYVTLRGE
FT                   RMWEFLDRLLTMALPRIRDFRGINGDQFDGQGNYNFGLTEQSMFHEIDPDSIDHQRGMD
FT                   ITVVTSTKDDKEARVLLKHLGFPFKEN"
FT   CDS_pept        429394..429579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BAD_0334"
FT                   /product="30S ribosomal protein S14-1"
FT                   /note="Orthologue of BL1593"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39115"
FT                   /db_xref="GOA:A1A082"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A082"
FT                   /protein_id="BAF39115.1"
FT                   /translation="MAKTALKNKAAAKPKFKVRAYTRCQVCGRPHSVYRKFGLCRICLR
FT                   EKAHRGELPGVTKSSW"
FT   CDS_pept        429664..430062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BAD_0335"
FT                   /product="30S ribosomal protein S8"
FT                   /note="Binds directly to 16S rRNA central domain where
FT                   ithelps coordinate assembly of the platform of the
FT                   30Ssubunit"
FT                   /note="Orthologue of BL1594"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39116"
FT                   /db_xref="GOA:A1A083"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A083"
FT                   /protein_id="BAF39116.1"
FT                   /translation="MTMTDPIADMLTRLRNASAAKHETVDMPYSKFKANIAEILKREGY
FT                   IKDFTAKEAKVGQTLEVTLKYGPNGERSIQGIKRISKPGLRRYAKSDALPMPLGGLGIA
FT                   IISTSSGLLTQKECLDRGIGGEIVAFVW"
FT   CDS_pept        430080..430619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BAD_0336"
FT                   /product="50S ribosomal protein L6"
FT                   /note="COG family: ribosomal protein L6"
FT                   /note="Orthologue of BL1595"
FT                   /note="PFAM_ID:Ribosomal_L6"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39117"
FT                   /db_xref="GOA:A1A084"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A084"
FT                   /protein_id="BAF39117.1"
FT                   /translation="MASHIGKLPVTIPAGVEVKIDGQSFTAKGAKGTDSYEIPEGITAV
FT                   VEGNEVVLTPADDLRPTRAKHGLARSIVAGMVKGVHEGYAKTLEIVGTGYRAQMKGKGI
FT                   EFSLGYSHTITVEPPAGIEFELPNPNQVIVKGIDKQAVGQCAANIRKLRAPEPYKGKGI
FT                   KYADEHILRKAGKAGK"
FT   CDS_pept        430619..430990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BAD_0337"
FT                   /product="50S ribosomal protein L18"
FT                   /note="COG family: ribosomal protein L18"
FT                   /note="Orthologue of BL1596"
FT                   /note="PFAM_ID:Ribosomal_L18p"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39118"
FT                   /db_xref="GOA:A1A085"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A085"
FT                   /protein_id="BAF39118.1"
FT                   /translation="MSVQILGKGKKVALKRRHARLRKHISGTPELPRLVVTRSNRHMVA
FT                   QIIDDTKGVTLVSESTLTSDFAGFEGTKTEAAKKVGELIAKKAQDAGITAVVFDRGGNK
FT                   YHGRVAAVAEGAREGGLAL"
FT   CDS_pept        430987..431712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BAD_0338"
FT                   /product="30S ribosomal protein S5"
FT                   /note="Orthologue of BL1597"
FT                   /note="located at the back of the 30S subunit body whereit
FT                   stabilizes the conformation of the head with respect tothe
FT                   body contacts S4 and S8 with S4 and S12 plays a rolein
FT                   translational accuracy"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39119"
FT                   /db_xref="GOA:A1A086"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A086"
FT                   /protein_id="BAF39119.1"
FT                   /translation="MSDNEKETQVAEETQNTQAAAESNNEDRKSRRGQRGEGRRGERRN
FT                   RREESHENEMLDRVVTINRVSKTHKGGRTFSFAALVVVGDGKGTVGVGYGKSREVPAAI
FT                   AKGQLDAKKHMFTVPRIKGTVTHPVIGHDAAGTVLLRPAAPGTGVIAGGAVRAVMECAG
FT                   ITDVLTKSMGSATAVNVVRATVDALKKLEEPEEIAARRGMSLEEVAPDALLRARAEGIA
FT                   EARKAREEAQAKAAQKDGE"
FT   CDS_pept        431709..431894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BAD_0339"
FT                   /product="50S ribosomal protein L30"
FT                   /note="COG family: ribosomal protein L30_L7e"
FT                   /note="Orthologue of BL1598"
FT                   /note="PFAM_ID: Ribosomal_L30"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39120"
FT                   /db_xref="GOA:A1A087"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A087"
FT                   /protein_id="BAF39120.1"
FT                   /translation="MMTNLNIKLHHGLVNSTPKQRAAAQTLGLNKIGKTVTREDTPALR
FT                   GQLQVLRHLITVEEAD"
FT   CDS_pept        431897..432343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BAD_0340"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Associates with 23S ribosomal RNA and is involvedin
FT                   50S ribosome assembly"
FT                   /note="Orthologue of BL1599"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39121"
FT                   /db_xref="GOA:A1A088"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A088"
FT                   /protein_id="BAF39121.1"
FT                   /translation="MADILQMHDLKPAPGANKDRIRVGRGEGSKGKTSGRGDKGTKKRY
FT                   QVRPGFEGGQLPLYMRLPKLRGFKNPFKKEYQVVNVAVLAELFPQGGEITVADLVAKGA
FT                   VRNGFPVKVLGDGEVSAAYTLKGVKASASAKSKIEAAGGSISED"
FT   CDS_pept        432536..433909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BAD_0341"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="Orthologue of BL1600"
FT                   /note="With SecE and SecG forms a protein-conductionchannel
FT                   in the inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39122"
FT                   /db_xref="GOA:A1A089"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A1A089"
FT                   /protein_id="BAF39122.1"
FT                   /translation="MRRCARRWKEPQVRTLIQALKTKELRNKILFTLGIIIIYRIGSFI
FT                   PTPGVDYTVVQQCVGKMNNASENFIGLVNLFSGGAMLQLSIFALGVMPYITASIVIQLL
FT                   RVVIPRFEALHKEGQSGEAKLTQYTRYLTIGLAVLQSTTILVTARSGALFNYQCSQVVP
FT                   DGSVWNLVVMVLIMTGGTGLIMWMAELVTDKGLGQGMSILIFMSICSGFLPQLWEIGWG
FT                   TNGTDGNWGKFAAVVGTLLVIMILVIYVELAQRRIPVQYTRRMIGRKMYGGSSTYLPLK
FT                   INMSGVIPPIFASSILAVPTLIAQFGNSDQSWVKWINSNLANTTSVWYIALYALMIVFF
FT                   CFFYTEITFNPDETADNMKQYGGFIPGIRAGSATSNYLSYVMNRLNTVGAVYLLFVALI
FT                   PTVLIMALNLNTKLPFGGTTILIIAGVGLDTLRQAKAQTEQFQYAGFLFEDTDHKEGK"
FT   CDS_pept        434027..434587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BAD_0342"
FT                   /product="adenylate kinase"
FT                   /note="Essential enzyme that recycles AMP in active
FT                   cells;converts ATP and AMP to two molecules of ADP"
FT                   /note="Orthologue of BL1601"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39123"
FT                   /db_xref="GOA:A1A090"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A1A090"
FT                   /protein_id="BAF39123.1"
FT                   /translation="MRLLIMGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNIKNKTEL
FT                   GVEALKYIDKGELVPDELTNKIVKDRLAMDDAKNGWILDGYPRNASQVEALDAILGELD
FT                   TPLDAVVALDADHDVLMERMKKRAEIEGRSDDTPEAIAKRLDVYAKETAPLLDIYQKRG
FT                   LLKTFNGVGAVDEIQATIVAELG"
FT   CDS_pept        434735..434953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BAD_0343"
FT                   /product="translation initiation factor IF-1"
FT                   /note="COG family: translation initiation factorIf-1"
FT                   /note="Orthologue of BL1602"
FT                   /note="PFAM_ID: S1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39124"
FT                   /db_xref="GOA:A1A091"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A091"
FT                   /protein_id="BAF39124.1"
FT                   /translation="MAKDGVIEVEGQVVEALPNAMFRVELENKHIVLATISGKMRKNYI
FT                   RILPQDRVVLEMSPYDLNRGRITYRYK"
FT   CDS_pept        434977..435090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BAD_0344"
FT                   /product="50S ribosomal protein L36"
FT                   /note="COG family: ribosomal protein L36"
FT                   /note="Orthologue of BL1603"
FT                   /note="PFAM_ID:Ribosomal_L36"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39125"
FT                   /db_xref="GOA:A1A092"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A092"
FT                   /protein_id="BAF39125.1"
FT                   /translation="MKVSPSVKRICENCRVIRRHGRVMVICVNPRHKQRQG"
FT   CDS_pept        435194..435604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BAD_0345"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Located at the top of the head of the 30S subunit_it
FT                   contacts several helices of the 16S rRNA"
FT                   /note="Orthologue of BL1604"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39126"
FT                   /db_xref="GOA:A1A093"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A093"
FT                   /protein_id="BAF39126.1"
FT                   /translation="MQDLRKTEGIAMARLAGVDIPNEKRIEIALTYIFGVGRTRAKETL
FT                   AATGINPDIRVKDLTDEQLITLRDYLEGNYKIEGDLRREIDADIRRKIQINCYQGQRHR
FT                   KGLPVRGQRTKTNARTRKGPKRTVAGKKKATK"
FT   CDS_pept        435689..436087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BAD_0346"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Orthologue of BL1604.1"
FT                   /note="located on the platform of the 30S subunit_
FT                   itbridges several disparate RNA helices of the 16S
FT                   rRNA;forms part of the Shine-Dalgarno cleft in the 70S
FT                   ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39127"
FT                   /db_xref="GOA:A1A094"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A094"
FT                   /protein_id="BAF39127.1"
FT                   /translation="MAAQKQAARKPRRRDRKSVPVGQAHIKSTFNNTIISITDPSGAVV
FT                   SWASGGDVGFKGSRKSTPYAAGMAAESAARKAMEHGLKKVDVFVKGPGSGRETAIRSLQ
FT                   SAGLEVGSITDVTPQAHNGVRPPKRRRV"
FT   CDS_pept        436132..437166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BAD_0347"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /note="Catalyzes the transcription of DNA into RNA usingthe
FT                   four ribonucleoside triphosphates as substrates"
FT                   /note="Orthologue of BL1606"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39128"
FT                   /db_xref="GOA:A1A095"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A095"
FT                   /protein_id="BAF39128.1"
FT                   /translation="MHHRPEAERITTVLIAQRPTLTEESLNPQRSRFTIEPLEPGFGYT
FT                   LGNSLRRTLLSSIPGAAVTSVRISGVPHEFTTLPGVEEDVTEILLNIKGIVLTSEYDEP
FT                   VVMYLRKSGKGEATAGDITPPAGVTIANPDMHIATLAEDGELEIEFTVERGRGYVPAQM
FT                   NKQDNAEIGRIPVDSIYSPVLKVSYRVEATRVEQRTDFDKLILDVETKPAISPRDAVAS
FT                   AGSTLVELFGLCRELNTQAEGVEVGPAPVAEETNPEMNIPIEDLNLTQRSYNCLKREGI
FT                   HTIGELVAHTEQDLLDIRNFGMKSIDEVKEKLQSLGLALKASPLGNFDANNLEGGTFFS
FT                   PEDE"
FT   CDS_pept        437255..437722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BAD_0348"
FT                   /product="50S ribosomal protein L17"
FT                   /note="COG family: ribosomal protein L17"
FT                   /note="Orthologue of BL1607"
FT                   /note="PFAM_ID:Ribosomal_L17"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39129"
FT                   /db_xref="GOA:A1A096"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A096"
FT                   /protein_id="BAF39129.1"
FT                   /translation="MPTPKKGPRLASSPAHERLMLANMATSLFQNGRITTTLPKAKRLR
FT                   PLAERLITLAKRGDLHNRRRVMRVIRNKSVVHKLFTEIAEQMEQREGGYTRIVKIAPRR
FT                   GDAAPAAIIELVTEPVSPKQAVVKEAEAATKVAAAEAPEAAAEEATAENAE"
FT   CDS_pept        437829..438749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BAD_0349"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="COG family: pseudouridylatesynthase (tRNA psi55)"
FT                   /note="Orthologue of BL1608"
FT                   /note="PFAM_ID: PseudoU_synth_1"
FT                   /note="Pseudouridylate synthase I"
FT                   /note="Uuracil hydrolyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39130"
FT                   /db_xref="GOA:A1A097"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A1A097"
FT                   /protein_id="BAF39130.1"
FT                   /translation="MLNAVRLRIDLAYDGTGFYGWAKQPEIRTVQGEIERVLHTILRVP
FT                   EGDPTEPLRLTVAGRTDTGVHASHQVCHLDVNEDVLKRCVGHMDVPPVIALTRRLQRML
FT                   PADIAIRGIAPAPDGFDARFSALERTYVYRIADRSSEVDPRTRNFVLHIDDELDLKSMN
FT                   EAAAMTIGLHDFGSFATPNPGGTTIREVKTAYWRRVPQRTLIDDGMTMGERYRTPTVES
FT                   GLVCFVIVADAFARNMVRSLVNGCVQVGIGKRSLDWFAGKMAAPLREGSTGPIAPQGLT
FT                   LEHIEYPADDQLAVRAEAIRAKRTL"
FT   CDS_pept        438926..441106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0350"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Bcr"
FT                   /note="Orthologue of BL1609"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39131"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR007302"
FT                   /db_xref="UniProtKB/TrEMBL:A1A098"
FT                   /protein_id="BAF39131.1"
FT                   /translation="MIESAARRLASELVDRRESINRELSRNGVRFGIYKNGEYHDRLFP
FT                   YDPIPRIIESDEFDRMEAGLKQRVNALNAYLRDIYSDKQAIKDGIVPEEYVYTSAGYFP
FT                   QVNGVTPPGGVFAHIAGEDLVQGQDGQWWVLEDNLRIPSGASYLLFARDIERRITPSLF
FT                   RNVRVRDNRDYPRLLRQSMDFVSTDGIAVVLTPGRYNSAFFEHAYLAEKTGAALAFPED
FT                   LEVVDNKVYFLDYAGRKHRVGVVYRRLSDEYLDPFAFNPDSVIGVPGILSAYRSGNVAI
FT                   VNAPGNGAADDKAIYYFVPNMIRYYLGEEPILHNAPTYMPMFDKDRKEVLDRLGELVIK
FT                   DVAEAGGYGVVFGSSLDRSQREELAERIKAEPRRFIAQEVIQFKDIDVVDPETGQMSSR
FT                   KCDLRAFVVTGKNTHAWYSGLTRYSSIPGQMIVNSSQGGGFKDTWVLAKETGVEHDYAP
FT                   GSEVVRVLEQSRKHSLALVTASKADNLFWLGRYTERVFTTLSQFFPFYDRVMDTDVDAF
FT                   RPFARALDLPEDFEDFDAFIHSFLYDEKNPDSVRSAIVYAFNNAVILRPELGSRSLQQV
FT                   ELAMSSIVEASEYGGTDADIFKHRDIADNMLAFWGGVENSPVEPTLKSFIFVGKYLERL
FT                   DLYTRFGYSVEELKAPLAKLGSYILPLNGLPVPQCFAEGLRWLVGQLPQRGYAELAEKL
FT                   GMLLKDFDGRISTKDLKDLGMLNTMDMDAARL"
FT   CDS_pept        441211..442011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0351"
FT                   /product="hypothetical protein"
FT                   /note="COG family: transglutaminase-like enzymes_
FT                   putativecysteine proteases"
FT                   /note="Orthologue of BL1610"
FT                   /note="PFAM_ID: Transglut_core"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39132"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1A099"
FT                   /protein_id="BAF39132.1"
FT                   /translation="MKKLVFDYEMKLSFSSPVTDHRFQLRCIPATGPRQQVIDVAVKIE
FT                   PDVELETTIDSFDSVVMTGFIPEPHTMFNYSVTGIAFVDNAHIKSEIYKPLYRFNSALT
FT                   VPGPAIEALIGICHERIVSLPADCTPIDQAREVMDEVFKTFVYTPASTTIRTTAEEAFA
FT                   QRKGVCQDYAHVMLSVCRHVGLTARYIAGLLGGEGATHAWVEIYHDGRWVGLDPTHNRM
FT                   VDDNYITIAHGRDYRDCMLDIGIFSGCDVKQDQWVNASVHEQGY"
FT   tRNA            complement(442111..442196)
FT                   /gene="serU"
FT                   /locus_tag="BAD_t0017"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:442160..442162,aa:Ser,seq:cga)"
FT                   /note="codon recognized:CGA"
FT   CDS_pept        complement(442317..443201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0352"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1614"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39133"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0A0"
FT                   /protein_id="BAF39133.1"
FT                   /translation="MQTRTPSFRSVSFIAKRVCALLCTAILMPALTACSMPRIAGRAEA
FT                   EQRQSPCEKAYFDATADNKIAHDQHQHIIRRYFSAQQAVSAWTNTAAQCPARFAEGTLR
FT                   SAQARHMARALGDQLSVAVAPITLSRFDDVESLDVDSKSLATAAQDEDRAGFAMEVLAA
FT                   RNSGHATLDISDRHKTTSQRFASFSGAIDDRRKTYEATALLAHPDTMLDSATGLTAPTD
FT                   ATIEMNCARSEITAIAGSSNAANDHSQSRVTNAKQSTDSRAQSLGVLAGLIADRVELAL
FT                   DWGYPSFDEALFA"
FT   CDS_pept        443279..444331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="BAD_0353"
FT                   /product="N utilization substance homolog"
FT                   /note="Binds to RNA polymerase and RNA; stimulates
FT                   rhoindependent termination by promoting hairpin
FT                   formation;also interacts with N protein and prevents
FT                   hairpinformation_ thereby preventing termination"
FT                   /note="Orthologue of BL1615"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39134"
FT                   /db_xref="GOA:A1A0A1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0A1"
FT                   /protein_id="BAF39134.1"
FT                   /translation="MELDLAGMHQLAAGQGIDPETLDAALSEALRLAYLKTPHAAKHAR
FT                   VELDPRAGSFTVWAQDEIPGEPTEDDPHPAPTLGEEYDDTPHDFGRLAAATARQVISQL
FT                   FRKAEDDKVFGAFSGQKGKLITGIVQQDVKDTSNVHVAVGDVEALLPRREQVPGERYRH
FT                   GERIRVYVVNVARGLKGPEIVVSRSHPELVRRLFEREVPELVSGAVSIMAIAREAGART
FT                   KIAVRANTEGVNPKGALIGPGGARVRAVMENLGPEKIDIVDWSADPAKFVAAALSPAVA
FT                   TGVQVISEKNKTAIAFIHDDQLSLAIGKEGQNARLAAKLTGWKIGIESAEAHAKKMAES
FT                   ADHSDGETEE"
FT   CDS_pept        444544..447339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="BAD_0354"
FT                   /product="translation initiation factor IF-2"
FT                   /note="Orthologue of Rv2839c_BL1616"
FT                   /note="Protects formylmethionyl-tRNA from
FT                   spontaneoushydrolysis and promotes its binding to the 30S
FT                   ribosomalsubunits during initiation of protein synthesis.
FT                   Alsoinvolved in the hydrolysis of GTP during the formation
FT                   ofthe 70S ribosomal complex"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39135"
FT                   /db_xref="GOA:A1A0A2"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0A2"
FT                   /protein_id="BAF39135.1"
FT                   /translation="MPKARVYELAKELGVDSKTVLSKLEAMGEFVKSASSTVEPPVARK
FT                   LRNAFASSGQGNASDSKKPGHTAKKPAEPASHSMPKPAAPSAPKPAAPAAPKPRHAASK
FT                   SDAPKPGHRAPRPGESRQHGNRPNGNAPRPQGGDRRQSGRPTAVPGARPQHGNAPQGGN
FT                   NANGAKPHTPGPRPGNNPFSRKQGMHTPTPGDIPRPHPMNRPSVNNGEGRRGGRPGQGG
FT                   GQRGGFRGRPGQGGAKPGQWGQHRPGQGGGQRPAGGGNRFGGNGGGFQGGNSAPSNGPA
FT                   RGGRGRGGAAGAFGRQGGKSSKARKNRLAKRQEFQEMKAPVIGGVRIPTGNGQEVRLRQ
FT                   GASLADLAEKINVNPAALVTVLFHLGEMATATQSLDEATFQILGEEIGWNIKIVSAEEE
FT                   DKELLQQFDINLDEEELQEDGDLKPRPPVVTVMGHVDHGKTRLLDTIRRTNVIEGEAGG
FT                   ITQRIGAYQVTVNLEGEPRKITFLDTPGHEAFTAMRARGAELTDVAILVVAADDGVMPQ
FT                   TVEAINHAQAAHVPIVVAVNKIDKPGANPDKVRGQLTEYGLVPEEYGGNTMFVDISAKQ
FT                   GTNVDKLLEAVLLTADAELDLRANPDMDARGATVEARLDKGRGAVATVLVQSGTLHIGD
FT                   AIVAGTSYGRVRAMLDENGNHMQEAGPSTPVQVLGLTSVPTAGDLFLVASDDRTARQIA
FT                   EKRQATERAAQLAKRRKVVSLESLKEQFAKSEVDMLNIVIKGDSSGSVEALEDSLMKIE
FT                   VSDEVGIQVIHRGVGAITQNDVNLATVDKAVIIGFNVRPNRQVADLAEREGVEIKYYSI
FT                   IYKAIEDIEASLKGMLKPEYEEVVTSHSEIREIFRSSKFGNIAGVMVQDGEVKRGTKCR
FT                   ILRNGIATVNDLEISSLRRFKDDVTSVKEGYEAGINLGTFNDIEIGDIIETFEMQEIER
FT                   K"
FT   CDS_pept        447449..447952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="BAD_0355"
FT                   /product="ribosome-binding factor A"
FT                   /note="Associates with free 30S ribosomal
FT                   subunits;essential for efficient processing of 16S rRNA"
FT                   /note="Orthologue of BL1617"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39136"
FT                   /db_xref="GOA:A1A0A3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0A3"
FT                   /protein_id="BAF39136.1"
FT                   /translation="MAGTNPRAARIAALIQRVIASSMEAQLHDKRLANVTITEVRVTND
FT                   LQIAKVYWTQLGHEGHEQGERRRAQQALNQAKGRLRSLVGTKAGLRLTPQLEFIFDEVP
FT                   GEAHEIEDILALAHKRDEELAKSRANAQYAGDADPYKHDEPDDDDFDDDDDVEVEDWDD
FT                   DDEA"
FT   CDS_pept        447936..449006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="BAD_0356"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COGfamily: pseudouridine synthase"
FT                   /note="Orthologue of BL1618"
FT                   /note="PFAM_ID: TruB_N"
FT                   /note="Uracil hydrolyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39137"
FT                   /db_xref="GOA:A1A0A4"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0A4"
FT                   /protein_id="BAF39137.1"
FT                   /translation="MTTKPDNSGLLVIDKPQGVTSHDVVAAVRGALHMKRVGHAGTLDP
FT                   MATGVLVVGFGNATRLLNYIVDHDKTYLATIRLGQRTTTDDADGELLPGEGTIAEFPSR
FT                   QTVEDVIAHHFTGRIEQVPNSYSAIKINGQRAYDLAREGKDVDLKARPVTISEFSVSAV
FT                   RYGYASTTCAGSPLADAIEIAPEESWHAETDGQNEPNMQPVMELDVTVTCSAGTYIRAL
FT                   GRDLGAELGLGGHLTMLRRIRVGRFSVNMPNVMTAHTEAKTFTNREGIEVTRNRAVLDD
FT                   AEHAVDHALDLVASAAASMDMLPVTEQEATDLRFGRRIAHDIHTTMAAYVPETNDLVAI
FT                   VERAKRGETKPVAVFN"
FT   CDS_pept        449076..450305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="BAD_0357"
FT                   /product="riboflavin kinase"
FT                   /note="COGfamily: FAD synthase"
FT                   /note="Fad pyrophosphorylase"
FT                   /note="Fad synthetase"
FT                   /note="Orthologue of BL1619"
FT                   /note="PFAM_ID: FAD_Synth"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39138"
FT                   /db_xref="GOA:A1A0A5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0A5"
FT                   /protein_id="BAF39138.1"
FT                   /translation="MKTITLTPDASGMVDWPTLSNDKKSVVTIGSFDGMHQGHQAVVRR
FT                   VAELAEQEQAFSVVVLFDPRPALVHAYAAKHDGQEPPAGTPDTQALTSVNERLRAIDAI
FT                   GVDYTLIVRYTMAFAAKSYRFFLGQMVGKLGMRTLVLGSDAAMGANRAGNVKAIENLAL
FT                   ATGVFQLEVVDDFGPGLTRVPVNAKPVMPSEPGEPSDPLEGASKAERRAWSKKHQAKEV
FT                   RTWSSTNVRYLLSQGRIKDADAILGHAHAVEGTVVHGEERGRTIGFPTANLSENVAGYL
FT                   PVDGVYAGWLVDLGEKSADGGEEAGEKPADGVSQQYDASSVNARVDMQSPHRWPAAISI
FT                   GTKPTFNEDGDAERVVEAYAITDDWLDLYGHQARVEFAGFLRPQIKFDSADDLVVELKR
FT                   NVEETKRLTA"
FT   CDS_pept        complement(450436..451854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BAD_0358"
FT                   /product="alkylation damage repair protein"
FT                   /note="COG family: predicted ATP-dependentserine protease"
FT                   /note="Orthologue of BL1620"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39139"
FT                   /db_xref="GOA:A1A0A6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0A6"
FT                   /protein_id="BAF39139.1"
FT                   /translation="MAKTSSQFLCSECGWSGPKWLGRCPECGQWGTIEEFHEARPAAGS
FT                   RTAAPGRTSRTQSHPVASSAARPITDIGTENISRIATGFSEFDRVLGGGIVPGSVTLIA
FT                   GEPGIGKSTLLLETAGNVARLTAFATERNTVLYISGEESQAQVRMRASRIGAMEPNLLL
FT                   ASTTDLSTVLGLIEQFKPALAIVDSAQTIVSQDVDGISGGSTQVREVASALIDTAKTLD
FT                   IPVLLVGHVTKDGSIAGPRTLEHLVDVVCQFEGDAETALRMLRAVKNRFGPTDEVGCFD
FT                   MSGEGIEEVTDPSGLFLSTGNGSAATQVDGTCVTFTLDGHRSLPIEVQALVTKSVLPTP
FT                   RRAANGVDSNRIAMLVAVLYRHGGINLLANDLYISTIAGGQAREPGCDLAIVAALASAA
FT                   KSKPIPRTTCAIGEISLTGQVRPVPRLEYRLREAARLGFTTAVVPTLRKNVAVPGMGVV
FT                   QADTLQDALAAILR"
FT   CDS_pept        451995..452648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0359"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1621"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39140"
FT                   /db_xref="GOA:A1A0A7"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0A7"
FT                   /protein_id="BAF39140.1"
FT                   /translation="MTSMSDTQNSSSHGKLIAAVVAAALVVVLALISAFVWPGWALNKN
FT                   GQAGQAGQTSQQASTSNGTDGDKTEPAKPSIDAVALPDGASELLKAMPDSVLNYARTKA
FT                   DASTTWSSTSPVEEYALTYSTGKKGQDVTLEVGQWNDGDKAKSQYDTLAEAMTGKELGS
FT                   GNVKVSGKTTGAYSAKADPDDDTKAVAVWRNDTVVFYATGAKNDIQRFYQQFPL"
FT   CDS_pept        complement(452697..452873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0360"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1622"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39141"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0A8"
FT                   /protein_id="BAF39141.1"
FT                   /translation="MLLLAHALAALLDDRAHLSLRSLNSKGKSLQLAQYYTASGTNTRA
FT                   DIHMVENHVSFSA"
FT   CDS_pept        complement(453047..453745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0361"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /note="Catalyzes D-ribose 5-phosphate -->
FT                   D-ribulose5-phosphate in the nonoxidative branch of the
FT                   pentosephosphate pathway"
FT                   /note="Orthologue of BL1623"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39142"
FT                   /db_xref="GOA:A1A0A9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0A9"
FT                   /protein_id="BAF39142.1"
FT                   /translation="MDKAQQDALKKAAGIEAAKLIQNGMIAGLGTGSTVRFLVDELGRR
FT                   VKEEGLEFTGVTTSRRTQEQAEGYGIKIVNIDDVDHIDVTIDGADEVDKNFNGIKGGGA
FT                   ALLWEKIVATNSNKIVWIVDESKVVDTIGKFPLPVEVIPFGAGQVVKKFEAKGYKPVLR
FT                   LDANGEPVRTDENNYVVDLHLERIDHPQELAQDLITTVGVVEHGLFLNMVDQVIVGDPN
FT                   GPRVMDNPNK"
FT   CDS_pept        complement(453967..455304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnh"
FT                   /locus_tag="BAD_0362"
FT                   /product="ribonuclease H"
FT                   /note="COG family: ribonuclease HI"
FT                   /note="Orthologue of BL1624"
FT                   /note="PFAM_ID:RNaseH"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39143"
FT                   /db_xref="GOA:A1A0B0"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B0"
FT                   /protein_id="BAF39143.1"
FT                   /translation="MTITVSTDGSALGNPNGPMGWAWADHEPAAGGKPGHEHAGDCDAG
FT                   GATNGTNQIGELCAVLEALRAHPGSEDLVIETDSQYAINCSTKWVQGWKRNGWKNSQKK
FT                   PVKNADLIRAIDNEIAHRAGSVRFVWVKGHAGNAGNEKVDELARTYAGDCRSHVREGYL
FT                   PLEGWQSLLASEYSRGTDVPEDARMLMDGAISAAEYHMGRGQGDSATTGTGDSGADTAN
FT                   SSNSTKPRSIASMLAEPEGVSHDLADFGQTTDDDADDAVETTVLETEPAETTTMLETEA
FT                   TKVIPESSFPDAGGPAEPDESGKTDESGEPHQSYAQMLVKPDYFPREGDENDKPVTGNA
FT                   DGTDTDSTAVPQNANESRSESQDDEESAPEQAASSQSQDLPKLPHRPSPSGLSVSGTVR
FT                   FTPPPESSPTFDGNPRLIRGYIAVEGYVMGDGTLVLDEAPFAVKHS"
FT   CDS_pept        complement(455409..456797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0363"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of lin0802"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39144"
FT                   /db_xref="GOA:A1A0B1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B1"
FT                   /protein_id="BAF39144.1"
FT                   /translation="MFAPLGEIIRNGIAQTTPSGLFFAIGEQLNALSGLALCLIMAWSH
FT                   MDNPRRNGTLFMSIGLVWFLLCGVLCGTLGIPSLWTVIPTAPLVLLVLRWLTELPWRQL
FT                   LLIVATASYMVAIVYYLSLVIDVAVLGADSTNLRVGWPGLVNLLLLDVIALVSLWHPLH
FT                   DSIPATFDSPSISKGFWQLIWLFPFVSSAIVVWCMPADNSTLLDSHMLEIAFTVAVVYS
FT                   CFMVLAYFLIWYMIQQSDRLLAARRRQHYEALQTLQLQHMNERIREARQIKHNVRHHIH
FT                   SLQALAAAEDMDGIRSYLDEMSKHRLLQPAPMQYCEHASLNAVLVYYCDWVRHLGADVD
FT                   VKAAVPQYININNAELCSMVGNLLENATEAITQQTQGERRLKVRIRYRSGPPAALFITV
FT                   DNTYGEADTSIEQIDGDLVSTKHGGTGLGTATVRETAERHHGTASFEHSDGMFRASVML
FT                   CLGD"
FT   CDS_pept        complement(456799..457560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0364"
FT                   /product="two-component response regulator"
FT                   /note="Orthologue of OB1641"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39145"
FT                   /db_xref="GOA:A1A0B2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B2"
FT                   /protein_id="BAF39145.1"
FT                   /translation="MCAEYFNGRNVGATAGRNAMQTVCDVFPDAKSFIESWKNSRYDLL
FT                   LLDCYLSDENLPHATTGLDIARLLRNQNDDCAIVFITSSTDFAVLGYEVQASGYLLKPV
FT                   NRKTFEATMERVEEQLKAKPPVTHLAKAQSPGTVDSSWHVAFGNPAVTMDRRLIAYALS
FT                   NAHYVEFTFADGTQTKIRTNFSDVDRRLTVFDNFYRTARGVLVNFDYVSGITNAQFVMK
FT                   GGKRIPITKTAVTTTCRAYAEYTFTRMRTED"
FT   CDS_pept        complement(457830..459602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="BAD_0365"
FT                   /product="phosphoglucomutase"
FT                   /note="Catalyzes the interconversion of
FT                   alpha-D-glucose1-phosphate to alpha-D-glucose 6-phosphate"
FT                   /note="Orthologue of BL1630"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39146"
FT                   /db_xref="GOA:A1A0B3"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B3"
FT                   /protein_id="BAF39146.1"
FT                   /translation="METRRDVKKKTYSSHIVGWLSAFRANSWHNEGMVAKNAGMPATPA
FT                   DLINVDEVIGKYYDVVPDPNVPEQRVSFGTSGHRGSSLKTSFNEAHIVAITQAIAEYRK
FT                   KAGVTGPLYIGRDTHALSEPAWKTAIEVLVANGVTVRIDSRDDFTPTPVVSQAILTHNR
FT                   AADGTQRFTGEGLADGIVVTPSHNPPTDGGFKYDPVTGGPAPADVTNAIADRANELLGD
FT                   FRNVKRVPFEQAVKSDLVERFDFREHYVADLENVIDFDVIRSSGVRLGIDPLGGASVNY
FT                   WPLMNEKFNLTIDVVRPQVDPTWSFMTIDHDGKIRMDPSSPYAMKGLVDSLNNGAWDKY
FT                   DLVGGTDPDADRHGIVCPNWGVMNPNHYIAVCVEYLFGGNRPGWPEGAGIGKTLVSSSL
FT                   IDRVAASIDAKLVEVPVGFKWFVDPLFKGEVAFGGEESSGMSFLRKDGRVWTTDKDGLI
FT                   PDLLAAEITAKTGKNPAQLHQEQVERFGESWYKRVDTPTTLEQKQKFAKLTGDDVEATQ
FT                   LAGEDITAKLTEAPGNHAKIGGLKVTTKDNWFAARPSGTENIYKVYAESFESPEALDKV
FT                   LAEATEVVDKALAE"
FT   CDS_pept        459828..461921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsG"
FT                   /locus_tag="BAD_0366"
FT                   /product="glucose-specific II BC component"
FT                   /note="COG family:phosphotransferase system IIb components"
FT                   /note="Glucose-permease IIABC"
FT                   /note="Orthologue of BL1632"
FT                   /note="PFAM_ID: PTS_EIIA_1"
FT                   /note="PFAM_ID: PTS_EIIC"
FT                   /note="PFAM_ID:PTS_EIIB"
FT                   /note="Phosphotransferase enzymeII_ ABC component"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39147"
FT                   /db_xref="GOA:A1A0B4"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B4"
FT                   /protein_id="BAF39147.1"
FT                   /translation="MADSLASQIITAIGGPENVRSLTHCATRLRFELADASKVDQNALE
FT                   HMKGVLGAVPQSGDRFQVVIGGGVATVYENIMHLPEMANAGAASASGEGQKSNADVKAE
FT                   ARSKARGKVAWLDSFFEYLADSFRPILGVLLGASIIIALVNLLISLNVIPNDEASAGWV
FT                   FVKAIWKGVFYFLPIMVAYNASKKLKVDPWLGGAIMAILMTPQFTSLIDAKTTTCVENA
FT                   ALGTKSCTANIFGIPMALSDYSGNVFVPLLMAAVLALVYHGLKKIIPESVQLVFVPFFC
FT                   MIIVGALTAFIIGPIGVWVGNGLGVGLAWMNTHAPFIFAIIIPLLYPFLVPLGLHWPLN
FT                   ALMLMNIQTLGYDFIQGPMGVWNFACFGATAGVLFIAVRDKDKDMRQTALGALAAGLLG
FT                   GVSEPSLYGIHLRYKLVYKRMLVGCGLGGVVIAVLGWLFPSVTAAGQTVHGVTTTAFAF
FT                   TSLLTIPVFDQMWVYAVSIAVSFLTSFFLIITFDYRTPEQKAEVLARAAADQKAAAPAV
FT                   EAKEAAPAATTATATATATKTEAPAAAAAATTVVNAPVAGHVIALDETGDPVFASRALG
FT                   EGVGIQPTDSEVVAPVSGVLQTVAETGHAFGIKTDDGVEVLVHVGIDTVKMNGEGFVVK
FT                   VKADERVNAGDPLVSVDFAKVKDAGYSTTTLMTVLNTAALTSVTPKTGIDVKAGDEVID
FT                   IQR"
FT   CDS_pept        461923..462801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0367"
FT                   /product="transcription antiterminator similar to LicT"
FT                   /note="Orthologue of BL1633"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39148"
FT                   /db_xref="GOA:A1A0B5"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B5"
FT                   /protein_id="BAF39148.1"
FT                   /translation="MSHRGEKGVDVDVLRVFNNNVVLARDGDREVILTGRGIGFQAKPG
FT                   QHVDDAKIVRRFIPVDGKDPDHMAQQVAGIPPEIIRLVTDAMNRTGLKEQADKQPTLVM
FT                   ALADHICGAIQRAQRKQNIEYPLEAEVRSLYADEYAKGVAMVDAMNTYLGGALPRSEAV
FT                   ALALHLVNAGFSGGDLSATYTMTGIIQQMIAVIEGAYGITLAQDSVNVARFITHLRYLF
FT                   VRIHQHEQLDDEPQPIIESIKTSYPKACQCARQLAVVVKMRLGSDLTEAEIAYLALHVA
FT                   RVTNGVNRQVD"
FT   CDS_pept        complement(462856..464049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0368"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Acr"
FT                   /note="Orthologue of BL1634"
FT                   /note="PFAM_ID: DAGKc"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39149"
FT                   /db_xref="GOA:A1A0B6"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B6"
FT                   /protein_id="BAF39149.1"
FT                   /translation="MPMPVIVLLVIIAVVAVCAAAFFGYRAYKHRTLAEKLDKRDDDQV
FT                   HYAFIVNPSKPQAEQRKQHIKEFCEAKHLTQIEFIETQLDKDGRACAFEALDHGADVVV
FT                   AVGGDGTVRTVASALSGTGHALGIVPIGTGNLFARNMGIPVDDIDAALTVATSHGSRLV
FT                   DVGRLTLLDDETTDHGHAFLIIAGIGFDALMIDDTDPELKKNISWLAYFVSGVKNLFAP
FT                   KYKGNVTITSADGSTHSTRGLTFRTFMAGNCGQIPMFSLMPEASYDDGILDYEIIDTSG
FT                   GLIGWANLFGDVLHQTITGKAQQSPLSTNSTVDQVQGVSAEITLERPVLAQVDGDMLPE
FT                   TKHIRFSVERQALCVRVPEAASEDTGILALNANMSATPTKPQPTEQASGQPAEQSND"
FT   CDS_pept        464177..465463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0369"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="Orthologue of Rv3834c_BL1635"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39150"
FT                   /db_xref="GOA:A1A0B7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0B7"
FT                   /protein_id="BAF39150.1"
FT                   /translation="MLDIQFIREHADVVKESQRKRGESVELVDEVLRSDEVRRSSLKEF
FT                   EAARAQQKEIGKKVAAAPADEKAKLIAATKELSQKVSEYKAAADAAAEEYTTAMWKLSN
FT                   IVEPEAPEGGEDDYVVVKKVGQIRDFAAEGFEPKDHLTLGRGVAGIDMERGVKVGGSRF
FT                   YFLRGQVARMQIAMLTMAVDQAEEHGFTLAITPTLVRPEVMRGTGFLNSHADEIYRLRE
FT                   PDDQYLVGTSEVALAGMHENEILNLENGPLRYCGWSSCYRREAGAAGKDTSGIIRVHQF
FT                   DKVEMFVYAKQEDSYKEHEHLLAMEQEMLGKVEVPYRIIDTAAGDLGSSAARKFDCEAW
FT                   VPTQGRYRELTSTSNCTEYQARRLNIRERMEDGNTRAVSTLNGTLATTRWLVAILENHQ
FT                   QKDGSIEIPKAMRPYMGGKEVIEPTKWEA"
FT   tRNA            465693..465782
FT                   /gene="serT"
FT                   /locus_tag="BAD_t0018"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:465727..465729,aa:Ser,seq:tga)"
FT                   /note="codon recognized:TGA"
FT   CDS_pept        complement(465863..466543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0370"
FT                   /product="response regulator of two-component system"
FT                   /note="COG family: response regulators consisting of
FT                   aCheY-like receiver domain and a HTH DNA-binding domain"
FT                   /note="Orthologue of BL1645"
FT                   /note="PFAM_ID: GerE"
FT                   /note="PFAM_ID: response_reg"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39151"
FT                   /db_xref="GOA:A1A0B8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B8"
FT                   /protein_id="BAF39151.1"
FT                   /translation="MSEWEQRIRIAVVDDHEMFRAGVIATLQPHFDVVGQAADVEGSVA
FT                   MIAQTKPDVVLLDVHVPGGEGGGGTEILTKSRPYSPNTVFLALSVSDSPQDVGSVIRAG
FT                   AQGYVTKTISGDDLVSSIKQVHEGYAVFSPKLAGFVLSAFQNGPSANGAFGGPIHDDEL
FT                   DRLSNREQEVMRLIARGYTYKEVASELFISIKTVETHMSSVLRKLQLSNRSELTRWAAD
FT                   RRIV"
FT   CDS_pept        complement(466597..468033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0371"
FT                   /product="possible histidine kinase sensor of two component
FT                   system"
FT                   /note="COG family: sensory transduction histidine kinases"
FT                   /note="Orthologue of BL1646"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39152"
FT                   /db_xref="GOA:A1A0B9"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0B9"
FT                   /protein_id="BAF39152.1"
FT                   /translation="MRWCYEQALREGRPVPSKPARLPLLRPTYGREVAGVAKAISIHLG
FT                   VSVHLIRFIFVVTTFFFGAGAIAYIFLWITVPVGDPVQQAYVIAGSQPVENAPLSHGNV
FT                   RNVRNLRNVGNGGAQSQDSDGNADGMQSGSGAQSSESLEQMFANAPRPALLAMAGLLML
FT                   GLCVAMAAKGIEGTLIVPLLLGVVGVGVSWLRFNAKDGQLWTMLGGIAVIFVAYAIYIA
FT                   THVRIMQSARHATFTMLVAGLALLVGVLLAIVPWIMTLVRDLGTERALKEREEERADMT
FT                   AHLHDGVLQTLALIQLHADDQQTVFSLARQQERELREWLYQERTTSDRSVNAGLKQIAA
FT                   HVEDTHGKPIEVVTVGDARPSAQTDALLDATQQALVNAVTHGGEPVSVYCEAGDKLVEV
FT                   FVRDHGDGFDVDAIPANRLGIRESIIGRIKRRGGTVEIVSRPGWGTEVRMHMPISGAAE
FT                   DADSATTTTADGDTGVQSAQ"
FT   CDS_pept        468120..470123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0372"
FT                   /product="hypothetical protein"
FT                   /note="COG family: putative
FT                   stress-responsivetranscriptional regulator"
FT                   /note="Orthologue of BL1647"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39153"
FT                   /db_xref="GOA:A1A0C0"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C0"
FT                   /protein_id="BAF39153.1"
FT                   /translation="MPIQGFQLVFRADSGCSPIRMTAADCCNGDMSNANNNPQGGSAAG
FT                   SAEPQSQPRPPMYQPQPNRGNRFFAWIRSSRITRGRNRWIAGVCDGVARRLGWNATLVR
FT                   ALVILTSLLFGAGAAFYALAWFLLPDETDGRILCEELVNGHWDWNCAGALVCAAVALCL
FT                   PGAGWLAFGVAVLVFWLLVNRQSYAASWQPPQQGGSWPGQPAQPVQPGRPVRPAQSQYM
FT                   PQPMSTNTATTANMPGTPGQPMPQPTCPAPSGYQQYARPVQSLYQTFQQPVNPPAAFAT
FT                   ANVPPTFTVPPTVAAPQSKRARRKPAGPLLVLVTLGLALLAIAGSGWYAITMPVDWDYA
FT                   LRVLRLATLCCGGICLGIGVVIVVLGCMGRRTGGLHPLAWCAAFMAVVMTFCTSAVAWE
FT                   SRDWMMSNDYHRTTVSGIVTWSDTSDAQMKRYEQGLVVVGKNYANDVLDIDLSGYPAAH
FT                   GKHKVKLNDGTYGESSCPTGKLNLVVVNAQVVVTLPDGCQWSVSDPDDGYTNVTDYIGG
FT                   PDGITFFNGTGFMGLSLDENDDSGLGHHGVNKGVPALNGTTDFDDSGDDDAGDAGSDTE
FT                   NDSQDSVYAGTDLDKAFKTIYENKWYWPSIDSDKAPEEPDLYVNVDGTVGGSVTMQYTS
FT                   DSKLPVGTTGGQSHGSVDGKNVGKSASGKETK"
FT   CDS_pept        470120..470734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0373"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1648"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39154"
FT                   /db_xref="GOA:A1A0C1"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C1"
FT                   /protein_id="BAF39154.1"
FT                   /translation="MSDEKTREVPLTDVMGIAEVSDEPTETLPAVDDPGEAKTESFQKP
FT                   FDGGPEAQRKFESQDEAESLETSGQDMRGSFAGRSARPTGSVKSADPAKSAEPVDPSKQ
FT                   VRIGKTDGELVIRPSGPSTGTIVLGVFFCLIGLMSMLCLLPIGAWRWMPNPSTLFFYVV
FT                   GGLGALLLIISVVWAVVAAVRLRRRERQSAEQSPESQQRQR"
FT   CDS_pept        complement(470693..472564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0374"
FT                   /product="hypothetical membrane protein possibly involved
FT                   in transport"
FT                   /note="Orthologue of BL1649"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39155"
FT                   /db_xref="GOA:A1A0C2"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C2"
FT                   /protein_id="BAF39155.1"
FT                   /translation="MIPCFPRHVRRIRLEWRTVRSIVKRILVTCAATTALALLLTMVLC
FT                   ALGNAMAPKWQVEPFTDHITLTTTNTAIQAVDQATGAVLKTPQEGAYRTKETHITVALD
FT                   GSKTVNAIVREPLDAPADHPACLFLHGSGTGKSSEAFGDVANAMASAGITTLVPDKRLD
FT                   NYTMLHRDYVSSAHDYAKSLEILRKWPGVSRSETGIYAESEGTWIATVLTQQHPDLAFA
FT                   ILTSPPVVSGRQQMTLAATNYLTAAGAPDAVKQLIPRITSLGTQRMGLAYADFDAAKYR
FT                   TSLTMPLLINYGVKDTAMPVEQGARLLIKAANQAGNTNVTLRYYDANHQLRTGSNQTVP
FT                   GLPLEPHYTHDLEDWINAVTSGTGANGWATPMIAGTQPNQTVAAPLKTPPALVKSMGVI
FT                   VGAIAVCLLCALLAMCGAPILLIAGWVRERRASRRVSHDSASTEPAEPTDSTSMFSTDA
FT                   TTPTGPSTQPNAARPIAITDHRFPVGMRVALALNTLLAVGTTGVFLAYLVTVIIDAISL
FT                   TDNSAALAKNWHAIVMLTWLSLVAFAWLLAEIIVDACRRHARNRAIASIDDDADMNNGH
FT                   DAAAGSRCDIGKDGKACIGSGHVIVATCVVVSAALSLALLAFWGLFC"
FT   CDS_pept        complement(472876..474030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0375"
FT                   /product="AraJ-like protein probably involved in transport
FT                   of arabinose polymers"
FT                   /note="COG family: arabinose efflux permease"
FT                   /note="Orthologue of BL1652"
FT                   /note="PFAM_ID:sugar_tr"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39156"
FT                   /db_xref="GOA:A1A0C3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C3"
FT                   /protein_id="BAF39156.1"
FT                   /translation="MKRSILALASGAFILGAAEFVMMGILPQTATAMHVSIPAAGHYIS
FT                   AYAIGVCVGTLILVFGRKVPPKHLIILFMAIALVGNTLSAVSFCSPMLLVARFISGLPH
FT                   GAFFGTATLIAKTLADKGKEAQSVSMMVMGQTVANMLGVPAGTLLAEAMSWRLAFAILA
FT                   AWALMTIVVVISWVPSIDPIKDAGIKGQFRFLTHPGPWLILLAVFFGNSGIFCWWSYVS
FT                   PWLQKTGGWSATMVPMLMVLAGLGMVVGGIVGGRLTDLWKAGATAALSHGIALCGLLLV
FT                   FLLPGNHATTALLTFIIGFALFFNSSPQQLLMVQAGEGGGELIAGAAVQIAFNFGNAIG
FT                   SIVGGAALTATAMNYHFTGIAGAPISLLAVILLVLYTRRYEARA"
FT   tRNA            complement(474189..474265)
FT                   /gene="proV"
FT                   /locus_tag="BAD_t0019"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:474229..474231,aa:Pro,seq:cgg)"
FT                   /note="codon recognized:CGG"
FT   CDS_pept        474277..476040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BAD_0376"
FT                   /product="lysyl-tRNA synthetase 1"
FT                   /note="Catalyzes a two-step reaction_ first charging
FT                   alysine molecule by linking its carboxyl group to
FT                   thealpha-phosphate of ATP_ followed by transfer of
FT                   theaminoacyl-adenylate to its tRNA"
FT                   /note="Orthologue of BL1654"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39157"
FT                   /db_xref="GOA:A1A0C4"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C4"
FT                   /protein_id="BAF39157.1"
FT                   /translation="MDILHDWALYARSACRVLCSGFSVHLGLMTETNESQENQNEEEAA
FT                   VPTMTTVERAEMLLQQDAAIRAKINGGAALDEAVDPSNKEFGPLAHPEQVQMRVAKRAM
FT                   MLKEGIQPYPVTLDVTATIEEVRAKYDGKLEAGDETGDVVGIAGRVLFLRNAGGLCFVQ
FT                   LSAGDGTKIQGMISKKEIGADSLKQFKQLVDLGDHLFIKGRVIASKTGELSVFATEWAI
FT                   AAKALQPLPALHKELNEDTRTRKPYIGMIADEKIRNMVRNRSKAVASLRKTFADHDFLE
FT                   VETPMLQTVHGGAAARPFTTHMNAFDLDLYLRIAPELFLKRCLVGGIDRVFEINRDFRN
FT                   EGVDATHAPEFTMVEAYQAYGNYDTIGALVKQLVQDTAMDVFGSHKVTLLDGTEYDFGG
FT                   EWKTISMYDSLSEALGEEIVPNGGPDNPGTSVEHLGEIADKLGVERDDVENHGKLVEHL
FT                   WEHFYEDKLYEPTFVRDFPVETSPLVKGHRSKAGVVEKWDLYVRGFELATGYSELNDPV
FT                   VQRERFVAQAKDALAGDEEACDIDEDFLEALGVGMPPAGGMGMGIDRLLIALTGATIRE
FT                   TITFPLVKPLN"
FT   CDS_pept        476095..477291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0377"
FT                   /product="probable 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /note="COG family: 1_4-dihydroxy-2-
FT                   naphthoateoctaprenyltransferase"
FT                   /note="Orthologue of BL1655"
FT                   /note="PFAM_ID: UbiA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39158"
FT                   /db_xref="GOA:A1A0C5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C5"
FT                   /protein_id="BAF39158.1"
FT                   /translation="MWASVPPEPSLKNKRAITKGRSQYGSALLHTLAHPTSNMRFMEIS
FT                   TWIRGARLKTLPLAIAPVVIGATLSWRGVFLYSQGGDIWHEPCPFFGGQHDLSELKFGS
FT                   LVGECQRSAGWFILVAVLCGCVALFLQVAANFANDYSDGIRGTDEGRAVDSARSFAKTP
FT                   SAESTSTPEMLPASQPQHGPARLVASGVSPKKVLAVAGINALIACLCGLAVVTLTGYWW
FT                   FILVGIACLVAGWCYVGGKHPYGYHYLGEIFVFIFFGLVAACGTMFALAGTISTEGMLG
FT                   GANVGLIAVAVLCVNNLRDVETDRTHGKHTWMTALGRRNGTVFAIALLSVAVLLLAAYI
FT                   LLLSTPAMPTIAILAVTCAMCAAAAVAIARKKYGEALPLCTFSSLALAVTYVCCVVFA"
FT   CDS_pept        477305..478135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm"
FT                   /locus_tag="BAD_0378"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase"
FT                   /note="Catalyzes the interconversion of
FT                   2-phosphoglycerateto 3-phosphoglycerate"
FT                   /note="Orthologue of BL1656"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39159"
FT                   /db_xref="GOA:A1A0C6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C6"
FT                   /protein_id="BAF39159.1"
FT                   /translation="MQRNENCCKTWGVNRRKRLVLGVPSGRLASMTYKLVLLRHGQSAW
FT                   NKTNQFTGWVDVPLTEQGVEEAKNGGRLLKEKNVLPDIVFTSMLRRAINTANVALDEAD
FT                   RLWIPVKRSWRLNERHYGALQGKNKTEIRQEYGDEKFMLWRRSYATPPPEIDPNDEYAQ
FT                   NNDPRYTGDPVPEAECLADVVKRVEPYFKSDIEPELKAGKTVLIAAHGNSLRAIVKMLD
FT                   NLSEEEIAKVNIPTAMPLLYELDENFKPIKPRGEYLDPEAAAAGAAAVAAQGQK"
FT   CDS_pept        complement(478362..480308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0379"
FT                   /product="myosin-crossreactive antigen"
FT                   /note="Orthologue of LBA0649"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39160"
FT                   /db_xref="GOA:A1A0C7"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C7"
FT                   /protein_id="BAF39160.1"
FT                   /translation="MPVYLCPTTRHNSAQRHPKEEVMYYSNGNYEAFARPRKPEGIDDK
FT                   NAYIIGTGLAALSAACYLVRDAQMPGDHIHVFEKDPVPGGACDGANIPGVGYVMRGGRE
FT                   MDNHFEVMWDLFRSIPSIETDGVSVLDEYYWLNKDDPNYSLCRSTKARGVDGGTNGKFA
FT                   LSDKASMEIMELFFTPNEELYGKKISDFFDDEVFDTNFWMYWRTMFAFENWHSALEMKL
FT                   YIRRYIHHIGGLPDFSALRFTRYNQYESMILPMIKYLEGFGVQFHYNVKVENVDFAIGG
FT                   GMGPVRQRTGTGQDTILRKQAEYGAYPRNPFSSPTKKMATRIDLTKADGTTRSIDLGEN
FT                   DLVFITNGGCVENSSMGSQTEPAAWAPEIKPGGGWDMWRRIAAQDPSFGHPDVFCSDPE
FT                   HSKWMSATVTTLDGEIPPYIQKICKRDPFSGRVVTGGIVTVEDSNWLMSWTLNRQQQFR
FT                   DQPKDQLCVWVYGLFPDKPGNYVKKPMQDCTGEEICEEWLYHMGVPTDKIADLAKNHAN
FT                   TVPVMMPYIDAFFMPRSAGDRPDVVPDGAVNFAFLGQFAETPRDTIFTTEYSMRTGMEA
FT                   VYTLCDVDRGVPEVWGSVYDVRNLLNATVMLRDGKPITDMKLNPIERGVLKQIVKKLDS
FT                   TDIPTLLKEYGVI"
FT   CDS_pept        complement(480564..481268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0380"
FT                   /product="response regulator of two-component system"
FT                   /note="COG family: phosphate uptake regulator"
FT                   /note="Orthologue of BL1657"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39161"
FT                   /db_xref="GOA:A1A0C8"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C8"
FT                   /protein_id="BAF39161.1"
FT                   /translation="MKHLKGKHMRVIFNEELKAVADDLDRMAQDVRKAINGAGDALLNQ
FT                   NLEAAQAVIDGDIEIDALESSVIDQCVKLLAKQNPVATDLRVVVSTLRLAATFERMGDL
FT                   ARHIAEAARRTYPASPLPADAQPLFAEMQAFLDNVADQVVSMLTDRDTKTAEQIILNDD
FT                   KLDALHKKTFELAQSEDWKGTNQQLIDVVLIGRFMERLGDHAVSAARRVMFIVSGFDPS
FT                   KEPTRDEGTDID"
FT   CDS_pept        481357..482616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0381"
FT                   /product="sensor protein"
FT                   /note="COG family: sensory transduction histidine kinases"
FT                   /note="Orthologue of BL1658"
FT                   /note="PFAM_ID: HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39162"
FT                   /db_xref="GOA:A1A0C9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C9"
FT                   /protein_id="BAF39162.1"
FT                   /translation="MFTGTFTLRSRKSRHDHSSGNVRVCENEDMFESVGTWWRNLTHRH
FT                   GDDRNNDDTLDDATNTLLSILPLASIVVDEHDEVIRAHPDAYALGVVRDDAIADDTVAS
FT                   AVHEVRAHGGKKQFSLTTTTLHEPKKAPKAGKPTMREVAKQALIGQSPDKPVTTVSRPN
FT                   WLKVIVGRLNERFVVVLVSDVSETVRFSQIRDSFITNVSEQLLKPTQSLEELADALEHD
FT                   SDNKAAIEGNTVKLRQSCARMEHMVSDLLLLIKAQEPILPTASNRINVMEQVKTVVDAH
FT                   RDMAQRRGIDIEIDGDESLDINGEGEQIQAAVAKLLENAIAYSPDGKGITVSVKPNEDG
FT                   TKVLLSVLDRGCGIAQKEQSRIFERFYRGGNQNGHSEEGIGLGLAIVKHVALTHHGSAS
FT                   VWSAPGQGSTFTLGLPVARN"
FT   CDS_pept        complement(482737..482991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0382"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1659"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39163"
FT                   /db_xref="GOA:A1A0D0"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D0"
FT                   /protein_id="BAF39163.1"
FT                   /translation="MKFAPIIDPSVRKPSPKPVRVDLRKVFTFGTALWAIALVICMILL
FT                   AFGINVERLQTMCAAGTVIGVLMLVWEHFDRWDYRRLGE"
FT   CDS_pept        complement(483018..484160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="BAD_0383"
FT                   /product="probable phosphoserine aminotransferase"
FT                   /note="Catalyzes the formation of 3-phosphonooxypyruvateand
FT                   glutamate from O-phospho-L-serine and 2-oxoglutarate"
FT                   /note="Orthologue of BL1660"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39164"
FT                   /db_xref="GOA:A1A0D1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D1"
FT                   /protein_id="BAF39164.1"
FT                   /translation="MTNTVNIPTNMLPEDGRFGSGPSKIRPEQVQALDAGARNLLGTSH
FT                   RQTPVKQVVGSIREGLSNFFQIPDGYEVVLGNGGASAFWDIACASLITRKAAFGTYGSF
FT                   SAKFAKSAQSAPFLEDPEIFAGKPGTYRLPELTEYVDAYCWAHNETSTGVAAPVKRVEG
FT                   SKEQGALTLIDATSGAGALNVDISQTDAYYFSPQKAFGSDGGLWIAVLSPAAIDRAYGI
FT                   AKSVSLPGARRWIPPFLSLTSAIENSRKDQTLNTPAVATLVMLENQVRWLNDNGGLAWA
FT                   TARCARSASLLYQWAEKSDYAQPFVSDENARSNAVVTIDLDESINASQVVAALRENGIV
FT                   DTNGYRKLGRNQLRIGVFPSVEPSDVEALTKCVDYVAEHL"
FT   CDS_pept        484367..485299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0384"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1661"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39165"
FT                   /db_xref="GOA:A1A0D2"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D2"
FT                   /protein_id="BAF39165.1"
FT                   /translation="MRHAAHKAAKVSHAQFSLSKALFTANRGSHTAKAVRMAQLAEGGA
FT                   VVGLAPEVVDKLNEVAPMSRRTMREAAKAASRKSALVTSASLAALVGTAATALAFSQQN
FT                   ASRLVLADDGTETSQIKRVSDGAASRSEGRTALKELASTSNNGGWQLGDTSASMDASLM
FT                   SKSIADNPNVAVLMDQDSSALPANFNPNHATGDVGNAYEFSQCTWWVYVRRHQLGLPAG
FT                   SHMGNGCQWADSARALGYWVDNTPRHVGDIIVFAAGQEGSDSYYGHVAIVEKINDDGSI
FT                   VTSESGASLNGGTYSRTLTNVGDFQYIHY"
FT   CDS_pept        485362..486111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0385"
FT                   /product="hypothetical protein"
FT                   /note="COG family: cell wall-associated
FT                   hydrolases(invasion-associated proteins)"
FT                   /note="Orthologue of BL1663"
FT                   /note="PFAM_ID: NLPC_P60"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39166"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D3"
FT                   /protein_id="BAF39166.1"
FT                   /translation="MKHIKHCSVIAALAAAALTFAGVAPAALAANDGATQDAVVATRSF
FT                   PKTNAVKKNILAEASSTQVESDSDWGGVESLNVPQTKSQAEKDAEAAAAAAEQQRQQQA
FT                   QAQAQAQAASRSAARSDLSSSGSFTVTPPDGASVSSLLTFANQFVGKVPYVSGGNTPSG
FT                   WDCSGFVQYVYGQMGVSLPHYSGAQATVGRAVGSLADAQPGDIIANAQHAAIYVGNGMV
FT                   INSQLNGTRYDPIAWVFPSSYSIRRIF"
FT   CDS_pept        486252..487307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0386"
FT                   /product="widely conserved protein in universal stress
FT                   protein family"
FT                   /note="COG family: universal stress protein UspA andrelated
FT                   nucleotide-binding proteins"
FT                   /note="Orthologue of BL1664"
FT                   /note="PFAM_ID: Usp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39167"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D4"
FT                   /protein_id="BAF39167.1"
FT                   /translation="MIQGRSLMINDKAILVGVDGSHASYKATWWAANYAKHAGLTLQIV
FT                   CAYSLPSYAAVSFDATYTAMGDDNAAHNDAQEILSKAKAIADEQGVEASTLIVTGDPAS
FT                   VFVELSRNYNLIVIGNRGKGGLAERLLGTTSSSLPAYAYCPIVVVPYTDDEGNLMHLNN
FT                   TITKVAVGSDESKWGLKALEIAAAFADSWGAELDVISAVPNMKGSEDEGVMASFQEDLD
FT                   VRIKPLEAAYPSLKINKQIVPGPAAGALTKASYDHDVVVVGSRGRGGFTGLLLGSTSQG
FT                   LLQHAVGPVYVVPRKYVEAAETRLDTVPSSPADVTPKAIDDIKGVEEVPVDKAKPEVVE
FT                   AIETKIDPDRQ"
FT   CDS_pept        complement(487411..487824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0387"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1664a"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39168"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D5"
FT                   /protein_id="BAF39168.1"
FT                   /translation="MGKRLWVERNKDGSWDAFSEDGAHIKFGKGRGQFTPGDLMKVALA
FT                   GCAALSSQFAVEHTLGDGKGAKIVVDGTYDADTDAYIGFDEQVVIDATDAGLSDEDAEK
FT                   LADRVSRHIEKGCTVKHTYVEPTPVRMNVTVKH"
FT   CDS_pept        488153..488953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="BAD_0388"
FT                   /product="thymidylate synthase"
FT                   /note="Catalyzes the formation of dihydrofolate
FT                   from5_10-methylenetetrahydrofolate"
FT                   /note="Orthologue of BL1665"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39169"
FT                   /db_xref="GOA:A1A0D6"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D6"
FT                   /protein_id="BAF39169.1"
FT                   /translation="MPYEDLVRKILTEGTLKSDRTGTGTISLFGQQMRFNLKDSFPLLT
FT                   TKTVFFKGLAYELLWFLKGSTNVRWLQEHNVHIWDEWADENGDLGPVYGAQWRSWPAPT
FT                   PDDPNRTIDQISNVLDLIRNHPDSRRMVVSAWNPAEVENMALPPCHALFQFYVADGRLS
FT                   CQLYQRSCDIFLGVPFNIASYSLLTLMMAQQTGLEPGEFVWTGGDCHVYDNHIDQVLEQ
FT                   LSRTPYPYPQIRIRKADSLFDYDYSDFEIVNYQHHPTIKAPVAV"
FT   CDS_pept        489023..489697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfrA"
FT                   /locus_tag="BAD_0389"
FT                   /product="dihydrofolate reductase"
FT                   /note="COG family: dihydrofolate reductase"
FT                   /note="Orthologue of BL1666"
FT                   /note="PFAM_ID:DiHfolate_red"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39170"
FT                   /db_xref="GOA:A1A0D7"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D7"
FT                   /protein_id="BAF39170.1"
FT                   /translation="MSEMEHDSSRSGYHEPEPGLAGREDEEDWGDDFPKTFSVNLIWAQ
FT                   ACDKEGHDGAIGFEGGMPWHLPEDMRHFTELTVSHPVIMGRKTWESLSPKFRPLPNRDN
FT                   IVISHDPSYFAPGATVVDSLDDALDLARQEAIPDDGLDRSEIWVIGGAKVFEEAMPFAD
FT                   KAYVTQISMHVNADTYAPDIHALVESGAWRVAEEGTWQKARKGNDQVEGFRFVTYERNH
FT                   EE"
FT   CDS_pept        489704..490207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="BAD_0390"
FT                   /product="low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /note="COG family:protein-tyrosine-phosphatase"
FT                   /note="Orthologue of BL1667"
FT                   /note="PFAM_ID: LMWPc"
FT                   /note="Small_ acidic phosphotyrosine proteinphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39171"
FT                   /db_xref="GOA:A1A0D8"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D8"
FT                   /protein_id="BAF39171.1"
FT                   /translation="MYTVMTVCTGNICRSPMAEIILRAEFERRGLADKVNVESSGVSDE
FT                   EYGNPIDRRAVKVLKERGYELPSHHFAHRITRDEIERTDLFLPMTASHMRALLRQLPQA
FT                   KRSEVHMYRSFDPNLPKPAAGREDSIDLVDPWYGGPREFEVAIDQIEEVAPYIVDWVEQ
FT                   QLQN"
FT   tRNA            complement(490662..490738)
FT                   /gene="aspT"
FT                   /locus_tag="BAD_t0020"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:490702..490704,aa:Asp,seq:gtc)"
FT                   /note="codon recognized:GTC"
FT   CDS_pept        complement(490866..491936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE2"
FT                   /locus_tag="BAD_0391"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="COG family: UDP-glucose 4-epimerase"
FT                   /note="Galactowaldenase"
FT                   /note="Orthologue of BL1671"
FT                   /note="PFAM_ID: 3Beta_HSD"
FT                   /note="PFAM_ID: Epimerase"
FT                   /note="UDP-galactose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39172"
FT                   /db_xref="GOA:A1A0D9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D9"
FT                   /protein_id="BAF39172.1"
FT                   /translation="MVDIFTNCCISLLIRRKGQNMTVLVTGGCGYIGAHVVHALHQAGE
FT                   KVVVVDDLSYGKPTRIEGSRLYGMDIAAPGAGERLAEIMKAEGVDSVIHFAARKQVGES
FT                   VEKPLWYYQQNLNGMLNVLIGMRDSGAKKLVFSSSAATYGVPPVDVVPEDVVPMLPINP
FT                   YGQTKLFGEWMARACEEPYGIRFCGLRYFNVAGCGPVELEDPAILNLIPMLFDRLKKGK
FT                   APAIFGDDYPTPDGTCVRDYIHVSDLADAHIAALKYLDRDERKYDAFNVGTGEGTSVRQ
FT                   IVDEVKKVTGLPFKETVMGRRAGDPPHLIGSPKRINEEMGWHAKYNVEDIVKSAWDAWQ
FT                   ANPEHHIDVDTWKQTD"
FT   CDS_pept        492044..492928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0392"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /note="COG family: predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="Orthologue of BL1670"
FT                   /note="PFAM_ID:Methyltransf_4"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39173"
FT                   /db_xref="GOA:A1A0E0"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0E0"
FT                   /protein_id="BAF39173.1"
FT                   /translation="MQHDENTPTDGRKTEENAQNIQHVQSAAADGRPALYGRKVLSFVR
FT                   RSARLDARLQRAWDTYADTYLLNINAGEGSLGVREGFVFDQAYIRETWGNTNPLIVEIG
FT                   SGQGENVVAAAAARPDVNFLALEVYDPGVAHTLLLAGKQNLKNLRIAQINAPELFKAAV
FT                   DGSIAEVWTFFPDPWPKMRHHKRRIVQPELAADIHRALTDEGVWRIATDIEDYALHVHE
FT                   VMDELDGFHNDGALTVSLPVEHVGKGNADEAAALRHADFAESERFDGRVLTNFEKKGLA
FT                   AGRVIHDFTYRRV"
FT   tRNA            493074..493145
FT                   /gene="gluU"
FT                   /locus_tag="BAD_t0021"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:493107..493109,aa:Glu,seq:ttc)"
FT                   /note="codon recognized:TTC"
FT   tRNA            493171..493244
FT                   /gene="aspT"
FT                   /locus_tag="BAD_t0022"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:493205..493207,aa:Asp,seq:gtc)"
FT                   /note="codon recognized:GTC"
FT   tRNA            493268..493343
FT                   /gene="pheT"
FT                   /locus_tag="BAD_t0023"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:493301..493303,aa:Phe,seq:gaa)"
FT                   /note="codon recognized:GAA"
FT   CDS_pept        493590..495755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0393"
FT                   /product="nucleoside-diphosphate-sugar epimerase and GAF
FT                   domain"
FT                   /note="Orthologue of CAC0731"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39174"
FT                   /db_xref="GOA:A1A0E1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E1"
FT                   /protein_id="BAF39174.1"
FT                   /translation="MRRVEILLIGNTDFVTKQWIEHAFPHDKVVVALRKGTESSGEDLK
FT                   IIDMPDRDAMSEVFSNYEFDRIVYFSEDLTPRSERDGDLGYLRRLLHTVRNRKVQMLMV
FT                   SGPESEFTYPQETDVHETSKSLMSRAGEELGLYYARTYDLEVKIVRCPYLYAPQRNGVT
FT                   AYFNGLFEQAQAGELRFHERAEQRTCFLCADDLAELIYRIFDDWTADSELFHVPNVFDF
FT                   TYGDLGTLIAGYFPGTKVVYGEDRPQAYPADDHELRLRYGFSPRYSLREDFPHVIEGWL
FT                   KLRENKTDKHPVWDFLRSHNKWWTVLEIIGAFLLTEWLRTFTQGNSQLETVDLRLLFVV
FT                   IVGTIYGLHAGVFAAVLACAGVAMSYASQGASFAPLFYDTSNWLAFVIYFVAGSVCGYV
FT                   QSRNQESVRFVRDENGLLRNRLDFLRGLYQDMLDDRRQLRDQIIGRRDSFGKLYAVTRE
FT                   LDEVQPQKLYHTAIRIMQESLDSDSLAIFRVDNGGQFARLVAASPRFDVGSFRSVRVSD
FT                   YGEIITALEHNGIWVNRTLKDKFPMYAVGVRDRGELAVIITMGEAKPDQMNLYFQNLFS
FT                   IMCGLVESAMIRAFEYEDVARRSMLVPGTNLLKPEAFLPKVLAANDLKHDHMGDHLLLK
FT                   VECEGNLEDVDSLLMQSIRQTDEAGMLTDDGVYLLMNQAGEKELPIILKRLTRSGLHCS
FT                   YVPQTQEDALLSEARSHIAQADDGGES"
FT   CDS_pept        495755..496672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0394"
FT                   /product="predicted membrane protein"
FT                   /note="Orthologue of CAC0732"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39175"
FT                   /db_xref="GOA:A1A0E2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E2"
FT                   /protein_id="BAF39175.1"
FT                   /translation="MGSTTIAALIIIAVHLLVCMTLCLLHHVGVLKVDGLLLPFMALIP
FT                   LWGPLSVALMHSRAVLRGGRRIPAGLQELKVEDQEQRNILVDDRTDYANTVPLEEALIV
FT                   DNPRQRRNLMLSILNENPGQYANLLSQARLNEDVEVVHYAATAMAQISAKEDIALQQRM
FT                   EEYERNRDSDEALDRYREALEHYLESSMEQGYARTLQMRRYTDLLAERLKRHNDYRTVC
FT                   SLAKTQMDLGSFDAASRTIEAALSAWPRQGDVWLMKLRLEAARHDGEAVQRTVRHIKDD
FT                   HIYLGGRGHDILRFWLGDKEAGRA"
FT   CDS_pept        496741..498540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0395"
FT                   /product="predicted membrane protein"
FT                   /note="Orthologue of CAC0733"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39176"
FT                   /db_xref="InterPro:IPR018695"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E3"
FT                   /protein_id="BAF39176.1"
FT                   /translation="MAIALVLLAQTLGIHYGATKFTLKYMARNEAIPAQNAIMGQRATN
FT                   LMLVDSSQDGVDEAETMMKQVLLDMKVPTATVDLAKTDPDDIPSLNRYRTVLIVMPELD
FT                   SLGDELVSIMRWVEGGGNMMLAMTPEKTGYLDAIGPQIGIESSAYDYVMTKGIKPARDF
FT                   MLGGGHTYMFSGPFKSSLSLNLNEKAAVEAVSANGHTPLIWSADVRSGRTVTCNIGIYG
FT                   KVVRGFYASAFSLLGSATAYPVINSAAFYLDDFPSPVPSGDATYIKRDYGMSITNFYSK
FT                   VWWPDLTKLAERYGIRFTGVMIENYGDDTKDAPVRQKDESHFIYFGGLLLKQNGEIGYH
FT                   GYNHQPLVLPNTDYGDEYAYHQWPNRKAVVASLRELIAFQKSVLPAATASVYVPPSNIL
FT                   SKEGRQTIGRDVPEIRTIASTYLPSDSKLPYVQEFGVADDGIVEAPRIVSGGMVGNDYM
FT                   RLAAESELNMHFVSTHFMHPDDMLDPDRGAKEGWAVYRKGLENYLDWLEVSAPSIRMQT
FT                   GTECASAVQRFSGLTVKMRESANEWEFDLGNFKDQAWLLLRANHGTPGRIQGGSMIRMT
FT                   GNLYLIKATDSTVHVERKAGGAA"
FT   CDS_pept        498537..499955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0396"
FT                   /product="glycosyltransferase I"
FT                   /note="Lipopolysaccharide biosynthesis protein-related
FT                   protein"
FT                   /note="Orthologue of CAC0734"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39177"
FT                   /db_xref="GOA:A1A0E4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022622"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E4"
FT                   /protein_id="BAF39177.1"
FT                   /translation="MRICLVLEGCYPYVHGGVSTWMHSYITAMKEHEFVLWVIGAKAKD
FT                   RGKFVYDLPSNVVEVHEVFLDDALRLSGEHAKVIFTDEEVKALRELVNLSDPDWDVLFN
FT                   LFHNKGVHPLSFLQSNEFIDLFTKICMEEYPYVAYADAFHTVRSMLLPVLYLMTGEVPK
FT                   AQIYHAISTGYGGLLACLGGSINHAPVLLTEHGIYTREREEEILSAEWVAPAFRQRWIR
FT                   FFAMLSQEIYRRAWRVTSLFGRARQTQIDMGAPASKCLVIPNGIQYERFCDIPLKPEDG
FT                   WVDIGAVVRLAPIKDVKTLIHAFSELSNRVDNVRLHILGGVDDQDYADECYELVKQLEV
FT                   KNLEFTGRVNVVEYMRKLDFTVLTSISEGQPLSVLESFAAARPCVTTDVGCCRELLEGE
FT                   EGDDLGVAGFYVPPMYREGLARAMERMCASRKLREAMGQVGRERVKTYYRHERMLDEYR
FT                   ALYLDTADHYGLEH"
FT   CDS_pept        499957..501435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0397"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of CAC0735"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39178"
FT                   /db_xref="GOA:A1A0E5"
FT                   /db_xref="InterPro:IPR031617"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E5"
FT                   /protein_id="BAF39178.1"
FT                   /translation="MAGIGFELKKLFHRKGLVAMVRAYGYAGVICTGPMLLGILLQFGV
FT                   LAVSGWWHVPRADQNLLVCMITYTLLASLVLTSFLSMPVTRFLADMLFEHHEETILPSF
FT                   WGSTTLMLAVGAVLYAVFLLFSGATLMQGLLCLWLFLEMIVNWNAMSYLTAIKDYQGIM
FT                   WSFVAAVVVAFLSACAMMALGLPQVESLLAAVAFGYGVMMVWDVVLLHRYFPQSSESPW
FT                   TFLAWLDRFLPLALTGLLTTLGLFSHLVITWCGPLGVHVKGLFYGAPYYDVPALLAFLT
FT                   ILITTVNFVVSVEVNFYPKYRAYYALLNDGGTVKDIVVAEREMLAVLNRELYYTALKQL
FT                   FVTAAVISLEKMVLGVLPLGFNDGMHGYFRVLCVGYALYAVGNTMLMILLYFTDYFGAV
FT                   CCAAIFAGSATVLTVISQFVPVTLMGFGFLLGASAFLLAAVVRLAVFTDNLPYRVLGAQ
FT                   PIVATEKRGWFTKLGEALDEFGERLHGTFGRKES"
FT   CDS_pept        501453..503279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotH"
FT                   /locus_tag="BAD_0398"
FT                   /product="spore coat protein H"
FT                   /note="Orthologue of BCZK1852"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39179"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E6"
FT                   /protein_id="BAF39179.1"
FT                   /translation="MERNGRMTMGNRPCGRNAIFKCVAIIATVVTTFSCVACGNAADSG
FT                   STADKSAAQSQGKHEKVKKSATQGLDGAHLRDNDSLYKVYDDSGVETMYLTVSRGNKSE
FT                   GTDHSWSEINQYSVDDYAAMRTNRYQVNGLLQVGDEQGPVSGELGYGEKAPNATVQVRG
FT                   QSSSLNKQKNYKIELKSGKGKWRGQRTIALNKHMGEGLRFRNKMAYDLIRGIDQMMGLR
FT                   TQFVHLYVKDETSGSNSFDDYGLYTQVEQLNKSALQAHGLDKNGQLYKVNYFEFQRDAD
FT                   VIRLADDPKYNLSKFEEKLEVKGNSDHTKLIAMLNQLNDYSVPMSSILGKYFDTENLAY
FT                   WMAFQLLTGNTDTQSRNMYLYSPTNSDTFYVLDWDNDGMLMRKENQLRNTSEGSSWEQG
FT                   VSNYWGNVLFRRCLQTKSFRDELDTAVKREYNYMNANRINGMVSHYESITNQYLWKTPD
FT                   STYEPLTRAQYDVVAGQLHDEIEQNYKTYRESYDKPMPFFIGAPQADNGKLKINWDTSF
FT                   DFRGEDLSYDITVAKDYLCKDVVFSKTNLALPQIVMDLPSDGQYFVRVRARNTSGKMQD
FT                   AFNYYVTEHGKTYGTKCFYIKSGQVVEDDNGQ"
FT   CDS_pept        503269..504099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0399"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of OB2513"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39180"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E7"
FT                   /protein_id="BAF39180.1"
FT                   /translation="MGSDETSTSLLRRIGRRVGRRIGEELAMPPRRCEERYRHELKYLI
FT                   SYGQKADLNVRMAPLLDHDSHARDGSYTIRSLYFDDYWNTAYQEKVDGVLTRKKYRIRI
FT                   YDYSDRVIKLERKRKSDSWIYKEDAPLTHEQFDRILAGDVGFMEHSEHQLCREFYVEYV
FT                   SNVLRPRVIVDYEREPWILDAGTVRVTFDMDVRAAVDGFDIFDRTLPTLPVLEPGKLVM
FT                   EVKFTEFLPQIVRDILPGKAQEITAASKYVLCYDKASYLRGFDYWQEGWNVPSV"
FT   CDS_pept        complement(504063..504767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vrrB"
FT                   /locus_tag="BAD_0400"
FT                   /product="hypervariable Bacillus group-specific protein"
FT                   /note="Orthologue of BCZK4489"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39181"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E8"
FT                   /protein_id="BAF39181.1"
FT                   /translation="MVATHGFGFDEELRAAERARDVVPDRVGSVMDHRDVHAALVLMRI
FT                   EQGEHADHHRAGDHHQQIHARAGRDAGRDGPEQVQQVHRILHGGTVTHDGQRAHHTKRD
FT                   HDVRADGQCDHAGEHAHAHQRHREAARIHDARVEPPVYAVDDDAHQQRHQQGQRHFGHV
FT                   VLAEGVQHRFLDHVVYAHGFVFSFAIVRLLRFLRLPMFSAARFRPSVFGLPRYVRPVRS
FT                   SHTLGTFQPSCQ"
FT   CDS_pept        complement(504853..505746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0401"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of YPTB2321"
FT                   /note="Similar to Escherichia coli b1706 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39182"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E9"
FT                   /protein_id="BAF39182.1"
FT                   /translation="MPVVGTFGQQLLHPSHRKRFVEVIPLDVPASHGQQLVDLLFGLCA
FT                   FGDDQQSQLSGHVDHRFDDFQPFAGIVLIEVDEFHVKFDHIDVDVLEHVQRRIRRSEII
FT                   HQHRDVVRMQLADGAFHFGQVPGHGAFGDFRLEQPSVDIVFVQQSGERVRHIHLVDVHH
FT                   GDVHGNRHQIAALTFPTCQHPDHGTPYEHVQSGDLSGLFQHGNEPARRYHTIFGVVPTH
FT                   QRLGTDDGTRSRIAFGLQVEAELVVVERTVDLVERQLRHKLVGGRRPAHFRCVSQTDSF
FT                   LSPRPIRDIHRCTVSG"
FT   CDS_pept        complement(506242..507114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0402"
FT                   /product="putative 200 kDa antigen p200"
FT                   /note="Orthologue of BURPS1710b_1550"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39183"
FT                   /db_xref="GOA:A1A0F0"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F0"
FT                   /protein_id="BAF39183.1"
FT                   /translation="MPEILFFGRRVFFGEHPHDLVHGMGVGENRNQEPFAVVSDIGVPY
FT                   SAFPAYPVADVIIVEQHAEAVPVGRRHQFVAIVEQHLVEGTAMFVKHFLHIAGNHDRPL
FT                   RIGTQIDHISDRIPCIQMLQQRFHVFVAYQDVLKLLVQRAQLPFAAAAGVVALLVFAHL
FT                   VFRLVDQIRNILAVIGFGHAHGQLATVIKQLLTHIFHLSGALRHRMGETDDHELVAADA
FT                   VDIIVAEIGARRIRKLAQHHVASGMTQMIIDLMQANQIYVHHRQRLVMGGLDEFHIIVE
FT                   SVAVEQPRQ"
FT   CDS_pept        507281..508432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucO"
FT                   /locus_tag="BAD_0403"
FT                   /product="possible lactaldehyde reductase"
FT                   /note="COG family:alcohol dehydrogenase IV"
FT                   /note="Orthologue of BL1673"
FT                   /note="PFAM_ID: Fe-ADH"
FT                   /note="Propanediol oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39184"
FT                   /db_xref="GOA:A1A0F1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F1"
FT                   /protein_id="BAF39184.1"
FT                   /translation="MVYRMIFNQTAYFGRGAIKEIPGVARSHGFTKAFIVTDPVLLETG
FT                   TVKKVTDVLDEAGMPYEVFDNVKPNPPVECIQDGVAKFAASGADFLIGLGGGSPQDTCK
FT                   GIGIVTANPEFADVLSLEGVADTKNPSVPIFGVPTTAGTASETTINYVITDTANKRKFV
FT                   AVDPHDIPIVAFVDPDLTDSMPRGLKVATGLDALTHAIEGYITPGAWSLSDCLSMQTIR
FT                   MIAKNLAKSADGDIPAGEQMAYASYITGMAYSNVGLGLVHGMAHPLGGRLGVAHGVANG
FT                   ILLAPVMEYNKDYTGEKYRDIADAFGIADAYTGDIETVREEAVQAVHKLTVDLKNPTKI
FT                   SEVGATEADLEPLAHDAFHDVCTPGNPRQATQEDILAIYKSLM"
FT   CDS_pept        complement(508564..509490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0404"
FT                   /product="probable glycosyltransferase"
FT                   /note="COG family: glycosyltransferases involved in
FT                   cellwall biogenesis"
FT                   /note="Orthologue of BL1674"
FT                   /note="PFAM_ID: Glycos_transf_2"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39185"
FT                   /db_xref="GOA:A1A0F2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F2"
FT                   /protein_id="BAF39185.1"
FT                   /translation="MLNVSIVIPAWNEQERINDCLLNATRQTVMPHEVIVVDNRSTDST
FT                   VAVVEQFMKDHPEAPVKLLHQDDEQGLIPTRDYGLNHATGDILGRFDADCMIRPDWVEV
FT                   VSGIFTEDPDAMGATGPVMYYDLPSRHFGLRGDNSTRKRIYRADDGQPLLFGSNMALRA
FT                   TAWREIADEVCQDKADVMHEDIDISLHLLGKDLKTVYCPRMIAGISARRMDTSPASFLN
FT                   YMRRFKNTFNAHPQHYRKHKPEILITALYPVMHLLYPVWQKVLNTADINPAEAAWINEQ
FT                   MELAEQEGHELYDDTPTDEEWSEKHEE"
FT   CDS_pept        509545..511068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0405"
FT                   /product="hypothetical integral membrane protein"
FT                   /note="COG family: predicted permease"
FT                   /note="Orthologue of BL1675"
FT                   /note="PFAM_ID: UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39186"
FT                   /db_xref="GOA:A1A0F3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F3"
FT                   /protein_id="BAF39186.1"
FT                   /translation="MSEREQHMDTDKRTGTSGQCGNTDEMRWDLGTLFPAKGDPRRPPE
FT                   WLGRALLYIAIAIVLLSFCWRSWGKIEYLIIDVVISLFLALAVEPVVIPLVKHGWKRSF
FT                   ASIFALLMLGVLLCVMFGLFGNLFVQQVIALCNGLPALYQQICDFVAQYTDFKLPEINS
FT                   LGGEILKNIQTSWVTDFAGTAISTVSGFFSFLLNLMTVIMTTFYISAAGPKLRRAACQW
FT                   MAPSAQRRFLFVWTVSQTQISSFLFSRAILAVLNAFFTSICLMALHVPYWMPLALFCGV
FT                   VSQFIPMLGTYIGGALPVLFAWGSCGLWQAIAVVAFICVYQQIENLIFASKISRRTMDV
FT                   NDAVAFLAVLAFGSLFGAIGAFLALPIVASIQTIARTYTKRYDLVDSPLMDDPVPDKKS
FT                   KLVEGAEVISEHLHAVPRAVQGSSAHVPIPDDVRFLQEQAYNITRSDETGDADESQTVA
FT                   IPKRVLDGVDRKPLRGTAEADGAQTEAGPQVADGSQSQGTDDNPRSRWR"
FT   CDS_pept        511068..512291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0406"
FT                   /product="narrowly conserved hypothetical transmembrane
FT                   protein"
FT                   /note="COG family: glycosyltransferases_ probably
FT                   involvedin cell wall biogenesis"
FT                   /note="Orthologue of BL1676"
FT                   /note="PFAM_ID: Glycos_transf_2"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39187"
FT                   /db_xref="GOA:A1A0F4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F4"
FT                   /protein_id="BAF39187.1"
FT                   /translation="MVLLSVLDVVLVVLGGAGMLYQAVCIVISLFAKPIKFPEAPMNKR
FT                   YAVLISARNEANVIGNLIDCLHSQTYPSELIDIWLVADNCTDNTAEVARNMGCHVIERF
FT                   NKEQVGKGYALTYLLDQMNESGASDPYDAFFVFDADNKLDKHYIEEMNKGFQAGFKILT
FT                   SYRNSVNLSDNWVSSGSALWFIRESRFVSASRMWLGNSCHVGGTGFMFSQEIMRRNNGW
FT                   KFHLLTEDLEFTMDSVLHGDRIGYCGTAILYDEQPVTFAQSWRQRLRWSKGFLQVFRYY
FT                   GPALIKRAVRERDFSAVDFTLLLCPFTVLGIARVLLGMLFAACGFVTWQSQLNSLTGWT
FT                   SGIVISVIGMMGLAALTIVAERDHVGATNKELLAYVLAFPIYMLSYVPISFQAVFAKSE
FT                   WKPIEHKG"
FT   CDS_pept        512324..513835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0407"
FT                   /product="hypothetical secreted protein with D-Ala-D-Ala
FT                   carboxypeptidase 3 (S13) domain"
FT                   /note="COG family: D-alanyl-D-alanine
FT                   carboxypeptidase(penicillin-binding protein 4)"
FT                   /note="Orthologue of BL1679"
FT                   /note="PFAM_ID: Peptidase_S13"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39188"
FT                   /db_xref="GOA:A1A0F5"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F5"
FT                   /protein_id="BAF39188.1"
FT                   /translation="MFRGDPYGADGEKMTKRGCGLAMDDAGDYRYTRRRRAITVAVSVV
FT                   ATVALCVGYAVADMCDVVPGVLTLRHVEHSTAAAAGRSIEAADVIADIDASKTIDPAAA
FT                   RALTDAFRASAAGFGGEFSIAIADASGNVVAENNIDVPRTPASTMKTLTAYAAAVELDM
FT                   GKTLDTQTYLEQSQDGTARLALKGNGDMLLGAGASDANHINGRAGLGTLAGRTAQALRQ
FT                   RGITSVTLAYDDTLFGNDRWPQGIAELDTDHLYYAPTASMAVDGGRNWNGTGPANPDVF
FT                   SAYPALSMQPARDAALVFQQRLAEQGITVQGFVSQGTVAGASHPLASVRSASLNEIMAF
FT                   TMRHSDNSLAEEFGRLLALQVGADNSPAGAVQAVKSVLERKGITTTGLDMRNCSGLTED
FT                   SKLTARTLLEVQLRNLAAGSGAAAAEGMSVMGFVGTAESRLNDADEAGLIRVKTGSLGD
FT                   VTSMTGNVSRLNGGALTFAVIVNNPTDFAAAKAAIDTFVAGLPKL"
FT   CDS_pept        513907..514479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BAD_0408"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /note="COG family: hypoxanthine-
FT                   guaninephosphoribosyltransferase"
FT                   /note="Orthologue of BL1681"
FT                   /note="PFAM_ID: Pribosyltran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39189"
FT                   /db_xref="GOA:A1A0F6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F6"
FT                   /protein_id="BAF39189.1"
FT                   /translation="MVGMRIADVQEDIDHELISKEEISDIINRAAAQASEDYRGKNPLL
FT                   VCVLKGAVNTLAAFSQAMSIPVQMDFMSLSSYGSGTESSGKITVRQDLSTDVRGRHVLI
FT                   VEDIIDSGITLAWLVDELKRRRAASVEIFALLEKPARRKVNVDVKYKGREIPDEFVVGF
FT                   GLDYDEYYRNLDSIAVLKPSVYEGGQA"
FT   CDS_pept        514476..516575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39190"
FT                   /db_xref="GOA:A1A0F7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F7"
FT                   /protein_id="BAF39190.1"
FT                   /translation="MSFPGPNQPPSNGGGNKPNGGSNPFTNPFSRNDDGKNGGSGANGN
FT                   KSNGPRPFWQSPWLWVVVVALLAVTMFQLFAGAGSQTIDTKDGMQILNGNTVEYATIVD
FT                   NTQQVKLKLSSDYSATDPDTGRTKNYGKNVQFYYTYAQSAAVVKAVQKADPAKGWTASM
FT                   QQTSIWTYLLTSLLPFLIIFGLFWFLMSRMGGAAGGMFGMGGKKNSGKLLDGQTPTTKF
FT                   SDVAGEDAAVQEVEEIKDFLKDPSRYKALGARIPRGVLLYGPPGTGKTLLARAIAGEAG
FT                   VPFYSMAGSDFVEMFVGLGASRVRDLFDEAKKNAPAIIFIDEIDAVGRKRGGSGMSGGH
FT                   DEREQTLNQLLVEMDGFGNDTNLIIIAATNRPDVLDPALLRPGRFDRQVAVEAPDLEGR
FT                   EAILKVHAKGKPFVPDVDLHMIAVRTPGFTGADLANVLNEAALLCARAGAQLIDNRAID
FT                   EAIDRVQAGPKRRSKGMALDELRNTAYHEGGHALVAAAMNDTDPVTKVTILPRGRALGY
FT                   TAVMPTEDRYSMSRNQLLDQMAYAMGGRTAEEVVFHDPTTGASNDIEKATNIARQMVLD
FT                   YGFSEKLGAIKWSDDEQSDLGALTHKYSAHTAEIIDEEVLKLVETAHTEAWNVINENRD
FT                   ILDELVRQLLVKETLNEKELAAIFANIKKAPKREVWLSDEKRPDSDIPPVPIPDKLKKS
FT                   AGLTN"
FT   CDS_pept        516575..517210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BAD_0410"
FT                   /product="GTP cyclohydrolase I"
FT                   /note="Involved in the first step of
FT                   tetrahydrofolatebiosynthesis; catalyzes the formation of
FT                   formate and2-amino-4-hydroxy-6-(erythro-1_2_3-
FT                   trihydroxypropyl)dihydropteridine triphosphate from GTPand
FT                   water; forms a homopolymer"
FT                   /note="Orthologue of BL1683_Tfu_2895"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39191"
FT                   /db_xref="GOA:A1A0F8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F8"
FT                   /protein_id="BAF39191.1"
FT                   /translation="MSDTDFDTLLDDKARAAHAAGPVGYDEEGVRQAVRLFLKSIGEDP
FT                   DREGLLDTPDRIGRACKELFAGLGHGPEEVLKTRFKVDTDEMVLVRDIELFSVCEHHLL
FT                   PFHGVAHVGYIPQNGQVAGLSKLARLVELYARRPQVQERLTQQVADALMEGIDARGVIV
FT                   VTECDHMCMAMRGVKKAQSRTVTSAVRGCMRDAATRTEAMSLILSNHS"
FT   CDS_pept        517258..518157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BAD_0411"
FT                   /product="dihydropteroate synthase 1"
FT                   /note="COGfamily: dihydropteroate synthase"
FT                   /note="Dihydropteroate pyrophosphorylase 1"
FT                   /note="Orthologue of BL1684"
FT                   /note="PFAM_ID: DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39192"
FT                   /db_xref="GOA:A1A0F9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F9"
FT                   /protein_id="BAF39192.1"
FT                   /translation="MNEGRKPMAIDMKAIHDSQRTLVMGVLNITEDSFSDGGLWLAPEA
FT                   AKAHGEAMMKAGADIIDIGAESTRPGAKRVSEADEKARVLGAVDALIPEGAVLSIDTTR
FT                   ASVALAALEHGAQIINDVSGGQLDRELPHVVADHSDCLYIVQHWRGWLAGAAGNVPDAD
FT                   TSRYEHGVVNDVYDELMRQVDAVLEAGVQAEQVIIDPGLGFSKPGVEHNLPILAALDRF
FT                   NATGYPVLIGASRKRFVGSLLAGAGVTEPDMASKDNATAAISALCAEHGVWAVRVHDVA
FT                   KSRDAVAVGNAWREYANA"
FT   CDS_pept        518242..519792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulD"
FT                   /locus_tag="BAD_0412"
FT                   /product="aldolase-pyrophosphokinase"
FT                   /note="7_8-dihydro-6- hydroxymethylpterinpyrophosphokinase;
FT                   HppK"
FT                   /note="COG family: dihydroneopterinaldolase"
FT                   /note="Orthologue of BL1685"
FT                   /note="PFAM_ID: FolB"
FT                   /note="PFAM_ID: HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39193"
FT                   /db_xref="GOA:A1A0G0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G0"
FT                   /protein_id="BAF39193.1"
FT                   /translation="MDQIRLTGIRATGKHGVLDFEHERAQTFVVDATLFLDLAAAGRSD
FT                   DLNDTVDYGAIAKGIVAIIEGEHVDLIEKLANRIVGMILGFPAVCRTQVTVHKPNAPIT
FT                   VPFDDVSVTVERSRETVDSPSRERSSEHGQVHHAIIAMGGNQGDVTATLRDAVRCIDGL
FT                   PSTQVTGVSPLYRTDAWGMPEGTAEFRNAVVSVDTRLSAAELLAGLQRIEASHGRVRTD
FT                   HWTSRTLDLDIIDFDGQESADPDLTLPHPRAWQRAFVLGPWLALEPDAELGGAHAGSVA
FT                   QLLHETSDRDHIDEIADDWMVAGAQDPIVRDSDIGTSADDVDAIDDADSVESIDSIELP
FT                   EGTAASKAAAAAAAKPGPASRRAVISLDSVSTDAEHQFRQAIVAIDALPGNQVEGISPL
FT                   YHVSQVDDYPDKMAAVMQISTRMDARELIGALESVSSSISDDLDLDLVDMEGVVRNEPD
FT                   CMVPWPSAREHAAVLAPWFDMDPDAKLGRDPVAFLLAMAPDAAQVGMLTDNWIIGDTL"
FT   CDS_pept        519855..520364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0413"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1686"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39194"
FT                   /db_xref="GOA:A1A0G1"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G1"
FT                   /protein_id="BAF39194.1"
FT                   /translation="MGLAKYGEISGLPLVGAPWIVPVVLAVLGGVVLYMALQIHKYTTK
FT                   DPVKRAQLKPLDPQKAFGTLVACKALGLAGAALPGWYGGQIIMSLPHGEAEFYSQAIIE
FT                   CVVACVVCVADMIVGIVGEWLCRIPPIDGPESPAVKKAAQRNRYAAAATKASTKSATNP
FT                   ATKSKV"
FT   CDS_pept        complement(520390..521295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="BAD_0414"
FT                   /product="Acyl-CoA thioesterase II"
FT                   /note="COG family: acyl-CoA thioesterase"
FT                   /note="Orthologue of BL1687"
FT                   /note="PFAM_ID: Acyl_CoA_thio"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39195"
FT                   /db_xref="GOA:A1A0G2"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G2"
FT                   /protein_id="BAF39195.1"
FT                   /translation="MTQTDMTPLQRLAKVLQLGTPSNYRNHTYINGESLYFPTGRVYGG
FT                   QVIAQSLMAASRTVAPSRLPNSIHGYFISAGDIRQDLLFDVENLRDGRSFSARRVNVTQ
FT                   AQGSILTAIASFQEHDQEGIEFADPMPENIPDPDSLTSAKQLMEPYAEQSPFAKYYAEK
FT                   SPFDIRHVTRTIMLGADKKSASEDSGKQMVWMKADGKVDVPQVMHRAMLAMGCDQIMLE
FT                   PILRRAGLSIATPGISYASIDHSMWWYRDIDINQWHLYVQDTPTAAHGRGLGQAKVYTQ
FT                   DGELVACMAQEAMFRVPKKD"
FT   CDS_pept        complement(521520..523175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0415"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="Orthologue of Rv2477c_BL1688"
FT                   /note="Probable ATPbinding protein ABC-transporter probably
FT                   involved in macrolide transport"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39196"
FT                   /db_xref="GOA:A1A0G3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G3"
FT                   /protein_id="BAF39196.1"
FT                   /translation="MIKARKAYGDRVILDDVTLSFLPGAKIGVVGPNGMGKSTLLKIMA
FT                   GLDTVSNGEAYLTPGFTVGILQQEPPLDDTKTVGENIKMAFGPIAEKVTRFNQIGEEMA
FT                   NPDADFDALMEEMGKLQNDIDAANGWDLDSQLEQAMDALQCPDPDTPVSVCSGGERRRV
FT                   ALCKLLLEAPDLLLLDEPTNHLDAESILWLEQFLHQYKGAVIAVTHDRYFMDNVAEWIC
FT                   EVDRGHLYPYKGNYSTYLETKAKRMEIQGAKDAKLAKRLKSELDWVRSSPKARQAKNKA
FT                   RLERYDQMEQEARNNKKLDFSEIQIPAGPRLGSTVLEAEHIHKAFGDRVLIDDLSFTLP
FT                   RNGIVGVIGPNGVGKSTLFKTIVGLEPLTSGSLKIGDTVKISYVDQNRAGLDPNKNLWE
FT                   AVSDGLDFIEVAGVEVPTRAYVASFGFKGSDQQKLVGVLSGGERNRLNLALTLKQGGNL
FT                   LLLDEPTNDLDVETLESLENALLAFPGCAVVISHDRWFLDRVATHILAWEGTDENPANW
FT                   YWFEGNFQAYQENRIARLGEDAARPHRLHRKLTR"
FT   CDS_pept        523176..523655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0416"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of SCO4877"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39197"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G4"
FT                   /protein_id="BAF39197.1"
FT                   /translation="MVNKLSQCCVPSLRNVGIPAFCVCRSTENRTCSPCCGALPARLVA
FT                   DESQVCCELIEAKCFRTVSIRKVPSPIIPYPVYTAVVGRLCGNGSVPPYVVGGDGGLLR
FT                   RSPSLGVSVCLCARDGTELRCRRREGSPGVVPVGAVAVILRGEIGFSRTGYVSTV"
FT   CDS_pept        523898..524215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="BAD_0417"
FT                   /product="two component system response regulatory protein"
FT                   /note="Escherichia coli ECs4838 transcriptional regulator
FT                   in 2-component system CpxR"
FT                   /note="Orthologue of YPTB0070"
FT                   /note="Similar to Yersinia pestis YPO0074 cpxR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39198"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G5"
FT                   /protein_id="BAF39198.1"
FT                   /translation="MRWYRTVRRSPWSERQPSAVSNAPSSAVMCGLNITKMRPPKSSST
FT                   KAMMRLGTPIILAAMPTQPLRCASNVSFRSCATARSSSVFSAAADGWLKNGMDVIISRC
FT                   M"
FT   CDS_pept        524261..525214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="BAD_0418"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /note="Orthologue of SAK_0872"
FT                   /note="identified by similarity to SP:P17618"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39199"
FT                   /db_xref="GOA:A1A0G6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G6"
FT                   /protein_id="BAF39199.1"
FT                   /translation="MAARRTAGRTCPFPDRSRRLRDVRCNVCGLDWCNMLGVMEDMLQY
FT                   RESMAQALELARKGAGWVDPNPLVGAVVVRDGEVLATGYHDRYRGPHAERMAFDYADAH
FT                   GIDLTGATVIDTLEPCCHVGSQPACTALILAHGIARVVVGSVDPNPIVAGKGLRILEEA
FT                   GVEVVRDVMREECDAINRHFFHYITTGKPYIVDGRRRAGESDSEYAVRRRELYATYAAV
FT                   LAGTESDVPDESFAHFNGPVQAVGADEVVIGGHRPLLLEAGALACTDPDEWLSELGKRK
FT                   IDSLIVESDEAFERLSMALPKRLKRHSCVVGRVSRL"
FT   CDS_pept        complement(525381..526928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0419"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted metal-dependent hydrolasewith
FT                   the TIM-barrel fold"
FT                   /note="Orthologue of BL0601"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39200"
FT                   /db_xref="GOA:A1A0G7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G7"
FT                   /protein_id="BAF39200.1"
FT                   /translation="MAGNEVILLNRGCMGEPYVIENVCFVGSDESVDITIEQGRIADVR
FT                   SSEKSVAKASKTWIIPGLWDCHTHFTQWSYTLGRLDLIDARSADEAMSLLREHLEERRE
FT                   SGTLDPDQYVVGMRFRHSLWADDAQPTLAAIDAVSGDQPVALSSADMHCGWVNSAAARK
FT                   LGVHVGESGLVGELEWFDAYCKLDKGPGAADELMRLLRNAEQDAAGKGVVGVRDYEMAE
FT                   NIDTWIDRFKQGLDGLRIEAGVYPERLQQAIDDGWHTGDELPGSHGLGHVGAMKMISDG
FT                   SLNTRSAYCSTPYSGITPETYGTLSYTPEQIESYMRLATEHGFDIACHAIGDEANTIVL
FT                   DCAERTHAHGSIEHAQMLKERDIPRLAQLGLAASIQPQHAMDDRDVITRFWGNPAGIPY
FT                   AFNSLHKSGTKLLMGSDAPVAPLDPWLAISAAVFGTESSDREPFQSEQCLDFETALASS
FT                   TALGRTTLQAGDAADLVLLDCDPSELESPEAMRAMPDHVLATMLAGCWTYQSHVSRL"
FT   CDS_pept        527106..528032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0420"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0019"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39201"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G8"
FT                   /protein_id="BAF39201.1"
FT                   /translation="MDNGAQYSESLARLRTRTIEQCLEAQRRTGRRLVFALDTALSLQG
FT                   IELPRYRRGGLLADTLHAVIESNGVRTILQGICFVLWSGPQTHMPIHHGRLRCTDSVTT
FT                   WAMHANRLEDEELVVLGDSMMRRDGHMKKATLEEFRIYVDSLSDLSNYSGSDRLRAVRG
FT                   VSKMRRALRLMRENTDSSQETRSRIVLLCYGLPCPEVNYAIRLKGYSHVFFADMAYPDL
FT                   KIIIEYDGRHHASRWLADSKRREALEDEGWLYIQVTAENLRDEDSQRELAERVAQRMSL
FT                   RLGEPVRLCGRMTIAQIADGRRKGNRL"
FT   CDS_pept        complement(528258..529538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0421"
FT                   /product="O-acetylhomoserine (thiol)-lyase"
FT                   /note="Orthologue of BT1923"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39202"
FT                   /db_xref="GOA:A1A0G9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G9"
FT                   /protein_id="BAF39202.1"
FT                   /translation="MSENVDTICVQGGYQPGNGESRTPPIIQATTFKYQSSEQMSRLFD
FT                   LSESGYFYTRLQNPTNDTVAAKICELEGGAAAMLTSSGQAANFFALFNICNNGDHIVAS
FT                   SAIYGGTFNLINVTMRKMGVECTFVSPDCTEEELEAAFQPNTKAVFGESISNPALIVLD
FT                   FEKFANAAHRHGVPLIVDNTFPTPINCRPFQYGVDIVTHATTKYMDGHGSCVGGAIVDS
FT                   GNFDWMAHAEKFPGLTTPDDSYHGVTYAKEFGKAAYITKATAQLMRDFGSTPAPINSWI
FT                   MGMHLESLGVRMERHCANALAVAKWLDADPRVSWVSFPGLETDKYHALAEKYMPNGTCG
FT                   VISFGVPGGREKVSAFLDHLKMVSIATHVADARSCTLYPAGTTHRQLTEEQLEEAGVGI
FT                   DLVRLSCGIENTADIIADLDQALAAVQ"
FT   CDS_pept        529775..531124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylA"
FT                   /locus_tag="BAD_0422"
FT                   /product="xylose isomerase"
FT                   /note="Catalyzes the interconversion of D-xylose to
FT                   D-xylulose"
FT                   /note="Orthologue of BL1704"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39203"
FT                   /db_xref="GOA:A1A0H0"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0H0"
FT                   /protein_id="BAF39203.1"
FT                   /translation="MGLWDIDKIPYVGREKGPQEGLAFHYYDADKVVAGKKMKDWLRFG
FT                   VAWWHTFDQQLVDPFGTGTAQRPWYGKYSDPEDEALAKVDYAFEFFQKLGVEYFCFHDR
FT                   DIAPEGDTLRETDKNLDKVVDKIEENMKSTGIKLLWNTSSLFTNPRFVSGASTSPFADI
FT                   YAYAGGQLKHSLEIAKRLGAENYVFWGGREGYENLWNTQMKREQEHMAKFFHMCHDYAK
FT                   EIGLDAQFLIEPKAKEPTMFQYDFDAATAINFLRTYDLMDVFKLNLEGNHANLAGHTYQ
FT                   HEIRTAREAGVLGSLDANQGDKLIGWDMDEFPTDLYETSTVMWEVLAEGQIGPHGGLNF
FT                   DAKPRRTSFTAEDLFRSHIAGMDSFAAGLLVAAKMHEDKVIENLQAERYSSFDSGIGAT
FT                   VENGTASLASLEEYALDIPQSKLIEATKSDHLESVKATINNYMIDALAEA"
FT   CDS_pept        531514..533208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0423"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /note="Includes: beta-xylosidase"
FT                   /note="Orthologue of ABC1148"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39204"
FT                   /db_xref="GOA:A1A0H1"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H1"
FT                   /protein_id="BAF39204.1"
FT                   /translation="MTTTITIANPILHGMHPDPSWIWDDDLRQIVLVTSTFELVPGLPI
FT                   YVSRDMAHWKHVSDAIDEELARRLLIPFVDDSGGVYAPTLRRIRGKYVIACTIARINGR
FT                   KAIAEGCSQAELDAAQAAEGNFVLESDSIDGPWRGPFWIEGAEGIDPDIFEDGDGNVYW
FT                   TQTRPAVNPQWEGQTEVWTQRINPETWTFVDDGLPAGSGKTVIWRGYGMESVWAEAPHL
FT                   YRVGDYVYLMTAEGGTSFEHSEMAMRIYAPHGLLRAFEAYEREASESGECIPQVRDGER
FT                   CYLGTAIRAFHADKKNPILTHRHLGLSEPLQCVGHADLLLHPELGWWLVCLGVRETRGK
FT                   HDGELLSYLGRESFVAPVSWEHNPADWKLDGNGALDTHEGDPGWPVTCAGLGRLADEIT
FT                   VTTEDDGITIEPRVKSSLAGDVEPALVDVADGSTNDVVVRDERDVSYRRIAKLPTLMPI
FT                   PMSGSLVIRQNSTHYAVFSMHGTDVRYEMVNGDDSQAGSVAVQADGVRPAVLFDDNRLS
FT                   VIVTGMHGPVDSATFVRQGQVLLSVDARFLSTEWAGGFVGCMAGFMA"
FT   CDS_pept        complement(533342..534361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0424"
FT                   /product="LacI-family transcriptional regulator"
FT                   /note="Orthologue of SAV4983"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39205"
FT                   /db_xref="GOA:A1A0H2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H2"
FT                   /protein_id="BAF39205.1"
FT                   /translation="MRNTTKKATVRLSDIAKETGYSLSTVSKALNGRADVSEETRQTIN
FT                   AVLKRYGYSRKATGAKSQRIIEIVFQDFDNVWALEVLRGAIREAKLHDLNVITTEGGNR
FT                   QHPDSSWIDNMLRRQTDGAILVFSSLTRIERNKLHSRGIPFVLFDPFGNPDPDTLSVQA
FT                   DNWTGGVIATRHLLALGHTRIGIITGPEEMMCSKARLDGYTSALAEHGIETDPELITEG
FT                   DFTTSGGYAQSISLLKRPNRPTAIFAGSDLQAMGVYEAARQLGLRIPEDLSVVGFDDVQ
FT                   TAAFLGPALTTVRQPLQDMARAAVRMLVEALSTDDVIQPHIIMPTSLVVRNSTQQLEG"
FT   CDS_pept        534698..535993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0425"
FT                   /product="putative sugar transporter solute-binding
FT                   protein"
FT                   /note="Orthologue of SAV4979"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39206"
FT                   /db_xref="GOA:A1A0H3"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H3"
FT                   /protein_id="BAF39206.1"
FT                   /translation="MVNKEKTMKFRTIAAATLAVATMLGMGACGSSTGAKDDKTITFWH
FT                   NATAGDGKQYWEDMAKAFEKKTGVKVQIQAIQNEDFEGKLTTAMQDPASGPDVYMTLGG
FT                   AKTKDMIDAGQTMDLTDKISDTVKKQMSSALESMSYDGKVYGVPVTVQPGGIWYSKDLF
FT                   KQAGIDAAPTTFSELKTDVQKLRSAGIDPIALGGKDAWPVGHWYYWLSMRECSPKAYAK
FT                   GVNDKDFSDSCWTKAGDDLKDLLDANAFNEGFLTTTAQQGASSSAGLLANHKAAMELMG
FT                   TWEPGVLKDLTPDKKPMADLGFFAFPTVDGGKGEEGALMGAVTGFAVNPEAPDAAVDFV
FT                   NFMAEKSNQEKYATAFSTIPASAEAYDAVTDENLKAIIEAMKKSDGMQLWMDTALGGNI
FT                   GNALNSGVVNLLSGQGTSADIVKAMKDAAAKG"
FT   CDS_pept        536010..537137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0426"
FT                   /product="putative binding protein-dependent transporter"
FT                   /note="Orthologue of SAV4980"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39207"
FT                   /db_xref="GOA:A1A0H4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H4"
FT                   /protein_id="BAF39207.1"
FT                   /translation="MKAKGGWIDRFSSALLPIRETYLVVEKTMSSTSKDAVTLRAKRSK
FT                   KPSDGKMRRNVEIFVLSAPAILLFVCFVILPIVLGAYYGFYQWKGYGLPSKTGKFVGLQ
FT                   NYITALKDPAFQAAILHTFEVVIGSLVIQAPLAILFALLLNQKFKGRGLIRTLIFVPYV
FT                   VSEVIVGTGWSLLLQKKGAINEILANFGINGPDWLADPKIAIWTLLLLISWKYVGFAVI
FT                   LMLAGMQSIPEELYEAAKVDGASFWQMQKSITLPLLAPTLRIWVFLSMIGSLQLFDLVY
FT                   IVWGKYVSTTAGVSTMATYMVREGRGAGNYGYGSAVALIIFVISLIIALVYQKFVLNRD
FT                   LDGAVTEQKEAEKRARKRAKEVQHREVAALASEVK"
FT   CDS_pept        537137..538030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0427"
FT                   /product="putative binding protein-dependent transporter"
FT                   /note="Orthologue of SAV4981"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39208"
FT                   /db_xref="GOA:A1A0H5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H5"
FT                   /protein_id="BAF39208.1"
FT                   /translation="MTAATIAGHSNKSEYSKKNGYRKSSKTPWGNPIVYFFSLVLVAIC
FT                   ITPVLYIIFGGFRTNSQITNHPSGMPNPWVPDNYKTVFESDIFWTELKNSTIVGIATMV
FT                   GVVVLSIMVSFVIARYKFRYAPLMYALFSAGLMFPMTVGITPLYLLIRNLGLANSLWGL
FT                   ILPQIAFGLPQTIIILVPFLQSIPNELEEACLLDGCSRLGFFWRMVIPLSMPGVATTGI
FT                   LTFVGSWNAYMLPLFVLSDANKYTLPLGVQMFSSEHSVDTAQVLAFTSLAMIPALICFT
FT                   IFQKKIVGGLTGAVKG"
FT   CDS_pept        538107..539738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xynB"
FT                   /locus_tag="BAD_0428"
FT                   /product="beta-1,4-xylosidase"
FT                   /note="Orthologue of L0234"
FT                   /note="intracellular xylan-degrading enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39209"
FT                   /db_xref="GOA:A1A0H6"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H6"
FT                   /protein_id="BAF39209.1"
FT                   /translation="MKISNPVLTGFHADPSMIRVGDTYYIANSTFEWFPGVRLHESKDL
FT                   VHWNILPSPLSRSSQLDMRGNPSSGGIWAPDLSYADNKFWLIYTDVKVVNGAFKDCTNY
FT                   LVTAEDIHGPWSEPVRINGVGFDASLFHDDDGRKYLVQQTWDFREYHHQFDGITLTEFD
FT                   VDTMKLKPETARTIWDGTSVKITEGPHLYKKDGWYYLFAAEGGTVYEHQESVARSRTLD
FT                   EYSFEVMPNGPFIGNFDTPDTYLQKQGHGALVDTPSGEWYYASLCGRPWRHDTEPAHGT
FT                   RGWCTLGRETSIQKVEWDEDGWPRVVGGHGGQRYVDAPKDAIETLAPTTRDEHDEFDSG
FT                   ELGPNWNTLRVPFTDAMGTVGGGKLALRGQGSLCNLFDLSLVARRWQAFDFDAETKVRF
FT                   DPKNYMQMAGLTNYYDDLCWSWAFVTWDEKRHARVIEVAQNDFNQYTSFLKDDAIVVPE
FT                   DAEAVWLRTKVRTEYYSYEYSFDGEHFTEIPVKLDAKILSDDYVNQRYGGFFTGAFVGL
FT                   ACVDLSGYGAQAEFDYFDYRELSDNQ"
FT   CDS_pept        539792..541771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0429"
FT                   /product="putative secreted protein"
FT                   /note="Orthologue of XCV4334"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39210"
FT                   /db_xref="GOA:A1A0H7"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR039329"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H7"
FT                   /protein_id="BAF39210.1"
FT                   /translation="MKSMGNEERTSMVLRLPKLLDDGCVLQAGATIHIWGTGDPGRGVL
FT                   VRLDGKDRTTRVGDDGSWSVSYGPITAGGPYDLTVRYEDGTECISRQCYAGEVFLCSGQ
FT                   SNMELPMAWVRADYPLEWDREPDPLLRQYKAIPDCDFNGPRSDHDHAFWQGCDAETLGD
FT                   FSALAYFFGRRIRRWLNVPVGLLNVSLGGSPIESWMDADALRAFPEALADLEPYLGDGV
FT                   ASKKSRDSVAERDRWYQALGYEAVADAHHEWLPLIAWDCPESKNIEPRDVAWHDIRLPG
FT                   WYKDRGLAGFRGEITMRKTVFLPPSDAGKPALLRLGTMNDADHTWVNGVLVGGRSNVYE
FT                   PRDYPVAAGVLRAGANEIRMRLVVERPGGRVTPGKRMTLTIGDDIFDLSGIWQYAVTAE
FT                   ADRDCPFEDFVRWKPTGLYNAMLAPCFPYAVRAVLWYQGESNTGDRAMQYGDELKAMIQ
FT                   LWRVKWHQPDMPFLIVQLPKFDIDAIEDGGWPLIREQEWRVADELEHVAAVVTLDAGES
FT                   NDLHPHDKKTIADRAFNVAMDFVYGQQAQPQPVVETAEADDGLLRMHCVWRNSMGEQMQ
FT                   SQNRHLMTLDGDVPREIDFLWHDCATSVRAEAWLDGCDIVARIPSRMPDEVRYAWSNSP
FT                   ESGLICDGDGVLLPPFHLPLPMVD"
FT   CDS_pept        541811..543211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0430"
FT                   /product="putative esterase"
FT                   /note="Orthologue of bll4001"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39211"
FT                   /db_xref="GOA:A1A0H8"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H8"
FT                   /protein_id="BAF39211.1"
FT                   /translation="MSGFSDADPVITVFRGIPYAKPPVDELRWREPQPAEAWDGVLEAG
FT                   DFAPMPMQPLPGSDEFYGREWQIDADTPMAEDCLYLNIWTPALRGCGSGSEIRTDSRCD
FT                   GHGLPVMVWLYGGAFQTGSTCEKEFNGEQLARQGVVVVSIAYRLNVFGFFAHAMLEKEA
FT                   VDGRPCANFGFLDQRMGIQWVKDNIALFGGDPANITVFGQSAGAASALAQSVSPMNDGL
FT                   FQRVIMQSGGGTGLFNRHLWSLEDAQRNGARFLKYLEVESIAEARSVPATDLLEAAVTF
FT                   PACDWSGQGDDVVWAPMTNWIPCVDGTFLVEQYRDALIAGHRVPCDLLVGNTTGEFMVP
FT                   GPDGTPYPEGECGNLDMIDAWVSGGGSEPYRYRFDVDMPGDDAGAFHSSDLWFSFGTLP
FT                   ASWRPFRGWHYDLSHAMNRYWVNFAATGDPNGSGLPEWTACGPDGQRYMLFGGCHDTPG
FT                   NVSCVMVK"
FT   CDS_pept        543244..543903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0431"
FT                   /product="maltose O-acetyltransferase"
FT                   /note="Orthologue of Tfu_1260"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39212"
FT                   /db_xref="GOA:A1A0H9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H9"
FT                   /protein_id="BAF39212.1"
FT                   /translation="MRWNVMKETDMTQETEALIASDEDLTKLFAGKPTQYRKSKSLPKF
FT                   TGEAMRACAKINRIFFDDPDEAYRLFHELVPDAGEGVQFTPPFNVDYGIGLTIGRGTFL
FT                   NKDFMVCGGGYVTLGEDCLIGPRCTIATPNHAKDAATRLAGWEHASAVTIGDNVWFGAN
FT                   VTVTPGVTIGSNSIIGAGSVVTRDIPENVIAVGNPAHVIREIPEHDPAFADVEGLL"
FT   CDS_pept        complement(544106..545626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="BAD_0432"
FT                   /product="xylulose kinase"
FT                   /note="COG family: sugar (pentuloseand hexulose) kinases"
FT                   /note="Orthologue of BL1709"
FT                   /note="PFAM_ID: FGGY"
FT                   /note="Xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39213"
FT                   /db_xref="GOA:A1A0I0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="PDB:3I8B"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I0"
FT                   /protein_id="BAF39213.1"
FT                   /translation="MARTLVAGVDTSTQSCKVRVTDAETGELVRFGQAKHPNGTSVDPS
FT                   YWWSAFQEAAEQAGGLDDVSALAVGGQQHGMVILDNQGNVIRDAMLWNDTSSAPQAAAL
FT                   IEKLGAAPAQDGEPEDPIARGKQRWVKAVGSSPVASYTLTKVAWVAENEPENVKKIAAI
FT                   CLPHDWLSWRIAGYGPVAEGEDAHLEALFTDRSDASGTIYYDAASNEYRRDLIAMVLEA
FT                   AEGAKAAQSHAEAIVLPTVLGPRDAAPVKADPAIAGKNVEGGCLLAPGGGDNAMASLGL
FT                   GMAVGDVSISLGTSGVAAAISENPTYDLTGAVSGFADCTGHYLPLACTINGSRILDAGR
FT                   AALGVDYDELAKLAFASKPGANGITLVPYFDGERTPNRPNATATFSGMTLANTTRENLA
FT                   RAFVEGLLCSQRDCLELIRSLGASITRILLIGGGAKSEAIRTLAPSILGMDVTRPATDE
FT                   YVAIGAARQAAWVLSGETEPPAWQLTIDGVETGEPTEAVYEAYAKARG"
FT   CDS_pept        545796..547028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0433"
FT                   /product="possible XylR-type repressor"
FT                   /note="COG family: transcriptional regulators"
FT                   /note="Orthologue of BL1710"
FT                   /note="PFAM_ID:ROK"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39214"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I1"
FT                   /protein_id="BAF39214.1"
FT                   /translation="MVSLRRINQDDLRNHNLSVVIDTLLRASGPMSRADLAKETGLTKA
FT                   TMSLLVSLLIDAGVVKEGEPQNSASYGRPSTPLMLGGGKVCGIGMQVNTDGYGCMALDI
FT                   NHDILRHEWVDADMSGVEPDVVFGKLDAMAKAMAEDLESKRCIIAGVSCALPGLVTSDK
FT                   RLLMARNLGWENVDLTTFDVMRGYDVTPCNEAKLAAIAQIPGYACARADVFDGVDCADS
FT                   FLYLSCDIGIGGAIVRDGEIVSGSHGFAGEIGHVSVSLDGPLCGCGRRGCLETYAGRRA
FT                   LVEASGVAEKNAASSGEALERLLDAWHSHDVRTVEAVGRAIDALASAIGSALNLVDVDT
FT                   VLLGGWWTDFGPFFYETLENRLESQVLGASDMQVSVSIPLVADHPALYGAAEVGLRKFI
FT                   DNPLTFITDKA"
FT   CDS_pept        547317..547709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggtA"
FT                   /locus_tag="BAD_0434"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /note="Orthologue of MAP0607c"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39215"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I2"
FT                   /protein_id="BAF39215.1"
FT                   /translation="MQRCDVFGEQRHDHGGDDQKDQRYVGGVGIPRLPERQAEEDGGGE
FT                   DGDEHPGRKSLFELAFEPFEILAYQIDVVMLVIGEHRAVQGGAGRADGDARNQGDQVDE
FT                   IQRGEARQRVHELPERGVGVEFHDPP"
FT   CDS_pept        548255..549241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0435"
FT                   /product="beta-galactosidase"
FT                   /note="Orthologue of BH3701"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39216"
FT                   /db_xref="GOA:A1A0I3"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I3"
FT                   /protein_id="BAF39216.1"
FT                   /translation="MKQSIGGCERFHGAVIAHDGTEQSRVFKETAALGGELDRIGKRIM
FT                   GSEIRAKVAIMFDWQSYWSLEGCVGPTAGFSYPNEVHRFYRAFWRRNVPVDIIESTTPL
FT                   DKLKQYDLVVAPALITVLPGVAETLESYVSEGGSFITGYMAGIHDEHDLVVPGGYPGKL
FT                   RDLMGVWVEEIDALAPDETIEVHGDAVDAKGEIVASIIHREGARRLAAYGGGEFYAGHS
FT                   ALTVNTYGKGKAYFVGTLLDETGMSAFMAPIIKELGLKPLDTPEDVSLSVRYGDDGVRY
FT                   AFLINNSESDKRLCLDELDGGVELLTGHVVDGPVGLKPYGVNVIELG"
FT   CDS_pept        549364..550275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0436"
FT                   /product="transcriptional regulator"
FT                   /note="Glucose kinase"
FT                   /note="Orthologue of LBA1367"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39217"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I4"
FT                   /protein_id="BAF39217.1"
FT                   /translation="MTAKRRILAFEIGTFFTRYVVFEDGRMGIPGTVATPVDSVESFYQ
FT                   ALAHIVNGQRAPLDGIAMSVPGFIDVSKQVAVTAGALGMLYKHEIGKELQEYLDKPVPT
FT                   WMENDANCAAMAEKLSGNAVKLDDFALITIDTGIGGALFLGGGIRRGKDWRAGELGMMI
FT                   PNYETGGFNTMQNYLSTIVLAEDYAKEFDVPTGSIVPATLFRRLDEPRVRKIVDKWIDY
FT                   LAIAIFNTAAATDPECILLGGGICREQQLLPMVNAALDRIPQWGDFRTSVKRCRHTNNA
FT                   GLIGAYYAFETEVGGLTDVPIR"
FT   CDS_pept        complement(550253..551059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0437"
FT                   /product="possible TetR-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulator"
FT                   /note="Orthologue of BL1756"
FT                   /note="PFAM_ID:tetR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39218"
FT                   /db_xref="GOA:A1A0I5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I5"
FT                   /protein_id="BAF39218.1"
FT                   /translation="MSVAAWDRFLQEQDSWPAASRANTSTPYGTQARNALAGKTFEKKK
FT                   RMSQEERHLQILQAAVKIIATKGFWGMSLQDIADEIGITEAALYHYISSKDDLLNMVLS
FT                   ECYDTPDADEYNAVTAAVTDNDGHRVYFYPRYCLNIALYNLQRPELVQLYSVLNGEALS
FT                   PTHPAHNFFIGRHMRNWEMICSMNWILPTGVDEERFYDLYTLAMSAMDGLQYRWLGDDS
FT                   MNLLEEWMSISDIIFPPSEWAGFTDPSEYDPAPDRCLLPFTLSARQ"
FT   CDS_pept        complement(551156..551989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0438"
FT                   /product="possible xylan esterase"
FT                   /note="COG family: esterase_lipase"
FT                   /note="Orthologue of BL0682"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39219"
FT                   /db_xref="GOA:A1A0I6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I6"
FT                   /protein_id="BAF39219.1"
FT                   /translation="MPCNISYFEHKIPGIDDSTATFVGYCLDNSKEIDPDRRRPSVLVI
FT                   PGGGYEMTSDREAEPIAMQFLAAGFNAFVLRYSVKPSVFPVALLEAAEAVRRMRAHAAE
FT                   WHVDGDRIAVIGFSAGGHLAANLATSASDDVLAAHGYDPDAVRPNALMLAYPVITSGPL
FT                   AHRGSFDALLGDRKADAEALEPVSIEKHIDAKTPPVFVWHTVPDDCVPYENTLMLIDAC
FT                   KKAGVSIEAHLFPSGGHGLALGTAETAWQGVNGIEECVQAWPKLAVAWMRRTLAQ"
FT   CDS_pept        complement(552313..552897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0439"
FT                   /product="cellobiose-phosphorylase"
FT                   /note="Orthologue of TM1848"
FT                   /note="Similar to GP:3184120 percent identity:
FT                   97.66;identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39220"
FT                   /db_xref="GOA:A1A0I7"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I7"
FT                   /protein_id="BAF39220.1"
FT                   /translation="MRYGHFDDAAKEYVIETPATPLPWINYLGNEDFFSLISNTGGGYS
FT                   FYKDAKLRRITRYRYNNVPADNGSRCYYLSLMDSDSADAKPVETWSPTFLPCKTPLDSC
FT                   KCRQGIGYTVFEASKRGIESKLTAFVPLHTNAEINRLDVTNTTDEPAVIDVTGSVEWCL
FT                   WNAVDDSSNFQRNLSTGEVEIGLATVCWTVS"
FT   tRNA            553096..553169
FT                   /gene="ileT"
FT                   /locus_tag="BAD_t0024"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:553131..553133,aa:Ile,seq:ata)"
FT                   /note="codon recognized:TAT"
FT   CDS_pept        553351..553563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="BAD_0440"
FT                   /product="50S ribosomal protein L31"
FT                   /note="COG family: ribosomal protein L31"
FT                   /note="Orthologue of BL1711"
FT                   /note="PFAM_ID:Ribosomal_L31"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39221"
FT                   /db_xref="GOA:A1A0I8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0I8"
FT                   /protein_id="BAF39221.1"
FT                   /translation="MKQGIHPDYHAVQVTCSCGNTFVTRSTYNGDHMTVDVCSNCHPFY
FT                   TGKQKILDTGGRVARFEKRYGKKAK"
FT   CDS_pept        553745..554833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="BAD_0441"
FT                   /product="peptide chain release factor 1"
FT                   /note="COG family: protein chain releasefactor A"
FT                   /note="Orthologue of BL1712"
FT                   /note="PFAM_ID: RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39222"
FT                   /db_xref="GOA:A1A0I9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0I9"
FT                   /protein_id="BAF39222.1"
FT                   /translation="MADEQFPAAVTALEEYHNIEQQMAEPEVASNPDKMRKLGRRHAEL
FT                   GAIVSAYTAYKQVKDDLEAAREMASEDPDFAEEAKRLEGELPAAEEKLRTALIPRDPDD
FT                   ARDTIMEIKAGTGGEEAALFAGDLLRMYMRYAEKRGWSVTVQSENTTELGGVKDVQLAI
FT                   RAKGTPAPEDGVWASLKYEGGVHRVQRIPVTESQGRIQTSAAGVIVFPEADEDDDEIEI
FT                   DPKDLKIDIFMSSGPGGQSVNTTYSAVRMTHIPTGITVNMQDEKSQIQNRAAALRVLKS
FT                   RLLAMKHEQEAAEAADMRHSQVRSLDRSERIRTYNFPENRIVDHRTNYKAYNLDAVLDG
FT                   DLQAVIDSDIQADEADRLANQK"
FT   CDS_pept        554843..555763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0442"
FT                   /product="possible methylase protein"
FT                   /note="COG family: predicted rRNA or tRNA methylase"
FT                   /note="Orthologue of BL1713"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39223"
FT                   /db_xref="GOA:A1A0J0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J0"
FT                   /protein_id="BAF39223.1"
FT                   /translation="MATVFETVRSAADELRAAGVDTPQHDAKLLLAEAFHTDLQHVDKA
FT                   MLMGDGVERLAEKEDAEPAMERFQTMLARRVKREPLQHITGHAPFRYLDLKVGPGVFIP
FT                   RPETELVVQEGVDWATRNGMYRAKVVDLCAGSGAIGLAFASEVPGSEVWAVEKSATTAE
FT                   WTWRNLDETAKRYPAIAGNYHLDIADATQMPTLSQLDGTIDIVLTNPPYVPLADIPEQS
FT                   EVRDYDPDLALYGGSADGTLIPERIIARAAKLLRAGGLMVMEHDITQGERLAAFARTCG
FT                   FVDVTVHNDYTGRPRYLTAEKQPAQ"
FT   CDS_pept        555904..557205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0443"
FT                   /product="solute binding protein of ABC transporter for
FT                   branched-chain amino acids"
FT                   /note="COG family: ABC-type branched-chain amino
FT                   acidtransport systems_ periplasmic component"
FT                   /note="Orthologue of BL1714"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39224"
FT                   /db_xref="GOA:A1A0J1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J1"
FT                   /protein_id="BAF39224.1"
FT                   /translation="MVAVVPRTGVEMNMIFSKVRVERNVQRFQEKRKNGMNAKFSAKCV
FT                   ALIAAGAMSMSLAACSGGSMDDSSSSNGSAANSDTITLGSVTTNSGTAAAYGEAEVAGF
FT                   KLAVDEINAKGGINGKKVKLESMDDKGDATEASNAFNKLAGDNSVLGVVGPTISSTTAA
FT                   VAPLADQSKLPAIAPAATSDSIETGGYMFRTCFKDSYQGEIAAKFAAETLKVKKVAVLY
FT                   GTGDPYSSGVGKAFAAAAKKAGLDVVAEENSSSADDTEYSSQLQKIQAAGAEFLYAPYY
FT                   YSVAGPYIIPQARSVGYKGYVMGPDGYDGLKMTDDKSLYNKVLYTTHYSPDDTSNAKVQ
FT                   DFIKSYKKANKNADPNTFTALGYDSVYMMKQAIEKAGKNATREGVRNAIAGMSFEGVTG
FT                   NFTLDKKGSPKKSVVVLELKDGKPQYKTTIQPAK"
FT   CDS_pept        557338..558306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0444"
FT                   /product="permease of ABC transporter for branched-chain
FT                   amino acids"
FT                   /note="COG family: branched-chain amino acid
FT                   ABC-typetransport system_ permease components"
FT                   /note="Orthologue of BL1715"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39225"
FT                   /db_xref="GOA:A1A0J2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J2"
FT                   /protein_id="BAF39225.1"
FT                   /translation="MSKVRHHQLLKGGMMGDQIIMFISQIFNGLKIGSVYSLVALGYTM
FT                   VYGIIRLINFAHGDFIMVGSYVLMLTIPAIVAFGLPAWVAVIPAILMCVAVGVIVERAA
FT                   YKPVREKGNSMTALITAIAMSLLLENGSQAIFGADYQTVPTIIQIPTLAIGKLKIDGAT
FT                   IITIVLGVIIMVALQLFVTYTKQGKAMRAVSEDKEASILMGINVNSTITLTFAIGSGLA
FT                   AVASLMYCVSYPQVSPMMGAMLGLKAFVAAVLGGIGSIPGAMVGGLVIGVVESLTKAYI
FT                   GTITSGVITSAFSDAIVFGILIIVLLVKPSGLMGEPETEKV"
FT   CDS_pept        558311..559432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0445"
FT                   /product="permease of ABC transporter for branched-chain
FT                   amino acids"
FT                   /note="COG family: branched-chain amino acid
FT                   ABC-typetransport system_ permease components"
FT                   /note="Orthologue of BL1716"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39226"
FT                   /db_xref="GOA:A1A0J3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J3"
FT                   /protein_id="BAF39226.1"
FT                   /translation="MKKSMLSTKQSYLMCAVGIVVLFGILMGVCESGMASTYIKGIMMT
FT                   SCIAIIMTTSLNLTIGVLGQLTLGCCGFEAIGAYSAALLSKLLVANGVAMDPTLRFLLT
FT                   TLAGGVVACIFGILVGIPALRLHGDYLAIITLGFGEIIRVIIQNLKVAGGMGLDKGAAG
FT                   QALIGIDRLANLYVVFWITVVTVVLLFMFARSRYGRAVKAIRDDEIAASASGINITYMK
FT                   VLVFAISAFFAGIAGGIFAQYIGSLNPAMAGWLQSINYVIMVVFGGMGSLTGSIVSAIA
FT                   LTILPELLRAFSTYRMLVYSVALVLIMIFRPQGIFGNWEFSLTKTINKLFYPMKVKAHG
FT                   KSKQAESTAKAAKDTAKTDETVETAADTKEAQA"
FT   CDS_pept        559429..560241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0446"
FT                   /product="ATP binding protein of ABC transporter for
FT                   branched-chain amino acids"
FT                   /note="COG family: ABC-type branched-chain amino
FT                   acidtransport systems_ ATPase component"
FT                   /note="Orthologue of BL1717"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39227"
FT                   /db_xref="GOA:A1A0J4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J4"
FT                   /protein_id="BAF39227.1"
FT                   /translation="MSEPILKAEHLGITFGGLKAVSDFNMTINSGELVGLIGPNGAGKT
FT                   TVFNLLTGVYQPTEGEFFLDGERMNGKKTYQVVRAGIARTFQNIRLFGQMTVEENVLVA
FT                   FNESFSYHMGGAIFRTPKFWKQEREMHAKAIDLLKIFGLEGLAETEAANLPYGAQRKLE
FT                   IARALATGMKLLLLDEPAAGMNPTETEDLLNCINTIRDRFGIAILLIEHDMSLVMNVCQ
FT                   RIQVLDYGRTIAAGTPDEIANNPQVISAYLGSDDDTDSDDAKHESEEA"
FT   CDS_pept        560241..560945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0447"
FT                   /product="ATP binding protein of ABC transporter for
FT                   branched-chain amino acids"
FT                   /note="COG family: ABC-type branched-chain amino
FT                   acidtransport systems_ ATPase component"
FT                   /note="Orthologue of BL1718"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39228"
FT                   /db_xref="GOA:A1A0J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J5"
FT                   /protein_id="BAF39228.1"
FT                   /translation="MLEVKNLSVSYGAIEAVKDISFTVNDGEIVSLIGANGAGKTTTLH
FT                   TITGLVPAKSGSVMYNGVDLLKTHNNKIVTLGMAHIPEGRHVFTRMSVEENLEMGAFSL
FT                   KDQSDLKKDLDMVYGLFPRLKERRNQKAGTLSGGEQQMLAMGRALMSHPKTILMDEPSM
FT                   GLSPKLVKEIFSIIRKLHEQGITILLVEQNAKMALSIADRAYVLETGRITMEGDAKELL
FT                   NNEQVRKAYLGA"
FT   CDS_pept        561103..561765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0448"
FT                   /product="conserved protein in the Sua5/YciO/YrdC family"
FT                   /note="COG family: putative translation factor (Sua5)"
FT                   /note="Orthologue of BL1720"
FT                   /note="PFAM_ID: Sua5_yciO_yrdC"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39229"
FT                   /db_xref="GOA:A1A0J6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J6"
FT                   /protein_id="BAF39229.1"
FT                   /translation="MSEICTVNDESLARAVEIIHDGGLVVIPTDTVYGVACDPRNIEAI
FT                   RKVFAAKQRPKYKSLQVLLPSIESMEKLHLTLPVPLNRLAAMFMPGAFSPIAEAEDDCS
FT                   LATLRHDPTTGKATQGVRIPNSAVALRILRATGPLAATSANRSGEESAQTVQEAADALG
FT                   DAVDLYLDGGATPGHVSSTVVAADPHERDGIAILREGVIRELVIRKALTLNGGALGA"
FT   CDS_pept        561762..562940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /locus_tag="BAD_0449"
FT                   /product="possible undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminyltransferase"
FT                   /note="COG family: UDP-N-acetylmuramyl
FT                   pentapeptidephosphotransferase_UDP-N-acetylglucosamine-1-
FT                   phosphatetransferase"
FT                   /note="Orthologue of BL1721"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39230"
FT                   /db_xref="GOA:A1A0J7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J7"
FT                   /protein_id="BAF39230.1"
FT                   /translation="MRIYLFIAAVAGGVTYLLTPLIRHIAIEIGAVGEVRARDVHTVPT
FT                   PRMGGLGMLIGFTVAMLFASRIPFIEGLFAQSHQAWVILAGAIMISLLGMADDLWDLDW
FT                   MLKLAGQLLISVFVAWGGLQIISLPLGSLVTASPSLSMAITAFLIVASINAVNFVDGLD
FT                   GLASGIVAIGGIAFAIYSYIIARSSPSYASMATLIDIAMVGMCVGFILHNWHPAKLFMG
FT                   DSGSMLLGYLITCASIVMTGRLDPASIHTSIYLPVFMPILLPMLVLFLPILDMCLAIVR
FT                   RLSKGQSPMHPDRMHLHHRMLRIGHTVQGAVLILWGWASLIAFGSIMILFFKAQYVLIG
FT                   FLIASALLTVATMYPYLKHRIPEIREENAISGTDAQHASVGRARGDKTRGGR"
FT   CDS_pept        563078..564622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BAD_0450"
FT                   /product="Inosine-5'-monophosphate dehydrogenase"
FT                   /note="Identified by sequence similarity"
FT                   /note="Orthologue of Lxx19860_BL1722"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39231"
FT                   /db_xref="GOA:A1A0J8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J8"
FT                   /protein_id="BAF39231.1"
FT                   /translation="MATIPDMNADSTFAPLPPIFAQLGLAYDDVLLLPNETDVIPSEVD
FT                   TTTHLTRNITMKVPAISAAMDTVTESDMAIAMARNGGIGVLHRNLSIDDQAAQVDIVKR
FT                   SESGMINDPLTVSPDVTLADLDKLCGRFHISGLPVVDKDSKLVGIITNRDMRFIASEDY
FT                   DRLKVSEVMTRENLITGPSDISKEDAHDLLAKHKVEKLPLVDSEGHLTGLITVKDFVKT
FT                   EQYPDATKDEQGRLRVAAGIGFLGDAYNRASALMEAGVDVLVVDTANGEAKLALDMIRR
FT                   LKSDSAFNGVDIIGGNVATRQGAQAMIDAGVDAVKVGVGPGSICTTRVVAGVGVPQLTA
FT                   VYEAAQACRAAGVPCIADGGIHYSGDIAKALVAGASSVMLGGTLAGCEEAPGEKVLLHG
FT                   KQYKLYRGMGSLGAMAPRGKKSYSKDRYFQADVTSNDKVVPEGVEGEVPYRGPLNAVLY
FT                   QMIGGLHQSMFYIGAHNISEMPERGRFIRITDAGLRESHPHDIVMTAEAPNYSGRQ"
FT   CDS_pept        complement(564786..565820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0451"
FT                   /product="probable LacI-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulators"
FT                   /note="Orthologue of BL0528"
FT                   /note="PFAM_ID:lacI"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39232"
FT                   /db_xref="GOA:A1A0J9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0J9"
FT                   /protein_id="BAF39232.1"
FT                   /translation="MPRTTIADVAQAAGVSVSTVSRALRGLDRVSPETRERIEQEAKRL
FT                   HFSFSKSASSLASGKTMRVAVLLPNEISSWFNAHAFEGIYEVMSKAGYDIVPYIVWTQD
FT                   DLDAFFQNLPGNRNVDAVIEASFDFDEAKKQVLGNLTIPVVGMNAPSTHGLDAGVAIDD
FT                   EASMATIVRFLKSLGHKTLAYIEQPINTTPFVCSDRLRKKGFSEASQACGYADEDIIVM
FT                   PSLSHIDARSEQDIYSGIVAQLLSAPKQPTAICVSVDAVAAPLLKELRRMGWRVPQDVS
FT                   LVGFDDDDTATALDLTTMHQDPAEIGRIAARKTLALLNGETLDEPFTVMPTSLVLRGTT
FT                   ERVS"
FT   CDS_pept        566137..567909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aglA"
FT                   /locus_tag="BAD_0452"
FT                   /product="probable alpha-1,4-glucosidase"
FT                   /note="COG family: glycosidases"
FT                   /note="Maltase-like enzyme"
FT                   /note="Orthologue of BL0529"
FT                   /note="PFAM_ID:alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39233"
FT                   /db_xref="GOA:A1A0K0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K0"
FT                   /protein_id="BAF39233.1"
FT                   /translation="MKGDNMTEVNDPSLWWKQAVVYQVYPRSFKDSRGEGLGQIAGVTE
FT                   KIGYLKELGVDAIWLSPFYPSQLADGGYDVDDYRNVDPKLGTMDDFDALAKAAHADGIK
FT                   IVVDIVPNHSSNLHEWFKAALAAKPGSPERDRYIFRDGKGPNGDEPPTNWQNHFGGPAW
FT                   TRVPDGQWYLHMFTKEQPDWNWKNEDVRADFIKTLRFWLDHGADGFRVDVAHGLAKDLD
FT                   RDDLDDYVVWCTNDQPEDGSHPVIDRDEVHDIYHEWRKVFNEYDPPAFAVAEAWVRPSR
FT                   QHLYASPDDLGQIFNFEFAKKDWIRDDMHLAIEEGLESAERSGSTATWVMSNHDVVRHA
FT                   TRYALPQVPTGEYHRLPLDWLLRDGTTYREDRALGTKRARAAIMMEMALPGSAYVYQGE
FT                   ELGLFEVADIPWDELEDPSAWRTSRSASTKGRDGCRVPLPWVAADAPQLDDPNDEFGHG
FT                   GSFGFSPADAKAEPHLPQPKWYKDFAVDVESADPDSMLNLYRRVLALRHELQTTDLSLE
FT                   WLPEDQPGKAHDGANGFPGGTIAYRRANGWASITNFGEEPITLPQGEVLLTSGPLTDDG
FT                   KLPQDTSAWLKLAD"
FT   CDS_pept        568148..568801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="BAD_0453"
FT                   /product="oligoribonuclease"
FT                   /note="3' to 5' exoribonuclease specific for
FT                   smalloligoribonuclotides"
FT                   /note="Orthologue of BL1723"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39234"
FT                   /db_xref="GOA:A1A0K1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K1"
FT                   /protein_id="BAF39234.1"
FT                   /translation="MVDAHDGETYTSEGSRLIWIDCEMTGLDIFGGDELVEVSVVPTDF
FT                   DLNVLDEGVDYVIKPSQKAVDHMNDFVRAMHTRSGLINEWEHGLSLDEAQAKVIEYVRK
FT                   FTPAGVKPLLAGNTIGSDKKFLDHYMPELMENLHYRTIDVSTFKELARRWYPAVYLNRP
FT                   PKNGGHRALADIIESLDELRYYRKAFMAPVPGPSEAEAKAIASEIQETSLLNKD"
FT   CDS_pept        568829..569728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0454"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of SAV4444"
FT                   /note="PF00702: haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39235"
FT                   /db_xref="GOA:A1A0K2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K2"
FT                   /protein_id="BAF39235.1"
FT                   /translation="MTAADWTTIGQPQDIRLVVADMDGTLLDERSRIPDGFWPMLARLK
FT                   RRGVEFVPASGRQYATLRNMFADKAAEILDGGELSYIAENGNVVALDGKVVEVHGVDLD
FT                   VTSHVIDLVDDAAASGEHNVGLVVCGLKSAYVQRSDKPFLDEVGKYYAALSIVDDLHEV
FT                   LDFAQEPSAYTPDGDAEIVLKLAILDLDGSERFTNEKLTHLRADYQVVVSGKLWVDIMN
FT                   IETDKKQGVEALQRVLGVTPAQTAVFGDYLNDLLMLEAGDWSFAMGNAHPDLKAAARYI
FT                   APSNVEHGVLKVVDRLVA"
FT   CDS_pept        569773..571185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0455"
FT                   /product="possible helicase"
FT                   /note="COG family: ATP-dependent exoDNase (exonuclease
FT                   V)_alpha subunit - helicase superfamily I member"
FT                   /note="Orthologue of BL1724"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39236"
FT                   /db_xref="GOA:A1A0K3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K3"
FT                   /protein_id="BAF39236.1"
FT                   /translation="MRQSEALAILGSGASVFLTGAPGAGKTYVLNEFIRQARADGASVA
FT                   VTASTGIAATHINGTTIHSWSGIGLATALTDNLVKTVRTRRKRKLQEADILIIDEVSML
FT                   HAWLFDMVDRICRIIRRDERPFGGLQVVLSGDFFQLPPVSVSGRNNDLIAPSAEYLASR
FT                   ERYMRAGLNPEGFVTESLVWRELNPVVCYLTEQHRQDDGQLLNVLTDIREGAVDDGDRN
FT                   VLLTRLGAIPEPGQQAVNLFPVNRQADALNDLRLFEIKEEPHEYLAESEGAANLVERLK
FT                   KNMLAPERLYLKTGAAVMAVRNDTDHQYVNGSLGTVRGFTTQSQGGWPIVEFENGNIVT
FT                   MKPNSWQMQDGDTVLATVKQVPLRCAWAITIHKSQGMTLDRAVMDLRRTFAPGMGYVAL
FT                   SRVEGLDGLYLQGVNERMFLVSPDAVRLDGQLRLESAQAVDTLASDGVGAFRARMPQPA
FT                   GEDDEFAQDVLF"
FT   CDS_pept        571767..573584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="BAD_0456"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="Catalyzes the formation of prolyl-tRNA(Pro)
FT                   fromproline and tRNA(Pro)"
FT                   /note="Orthologue of Lxx12210_BL1728_Rv2845c"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39237"
FT                   /db_xref="GOA:A1A0K4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0K4"
FT                   /protein_id="BAF39237.1"
FT                   /translation="MSTMFLRTLREDPADADVVSDKLLQRACYLRKAAPGIWTWLPLGL
FT                   NVLNKIENIIREEMASIDAQEVHFSGLLPREPYEATHRWEEYGDNIFRLKDRHEADYLL
FT                   APTHEEMFTLLVKDLYSSYKDLPVTLYQIQTKYRDEFRPRAGLIRGREFIMKDAYSFTL
FT                   DKEGLVKAYMDERGAYERIFNRLDLKYVPVHAMAGPMGGFESEEFLAPMEIGEDTFAQS
FT                   PSGKAWNVEALTTPEPEAIDFTATPAAEKRPTPDAATIDKMVEFANANHPRSDGRDWQA
FT                   SDILKNVVIAVMHPQDEDHDEPWRELVVVGVPGDRTVDMKRLEAQFTPAEIEEATDEDL
FT                   KKHPELVKGYIGPMALGPQARDGKKAENASETGDALRYLIDAHVARGSAWFTGADEQDV
FT                   DYYDLVYGRDFEADGTVEAVQVRHGDMSPDGSGPLSFERGVEIGQVFQLGLKYSNALGL
FT                   KVLDQNGKTVPVWMGSYGIGVSRVMACIAETHHDEKGLAWPAVIAPAQVHVVATGKDAA
FT                   AFEAAEQLIGELEAKGIEVIFDDRKKVSPGVKFKDAELIGVPIIAVAGRDTVNNGTIEV
FT                   RDRNGENAEAVPVADAAQAIADRVAALLK"
FT   CDS_pept        573978..574556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0457"
FT                   /product="hypothetical protein"
FT                   /note="COG family: single-stranded DNA-binding protein"
FT                   /note="Orthologue of BL1729"
FT                   /note="PFAM_ID: SSB"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39238"
FT                   /db_xref="GOA:A1A0K5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K5"
FT                   /protein_id="BAF39238.1"
FT                   /translation="MAQQQGLLTITGYVGGQPTQFNREGMPHASSFRLASTRHYFDGRT
FT                   QQWKDLPTTWITVKAYRGLSESICQSFKKGEPVIVTGVLAAESWVDQNGKQQSKLVMEA
FT                   NAAGHDLSYGVSTFRKLAKKNDSGQQDAQPGQALGRDPYVQAAQQRGETSVNAMDGQSS
FT                   GVDEQGGSQAGTDSNAAEPLREEFGGDGF"
FT   CDS_pept        complement(574595..576685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepO"
FT                   /locus_tag="BAD_0458"
FT                   /product="belongs to peptidase family M13"
FT                   /note="COG family: predictedmetalloendopeptidase"
FT                   /note="Orthologue of BL1730"
FT                   /note="PFAM_ID: Peptidase_M13"
FT                   /note="Zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39239"
FT                   /db_xref="GOA:A1A0K6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K6"
FT                   /protein_id="BAF39239.1"
FT                   /translation="MNNTSNSLVSGIDPASFSAVTGPSQDLFRFVNGPWVDMYRLPDDR
FT                   SRYGSFDKLAEDAENQIRDILEEDDCPAVKSRALYHSFLDVDAIDAAGLAAIEDQLASI
FT                   DEAEDKAALTRALGAMNPTGGPDLIGIAVYGDPGAPETNVVHIEQDGLDLPDEAYYRED
FT                   HYAPIREAYVEMVAKQLKNAHLAADDEDAHAQAKRFLDVETRIAANHWDNVSTRDSVKT
FT                   YNPTDYADLCAMLADVDLDAWIDAWQNAYDATTAAAVQPLDFRGCFSHTIVHEPSFLTG
FT                   LNAFWKEASLDDLKLWARVHVVIGSTLELPHEFDETNFDFYGKTLSGQKEQRVRWKRGV
FT                   SLVNGICGEDVGREYVKRHFPETSKQRMEQLVGNLIDAYRVSISNSTWLGDETKAKALE
FT                   KLSKFVPKIGYTNHWRDYSALDVREDAGFVQNMRAANLYETGYQLAKVGKAVDKDEWLM
FT                   NPQTVNAYYEPSMNVIVFPAAILQPPFFNPDAEDAANYGGIGAVIGHEIGHGFDDQGSQ
FT                   YDGDGKLNDWWTEEDKANFKALTQKLIDQYNEFVPTQLAEKYSDDPSKAPHVNGALTIG
FT                   ENIGDLSGVNIALKAYAFALDEAAGRGKDGSTEAIEAALADAPEIDGFTGLQRFFLSYA
FT                   SIWRTKNRDELAEQYLQIDPHSPAECRTNGIARNVDLFHKAFGVQPGDGMWLAPEQRVR
FT                   IW"
FT   CDS_pept        576816..577589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BAD_0459"
FT                   /product="methionine aminopeptidase"
FT                   /note="COG family: methionineaminopeptidase"
FT                   /note="Orthologue of BL1732"
FT                   /note="PFAM_ID: Peptidase_M24"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39240"
FT                   /db_xref="GOA:A1A0K7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K7"
FT                   /protein_id="BAF39240.1"
FT                   /translation="MIELKTPKEIEAMKPAGRFVGGILRDLKEFTKVGTNLLEIDEFVH
FT                   KRIVDRKGASSCYVDYAPDFGTGPFAHYICTSVNDAVLHGVPYDYNLKDGDLVSLDLAI
FT                   NVDGWVADSAISFCVGTQHPDDLCLIKCTEEALAAGIEAAQPGNRLGDVSCAVGDVARE
FT                   YGYPINLEFGGHGVGHIMHGDPHVPNDGKAHHGYKLRPGLVIAIEPWFLKTTDEIYQDP
FT                   KDGWTLKSEDGSRGAHSEHTIAITENGPVILTVRD"
FT   CDS_pept        577730..579025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA2"
FT                   /locus_tag="BAD_0460"
FT                   /product="citrate synthase 1"
FT                   /note="COG family: citrate synthase"
FT                   /note="Orthologue of BL1733"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39241"
FT                   /db_xref="GOA:A1A0K8"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K8"
FT                   /protein_id="BAF39241.1"
FT                   /translation="MATANLSVESKDFTLPVVEATAGADGIVVSTLRNDGWVTLDPGFL
FT                   TTAQCESKITYIDGKNSILRYRGYPIEQLCEQSDFLEVAWLLRHGELPNKDQYDRFISD
FT                   INHRTMVGEDFRTFMGSFPRTAHPMSVMASAVNALATFYPDTTDINDSDQLDEAATIIM
FT                   AKARTIVSYIFRRRRDEPMLYPDYSRGYVDDFLRMCFAVPYEPFESDPLYVHALGRLLI
FT                   IHADHEQNCSTSVVRIAGSAHANLYSAVAAGINALSGPLHGGANEAVLRQLKAIRDSGK
FT                   TVKEFVEDAKANGRRISGLGHRVYKSYDPRAAIAKTYLQKIMERTDTLKLPADERALFD
FT                   VATELEQIALSDDYFVSRHLYPNVDFYTGLIYRAIGFDPSMFTTLFALGRIPGWIAQYR
FT                   EMLADPNTKIGRPRQVYTGYTERDYVPMDQRH"
FT   CDS_pept        579167..580159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0461"
FT                   /product="hypothetical protein"
FT                   /note="COG family: tetrahydrodipicolinateN-
FT                   succinyltransferase"
FT                   /note="Orthologue of BL1734"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39242"
FT                   /db_xref="GOA:A1A0K9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR019875"
FT                   /db_xref="InterPro:IPR026586"
FT                   /db_xref="InterPro:IPR032784"
FT                   /db_xref="InterPro:IPR038361"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K9"
FT                   /protein_id="BAF39242.1"
FT                   /translation="MTEQRTAWGWGLASIDAAGNTLDVWYPELTLGEAPAETSRPNHNF
FT                   GAIAHDEADARGVRRMPVFTVSKLDEPIEDAADAYLRLHLLSMRLAKPNTLNLDGIFAK
FT                   LNNVVWTNYGPFAVDDFALRKLDVMAATRQSGAVLAPHVDVNVLSIDKFPRMVDYVVPT
FT                   GVRIGDADRVRLGAHLSEGTTVMHAGFVNFNAGTLGVSMVEGRVSQGVVVGNGSDIGGG
FT                   ASIMGTLSGGGKLKNSIGEHSLLGANAGIGISLGDNCVVEAGLYVTAGTKVTIYDKAKV
FT                   AAGEPLETVKGAELSGKDNILFIRNSVSGRIEARYRKTGIELNEKLHKN"
FT   CDS_pept        580167..580688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0462"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Acr"
FT                   /note="Orthologue of BL1253"
FT                   /note="PFAM_ID: DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39243"
FT                   /db_xref="GOA:A1A0L0"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0L0"
FT                   /protein_id="BAF39243.1"
FT                   /translation="MAESVIRALRKRKLVKITLITVGKVKEKYLRDAIAEYSKRLGRYC
FT                   KLGIVEVADEKTPEHASDGLERQIKAKEGERIAKHIRDDAFVIALAIEGKQLTSEQLAA
FT                   KINDLGLHGTSHIQLIIGGSLGLDPAILKRADYLLSFSKMTFPHQLMRVILLEQIYRAY
FT                   KINAGEPYHK"
FT   CDS_pept        581062..582192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="BAD_0463"
FT                   /product="peptide chain release factor 2"
FT                   /note="Directs the termination of translation in responseto
FT                   the peptide chain termination codons UGA and UAA"
FT                   /note="Orthologue of BL1184"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39244"
FT                   /db_xref="GOA:A1A0L1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L1"
FT                   /protein_id="BAF39244.1"
FT                   /translation="MAEFDYSEAISEARAKYESISKALDVDRLTAEAKDLEVKAAEPGL
FT                   WDDPENAQKVTSKLSAVQSQLKRLASADQRIEDVETLVELGQEEEDADTLAEAKAEVES
FT                   IQKDLDDMEIQTLLDGEYDERSAVVTIRSGAGGVDAADFAQMLLRMYLRWAERNGYKAK
FT                   VMDTSYAEEAGIKSATFQVDAPYAYGRLSVEGGTHRLVRISPFDNQGRRQTSFAAVEVV
FT                   PLVEATDHIDVPDSEIRVDTYCSSGPGGQGVNTTYSAVRITHIPTGIVVTMQDERSQIQ
FT                   NRAAAMAVLQSRLLVLRHEEEAKKKKELAGDIKASWGDQMRSYVLHPYQMVKDLRTGYE
FT                   TSQTQAVFDGDIDEFIEAGIRWRHEQRRAAAEEQEA"
FT   CDS_pept        582216..583454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="BAD_0464"
FT                   /product="FtsE-like ATP binding protein in cell division"
FT                   /note="COG family: predicted ATPase involved in
FT                   celldivision"
FT                   /note="Orthologue of BL1183"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39245"
FT                   /db_xref="GOA:A1A0L2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L2"
FT                   /protein_id="BAF39245.1"
FT                   /translation="MALISLEHVSKVYPKGTRPALDDISLDIDRGDFVFLVGASGSGKT
FT                   TLLSLLLREEEATDGEIRVAGNDLRRLSARQVPHYRRQIGFIFQDYKLLNNKTVWENVA
FT                   FALEVIGTSRSTIKSLVPKVLQTVGLTGKENNYPHELSGGEAQRVAIARAYVNHPQILL
FT                   ADEPTGNLDPTTSLGIMEVLDAINRTGTTIVMATHNEEIVNSMRKRVVELHTGKIVRDE
FT                   QQGSYDSALYFPDAEVESKSHQALGTSDPNAKYRRQNAIDSTNAPDDTVDVEGATRAET
FT                   VVNAVDVVAAAVHDGQGNDGIARLAKSVHSGRTGRYGEAFASVETTLTWGKGLSLEQMA
FT                   DQEQAEQTERNEQAKTSAENDASETGADEASALSAPPAPPVPPTQTEPPTPPEPPVPPA
FT                   PSDENPEDTKEHD"
FT   CDS_pept        583451..584377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="BAD_0465"
FT                   /product="FtsX-like protein in cell division"
FT                   /note="COG family: cell division protein"
FT                   /note="Orthologue of BL1182"
FT                   /note="PFAM_ID:DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39246"
FT                   /db_xref="GOA:A1A0L3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L3"
FT                   /protein_id="BAF39246.1"
FT                   /translation="MMRFRFILSETWNSLKRNVSMIISVMLVTFISFLFIGVSGLMQAQ
FT                   ITAAKGEWYDKVEVVVWLCPDGASQAASCSSGKAPSNQEIVDLENVINEEAGNIVSKIT
FT                   YVSREDFYKNTFLKQYPNGEYQGRVLTAADMQGSLRLKLKDPTKYQVVSEVLSGRTGVE
FT                   EVQDQRKIFDPVFSVLNRATAVTVALAGVMILVAIMLTGTTIRMSAASRKNETEIMRLV
FT                   GASNWTIRLPFVLEGVFASLIGSLLACGTLSAMVKLFITDWLSKSVQWMPLINQKTVWL
FT                   LAPALVVGAVVLSIVASSISLRKYLKA"
FT   CDS_pept        584387..585889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0466"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1181"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39247"
FT                   /db_xref="GOA:A1A0L4"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L4"
FT                   /protein_id="BAF39247.1"
FT                   /translation="MLNEMFSIFEVCWIQCRNRWISGREYMSRKMTRQVRPIVGLMLAS
FT                   AMFCAGGVAVVVAPAPQAHAVSMSEYQAKVSNHAKLKSQLVGVSSDLADTILQLADLND
FT                   NQIPAAVEAAESAQQAAEQAQSLAEATTQRLQAAQQDKANLEEQIKQTGSDYDDAKAAV
FT                   AQLARESFHGSSTSDVLDFVTDSTTADDFVNKMQSQAAVTRSESNAATDAANELNTSMN
FT                   RKDRLGAIEQKITQLKEQADQQAASAQQAASEASAKQTALQKLRDEGTVKREKLESQKS
FT                   QLTTQSAKEAADIVAMKSQIDSWNNQYNNSNNAAVNPNNNQQQSRPNNNTNYNPAPAPA
FT                   PAPAPTPNNNNSGGAGGMNYAVPGNCPAGSGYCYGHNTGNTVGGAAYPSRQCTLWAYLR
FT                   RSQLSLPVGSYMGNGADWANTARGLGYLVNNTPHVGAAMVFARGQSVGGHWTADWQYGH
FT                   VAVVERVNADGSVLISEGGTGFATFPAWETISNAGAYQYVHY"
FT   CDS_pept        586018..586497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="BAD_0467"
FT                   /product="SsrA-binding protein"
FT                   /note="Binds to ssrA RNA and is required for its
FT                   sucessfulbinding to ribosomes"
FT                   /note="Orthologue of BL1180"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39248"
FT                   /db_xref="GOA:A1A0L5"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0L5"
FT                   /protein_id="BAF39248.1"
FT                   /translation="MAKEQGTKPIAQNKKARHDYAIEDKYEAGLVLTGTEVKSLREGRA
FT                   SLAESFITIDRRGEMWLEGANIPEYLNGTWNNHAPKRKRKLLLHAAQIDKLARQTQAKG
FT                   FTIIPLSLYFKDGRVKVEIALARGKKEFDKRQSLREEQDKREALRAMRYANKQVR"
FT   CDS_pept        586624..587571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0468"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type amino acid transport
FT                   system_periplasmic component"
FT                   /note="Orthologue of BL1179_BL1178"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39249"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L6"
FT                   /protein_id="BAF39249.1"
FT                   /translation="MQAGKALKTAAAFMLSVAMLATGAACGTSDDSDASASKSSSKSSE
FT                   LTGYDVSGVKKDDAIAKMLPDYVNKDGKLTIGMDTSYAPAEFLAADGKTPVGFDVDIAK
FT                   ALAGVFGLEADPETANFDSIIPAVGAKYDIGISSFTVTKERLEAVDFVSHFNAGSAWAV
FT                   KKGNPNKVDTSDLCGKKVAVQTATMQETAANKMAKQCKADGKAEMDVISSKLQTDVTTN
FT                   VVTGKADVFYADSPVAGYAIAQTDGELETLGKTEGIAPEGIVVKKGDQQMDEALQKALQ
FT                   KLIDDGTYMKILKYWGVQDGAISKPEINTPGTNE"
FT   CDS_pept        587682..588617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0469"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type amino acid transport
FT                   system_periplasmic component"
FT                   /note="Orthologue of BL1179_BL1178"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39250"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L7"
FT                   /protein_id="BAF39250.1"
FT                   /translation="MMRNLKGWAALALSAAMVVSMGACGTSDKTDSQASVDSNSSSTTG
FT                   YDVSGVKKDEKIAKMLPSSVTKDGKLTVGMDTSYAPAEFLAADGKTPVGFDVDIVKALA
FT                   KTFGLEADPQTSNFDSIIPSIGSKYDIGVSSFTITPERMKAVDFVSMFKAGSTWVVKKG
FT                   NPGKIDTSDLCGLKIAVQTGTTQEEEVNKGAEQCKADNKLDIQILSNKLQTDVTTNVVT
FT                   GKADVFYADSPVAGYAISQTDDQLEALGEDVGVTKEAVAIKKGDSDTAKAVQAAMQKLM
FT                   DDGTYMKILKHWGVESGAVDKAEINPTDLG"
FT   CDS_pept        588667..589734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0470"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type amino acid transport
FT                   system_periplasmic component"
FT                   /note="Orthologue of BL1179_BL1178"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39251"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L8"
FT                   /protein_id="BAF39251.1"
FT                   /translation="MPLRFLPINVGVALRFYRVPLEYWTSDWQMDDYRSVDGKRIEGEP
FT                   TMSLKFKSFAALALSAAMMFSVAACGTTDSGDAKSDSKAKNTTVGYDVSTIKKDDELAK
FT                   LAASAKTVKDGELSVGMELSYAPAEFYAEDGKTPVGYDVDMSKAIAQTLGLKPKIVSSM
FT                   FDTIVPSIGSKYDLGITAMTITEERLQSVDFVSYYRAGSTWAVQKGNPKKLDTSDMCGA
FT                   KIAVQTGTVQEDEANKIAKGCKADKKAEVMSYKRQAEAATAVATGKADVFYADSPVAGY
FT                   AISQTDGQLEALGDVEGVAKQGIAIKKGDQQLDEAVQKAVQKLMDDGTYMKILKHWGVE
FT                   SGALDKAEINPTDLN"
FT   CDS_pept        589769..590752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0471"
FT                   /product="permease protein of ABC transporter system"
FT                   /note="COG family: ABC-type amino acid transport
FT                   system_permease component"
FT                   /note="Orthologue of BL1177"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39252"
FT                   /db_xref="GOA:A1A0L9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L9"
FT                   /protein_id="BAF39252.1"
FT                   /translation="MAKKQVDGDGLDIPNRIKALPVKRTGPIVAAIIVALFAAMLVQAL
FT                   VTNPRFEWNVVWKYLFNENVLEGIKYTLLLTVISMVIAIILAVILAVMRKSINPVLRGV
FT                   SWFYIWFFRGTPVYTQLVFWGLFAVLVPRIGVGIPFTSIEFWSIDSQSVITAFNAAWLG
FT                   LALNEAAYLAEIVRAGLEAVDPGQTEAAKALGMKRTLIMRRIVLPQAMRIIIPPTGNEF
FT                   IGMLKTTSLVNAVPFTLELQFATTAIATRLYKPIPLLIVACIWYLVITSILMVIQSRLE
FT                   KHFGKGFDARPAGARGKRTPLPGKTFGEPKDDVDKQNEATFAGMTA"
FT   CDS_pept        590749..591558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0472"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG family: ABC-type polar amino acid
FT                   transportsystem_ ATPase component"
FT                   /note="Orthologue of BL1176"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39253"
FT                   /db_xref="GOA:A1A0M0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0M0"
FT                   /protein_id="BAF39253.1"
FT                   /translation="MRGMTMSEITTNEIVPAVKATQVHKAFGNLHVLKGIDMTVMPGTV
FT                   TVILGPSGSGKSTFLRLINQLETLTGGEIDVDGEMIGYKYVDKGGERVLQTLNDKEVAE
FT                   QRSKLGMVFQRFNLFPHMTALENVMEAPVHVKHMDKKEARELAIQELNRVGMGERLDYY
FT                   PAQLSGGQQQRVAIARALAMKPEIMLFDEPTSALDPELVGEVLNVMLDLAKEGMTMVVV
FT                   THEIGFAREVADQIVFMDGGVVVEQGGPEIIDHPKESRFKDFLQHVL"
FT   CDS_pept        591788..593680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BAD_0473"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /note="Catalyzes the first step in hexosamine
FT                   metabolism_converting fructose-6P into glucosamine-6P using
FT                   glutamineas a nitrogen source"
FT                   /note="Orthologue of Rv3436c_BL1175"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39254"
FT                   /db_xref="GOA:A1A0M1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0M1"
FT                   /protein_id="BAF39254.1"
FT                   /translation="MCGIVGYAGNVRTACGKPLEVCLQGLQRLEYRGYDSAGVALTAPG
FT                   MDHVAVRKKAGRLANLVQDIERDPMPEATVGIGHTRWATNGVPNDTNAHPHTSRDGKVA
FT                   IIHNGIIENASQLRLDLQTEGYHFVSETDTEVAAKLLGKISDKIIEETGKPDLFKAVRR
FT                   LARMLEGAFTILATDVRQPDIVVGARHDSPLVVGLGEGENFLGSDVAAFVAYTKRAMEI
FT                   DQDQAVMVSADKVVVSDFMGNIVPDPKTYTVDWDASAAEKGGWDSFMDKEIHEDPAAVQ
FT                   RTLLGRLDENGNINLDEVRIDEHDFKAIDKIIVIACGTAAYAGMVAKYAIEHWVRIPVE
FT                   VELAHEFRYRDPILTPRTLVVAISQSGETMDTLMALRHAREQGSKVLAICNTQGASIPR
FT                   ESDAVLYTHAGPEVAVASTKAFVAQITAAYVLGLYLAQVKGAMYRDEIAQTLESLKDMP
FT                   RKIQWILDTQTKTVQEAAEQMVDAKSFLFLGRHVGYPVAMEGALKLKEIAYTFTEGFAA
FT                   GELKHGPIALVDEGEPVVFIVPPARGRNVLHSKVISGIEEVKARGAYIIAVAEEHDPDV
FT                   ERYADVVFWRPACPTLMSPLVDVVPLQLFAMDMAKLKNYDVDKPRNLAKSVTVE"
FT   CDS_pept        593739..594425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0474"
FT                   /product="pseudouridine synthase"
FT                   /note="COG family: pseudouridylate synthases_
FT                   23SRNA-specific"
FT                   /note="Orthologue of BL1174"
FT                   /note="RNA-uridine isomerase_RNA pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39255"
FT                   /db_xref="GOA:A1A0M2"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0M2"
FT                   /protein_id="BAF39255.1"
FT                   /translation="MYEDENIIVIDKPHFLATTPRGMWYRETALVRLCERYDEPNITPA
FT                   HRLDRLTAGVVVFVRNPSARGAYQMLFQNRKTVKTYECLAPLAPTQRPRYGTAVRIDRH
FT                   LPFPLVRRSHINKDRGRLQAYESADVPNAETLIERGSGIRFVAGRPYVNYTLHPKTGKT
FT                   HQLRVHMNSLGLAILGDDFYPDIVQRAYDDFSQPLELVARELRFDDPLNGEPRRFVSHV
FT                   PLGAGL"
FT   CDS_pept        594534..595826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0475"
FT                   /product="transport proteins"
FT                   /note="Orthologue of gbs1682"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39256"
FT                   /db_xref="GOA:A1A0M3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0M3"
FT                   /protein_id="BAF39256.1"
FT                   /translation="MGKISKAVRGVADIYNGASLIVRIIVGLIIGTVLALTMPHVTWIG
FT                   EFGTLFVAALKAAAPILVFVLVASALAQGTSKLDRRFGTVLFLYLFTTFLAAVVAVLTS
FT                   RLFPQTLSLGKAAKADVVPQGLSEVIQTLLTNIVANPIQAIIDGNYICILMWACLFGLA
FT                   MKSIANESSKAFMANVADAVSQVIRWVINLAPFGIMGLVFTNVADNGLSAFTKYGSLLL
FT                   LLVGTMLLMVLVFGPLVIFIFLRRNPYPLVYRCFKESGLTAFFTRSSAANIPVNMQLCE
FT                   KLGLDKDMYSVSIPLGATINMNGAAITITIMAMAAANTLGIQISLPAAILLSVVSALGA
FT                   CGASGVAGGSLLLIPMACSLFGISNDIAMQVVGVGFIIGVIQDSVETCLNSASDVEFAA
FT                   TAEYHAWLKQGRQLPAFMYSKKERAKLGIEA"
FT   CDS_pept        596016..597449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0476"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system for sugars"
FT                   /note="COG family: sugar-binding
FT                   periplasmicproteins_domains"
FT                   /note="Orthologue of BL1163"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39257"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0M4"
FT                   /protein_id="BAF39257.1"
FT                   /translation="MGVVLKSAKLVKQLIAICCAGVMASSAAACGANTDTRTQITVWSW
FT                   EPSMKQVIAGFEKDNPDIRVVWKNTSGYDKLNNAIQDGYGIPDVVQLEYYALRQYAVSS
FT                   QLVPITGRTEGYADFYTPGTWASVQLNGRVYGLPMDSGPMAFFYNNSVFEQVGVDASKI
FT                   RTWDDYYEAAKKLKKIGVYITADSGDASFYDTMIWLAGGRPFSTSNDGKNVTIRLTEDK
FT                   GTREFTEFWQKMIDEGLVATNLTSWSDRWKSAVGQGKVASLFSGAWLPSLLMSDIPGAA
FT                   GLWRVAQMPTPDGKATTSENGGSALAVLQRSRKPEASYRFIEYACHNAKGITTRVDGGA
FT                   FPADKNTLSDSKFLSKTTVTDDRGIEVPYFGGQEYNRVLSQAAENVSTGYQYLPFEVYA
FT                   RSDFRSTVGKAYKWSSLLRKEQNRLNIIAAGGQVSDTSNIGDALKNTESSDRIKLKGGI
FT                   ALWQKDLKEYGANQGFTIQ"
FT   CDS_pept        complement(597563..598333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0477"
FT                   /product="hypothetical protein"
FT                   /note="COG family: putative transcriptional
FT                   regulators_homologs of bvg accessory factor"
FT                   /note="Orthologue of BL1162"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39258"
FT                   /db_xref="GOA:A1A0M5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0M5"
FT                   /protein_id="BAF39258.1"
FT                   /translation="MLLMAVDIGNTNVVIGFIDDGRIAGTYRITTKANHTSDEYGLMIT
FT                   QFLALSGYKPADVDDVIISSVVPKVMHSFRASIVKFLDIDPMIVGPGIKTGLNIRMDNP
FT                   QNMGADCIADCAGAYYEYGGPILVADFGTATTFNYVTADASVISGLITTGIRTAAAALW
FT                   EGTAQLPEVEITRPKSILAKSTKPAMQAGLYYNFLGGIERTIAQFHKEIDEDFRVVATG
FT                   GLSRVFADGTNMIDIYDPDLIFKGMWHIYDRNVR"
FT   CDS_pept        complement(598425..599603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0478"
FT                   /product="phosphopantothenoylcysteine decarboxylase"
FT                   /note="Orthologue of SH1703"
FT                   /note="Phosphopantothenate-cysteine ligase"
FT                   /note="Ppantothenate metabolism flavoprotein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39259"
FT                   /db_xref="GOA:A1A0M6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0M6"
FT                   /protein_id="BAF39259.1"
FT                   /translation="MTAAAQEFVTPLTFSSLTHTPTRMSMFAAGHRPGATADVAPGPDG
FT                   PLQISHVADAKWADLLAVAPASADIIAKIACGIADDQLTSTILAYDKGPKILCPAMNVH
FT                   MYENAVTQRNLNTCRELGWTIVEPESGMLACGDAGKGRMEEPARIETAVKALLLANRPD
FT                   GELPLKGLAVLVTAGPTQEPLDPVRFLTNHSTGKMGYALAEQARNLGAQVTLVSGPVAL
FT                   DAPYGVDVVDVTTARDMFDVVTSRFSDTDITVMAAAVGDFRPVEQARDKIKKNGRSGIE
FT                   LELTSNPDILAWAGEHKRPDQTLCGFAMETRDLEANAAKKLNGKHCDMLVANNLRTPGA
FT                   GFAADTNVVTVLTPGETADRPSIERWSKMGKDALAKRILVKLAAMRADGERR"
FT   CDS_pept        599907..601562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0479"
FT                   /product="solute binding protein of ABC transporter systemy
FT                   for peptides"
FT                   /note="COG family: ABC-type
FT                   dipeptide_oligopeptide_nickeltransport systems_ periplasmic
FT                   components"
FT                   /note="Orthologue of BL1161"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39260"
FT                   /db_xref="GOA:A1A0M7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0M7"
FT                   /protein_id="BAF39260.1"
FT                   /translation="MSSPTGAHGEADATKQENEQQPQSTASTDATLNARAKSSNGAKSQ
FT                   GPKKWLIALIAVIAAVAVIVAIAVTRGKNDDANTSGVTKADTVTIGLKLAPVSLDIRHQ
FT                   SGSAIEQVLIGNVYEALLSRDSDNKVQPGLAKSWDISKDGKTYTFHLNQNMTFSNGDKL
FT                   DADDVAWSINQLKEKQYYNANQVASLDKAEAVDANTVKLTLSTPDSNLLWYLTGRPGLV
FT                   FDKNAKYNAKTEAVGSGPYTVESFDSASKMVLKANAKYWGTAHKPATQNVVIRFLTDDN
FT                   AAVNALKSGDVDVLSPVNATLAKSLDASTYTVSAADGSDKFVLAFNCTNAKLKDKRVRQ
FT                   AIRYAINHKEIIASRGNVDYALGGPIPSVDPGYEDLTGLYPYNVDKAKELMKEAGYTTD
FT                   KPLRLTLTYANTYGTELGDQLKSQLAKIGIDLKIDYVEFSTWLQNVHANGDYELSLVDH
FT                   AESHDFYKWTTPDYYYHYDGKQAQKLYAKALEATDEADSAKYLKQAAKAVSEDAPADWL
FT                   FGYRVTVAVNKHVQGFPSKLSQTVLPLWRISRNK"
FT   CDS_pept        601578..602558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0480"
FT                   /product="similar to ABC transporter permease protein for
FT                   peptides"
FT                   /note="COG family: ABC-type
FT                   dipeptide_oligopeptide_nickeltransport systems_ permease
FT                   components"
FT                   /note="Orthologue of BL1160"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39261"
FT                   /db_xref="GOA:A1A0M8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0M8"
FT                   /protein_id="BAF39261.1"
FT                   /translation="MRFVGKRLALFVAALVGLSALVFVMLRVLPGDVAAVIAGTNATPE
FT                   RIASLRAEFGLDKPLVAQYGDWMAGMLHGDLGVSAVGGRPVARQVAMRAAVTFPLIVLS
FT                   LLIALAIGLPLGCEAVLTRNPRLRGLFHGIAIVGGAVPALWGGLLLILLFSRGRGLLGL
FT                   LPAQGFPDTGWATPGKALSCLLLPALTTGITAGASIMRYTRAAVGDMASSQAVDMAMAC
FT                   GMTRKQAVLRVALRLATAQLVSVVGLTFAQMITGVMVVENLFALPGLGAMLVTDVGNRD
FT                   LVAVQSELFLLAAFFLLLGLVVDMTHRALDPRLKASGVVSGKVNA"
FT   CDS_pept        602636..603493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0481"
FT                   /product="probable ABC transporter permease protein for
FT                   peptides"
FT                   /note="COG family: ABC-type
FT                   dipeptide_oligopeptide_nickeltransport systems_ permease
FT                   components"
FT                   /note="Orthologue of BL1159"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39262"
FT                   /db_xref="GOA:A1A0M9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0M9"
FT                   /protein_id="BAF39262.1"
FT                   /translation="MSTTGAVVSSIWAKASGRYATIVIGLWLLTAAVSLVWTPYSLLDT
FT                   DGFNAWASPSAAHPLGTDGTGADVLSWLMAGSRTNLMIAVLTVVVAAAIGLLLVAAMVS
FT                   RSGALASTSVVVADALISIPTVLIALILSVPFGASAAVVIAACGCAYGLNLARILRPSA
FT                   LLAARSAYVESALWSGASSVRVFFTHIVPNTLPVLCVQLSMSAGTSLLAEAGLTYLGVG
FT                   VGAGVPSWGHSLSTSVKFISIYPMAVLWPGLVVTMVVVALNLFGDALRDALDPLTNPAL
FT                   REAA"
FT   CDS_pept        603490..604320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="BAD_0482"
FT                   /product="probable ATP-binding protein of ABC transporter
FT                   system for peptides"
FT                   /note="COG family: ATPase components of variousABC-type
FT                   transport systems_ contain duplicated ATPase"
FT                   /note="Orthologue of BL1158"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39263"
FT                   /db_xref="GOA:A1A0N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N0"
FT                   /protein_id="BAF39263.1"
FT                   /translation="MSAVIRHLNIAINGKPIVDDVDLDIADGERVGLVGSSGSGKSMIA
FT                   RAMMGLLPATAQVTGSVELGGTQIVGASDAAVADLRGRYVGMVFQNPSAALNPVMTVAQ
FT                   QVGLPLYLHYDLSLAERSERVTAVLAKVGLGEDVLVKYPHELSGGQRQRVGIATALVTS
FT                   PRLIIADEPTTALDSITQRQIVDLLTSLVDESGASMLFITHDFAVLNRATTRCYVLECG
FT                   RIAESGDTDALLDQPRTDAGHRLVRSARALSLHAGQDAGRESVRNPAQKEVDHD"
FT   CDS_pept        604334..605089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="BAD_0483"
FT                   /product="probable ATP binding protein of ABC transporter
FT                   for peptides"
FT                   /note="COG family: ATPase components of variousABC-type
FT                   transport systems_ contain duplicated ATPase"
FT                   /note="Orthologue of BL1157"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39264"
FT                   /db_xref="GOA:A1A0N1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N1"
FT                   /protein_id="BAF39264.1"
FT                   /translation="MVLRGRGLDKWYGAKHDRRQVLFGVDADVRAGECLAVIGGSGSGK
FT                   TTLTRVLLGLESADGGSVEYCGEPVRGDVAHSLRLQSGLVFQSPFDSLDPRWRIGRSIG
FT                   EPLRMHHPDWPRERVAERVTEVLEMVSLDPGTFVNRFPVDLSGGQAQRAAIARAIVDKP
FT                   KMLLADEPMSAIDVAARVRILDAFVAIRESQPDMAIIMVSHDLGVVQHIADRILVLHDG
FT                   RAVEVGPTDQVLGHPQDEYTKRLVQAASL"
FT   CDS_pept        605287..606042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0484"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of Lxx17750"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39265"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N2"
FT                   /protein_id="BAF39265.1"
FT                   /translation="MTHGTYQSHGMQRPRRIVTILTVLALSISLGACGTAGDRKQEQSS
FT                   RGQASAISGDADANAADASYRDEIAKIKNSGSTEAAQILEDGKITEEELVQLGSSYAQC
FT                   LTSKGITVDAGEARYPGGSIGPSYGDDALDKRNLSEDEIAATNAADEACQNETQYKNIV
FT                   DLYLSLKENPENVDNDQLARQQNDKTLACLKKHGIVDDSVTADAYDELATMGESGGTSF
FT                   DDLIGKYALKDNPAYDKRKAAIIEQCGAL"
FT   CDS_pept        606027..607208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0485"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of Lxx17740"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39266"
FT                   /db_xref="GOA:A1A0N3"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N3"
FT                   /protein_id="BAF39266.1"
FT                   /translation="MWGIVMAGGKTPVRAWSHVRNRRTDADGKRWPATRRRQPLAMSVV
FT                   ALLVVIALAAGVGCGFLLVRPAIPQSLRSSTASGSITAAKSRFDDARDVTVTVHTGTGR
FT                   TVASPKSGTITAYGCAPGQTIDSGTSFIAVDEVPLLSLHTAVPPFRDLQSGMRGRDVAA
FT                   LNAELRRLGYAAPDGDAMTWDTILAYNALADTVGAARLVKDNGWTLAKDAYVWLDGQSV
FT                   TIRSCVAGIGASIDVKSELLTTDSQSQSVSVTMPQDEVVAGDRVLDVDGRMVDMPQQTT
FT                   AITDSSTLAALLGSDAYRQASGTAESSESASDGASDVTFTLQWRLKTPIDVWSLPPTAF
FT                   YAQHDEQACVVSDGKPVAVTVIGSRLGRSMATVDSGAALGKVRTNPQGGKPCR"
FT   CDS_pept        607205..607870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0486"
FT                   /product="ABC transporter"
FT                   /note="ATP-binding protein"
FT                   /note="Identified by sequence similarity"
FT                   /note="Orthologue of Lxx18820"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39267"
FT                   /db_xref="GOA:A1A0N4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N4"
FT                   /protein_id="BAF39267.1"
FT                   /translation="MSDPVDSTGPLMKGDDERTPGKLVTLRDVGHTFTGDTWLFRSLNA
FT                   DLRPDRVYALVGPSGSGKSTLLSILAGWVKPSEGSIQRLNIGKTSWVFQNPIGVARRNV
FT                   IDHVTLPYLARGLDVPQAEACARELLAQFGLAERASSEYRELSGGEAQRLMLARGVASG
FT                   ADLLLVDEPTAQLDVHTADTVNARLGALSRQGMIVVVATHDHRTRDAATDVIDLEDYQ"
FT   CDS_pept        607867..609015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0487"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of Lxx17710"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39268"
FT                   /db_xref="GOA:A1A0N5"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N5"
FT                   /protein_id="BAF39268.1"
FT                   /translation="MKSMRLKAVLRETWRNVATGTSRCALISLLLSICAVACMCADLTQ
FT                   MTGLIGDAWKWKESGASTYAITLQGGIDGAACEGLRSANGVLGAAALRQSSDRVRIASL
FT                   PATEIPTYEASAHVAQVFAATGIRKDNSGVIMSTAVARTYGAHAGTVLPLVGGARMRVS
FT                   ATFDWPSDGRQPTYGYAIISPGNDTKAYDTCLVRAWPVPDGIESLLRVSIRADAESGVG
FT                   AAASSTSAGTSGSNETPHAKISRINTMLGSHMPGPADFDARITRYAPLLMFVIAMALGF
FT                   ASVCMRRIEIASALHAGYPKTAMLLQLSLETLATVAASCVACLPVVAIVPLILTGSGDA
FT                   MPVVAMLCRVPGAMSVGMLAGTAVGGMTIRERQLFAYFKARA"
FT   CDS_pept        609455..610363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0488"
FT                   /product="ABC transporter"
FT                   /note="ATP-binding protein"
FT                   /note="Orthologue of lp_2743"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39269"
FT                   /db_xref="GOA:A1A0N6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N6"
FT                   /protein_id="BAF39269.1"
FT                   /translation="MRTTTAHHRKDLSMSLVISDLSKSRHGTSLLNGVNLELRSGAIHG
FT                   LFGRNGAGKSTLLNIIANRLVADAGSVSFDGNRMTDGGGMWERLMLMDETWPYPVEWRL
FT                   RSVFRLISRRYGGFDDVLAGRMMQAFGLRPDARFMRLSTGQRGAAKLVAALCAPTDIVL
FT                   LDEATDGLDAAARDLCYRFVIESYGDRPRTMIISTHLITEVEGLVEHAVVLDHGRVLES
FT                   FDMNELAQRGRMLSGPVGSVRRYLADNGLRTLSETVLGGLLTVGVRGVPSAPMPEDVVM
FT                   RSFDLNEYVIQITGMDKGYAS"
FT   CDS_pept        610360..611307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfF"
FT                   /locus_tag="BAD_0489"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of STY4758"
FT                   /note="Similar to Escherichia coli hypothetical 35.5 kDa
FT                   protein in rpli-cpdb intergenic region ytfF
FT                   SW:YTFF_ECOLI(P39314)Contains possible membrane spanning
FT                   hydrophobic domains"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39270"
FT                   /db_xref="GOA:A1A0N7"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N7"
FT                   /protein_id="BAF39270.1"
FT                   /translation="MMDEVKGLSAGMRFALTRQLAARCVVLMAYVLAGYCVPWLWGLIL
FT                   ALVSGGHYVVEYHVLGPTLVMCAVLTAVPAVSGFRSLISMGVGRAVYFWTEMFANLCFS
FT                   LACSVVMTLGFVLTPNHDADILITFRVGSDLQWLACVPPSDSFGRLRFLNRDLGGSYAA
FT                   MRTGVRGDTANPMLLFLALFLLTASVAILGQCVGELLAQVNRYGAIALAVSACIAWVAR
FT                   PWLLNRTATDVNPMIWKLLEALRGRWCLMWREGQAASAAMYGTSNERLVYDQAYTFWPM
FT                   MVLFVGVMIFGNLLCWLLIRRREVRVPQLLPVWW"
FT   CDS_pept        611548..612684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbsSV"
FT                   /locus_tag="BAD_0490"
FT                   /product="cystathionine beta-synthase"
FT                   /note="Beta-thionase"
FT                   /note="COGfamily: cysteine synthase"
FT                   /note="Orthologue of BL1156"
FT                   /note="PFAM_ID: PALP"
FT                   /note="serine sulfhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39271"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N8"
FT                   /protein_id="BAF39271.1"
FT                   /translation="MSKAASQQVPFQQLHATDASFSNIRNQNHSKSPRTAPCKGNVMTI
FT                   HNSLSELIGNTPLVKLNHVTDGIKATIAVKVEYLNPGGSSKDRIAERIIDAAERSGELK
FT                   PGGVIVEPTSGNTGVGLALVALQRGYRAIFTLPDKVSEAKRAVLRAYGAEVVVTPTDAG
FT                   PDDPRSYYQVADRLAKAIPGGYRPNQYDNPNGPESHYHTTGPEIWEATDHKVTHFVAGI
FT                   GTGGTISGTGHYLKDVSNGAVQVIGADPEGSIYSDPNDVHQYQIEGVGEDFYPKAFDRS
FT                   LPDEIVQVTDAEAFEMTRRLANEEGLLVGGSSGMAVFSALKYAREHDLDENQLVVVLMP
FT                   DSGRSYMEKIFNDDWMRANGFADVVERTTKPSLAEQYL"
FT   CDS_pept        612700..613968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="BAD_0491"
FT                   /product="cystathionine gamma-synthase"
FT                   /note="Catalyzes the formation of cystathionine
FT                   fromL-cysteine and O-succinyl-L-homoserine"
FT                   /note="Orthologue of BL1155"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39272"
FT                   /db_xref="GOA:A1A0N9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0N9"
FT                   /protein_id="BAF39272.1"
FT                   /translation="MSGSPIAPLKPMPIIRTTQTIRYFQGVPIMTISTNTEALNATALA
FT                   TRAIHAGQEPDPTTGAVVTPIYMTSTFKQDGVGGLRNGYDYSRSINPTRNSFDEQLAAV
FT                   EGAKYALSFSSGLAAIDVLLRSTLKPGDNILLGNDVYGGTYRLLSKVFVPWGIGLDVVD
FT                   ITDTAAVSAALAKKQYAYIWVETPSNPLLNITDIAATAAVAHAHGTKVVVDNTFASPVL
FT                   QHPLADGADVVVYSTTKYIGGHSDVVGGAVVLNDKETRDAVAFLQNAAGAVPSPFDSWL
FT                   DIRGLKTLDLRVKQHSRNAMKVAQWLETRPEVERVWYPGLESHPGHDIAARQMHGGFGG
FT                   MISIQIAAGFEAAKKFAGATEVFTLAESLGGVESLIEHPGAMTHASVAGTTLEVPANLI
FT                   RLSVGLEDADDLIADLEQAFRQI"
FT   CDS_pept        614005..616029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="BAD_0492"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="COG family: superfamily II DNA helicase"
FT                   /note="Orthologue of BL1153"
FT                   /note="PFAM_ID: HRDC"
FT                   /note="PFAM_ID: helicase_C"
FT                   /note="PFAM_ID:DEAD"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39273"
FT                   /db_xref="GOA:A1A0P0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P0"
FT                   /protein_id="BAF39273.1"
FT                   /translation="MGKTRAGRFALRGQRTALLHLETMTQAVDSADSVDPRALEALNRY
FT                   FGYDSFRPGQSGIVSAILTGHDVLGVMPTGAGKSICYQIPAAILPGVAIVISPLISLMR
FT                   DQVDALNDVGLPAAFINTTQTPDEQDLVFAQALSGQIKLLYVAPERLETERFRNFAVRV
FT                   PISLVAVDEAHCVSQWGQDFRSSYLGIGEFIAGLPTRPTVAAFTATATERVRRDIVSIL
FT                   GLHTPSITVTGFDRPNLYFDVISMPRKDKASWVASYIASHPDESGIVYCATRKETEALA
FT                   ESLNSAVAELRAAGGADVSDIGTIAVAYHGGMSADAREKAQRDFVTDRVPVVVATNAFG
FT                   MGIDKSNVRFVIHHNMPESIEAYYQEAGRAGRDGEPSRCTLLWNESDIVTRRRLLDSDY
FT                   ENERLTPEEQEAVRASKRRLLDAMVGYCRTTDCLHAYMTRYFGETAGAAAKTDGKCVGG
FT                   CANCEHTFETIDVTDIARAISRCVHDVNQHVGSGKIVKVLRGSKAQDLSYLNPESLPSF
FT                   GMLDEVPEARIRDVLSQMATDGFLTIAEGRLPIVGFGPRAAETVAPEFHYDIKKIKRAD
FT                   ARARRTPDVSTPAVGSYVPDDGDEALFQKLRALRLDIARELGKPPYIVFSDKTLRDMVR
FT                   VKPITDDQFLAVNGVGESKLKQYGERFLAAIREDSGDEA"
FT   CDS_pept        616124..616609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0493"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /note="Catalyzes the hydrolyses of S-ribosylhomocysteineto
FT                   homocysteine and autoinducer-2"
FT                   /note="Orthologue of BL1152"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39274"
FT                   /db_xref="GOA:A1A0P1"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0P1"
FT                   /protein_id="BAF39274.1"
FT                   /translation="MAEDKPVVESFQLDHTKVKAPYVRYIDTETGLHGDVISNYDLRLV
FT                   QPNENAIPTGGLHTIEHTIAVLLRERIPGYIDCSPFGCRTGFHLLTWGEHSTEDVARAL
FT                   KESLEFIAYEATWDDVPATTIESCGNYRDHSLFTAKEWCKDILAKGISSDPFERRLV"
FT   CDS_pept        616687..617223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0494"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1151"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39275"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P2"
FT                   /protein_id="BAF39275.1"
FT                   /translation="MKGLSETTSERRFRRATMDDLPVMLKIYQHARELMAANGNPTQWG
FT                   NTFPREEVILDDIRQQRTMLLVDEADGKERVLAQFALCTGEDPTYAHIDGAWLDDDSYV
FT                   TIHRIASSGIVKGAAKDCINWCIEHYGNVRADTHPNNKAMQHVLESNGFARCGLIQLLD
FT                   RPTDTTRIAYQRHEW"
FT   CDS_pept        complement(617304..618731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfnA"
FT                   /locus_tag="BAD_0495"
FT                   /product="probable amino acid transporter"
FT                   /note="COG family: amino acid transporters"
FT                   /note="Orthologue of BL1150"
FT                   /note="PFAM_ID:aa_permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39276"
FT                   /db_xref="GOA:A1A0P3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P3"
FT                   /protein_id="BAF39276.1"
FT                   /translation="MDLFRKKSVDQLVSESTPLKRTLKTFDLTMLGIGAIIGTGIFVLT
FT                   GKGALTAGPALCVSFLLAAVCCGFAGLCYAEFAAMAPVSGSAYSYAYLAFGELIAFVIG
FT                   WDLILEYALQAATVSAGWSGYFNKLLEGFGLHLPVELTAAYGTTPGVTTYFNLPGFVIV
FT                   LIITWVLSIGINQTKKTNDIMVMIKLAIIVLFIVCTVWYINPANWKPFSPYGIYTFQPG
FT                   STQPYGIVPAASIVFFSFIGFDAVSSSAEETINPNKTLPRGILISLAVSTVLYIIMTLI
FT                   MTGVVPYKEFAKFIDAPVAGVILETGLNWLAFIVNLGALIGMTTVMLVQLYGQSRICYA
FT                   MSRDGLFPKFFGEVHPKYRTPFKGTWFFGILTAIAGGFININVLFELVNIGTLSAFIIV
FT                   SAGILWMRKTQPDAHRGFRAPGVPFTPICAIIFCLILIFGLNWETWVRFAVWFALGLVV
FT                   YFTYSRKHSQLNEPGLF"
FT   CDS_pept        618966..620324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="BAD_0496"
FT                   /product="alanine racemase"
FT                   /note="COG family: alanine racemase"
FT                   /note="Orthologue of BL1149"
FT                   /note="PFAM_ID:Ala_racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39277"
FT                   /db_xref="GOA:A1A0P4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P4"
FT                   /protein_id="BAF39277.1"
FT                   /translation="MTLSATREWDFSSEQGKANYKAAQRRYPAQAIVDLAALRDNMRHL
FT                   VSVVGGPHSGTAVMGIVKADAYGHGLVPAALAALAGGATWLGTAQSHEALLLRKAGIGP
FT                   DRCHILTWVYSGAEVPFDELVDNDIDISVGSLAGIDGVAAAARRLGKTARVHVKVDSGF
FT                   GRNGFTPAGFDAALAKLVPLAKEGVLHIVGQWSHLAVADAPDVPEFVASTDMQVETFKD
FT                   FTRRMEAAGIPPEIRHLANTAATLSRPEIHFELTRPGIGLYGYEADPAMGTPSTYSLKP
FT                   AMTLQAQLGTVKDVEAGHGISYGRTYLTPSDTSTAIVPLGYADGIHRSASGFDMEGAKH
FT                   VTKPGGPVRVMTSEGPRLYRVSGRVCMDQFILDLHGSAAELGIHEGDNVELFGPGRGED
FT                   YAEPTADDWGHAADTISYEIFTCLRNRIPRLYEHATDVLSAEDLAKLDPASIL"
FT   CDS_pept        620375..621634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0497"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /note="Orthologue of BL1148_Tfu_0865"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39278"
FT                   /db_xref="GOA:A1A0P5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P5"
FT                   /protein_id="BAF39278.1"
FT                   /translation="MTSEGYSAFDEERWAPEPPKSSSRTAFQRDRARLIHSSALRRLGA
FT                   KTQILVAGTDDFARTRLTHTLEVAQIGRQIGTSLGCDPDVVDCACLAHDLGHPPFGHNG
FT                   ERALAEIAGNIGGFEGNAQTLRLLTRLEPKILFPDGRSAGVNLTRAALDAAVKYPWTLA
FT                   EAAAHPKGERSAKFCVYPDDTDVFAWLKQHAPDTTRRPVECQVMDLSDDIAYSVHDVED
FT                   AIATGAFNPGVLHESGVIDAVVEDARAWYGPQWDTDKLVAAFARMHRRDTFPGYFDGSR
FT                   RALAALKNMTSNLIGRFAGSVEQATRDTYGNEPLTRYNGDLVIPEETSYEIVVLKGIAV
FT                   HFVMAPGEREPMHGEEQRIVGDLVDVFMADNPKPSSALENVFLDDWREAGSDGERLRVA
FT                   IDQVASLTDTSALTLHSLLC"
FT   CDS_pept        621658..623745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="BAD_0498"
FT                   /product="DNA primase"
FT                   /note="Orthologue of BL1147_Rv2343c"
FT                   /note="Synthesizes RNA primers at the replication forks"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39279"
FT                   /db_xref="GOA:A1A0P6"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P6"
FT                   /protein_id="BAF39279.1"
FT                   /translation="MPGMIKKEDIEKVRATADLYDIVSATVTLKPSGTGTYVGLCPFHD
FT                   EKTPSFSVRPALGVWHCFGCGLGGDVFGYVEHQENIDFRDAVELLADKYHIELHYDKAD
FT                   NVPAHTGSKRARLLEANEAAQEYFVSQLMTKEALAARKLLDGRNFSQADCQRFGCGYAP
FT                   QGWDNLVRHLAGKGFTQQEMLDAGLARQGQRGVYDYFRGRVTWPIRDSTGRTLGFGARK
FT                   LYEDDTINAKYINTPDTQLYRKTQVLYGIDLAKSAIVKKRQAVIVEGYTDVMAMHLAGI
FT                   DTAVATCGTAFGAEHAKIIRRLIADDSLGAVQLVGPLKVEGQALSSRVVFTFDGDAAGQ
FT                   KAAIHAFGLDAAFSTQAFVAVAEDNLDPCDLRIKRGNEAVRALIANARPLYDFVIDSAI
FT                   DRFDTTYATGQMGAVKAVAPLIAQIRDRSLLDLYSRKAVRRIGVDLDIMQREVAYQRRK
FT                   LNMRDEDAYAPKRRFQNNAGPSAEPAYAERGANPYANPAARKALEHRDAAEQSYYRIDD
FT                   AVFICEQQFMATLIQVPLAVDPTMFASLTLSSFMTPVFRTLFQAVAAAGGLPGEDVPQG
FT                   LWMHNLTKAGGPMLESVINELAVMPLPLPPSEADANRNTGESQEQSAQLRKPTQEERRY
FT                   ASELIVRLLDTGIMRKIGAAQRRMAQLPDGAEKIELLGQITKLETLRKDLQSRVFGNNV
FT                   A"
FT   CDS_pept        624041..625234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0499"
FT                   /product="possible transport protein"
FT                   /note="COG family: di- and tricarboxylate transporters"
FT                   /note="Orthologue of BL1140"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39280"
FT                   /db_xref="GOA:A1A0P7"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P7"
FT                   /protein_id="BAF39280.1"
FT                   /translation="MRRLVVKVLKNETILVVASILALISCFIVPPDKEYAGYIHASTIS
FT                   QLICLMLVVCGFQRIGVFRIIGSRLLHHVKTARGLVLTLIALPFFSGMLITNDVALVTF
FT                   VPFAIAVLTMAHMEEHAVLVGTLMTIGANVGSMLTPIGNAHNLYLKALTGMPTSEMIGI
FT                   MAPYSATAAVLLIIITCVIFGSKPVSEFSAIDSSGIEQNVLAPHSDRPQPDEIRVTGYG
FT                   AGYGGWRTIVYSVLFVVCLLAVSDFIPLWLMCVIVFVAFLLCDRRVFRNVDWGLPLTFC
FT                   MFFIFIGNMKRVPEFYELAASLVGAHPLEVAVVSSQFISNVPTTLLLSGFCDQWRELII
FT                   GTNLGGLGTLIASMASLIGYKNVTRAYPDKKGRYLAVYTAVNVLFVIVLVGLSWIIE"
FT   CDS_pept        625372..626412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0500"
FT                   /product="integral membrane protein"
FT                   /note="Orthologue of lp_2696"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39281"
FT                   /db_xref="GOA:A1A0P8"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P8"
FT                   /protein_id="BAF39281.1"
FT                   /translation="MIICAGKRVPRNVGRLNMLQGLLGIFSGLITPVQTAVNTRLGRSI
FT                   GSPLRASLVSFSIGLIAMLTLTLLLGPYPLIPATAANGPWWMWFAGVFGVTFLTGNVLL
FT                   LPKLGSLKTVIMPVTGQIVMGLLIDTFGWFGTTAQPISPLRIAGAAITLVGFLLAVAGP
FT                   NLRLRPAIDRPAGGSENSGDSEKSETDGKAVHVPGSATVLWSCAGIAFGMCSAVQTALL
FT                   GKLGVALGSPVKASLASFVVGLISLAIVVAFVDRTYSLGDALKKGNPWWMWVGGLLGAT
FT                   LVMCNAYLSAHIGTGMTVMLVLLGQVGGGLLVDRFGLLGVPRKPVAGIQYVGVLVAIVG
FT                   IVLKAM"
FT   tRNA            626466..626542
FT                   /gene="argT"
FT                   /locus_tag="BAD_t0025"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:626500..626502,aa:Arg,seq:tct)"
FT                   /note="codon recognized:TCT"
FT   CDS_pept        626629..628617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0501"
FT                   /product="translation elongation factors"
FT                   /note="GTPase"
FT                   /note="Orthologue of LBA0051"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39282"
FT                   /db_xref="GOA:A1A0P9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035650"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P9"
FT                   /protein_id="BAF39282.1"
FT                   /translation="MKRIVAGILAHVDAGKTTLSEALLYATGQVRKLGRVDHGDAFLDT
FT                   DAMERQRGITIFTEPAVIATPDLTITLLDTPGHVDFSAETERTLAVLDYAILVISGADG
FT                   IQGHTETLWRLLNRYQVPTFVFVNKMDAPGADKTQLLAQLKKRFSDGCVDFTEPIDGER
FT                   MEEIAMQNETAMDAYLDTETVPDETIRAMIARRELFPCYFGSALKMDGIEQFVAGFERF
FT                   AQEPQYNGEFGARIYKVSHDAQGNRLTWLKVTGGELKAKMMLSGTAHAGDADAVAEDGQ
FT                   WHEKADQVRVYSGAKSTTVDTVPAGTICAVTGLTQTFPGEGLGMERDAGSPVLQPVLTY
FT                   TLEPGECDIHKCLVALRELEDEDPLLHVVWQSRLEEVHLQLMGAVQLEIIQQIMHDRFG
FT                   LDVTFGPGSILYKETIAAPIEGIGHFEPLRHYAETHVLLEPLPQGSGMAYATVCSEDVL
FT                   DRNWQRLIMQHFQEREHLGVLTGSPITDMRITLLTGRAHLKHTEGGDFRQATYRAIRQG
FT                   LMEAKKKGDCRLLEPWYGFRLEVPQDMVGHAMADIQRMSGTFDTPTGDGEYMVLNGTAP
FT                   VSEMRDYAMDVNAYTHGRGHLSCVFAGYQPCHNADEVIENMAYDPESDLENTPDSVFCA
FT                   HGAGYPVKWYKVPEFMHLDYAWDGMRE"
FT   tRNA            complement(628730..628805)
FT                   /gene="glyV"
FT                   /locus_tag="BAD_t0026"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:628770..628772,aa:Gly,seq:gcc)"
FT                   /note="codon recognized:GCC"
FT   tRNA            complement(628839..628911)
FT                   /gene="valX"
FT                   /locus_tag="BAD_t0027"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:628876..628878,aa:Val,seq:cac)"
FT                   /note="codon recognized:CAC"
FT   tRNA            complement(628957..629028)
FT                   /gene="valU"
FT                   /locus_tag="BAD_t0028"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:628994..628996,aa:Val,seq:gac)"
FT                   /note="codon recognized:GAC"
FT   CDS_pept        complement(629116..629853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0502"
FT                   /product="hypothetical protein"
FT                   /note="COG family: histone acetyltransferase Hpa2
FT                   andrelated acetyltransferases"
FT                   /note="Orthologue of BL0130"
FT                   /note="PFAM_ID: Acetyltransf"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39283"
FT                   /db_xref="GOA:A1A0Q0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q0"
FT                   /protein_id="BAF39283.1"
FT                   /translation="MLADCAVGAYRNVKIGYALRESMHMLIRHATMEDLDAIEAVEAAC
FT                   FPPAEAASNESLTARVAAYPDHFWLLVNTDDDDTPFPSRVEDGTLVGFVDGMATNEPNL
FT                   ADAMYDDADMHDEHGDWQMIFGVDVAPVYQHRGCASYLLRQVILDTAQAGRKGLVLTCK
FT                   ERLVDFYARLGFVDEGLSESTHGNVVWHQMRLALTHAVGTGNPTANGSAKTAERTNDAD
FT                   TTAMSGVDHDTETLEFPQVEPTA"
FT   CDS_pept        630031..630687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0503"
FT                   /product="permease protein of ABC transporter system"
FT                   /note="COG family: ABC-type amino acid transport
FT                   system_permease component"
FT                   /note="Orthologue of BL0074"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39284"
FT                   /db_xref="GOA:A1A0Q1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q1"
FT                   /protein_id="BAF39284.1"
FT                   /translation="MFDWTFISHYAPFFVSGAEMTLFISVFGIILAIVVGLVCAGIEIA
FT                   RIPVLRQVVRVYIELSRNTPLLVQLYFLYFGLPKLGLVWSAELCAIVGLGFLGGSYMAE
FT                   AMRGGLETIPEVQRESAYVLGLSKWQTLSRVVIPQAISTSIPGVVANVIFLIKESSVVS
FT                   AIALADVMYMAKDLIGMYYDTYESLFLLIVAYLVILLPISLFGTWLERRFDYERR"
FT   CDS_pept        630674..631348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0504"
FT                   /product="permease of ABC transporter system for amino
FT                   acids"
FT                   /note="COG family: ABC-type amino acid transport
FT                   system_permease component"
FT                   /note="Orthologue of BL0075"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39285"
FT                   /db_xref="GOA:A1A0Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q2"
FT                   /protein_id="BAF39285.1"
FT                   /translation="MSGAEILLEPGVIPRLLQGLWVTVWIAGVSVALSVPVGLIVGWLM
FT                   TMKNPVVRVLTRIYLDFIRIMPQLALLFIAFYGFAQAWNWNLDATGACVFVFVLWGGAE
FT                   LGDLVRGALESIPKAQYESSYVLGLSGWQTFTKVILPQALRRLLPASVNLATRIVKTTS
FT                   LAVLLGVVEVIKVGQQIIDANRFQYPTGTLWIYGTIFFMYFIVCWPLSIVARRLEKRWK
FT                   HD"
FT   CDS_pept        631341..632219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="BAD_0505"
FT                   /product="ATP binding protein of ABC transporter for
FT                   glutamate_aspartate"
FT                   /note="COG family: ABC-type polar amino acidtransport
FT                   system_ ATPase component"
FT                   /note="Orthologue of BL0076"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39286"
FT                   /db_xref="GOA:A1A0Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q3"
FT                   /protein_id="BAF39286.1"
FT                   /translation="MTEQAEQVTQTAQNSGKSQTSLEIRHLVKRYANADKPVLDDISFD
FT                   VPHGKVFVIVGPSGSGKSTLLRTIAGLEPIQGGTIALNGEIIETGKPGTESAGRSKRGS
FT                   ELRTRVGMVFQSYDLFPNKTVLGNITLAPTLVQKRDKAEVEKEAIALLERVGLADRKDA
FT                   WPHELSGGQRQRVAICRALILHPEVLLFDEVTAALDPEMVREVLDVMLELADSGQTMLI
FT                   VTHEMQFARAIADQVIMLEDGGIVEQSDDAEAFFTNPKTERAKRFLHTFEFDRHRRPAE
FT                   TPTEPTGTSAE"
FT   CDS_pept        632264..633169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0506"
FT                   /product="probable solute-binding protein for
FT                   glutamate_aspartate ABC transporter system"
FT                   /note="COG family: ABC-type amino acid transport
FT                   system_periplasmic component"
FT                   /note="Orthologue of BL0077"
FT                   /note="PFAM_ID: SBP_bac_3"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39287"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q4"
FT                   /protein_id="BAF39287.1"
FT                   /translation="MTASIINKTIKSIVAASAALIMAASVAACGPNAATPSEENNASNG
FT                   GVTTSKVTARSLDEIKKSGVLKVAVFSDKAPFGYIDKDGKNAGYDIVFAERLAKDLGVK
FT                   VKYTSVDPAARVDVLTSNKVDITLANFTVTDERKEKVDFAKPYMKVALGVVSPENAEIT
FT                   DVSQLKGKTLIIAKGTTAESYFEKNEPDVKLQKYDQYADAYNALLDGRGDAFSTDNTEV
FT                   LAWAKTNKGFKVGITKLGDEDTIAPAVQKGNKELLNWINDEIVKLGKENFFHKDYEETL
FT                   KPVYGSDVNPDDIVVEGGQL"
FT   CDS_pept        633498..634733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="BAD_0507"
FT                   /product="cystathionine beta-lyase"
FT                   /note="Beta-cystathionase"
FT                   /note="COG family: cystathioninebeta-lyases_cystathionine
FT                   gamma-synthases"
FT                   /note="Orthologue of BL0078"
FT                   /note="PFAM_ID:Cys_Met_Meta_PP"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39288"
FT                   /db_xref="GOA:A1A0Q5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q5"
FT                   /protein_id="BAF39288.1"
FT                   /translation="MTRFNTQLVHGLPVNDNNTGAVNPPIYNSSTYAFESVGTMPRWDY
FT                   ARSGNPTREFLEKQIAQLEHGTRGFAFGSGLAAIHAVLSIFQPGDRIIVGKNIYGGTYS
FT                   LFHEYFERWGVIVEEVGTTDYKALDAAVSGESAKGNAHGCPAKAVYFEVLTNPLLQVNN
FT                   VTAIAGIAHRHGAIAIVDNTFVTPYLQQPLDQGADIVIHSATKYLAGHSEVNAGLVVVK
FT                   DDELGKRVYFAQNRLGGVLAPNECDSVRRGIQTLALRMDRQQENARAISSYLLLHPLVK
FT                   SVHYPGLPGHEYELASNGLKGGGAVLSFEVVPGVDPADVLDNLHIFRLAVSLGAVESLA
FT                   ELPCRMTHFELPREERLKVGITDELVRLAVGIEDKQDLIEDLGQAFDIAYENYLKRHAG
FT                   ESLFTFAQHVYA"
FT   CDS_pept        635013..635966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0508"
FT                   /product="hypothetical protein"
FT                   /note="COG family: membrane protease
FT                   subunits_stomatin_prohibitin homologs"
FT                   /note="Orthologue of BL0084"
FT                   /note="PFAM_ID: Band_7"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39289"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q6"
FT                   /protein_id="BAF39289.1"
FT                   /translation="MPFLVALLVIALIIAFLFLSTLFIVPQQQAYIIERFGKFNKVQFA
FT                   GIHIRIPFVDRIAMKTNMRVNQLNVQLETKTLDNVFVTVVASTQFRVNPENVATAYYEL
FT                   RDPAGQLRSYMEDALRSAIPALSLDDAFARKDDVAFDVQKTVGNEMSRFGFTVVKTLIT
FT                   AIDPSPQVKNAMDSINAAQREKEATRNRAEAQRIQIETQAAAEAEKTRLQGEGQANYRR
FT                   EIANGIVDQIKSLQAVGMNIGDVNNVVLFNQYLDVLRSLSESNNAKTVVLPASTPGGYQ
FT                   DMYSQITQAMVTANETVGQHSTVPTPPHVAPTTPRI"
FT   CDS_pept        complement(636186..636650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0509"
FT                   /product="transposase"
FT                   /note="Orthologue of ABC3794"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39290"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q7"
FT                   /protein_id="BAF39290.1"
FT                   /translation="MSNGFTPKGNNMKRHFTQAEVYYLNTLPAVERASMDRITYSREFQ
FT                   VRCMAQYLRGNGPTSIFASAGLNPKIVGSKRIERAIARWKADPQIMTEAQSFANEAAAD
FT                   QRDLLVISQSMTIAWLEKKVMDLQDQLRSMEAHAAECLNAPSPGKLVTLA"
FT   CDS_pept        636908..637639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0510"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG family: ABC-type transport systems_ involved
FT                   inlipoprotein release_ ATPase components"
FT                   /note="Orthologue of BL1135"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39291"
FT                   /db_xref="GOA:A1A0Q8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q8"
FT                   /protein_id="BAF39291.1"
FT                   /translation="MNVPVGITSNVGKTGRGPIIEVKNLRKEYPVLDETVVALERVNLA
FT                   IPQGQICCIYGESGSGKSTLLNQLAGMEKPTKGGVRIAGVPISRLDERQLAEFRQKHLG
FT                   FVFQSYNLLPNLNAIENVAMPLMFRGVPKRKREMIARAMLKRVGLGKRMNHYPAQMSGG
FT                   QQQRVGIARAFAARPQVVFADEPTGNLDSKTKTEVMDMICSFARDFNQTIVLVTHDDNM
FT                   AQYADRIVTLLDGRIIGDRLT"
FT   CDS_pept        637667..638863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0511"
FT                   /product="hypothetical protein"
FT                   /note="COG family: S-layer domain"
FT                   /note="Orthologue of BL1134"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39292"
FT                   /db_xref="GOA:A1A0Q9"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Q9"
FT                   /protein_id="BAF39292.1"
FT                   /translation="MTTTEGPSMGNNTRIATLLNGAISLLAVVAITLVCIVPTAFAEDG
FT                   ANTSDAPGAGADNSVEQIAGPVPNIIITNFTYGDGSVAVGSTFNLGFTFQNMGKVAVSN
FT                   MVVTVDGGENFAISGGTNTFYYDALNAGAALTQTVPMQTLASAKNGAQGIDISFKYEYV
FT                   DGAARSSNTSDIKISVPVSQPDRFELNDPVVPNIVNAGEETTITMDYVNKGKGDVSNVE
FT                   ASVEGDGITATQAKQYVGNVASGASGSIGFAFTADKPGETEAKLTVTYENSDGQPQTKE
FT                   FPVKINAVEAPVPDDSDTDVDVQDQSMPVWVWIVAAAVALVVIVLTVVLVVRRRRKKAK
FT                   QVADDDDWDWETADLGADKQGKSTAMAADAPTQVIATAGGTSAASVSATSSSTPSVKE"
FT   CDS_pept        638866..640377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0512"
FT                   /product="protein with weak similarity to components of ABC
FT                   transporter"
FT                   /note="COG family: ABC-type transport systems_ involved
FT                   inlipoprotein release_ permease components"
FT                   /note="Orthologue of BL1133"
FT                   /note="PFAM_ID: DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39293"
FT                   /db_xref="GOA:A1A0R0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R0"
FT                   /protein_id="BAF39293.1"
FT                   /translation="MRFSDIAHTCAQNLLRRKSRTILTVLGVIVGCCSIVLMISIGQGI
FT                   SEQNEQMLKSMGNLNDITVTAAGGSGAYDSSGVGMSSLSSSDMTSSDQQAKLDDAAVQT
FT                   FRGISGVAAVMPQRSAQSTVDLTAGAGSRYVAQYASVMGTDMTQLEASGYKLVQGRMPR
FT                   RAGEVLLGKYAAYQFMDKYRSDDDSRRIAPGDYECDENGCKESEGEKPFFDVLTTKLNL
FT                   ITGADYQSPDDYRKIGSTSMSSTDSGDGDGIASSQNPVVSMPLTVVGVLDAATNNYDAF
FT                   SSGVVMSLEDMDTLQAKIDGKTNTTSRTKTNYDQVVVHAQNIKDVPGIEAQIKMSGYQT
FT                   TSFEQTRKEIEKQSRGIQLALGGIGAVSFLVAAIGIANTMIMSVSERTREIGIMKALGC
FT                   YVNDIRTMFLCEAGAIGLVGGLIACLISALGSLSINLLSFGGFSMENVGKAIMGGDDVN
FT                   RISVIPWWLFVVAVLFSILVGILAGFGPANKAVKIPALDAIKNEQ"
FT   CDS_pept        complement(640494..642398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="BAD_0513"
FT                   /product="probable 1-deoxyxylulose-5-phosphate synthase"
FT                   /note="Catalyzes the formation of
FT                   1-deoxy-D-xylulose5-phosphate from pyruvate and
FT                   D-glyceraldehyde3-phosphate"
FT                   /note="Orthologue of BL1132"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39294"
FT                   /db_xref="GOA:A1A0R1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R1"
FT                   /protein_id="BAF39294.1"
FT                   /translation="MTAGILGSIHSPADVHALSSQQLRDLCLEIRSTLLDYGRKHGGHI
FT                   GSNLGVVELTVALHRVFGSPRDRFVFDVSHQSYVHKMLTGRAEAYLDESRFGEVTGFTN
FT                   PLESEHDSFVLGHTGTSISLACGLAKTRDMQHTAAGASEIGNVIAIIGDGSLSSAIAFE
FT                   GLNNAAEQGGNLIIVVNDNEMSIAEDFGGMYGNLARLRASNGTAELNLFKAFGLDYRYV
FT                   EQGNDVDTLVAALEDLKDIDHPVVLHIHTTKGLGFSDETEAQDGSDGCNQTNPQPHAGQ
FT                   CEANHWQDPDSALGKPLDARKYYGQMAMASLESRFENEPGLVVISPATPGSNGITRDFR
FT                   ERAGSHYVDTGITEEHAAAFAAGIAKAGGRPVLATSATFFQRIYDQLQQELALNHVPAT
FT                   LLIFGAGISGADNTHSGTFDMTMFANTPDVTCLAPTSGEQMLDMLAWATGPSDHGVTAI
FT                   RMPGEQILAMERSADMAFDPAERADTHETTIDITGDCPFTRYQIVRPGREVAILGLGNT
FT                   LPLAAEVAATLENDDDINATLIDAQQYSAMDGELLDVLADGHRVVVTLEDGQLEGGWGE
FT                   KVTAFYANSTNPKAATVHALNFGASKEFTDRVPLAELDERYGLTVEAVADRIRRVLAR"
FT   CDS_pept        642573..643574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="badC"
FT                   /locus_tag="BAD_0514"
FT                   /product="alcohol dehydrogenase"
FT                   /note="COG family: NADPH"
FT                   /note="Orthologue of BL1131"
FT                   /note="PFAM_ID: adh_zinc"
FT                   /note="Quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39295"
FT                   /db_xref="GOA:A1A0R2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R2"
FT                   /protein_id="BAF39295.1"
FT                   /translation="MKAVYVAGTDYDNPLSQLKVGELDTPETKPFWSTIHVAAASVNHH
FT                   DIWSLQGVGLSAEQTPMILGTDASGVLDEDIPVRKGLKAGAEVVLYTFVGTDGAGVMPG
FT                   ERRTILSEKYAGTMAETTQVPSANVFAKPANLTLDEAAALGTSWLTAYSLLFTSANVKP
FT                   GDTVLVQGAGGGVSTAAIQLAHAAGLEVFVTSRSEEKRDRAIAIGADAAFETGARLPHK
FT                   VDAVIESVGAATWSHSVKSVRPGGTIAICGATTGDQPGAELTRIFFQDIRVQGNTMGSR
FT                   DDFARLLKFVEHADLHPVIDSTYALADAPAAFRKVVDGDVFGKVVLHIEPSK"
FT   CDS_pept        643628..644125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BAD_0515"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /note="Air carboxylase AirC"
FT                   /note="COG family:phosphoribosylcarboxyaminoimidazole
FT                   (ncair) mutase"
FT                   /note="Orthologue of BL1130"
FT                   /note="PFAM_ID: AIRC"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39296"
FT                   /db_xref="GOA:A1A0R3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R3"
FT                   /protein_id="BAF39296.1"
FT                   /translation="MADNKPEVAVIMGSASDWETMKHACEMLDQFEVPYMKQVISAHRT
FT                   PELMGEFAHNARANGLKVIIAGAGGAAHLPGMVAAQTTLPVIGVPVRSHALSGWDSLLS
FT                   IVQMPGGIPVATTAVGNSGATNAGLLAVSILSATDERLAKALQDYRDSLKEKVAESNAQ
FT                   LV"
FT   CDS_pept        644154..645284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BAD_0516"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /note="Air carboxylase AirC"
FT                   /note="COG family:phosphoribosylaminoimidazole carboxylase
FT                   (ncairsynthetase)"
FT                   /note="Orthologue of BL1129"
FT                   /note="PFAM_ID: ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39297"
FT                   /db_xref="GOA:A1A0R4"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R4"
FT                   /protein_id="BAF39297.1"
FT                   /translation="MPGATIGIIGGGQLGRMMALSARYMGFRIGVLDPTSDCPAAQVAD
FT                   FQVTAEYDDIAAIRELAEKSDVLTYEFENVDADAIDQVRSLAAAPQGTDLLRVTQDRVN
FT                   EKRFINDHGTPTAPWKAVNSVEELEAALDEIHYPAVLKTRSGGYDGHGQTVLKSEADLE
FT                   QVRARADHDGSFPPSILEGFVDFAFEASILVAGNGKNYVTFPIVRNEHRNNILHMTIAP
FT                   AEVDETVAKEAHELALRLAKGFELAGILAIELFITKDNKVIVNELAPRPHNSGHYTIEA
FT                   CSFDQFDAHIRGIAGWPLEQPQLLKPAVMVNVLGQHVAPTRALIADHPEWNVHDYCKAE
FT                   VRHDRKMGHITVLTDDTAKTVADLEATGCWDDLKKA"
FT   CDS_pept        645296..645694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="BAD_0517"
FT                   /product="probable metal uptake regulator similar to ferric
FT                   uptake regulator protein"
FT                   /note="COG family: Fe2+_Zn2+ uptake regulationproteins"
FT                   /note="Orthologue of BL1128"
FT                   /note="PFAM_ID: FUR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39298"
FT                   /db_xref="GOA:A1A0R5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R5"
FT                   /protein_id="BAF39298.1"
FT                   /translation="MSEHIVRQTRQKDAIRDALNGCDEFISAQELHRKLEDRGEHIGLA
FT                   TVYRQLNALAEAGRADTVRLDGQQLFRLCGDDGHHHHLVCTNCGKTVEIESPSESWLKG
FT                   ISDKYGFTIERHTLEVFGLCEDCRKADK"
FT   CDS_pept        645904..647913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0518"
FT                   /product="hypothetical protein"
FT                   /note="COG family: phosphoglycerol transferase and
FT                   relatedproteins_ alkaline phosphatase superfamily"
FT                   /note="Orthologue of BL1125"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39299"
FT                   /db_xref="GOA:A1A0R6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R6"
FT                   /protein_id="BAF39299.1"
FT                   /translation="MAKKAGKEFPGWLYGVLFVLFDAVGVAALQIGVSESATRVQLSNN
FT                   MWLTGWGFVGKMFTSANFVAVLNLILWGVLYVILLMLTNRFWVATPVFLAVTFIIAVIE
FT                   HFKVSIRYEAILPSDLNFLKADAGNLMSFMPSGAQWTILIAVAAFAAFVALFVFLNRLD
FT                   ARHGRLFRGSDKRSRSVNAIARLLLILLPGLFFTLYSMQVSTVGSWAKGFATVMGDKPS
FT                   MWDSVYDAQRNGPLVAFTRQLNPKVMVKPDDYSEETMKQVAARYEKAAKKINAKRSANM
FT                   TDSTVIYVLSESFSDPSRVPGLKVNKDSIPNIRKIKQNTTSGLMLSSGYGGGTANLEYM
FT                   GLSGLSMANFDSSLTSPYQQLVPSEHWTPTINQMWGASKNSIGLHPYESSMYSRATNYK
FT                   KFGFSHFYTLTGPDVISHQDKIDDSPYVSDEATYQSTLEEVRKTKSNQFLQVITMQNHM
FT                   PYHDWYKHNDFKASSTTGKPLKDDEKESIETYQKGASLTDGATAGFLSELDKLDKPVTV
FT                   VFYGDHLPGIYSSASADDGNSLALHQTDYFIWSNKASGTQGNKIDNAEYSSPNFFVAQA
FT                   AEHMDAKVSPYLAFLTEMHSKISAMEPPVVNNIQGWDRIPEGQNIYLDSKGEPMAEDDF
FT                   DAETRQLLADYRLIQYDITTGKNYLKNTSFMTLP"
FT   CDS_pept        complement(648078..649340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BAD_0519"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /note="COG family:phosphoribosylamine-glycine ligase"
FT                   /note="GarS:glycinamide ribonucleotide
FT                   synthetase;phosphoribosylglycinamide synthetase"
FT                   /note="Orthologue of BL1123"
FT                   /note="PFAM_ID: GARS"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39300"
FT                   /db_xref="GOA:A1A0R7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R7"
FT                   /protein_id="BAF39300.1"
FT                   /translation="MKVLVIGSGAREHAIAHALMRGDSVSEVTVAPGNPGMELDGIRTT
FT                   QLNPSNHAALIDFVKNNGYDWVFVGPEVPLIEGIVDDFAAAGIKAFGPNKAAAQIEGSK
FT                   DFAKQLMERHDIPTAKYQTFDDLERSTAYVREHGAPIVIKADGLAAGKGVTVAMDEETA
FT                   IAALEDIFVDHRFGNAGAKVVIEDFLEGQEFSLMSFVNGTDFWPMPISQDHKRAYDGDK
FT                   GPNTGGMGAYSPVPQIGQDVIDTAIETIVKPTVQAMADEGTPFTGILYAGLIATADGPK
FT                   VIEFNARFGDPETEVVLPKLTSDLGAGINAILNDETPEFTWDEDNATLGVVLASDGYPT
FT                   NVVKGAAIPEIKVDDDSHVYYAGVTRGEHGLVANSGRVLFVETSAADIKTAQDKVYGII
FT                   DKLDTTGMFYRHDIGFKALNA"
FT   CDS_pept        complement(649431..650465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BAD_0520"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /note="Catalyzes the formation
FT                   of1-(5-phosphoribosyl)-5-aminoimidazole
FT                   from2-(formamido)-N1-(5-phosphoribosyl)acetamidine and ATP
FT                   inpurine biosynthesis"
FT                   /note="Orthologue of BL1122"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39301"
FT                   /db_xref="GOA:A1A0R8"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0R8"
FT                   /protein_id="BAF39301.1"
FT                   /translation="MPKAYEEAGVSVEAGYEVVKRIKSHVARTNRPGVVGGIGGFGGLF
FT                   DLASLGYKEPVLISGTDGVGTKLVVAKMAGKHSTIGIDCVAMCVNDIAAQGAEPLFFLD
FT                   YIACGKNDPALLEQVVSGVADGCVQADCGLIGGETAEMPGMYDEDEYDLAGFAVGVAEK
FT                   SAIVDGSSIVEGDVLIGLPSTGVHSNGFSLVRKALFEQAGYTVDTQLDELGGEKLGDVL
FT                   LTPTKIYVKTLSPLFKAGVVKGVAHITGGGFIENIPRMIPDGLAAHINLGSWPVLPIFD
FT                   VLEKAGEIDHMEMFNIFNMGIGMVLAVSAEDADKTMELLKSNGEAGYVLGNIVKKTGED
FT                   VELQ"
FT   CDS_pept        complement(650485..651999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BAD_0521"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="Catalyzes first step of the de novo purinenucleotide
FT                   biosynthetic pathway"
FT                   /note="Orthologue of ABC1031_BL1121"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39302"
FT                   /db_xref="GOA:A1A0R9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R9"
FT                   /protein_id="BAF39302.1"
FT                   /translation="MSAELEDIHEECGIFGVWGHSDAARLTYFGLHALQHRGQEGAGIV
FT                   SNDNGHLIGHRGTGLLTQVFSDEREIKRLKGDRAIGHVRYATAGSGGTDNIQPFIFRFH
FT                   DGDMALCHNGNLTNCLSLRRKLEDEGAIFHSNSDTEVLMHLIRRSTQRTFMDKLKEALN
FT                   IVHGGFAYLIMTENAMIGALDPNGFRPLSLGKMKNGAYVLASETCALDVVGAELVRNIR
FT                   PGEIVVVDDHGYKIVQYTNQTQLAICSMEFIYFARPDSDIYGVNVHSARKRMGARLAQE
FT                   SPVDADMVIGVPNSSLSAASGYAEEAGLPNEMGLIKNQYVARTFIQPTQELREQGVRMK
FT                   LSAVRGVVKGKRVIVIDDSIVRGTTSKRIVQLLKEAGAAEVHMRISSPPLKYPCFYGID
FT                   ISTTKELIAAKKSVEEIREYIGADSLAFLSLDGLVESIGLGADAPYGGLCVAYFNGDYP
FT                   TALDDYEADFLKSLTPEDRVRLPEFALYKSKYEGNEYTTTSPQEEH"
FT   CDS_pept        652232..653866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0522"
FT                   /product="hypothetical protein"
FT                   /note="COG family: nucleotidyltransferase_DNA
FT                   polymeraseinvolved in DNA repair"
FT                   /note="Orthologue of BL1114"
FT                   /note="PFAM_ID: IMS"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39303"
FT                   /db_xref="GOA:A1A0S0"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0S0"
FT                   /protein_id="BAF39303.1"
FT                   /translation="MAGRIYVAIDLKSFYASSECVEHGFPPLSTHLVVADQERTDKTIC
FT                   LAISPSLKAYGLPGRARLFEVKAKLKEINAVRRAAAPGGVLTGKSYDAKALAANPNLAA
FT                   DVFIAKPRMSHYLAMSAKIYGIYLKYVSAEDIHVYSVDEVFMDVTGYLRAYGKGVEEMT
FT                   RDIIRDIHTQTGITATAGIGTNMYLAKVAMDIVAKHIQAGEDGIRIARLDEMSYRKLLW
FT                   NHRPLTDFWRVGRGYARKLEAHGLATMGDIARCSIGRADEYYNEDLLYKMFGVNAELLI
FT                   DHAWGWEPCTIADIKAYKPAGHSLSSGQVLTGPVGFDAARLIVREMADTLSLDLVAKGV
FT                   KAGRVGLMVGYDTASLDPKRLGKDVSADLKAIAEHAAATYDGPVSIDRYGRRVPKPATG
FT                   SIALPEPTSATSRICDAVDKLFLSIVDRRLLVRRVNVVAADVLTDEQLEERRQAAASEY
FT                   TQPDLFATMEAPVDSASADAAECEAMRSAADGGSKDSPQGDAELHMQQTLLDIKRKFGR
FT                   NSIIKAMDMFDDATGQQRNKQIGGHAA"
FT   CDS_pept        complement(654202..657936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ_purL"
FT                   /locus_tag="BAD_0523"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /note="Bifunctional enzyme"
FT                   /note="Orthologue of CAC1655_BL1108"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39304"
FT                   /db_xref="GOA:A1A0S1"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0S1"
FT                   /protein_id="BAF39304.1"
FT                   /translation="MVFRVYVEKKPGFDVAAQQLANELHTILGIGALKNVRLVNRYDVE
FT                   GISEELFAQATPTVFSEPQVDNVYADLPDFGSDTVFAVEYLPGQFDQRADSASECIQLI
FT                   SQGERPTVRSAKVYALEGELSEADVEAIKHYVINPVEAREASLDVKTTLKAQVPVPGKV
FT                   EVINGFRSMSDAELEQFIEDRGLAMDLADLQFCREHFTEEQRDPTITEIKVIDTYWSDH
FT                   CRHTTFGTQLDEVSIDDATVKAAFDKYLEMRHELGRDAKPVCLMDMGTIGAKWLKKNGI
FT                   LKNLDESEEINACTVKVKVDVNGHDEDWLFLFKNETHNHPTEIEPFGGAATCIGGCIRD
FT                   PLSGRSYVYQAMRVTGAADPTVPVSETLEGKLPQRKLVTTAAAGYSSYGNQIGLATGQV
FT                   DEIYHPGYVAKRMEVGAVVAATPADHVRRETPAPGDKVILLGGRTGRDGIGGATGASKA
FT                   HNVESLELDGAEVQKGNAPVERKLQRLFRRGDACRLIKRCNDFGAGGVSVAVGELADGL
FT                   YVDLNKVSKKYEGLDGTELAISESQERMAVDVAAEDVDEFLGYAKEENLEAEVIATVTE
FT                   EPRMTMVWNGDTIVDLSREFLASNGAPKHQVVHVEAQHGYATPWKTGTLAERMHTMLTD
FT                   LNVASNKGLSERFDSTIGAGTVLMPFGGRKQLTPNMAMVAKLPVFGETTTASAMAWGFN
FT                   PYIMEQNQFTGAYLSVVESLSKLVAAGFEHEKAYLSFQEYFEKLRDEPERWGKPMAAVL
FT                   GALMAQVDLGAGAIGGKDSMSGTFEQLDVPPTLISFAVAVGNMKRATSPEFKGAGHRVV
FT                   RIAPRYNADGLTPDKDALLEVFSAVEELTDFGDALAVSTPGYGATAEAIFKMTVGNQIG
FT                   VKLADGISVDDLFAPAYGSFIIELADNAKVPAVSNLVEVSEVGETTEAYQFAAAGETLD
FT                   LAELQDAWEGGIESVFPYRSNGDEKGKTVETVSFDAPKKTVYTGTGVAKPHVIIPVFPG
FT                   NNCEYDSAAAFERAGADVSTLIVNNLTPAAVAESTAALVEEIKKSQIIMIPGGFSGGDE
FT                   PDGSAKFITAFFRAPAVTEAVRDLLNNRDGLMLGICNGFQALIKLGLVPYGDIVPMTAE
FT                   CPTLTFNTIGRHQSRLVRTRVASNLSPWLAKTEVGDMHTIAISHGEGRFVASDDVLAQL
FT                   KANGQIATQYVDENGVPGMDLDVNPNGSLLAIEGITSPDGRVFGKMGHSERYSNGTFVN
FT                   VPGEKDQPLFAAGVEYFTA"
FT   CDS_pept        complement(658055..658807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BAD_0524"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="Catalyzes the formation
FT                   of(S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-
FT                   carboxamido)succinate
FT                   from5-amino-1-(5-phospho-D-ribosyl)imidazole-4- carboxylate
FT                   andL-aspartate in purine biosynthesis"
FT                   /note="Orthologue of BL1107"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39305"
FT                   /db_xref="GOA:A1A0S2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0S2"
FT                   /protein_id="BAF39305.1"
FT                   /translation="MEKLEKLYEGKAKQLYATDDPEVLWVEYKNSATAGDGEKKEDFAG
FT                   KGRLNNLITTLIFDLLKKRGIDSHLVARVGETSQLVKKVTMFPLEIVLRNTAAGHFCSR
FT                   LGVEEGIELKEPVLEYFLKNDELHDPFVNDDDLVALDVCTREDLAEIAPLARRINEALI
FT                   EIFAKIDVKLVDFKIEMGRTSDGTLLLADEITPDSCRLWDQRDHSGKVEHLDKDLFRRD
FT                   LGDIIPAYEEIESRLAELAKSEGIEVAE"
FT   CDS_pept        complement(658943..660196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="BAD_0525"
FT                   /product="probable phosphoribosylglycinamide
FT                   formyltransferase 2"
FT                   /note="Involved in de novo purine biosynthesis"
FT                   /note="Orthologue of BL1105"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39306"
FT                   /db_xref="GOA:A1A0S3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0S3"
FT                   /protein_id="BAF39306.1"
FT                   /translation="MTEENRALGTPLGKHPTRVLFLGSGELGKEVTIELMRLGAWVCAA
FT                   DSYAGAPAQQVAHEYRVLDMANADQLRALFDEIQPDIIVPEVEAIATSELAAAAARGAQ
FT                   VVPSAEIAAICMDRERLRVLAHEELGLPTTPYRFAGSLEELREGAQIVGYPCVVKPIMS
FT                   SSGHGQSVVRSADAIDAAWTEAQEGRRAHDEGDVSRVIVEALAPLDYELTVLTVSSSAG
FT                   IVTCAPIGQRQESGDYRESWQPATFTPDVLEQAQHIARTAVEGLVAKAQASGEKGWGVF
FT                   GVELFVLTDGNVLFNEVSPRPHDTGMVTMASQRLSEFALHARAILGLPITQEHVALSIP
FT                   EGTVAASHAIVVQGDGEAEFRNVAAALAEPGTDLRVFAKPEVHGHRRMAVALAVGGDEA
FT                   DARAKAGNVAESLDIAIV"
FT   CDS_pept        660232..661398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0526"
FT                   /product="possible glycosyltransferase"
FT                   /note="COG family: predicted glycosyltransferases"
FT                   /note="Orthologue of BL1104"
FT                   /note="PFAM_ID: Glycos_transf_1"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39307"
FT                   /db_xref="GOA:A1A0S4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0S4"
FT                   /protein_id="BAF39307.1"
FT                   /translation="MSENEKNETQRPLTIAMVVDTSGNRGNGTSNSALQWAQELERQGH
FT                   HVRLVGIGAPEYPARVNHVPLVSWVAKKQQMQFAEPSDTLFRKAFDGVDVVHIYTPFRF
FT                   GQHACKVAKQMGIAVTAGYHVQPENVTYSAGPLKYVPGIDSFIYWLFDIWLYRKIDHVH
FT                   VPTELGASLLRSHGYKSKLHVISNGYESRFTPKRQRKADEPSPVPFRIVASGRLTNEKN
FT                   HVALIRAIARCRHAQDIELVIAGTGPLKKRLQRMAGRLLSRPASIGFHRNADMPALLRS
FT                   GDLLVHPSIADLESVSVIEGMAAGLVPVIASSSLSAAGQFALLDESLFPVDDVDALARR
FT                   IDWWIDHPAQLAKWGGTYAEHTKTNYSVESSVRKFVAMEREAIADNRR"
FT   CDS_pept        complement(661490..662515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="BAD_0527"
FT                   /product="possible low specificity-threonine aldolase"
FT                   /note="COG family: threonine aldolase"
FT                   /note="Orthologue of BL1103"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39308"
FT                   /db_xref="GOA:A1A0S5"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0S5"
FT                   /protein_id="BAF39308.1"
FT                   /translation="MLSFENDYSCAATPEIIARLAETAPNQYPGYGTDDVCESAKAKIR
FT                   EACACPDAEIFFLVGGTQTNQVVIDAITPPYAGVVAATTGHVNVHEAGAIEFTGHKVLT
FT                   LPHHDGKINADELDEYCATFYADGNYTHMVFPGCVYISQATEYGTLYTLAELEAIRKVC
FT                   TKYDMPLFIDGARLGYALTATGNDVTIEDIARLADVFYIGGTKVGAMFGEAVVFTHGNM
FT                   PKHFVTIVKQHGALLAKGWLLGLQFDTLFTDGLYLRIARHANDAADRIRKVLVERGYTL
FT                   TFDAPTNQIFVTLDNETSERLQRDVRLGFTEKADDAHTVMRICTSWATTDEQVDELVAL
FT                   L"
FT   tRNA            complement(662621..662696)
FT                   /gene="hisT"
FT                   /locus_tag="BAD_t0029"
FT                   /product="tRNA-His"
FT                   /anticodon="(pos:662661..662663,aa:His,seq:gtg)"
FT                   /note="codon recognized:GTG"
FT   CDS_pept        662961..664022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0528"
FT                   /product="probable Na+ dependent transporter possibly for
FT                   ileal bile acids"
FT                   /note="COG family: predicted Na+-dependent transporter"
FT                   /note="Orthologue of BL1102"
FT                   /note="PFAM_ID: SBF"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39309"
FT                   /db_xref="GOA:A1A0S6"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0S6"
FT                   /protein_id="BAF39309.1"
FT                   /translation="MQKIKAFGDWLTKWFTVIVIVWAVFNYFVPQTSLWGKSYTGYFLG
FT                   IVLFGMGLTLTLDDFKRILTQPLMVVVGTVAHFVIMPLVAVLLCWIFRLDGPLAVGVIL
FT                   VGCCPSGTSSNVMSYLSRGDVALDVSIGILSTLCAPFMIPLLMQWLASQYVTVPVESLF
FT                   LNAVKVVLFPIALGVICHAIFKEKIEKVTVALPIVSQVAILLIIGVVVAANGPKLFVAS
FT                   SLLAIPVVILHNLCGYALGFGFSKLMYKVYPKGFRYAQQKAITFEVGMQDSALGATLAL
FT                   SSFASNPLAAVPSTFFSVWHNISGSVLSSWWREHDDKHQIHPDSDNGEKGSAAKASEAG
FT                   DAVKDESEETVNA"
FT   CDS_pept        complement(664397..664612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0529"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BPSL0772_BL1101"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39310"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0S7"
FT                   /protein_id="BAF39310.1"
FT                   /translation="MQSSSGISQPARLLHKACRWHTRITSIQVCRTMLDNRVATATAVI
FT                   RRVAPTPSWHRSHSPTRHLARIASNL"
FT   CDS_pept        664759..665130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BAD_0530"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Important for translational accuracy. Interactswith
FT                   and stabilizes bases of the 16S rRNA that areinvolved in
FT                   tRNA selection in the A site and with the mRNAbackbone.
FT                   Located at the interface of the 30S and 50Ssubunits_ it
FT                   traverses the body of the 30S s"
FT                   /note="Orthologue of BL1100"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39311"
FT                   /db_xref="GOA:A1A0S8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0S8"
FT                   /protein_id="BAF39311.1"
FT                   /translation="MPTIEQLVRKGRQAKPKKSKTLALKGSPLRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLSSGVEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDT
FT                   QGVKDRKQGRSLYGAKKAK"
FT   CDS_pept        665136..665606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BAD_0531"
FT                   /product="30S ribosomal protein S7"
FT                   /note="One of the primary rRNA binding proteins_ it
FT                   bindsdirectly to 16S rRNA where it nucleates assembly of
FT                   thehead domain of the 30S subunit. Is located at the
FT                   subunitinterface close to the decoding center"
FT                   /note="Orthologue of BL1099"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39312"
FT                   /db_xref="GOA:A1A0S9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0S9"
FT                   /protein_id="BAF39312.1"
FT                   /translation="MSRKGPSKKHQLLPDPIYGSTVVAQLINKILLDGKKSIAEDIVYS
FT                   ALDMVKEKTDQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPGRANTLSLRWL
FT                   TDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW"
FT   CDS_pept        665637..667766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA1"
FT                   /locus_tag="BAD_0532"
FT                   /product="elongation factor G"
FT                   /note="Orthologue of Rv0684_BL1098"
FT                   /note="Promotes the GTP-dependent translocation of
FT                   thenascent protein chain from the A-site to the P-site of
FT                   theribosome"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39313"
FT                   /db_xref="GOA:A1A0T0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0T0"
FT                   /protein_id="BAF39313.1"
FT                   /translation="MALDVLNDLNQIRNIGIMAHIDAGKTTTTERILFYTGKNYKIGET
FT                   HDGASTMDFMAQEQERGITIQSAATTCFWNRQTHDEKQKFQINIIDTPGHVDFTAEVER
FT                   SLRVLDGAVAVFDGKEGVEPQSETVWRQADKYGVPRICFINKMDKLGADFYYSVDTIKT
FT                   KLGATPLVVQLPIGAENDFAGVVDLIRMKAYVWNDVSGDLGAHYDTTDIPADLQDKAEQ
FT                   YRSELLDQVAESDEELLEKYLESGELTEDEIRAGIRKLTINREAYPVLCGSAFKDKGVQ
FT                   PMLDAVVDYLPSPEDVPSIVGFDPQDESIEIDRKPTTDDPFSALVFKISTHPFYGKLVF
FT                   VRVYSGSVKPGDTVLDSTKEKKERVGKIFQMHADKENPVDAAEAGNIYTFVGLKNVTTG
FT                   DTLCDEKSPISLESMTFPDPVIEVAVEPKTKADQEKMSIALAKLSDEDPTFQVKTDEES
FT                   GQTLISGMGELQLDIIVDRMRREFKVECNVGNPQVAYRETIRKAVMNQEYTHKKQTGGS
FT                   GQFAKVLMNFEPLDTENGETYEFVNEVTGGHITKEFIPSIDAGVQEAMESGILAGFPVV
FT                   GVKATVTDGQVHDVDSSEMAFKIAGSMCFKEAAPKAKPVILEPIMAVEVRTPEEYMGDV
FT                   MGDINARRGSIQSMTDSTGVKVIDAKVPLSEMFGYIGDLRSKTQGRAMFTMQMDSYAEV
FT                   PKNVSEEIIKAQRGE"
FT   CDS_pept        667935..669134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BAD_0533"
FT                   /product="elongation factor Tu"
FT                   /note="COG family: GTPases - translationelongation factors"
FT                   /note="Orthologue of BL1097"
FT                   /note="PFAM_ID: GTP_EFTU"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39314"
FT                   /db_xref="GOA:A1A0T1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0T1"
FT                   /protein_id="BAF39314.1"
FT                   /translation="MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHEEYPDVNP
FT                   EYDFNQIDSAPEEAARGITINIAHIEYQTEKRHYAHVDCPGHADFVKNMITGAAQMDGA
FT                   ILVVAATDGPMAQTREHVLLARQVGVPKILVALNKCDMVDDDELIELVEEEVRDLLDEN
FT                   GFDRDCPVIHVSAYGALHDDAPDHEKWVEQIKKLMDAVDDYIPTPVHDLDKPFLMPIED
FT                   VFTISGRGTVVTGRVERGKLPVNSNVEIVGIRPTQTTTVTSIETFHKQMDECEAGDNTG
FT                   LLLRGINRDQVERGQVLAAPGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRT
FT                   TDVTGVITLPEGVEMVQPGDHATFGVELIQPIAMEEGLTFAVREGGHTVGSGRVTKIIE
FT                   "
FT   CDS_pept        complement(669138..670265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0534"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of c5233"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39315"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0T2"
FT                   /protein_id="BAF39315.1"
FT                   /translation="MDERRRIVVAQRFGKAQRLIDGHHVGNIIVEHDLPCGDAQDIAVD
FT                   DAHALDLPTGGMFVKHGVDGGDMLRHATDDFDGVVGQRGLSAGLLDALSKKGQDVLSLL
FT                   IRFIQRVQSPLASGGTCHETSLSLLSVLAAEVGAVGGVHLDLLAFADEQRHLDLGAGFD
FT                   GGRLGAGVGTVALQARLGVGDGQDDGSRQLDGQRGAVVEGHDAVGAFEQELGLVADQGL
FT                   RNEDLVVGGHVHEDEVVAVFIGVLEVAVVDGFEFHLHARVEGLVDDLAGKHVLDGGAHE
FT                   GGALARLDVLELDDGPQLAIEVQNRTVLDVIGSLCQINSPISSSDGKAYKKPCSLCHGV
FT                   HTLEHCPSIYKETSLGFASLGGFFKTLIQACLDVG"
FT   CDS_pept        670458..671648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="BAD_0535"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /note="Composed of two chains; the small (or
FT                   glutamine)chain promotes the hydrolysis of glutamine to
FT                   ammonia_which is used by the large (or ammonia) chain
FT                   tosynthesize carbamoyl phosphate"
FT                   /note="Orthologue of BL0067"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39316"
FT                   /db_xref="GOA:A1A0T3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0T3"
FT                   /protein_id="BAF39316.1"
FT                   /translation="MFDPQDAVLVLEDGQVYVGEPYGAIGTTSGEIVFATGMTGYQETL
FT                   TDPSYDRQIVVQTFPHIGDTGINGEDPESSRIWVAGYVVRDPSPNVSNWRATGSLDDDL
FT                   ESNHIVGISHIDTRKLVRHLRSAGVMRAAIFSGDALLDGDGKLRTIDSMLDEVKATPQM
FT                   KGMSLYDEVSTKEAYTIEPCGEFEGKEPLFTVAAVDLGIKSMTPHRMAERGCRVHVVPS
FT                   TITFDELQSLNPDGVFFSNGPGDPEQADSEVNLLRQVLDAGYPFFGICFGNQLLGRALG
FT                   FGTYKLKFGHRGINQPVKDMTTGKIEITAHNHGFAVDAPIGETVDAPFENGKYGKVFVS
FT                   HIDLNDNVVEGLQCVDIPAFSVQYHPEAAAGPHDAAYLFDRFVDLMRSVKEGTRNA"
FT   CDS_pept        671641..675021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="BAD_0536"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /note="Composed of two chains; the small (or
FT                   glutamine)chain promotes the hydrolysis of glutamine to
FT                   ammonia_which is used by the large (or ammonia) chain
FT                   tosynthesize carbamoyl phosphate; binds manganese;
FT                   involvedin pyrimidine synthesis"
FT                   /note="Orthologue of Rv1384_BL0068"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39317"
FT                   /db_xref="GOA:A1A0T4"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0T4"
FT                   /protein_id="BAF39317.1"
FT                   /translation="MPKRTDIKSVMVIGSGPIVIGQAAEFDYSGTQACRVLREEGIRVI
FT                   LVNSNPATIMTDPEMADATYIEPISTPILEQIIAKERPDALLPTLGGQTALNAAMALGE
FT                   AGVLKKYNVELIGASLDAIDRGEDRELFKKVVEEAGAESARSDIAHSLEEVDKIAEKFG
FT                   YPLVVRPSFTMGGLGSGIAHDEDELHRIAGAGIHYSPTDHVLIEESIEGWKEYELELMR
FT                   DKKDNVLVVCPIQNVDPVGVHTGDSITVAPVFTLTDREYQKLRDIGIAIIRGVGVDTGG
FT                   CNIQFAVNPDTGRIIVIEMNPRVSRSSALASKATGFPIAKIATKLALGYTLDEIQNDIT
FT                   QSTPASFEPTIDYVVTKVPRFAFEKFPGADPTLTTSMKSVGEAMALAGNFQESLGKAMR
FT                   SIDKRHMGFNWDGDKPSEDEVSQLLDAIKVPTEHRYLQIQRALWGGATEEQIFAATKID
FT                   PWFIRQFALINETALEVKNAEKLTRKLLKKAKLAGLSDLQIAHLRRLGDEGENTIRELR
FT                   WSYDLRPVFKTVDTCAAEFDAATPYYYSCYADETELRPRDREAVIILGSGPNRIGQGIE
FT                   FDYTCVHAVQELGKNYDTIMVNCNPETVSTDYDMSDRLYFEPLTFEDVLEIYEAEKKMG
FT                   PIKGVIVQLGGQTPLSLAARLKAAGVPILGTTPESIDLAENRELFGEVLKKADMNAPRY
FT                   GTALSLDEAREAAHAIGYPVLVRPSYVLGGRGMEIVYDDAQLRKYVDRALKEAQADTVV
FT                   SGRLPSPLLIDKFLQDAVEIDVDALFDGEELYIGGIMEHVEEAGVHSGDAACTLPPSTL
FT                   SDDQIRRLREGTYAIAKGCGVQGLINVQYAFMANTLYVIEANPRASRTVPFASKATGVA
FT                   LAKAAARIMVGETIQQQRDNGLLLPHGDGGDIHRGQQVAVKESVLPFKRFRTPLGKTVD
FT                   VLLGPEMRSTGEVMGFDRDFPHAFAKSQLAAYEGGLPTSGNVFISVNDTDKRQLPLFAA
FT                   RLVELGFNIWATEGTASVLRRYGIDSKIVDKISVRMDSDPDDPITTYHAEGSVGKNVVQ
FT                   LIEEGAIDLILNTPNSRGSRSDGYAIRSAAIAADLPQFTTMTEFSAVLMAIEAVRNNDY
FT                   QIMSIQDHSTQLFELESRD"
FT   CDS_pept        675021..675962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0537"
FT                   /product="similar to orotidine 5'-phosphate decarboxylase"
FT                   /note="COG family:orotidine-5'-phosphate decarboxylase"
FT                   /note="Omp decarboxylase"
FT                   /note="Ompdcase"
FT                   /note="Orthologue of BL0069"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39318"
FT                   /db_xref="GOA:A1A0T5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0T5"
FT                   /protein_id="BAF39318.1"
FT                   /translation="MMSSPSSEEVNAQRSDFGLRLSNSMAKYGPLCVGIDPHRQLLTDW
FT                   GYNVDALGAELYSMRMLQAANGRAAAVKFQSSMFERYGSKGIAALERVLYAARQMGVIT
FT                   IVDCLHGGLPTTISAFADAYFKPGAPLLADAITLLPYYGARSLGGVINDALNNGRGVFI
FT                   ASLTSNQEGASLQTAIRQAGEYKGKTVAYGIASTAQKFNKGNDGMGSVGLIIGATIGQW
FT                   INDSGVDPAKFTGPILSPGYGWQGAETRDLKTVFKGTKGNVLVTVSRSIATHGPDIAKL
FT                   TEATASVARDIRQALTEAQNESADDAADGDVE"
FT   CDS_pept        676023..676610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0538"
FT                   /product="guanylate kinase"
FT                   /note="COG family: guanylate kinase"
FT                   /note="Gmp kinase"
FT                   /note="Orthologue of BL0070"
FT                   /note="PFAM_ID:Guanylate_kin"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39319"
FT                   /db_xref="GOA:A1A0T6"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0T6"
FT                   /protein_id="BAF39319.1"
FT                   /translation="MADSQHGRLIVLCGPAGVGKGTVLGRVREQHPEIWLSVSATTRQP
FT                   RPGEVNGVNYFFMTEPEFLAKEKAGEFLETADVFGLAHYGTPVKPVVEHLERNIPVVLE
FT                   IDLQGARTVKRRAKELGLEVLTVFIEPPSFEELKRRLIGRGTETPQQQAKRLETAKVEL
FT                   AAAPEFDKRIVNNVVDEAADELWHIIAEEFGL"
FT   CDS_pept        complement(676698..678557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BAD_0539"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /note="Catalyzes the dehydration
FT                   of2_3-dihydroxy-3-methylbutanoate to
FT                   3-methyl-2-oxobutanoatein valine and isoleucine
FT                   biosynthesis"
FT                   /note="Orthologue of HI0738"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39320"
FT                   /db_xref="GOA:A1A0T7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0T7"
FT                   /protein_id="BAF39320.1"
FT                   /translation="MEMRSAKLMNGRVFAGARALYRAAGVDGKDFGKPIIAIANSFDEF
FT                   LPGHVHLNKVGRLISDAIKEAGGIPREFNTMAVDDGIAMGHTGMLYSLPSRDIIADTVE
FT                   YQVNAHCADALICIPNCDKVVPGMLMAALRLNIPTVFVSGGPMEAGTTVLPDGTVKKNT
FT                   DLIDVMYASADDNLNEEDLLAYEKTVCPTCGSCAGMFTANSMNCLTEAIGLALPGNGTI
FT                   LASHSYRKDLFKRAAEQVVKIAKQYYDDDDDSVLPRSIATKKAFENAMTMDVAMGGSTN
FT                   TVLHILAMAQSADVDFTLDDIERISHTVPCICKASPSGEWEISDVHRAGGITGILGELD
FT                   RAGKLHRDVHSIDYKSLEDKLNDWDIMRDTCTEEAKQMYLAAPGHIVSPEPWTHTTLFD
FT                   SLDRDRVNGAIHDIDHPAVTEGGLAVLRGNLAPDGCVVKTAGVPKEIWTFRGPALVVES
FT                   QEQAIEVILNDTLKPGMALVIRYEGPKGGPGMQEMLYPTSFVKGKGIGKQVAMLTDGRY
FT                   SGGSSGLAIGHIAPEAANKGPIALIKNGDIINIDIPNRTVNVELSDEELAQRRAELEAG
FT                   DGYVAHRDRKVSQALKAYAAFARSADKGATRDPELIDKLSGLA"
FT   CDS_pept        678772..679056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="BAD_0540"
FT                   /product="RNA polymerase omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39321"
FT                   /db_xref="GOA:A1A0T8"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0T8"
FT                   /protein_id="BAF39321.1"
FT                   /translation="MAFGTEPTPTGLADPPIDDLMEHADSKYALAIFAAKRARQINSYF
FT                   TQLNEGLLQNVGPLVEYQNQEKPLSIAFREINSGLLEETLGEDDLTEGN"
FT   CDS_pept        679230..680444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BAD_0541"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /note="Orthologue of BL1786"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39322"
FT                   /db_xref="GOA:A1A0T9"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0T9"
FT                   /protein_id="BAF39322.1"
FT                   /translation="MAELKLISAESVTEGHPDKVCDQISDAILDDMLAQDPHSHVAVET
FT                   CATVGQFFVFGEVTSEGYSDIQNIVRSVVRNIGYTSSRVGLDADSCGVTVSLTEQSPEI
FT                   NQGVARLSGEEESKASREQRYEAQGAGDQGVMFGYACDETDVLMPLPIHLAHRLAYRLA
FT                   EVRKSGEVPHLRPDGKTQVTIEYDDDDHPVRLDTVLVSTQHDPEVDQAWLKEQLTEHVI
FT                   RPVLDDVLADRVAHDEYRVLVNPTGSFILGGPAADAGLTGRKIIVDTYGGAAHHGGGAF
FT                   SGKDPSKVDRSAAYAARWVAKNIVAAGLAHKVEVQVAYAIGVADPVSINVETYGTEIGV
FT                   TREQIQQAVRKVFDLRPAAIIDELDLKRPIYSKTAAYGHFGREDADFTWEATNKVDELK
FT                   EAIKA"
FT   CDS_pept        680503..682734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="BAD_0542"
FT                   /product="probable primosomal protein N'"
FT                   /note="Binding of PriA to forked DNA starts the assemblyof
FT                   the primosome_ also posseses 3'-5' helicase activity"
FT                   /note="Orthologue of BL1791"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39323"
FT                   /db_xref="GOA:A1A0U0"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0U0"
FT                   /protein_id="BAF39323.1"
FT                   /translation="MTNEDAEQLALDGLAPRKRRKRAPAVKTPAAEHPIAQVVLDIQAT
FT                   HLGQTFDYFVEEKYSAAAQPGVMVRVRFGGQRVNGIIWKRADTSATPESSIRYIERVVT
FT                   DRVLVPESMRDDMTRIADAFGGTRANILRLAVPPRVAKVESQLRVGNRDAAGTAAGKQR
FT                   LTAVDQEIYGQLQRQYGNINLLHDALQGRRFQSFVFDLLPGADHWRRCAAWMVAAALAQ
FT                   NKPAVLVLPTMREIADMTETLRSVGLKPFAPTGAANGVYDGDFAVLNAQMAPADRYRAY
FT                   LAISCGQVRCVLGTRAAMYAPVEGNALFLILDDVCYQDADGMMPYANARGVLRLRAKSH
FT                   NGVFVAMANARSAQSQWETDAAHVGDTQVSGFSTPIHALPAVTKEASPWIRWLNRDELA
FT                   RLADPTIGARVPHTAVRILSKALETGPVLLSIPQDGITEALSCSKCHRQVRCARCTGPL
FT                   ERLADGTIRCRWCGAATVQWSCPTCHNERMRVVRVGAAGTAMELARLFRGVPMVLSTPS
FT                   QPRGVVSDIGFAPQLVIATPGAEPRVRGESPAQCEYRAVAILDAWTSLYASGIDADVDT
FT                   LTGWMRAVSLCAPRTRGGQALLIGETDPVLARSLMLWNSPMLAQVEVEDRAQTALPPVF
FT                   AAACVWGRRDAVGTMLKRIGALAGGDMATIDTIAGTMPSVLGPVPIPQPRTIDSRELEG
FT                   TADRVKAVVRVPQGRRAELALRLRSASARHVASREPGELRFQMDPKERI"
FT   CDS_pept        682801..683511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0543"
FT                   /product="possible alpha beta hydrolase"
FT                   /note="COG family: predicted hydrolases of the
FT                   Hadsuperfamily"
FT                   /note="Orthologue of BL1790"
FT                   /note="PFAM_ID: Hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39324"
FT                   /db_xref="GOA:A1A0U1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0U1"
FT                   /protein_id="BAF39324.1"
FT                   /translation="MKGWPGEPQMEYDVLMADGNAAANAGRQITDVIFDFGNVLIYWDP
FT                   AAVMTPRYSDGLVEQFLDNDVSGFYDINNELDAGMSNDDGVALMRERHGDQWADMMRYY
FT                   LDNFVDSLTGVVPGARVLINDLKAAGVHVWGLSNWQKDLFPVALDHYDILCSLEDRVVS
FT                   GYVGLRKPHRDIYDYALKQFGIDASGALFVDDKAMNIVGANEAGIRGVRFKDARALRTL
FT                   LIDAGVAIPAVHEK"
FT   CDS_pept        683617..684579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BAD_0544"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="COG family: methionyl-tRNA formyltransferase"
FT                   /note="Orthologue of BL1789"
FT                   /note="PFAM_ID: formyl_transf"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39325"
FT                   /db_xref="GOA:A1A0U2"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0U2"
FT                   /protein_id="BAF39325.1"
FT                   /translation="MLKVLFAGTPDVAVPSLKLLAQDTEHFEVVAVLTRPDAPTGRGRK
FT                   LVANPVKQAALELGLPVIESDPSEETFVSELAATGAQAAAVVAYGKILKQDVLDALPMG
FT                   WYNLHFSLLPQWRGAAPVQRSIWAGEKVTGATVFRIVRAMDAGPILAQSTVEIGAHETA
FT                   GELLGRLAEDGSHLLAASLQALADDQIAPVEQPAGAYEVAQKITVEDAHIRFDVPVFAA
FT                   DRQIRACTPNPGAWCELHAHADAEPATLHVLRAQPADMSNPNAPASLEPGHIVAGKKNV
FT                   WVGTSTEPLELLEVKAQGKKAMRAADWARGAHLDNAFCE"
FT   CDS_pept        complement(684731..685414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="BAD_0545"
FT                   /product="probable phosphoserine phosphatase"
FT                   /note="COG family: phosphoserine phosphatase"
FT                   /note="Orthologue of BL1792"
FT                   /note="PFAM_ID:Hydrolase"
FT                   /note="Psp:O-phosphoserine phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39326"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0U3"
FT                   /protein_id="BAF39326.1"
FT                   /translation="MLEQETPNIASMASLPTLSTPGLLVMDVDSTLIDEEVIDELGVAA
FT                   GVGEQIASVTARAMNGELDFREALRARVALLKGLPTTIFDEVYHRVHFTHGALELIDTL
FT                   HAHDWKVGVVSGGFHEVVDRLAADAHLDYWIANRLEAADGRLTGHVLGDIVTKDTKLES
FT                   LRAWAARMGIDMAQTVAVGDGANDLPMIHAAGLGVAFCAKPKVQEDAPHRLNERDLAKI
FT                   LDYLK"
FT   CDS_pept        685488..687035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0546"
FT                   /product="probable Aaa-family ATPase"
FT                   /note="COG family: ATPases of the Aaa+ class"
FT                   /note="Orthologue of BL1794"
FT                   /note="PFAM_ID:AAA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39327"
FT                   /db_xref="GOA:A1A0U4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR022482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041626"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0U4"
FT                   /protein_id="BAF39327.1"
FT                   /translation="MNDHDEETLASLQQANDQLMAKNHALVKALSRATQEMTKTKAQLN
FT                   QLAGPPMTFATMVRVHSAKTDGQGVQHASAEVAAGARRMIVPIAANLQASRLEPGRTVL
FT                   LNENMVVVSQLDTDTLGAVRSVRQVCDDGRLLVADGGGNVTLVRCSGTLAKQAISAGDR
FT                   VNVDASLRFALSLVPPENDDDLVLEEVPDVTFADIGGLDEQIERIRDAVQMPFQHRELF
FT                   ERYDLKPPKGVLLYGPPGNGKTLIAKAVANALAEGTDAGSGVFLSVKGPELLNKFVGES
FT                   ERLIRMIFKRARERAADGKPVIVFIDEMDSLLRTRGTGVSSDVETTIVPQFLTELDGVE
FT                   SLDNVMVIGASNRIDMIDPAVLRPGRLDVKIRVDRPGIQQATQIVRHYLTDKLPLSPNV
FT                   DAKALIGVLVNDIYAQDEHRHLCDICDDHGQWRPVYLADVVSGAVLKNIVDRAKTYAVK
FT                   LSITTGQAAAIGINLLAKAVDEEYGETRDALLDADPEQWSRINGLEPGRVTGIRPVA"
FT   CDS_pept        687107..688690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0547"
FT                   /product="hypothetical proteasome-associated protein"
FT                   /note="Orthologue of BL1795"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39328"
FT                   /db_xref="GOA:A1A0U5"
FT                   /db_xref="InterPro:IPR004347"
FT                   /db_xref="InterPro:IPR022366"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0U5"
FT                   /protein_id="BAF39328.1"
FT                   /translation="MSVRRVMGTETEYAVSAPGQGRYNPVQLSFDVVGAASDASRSHIR
FT                   WDYRQEDPVNDARGTRLERAAAHPDLLTDAPQLNITNVIAPNGGRIYVDHAHPEYSAPE
FT                   TTDPFEAVRYDRAGDLIMRAAAAKASETTGRKIVLHRNNVDGKGASWGTHENYMMLRSV
FT                   PFDLVTRLMTTHFVSRQIFIGSGRVGIGEHSENAGYQLSQRADYFHMKVGLQTTFDRPI
FT                   INTRDESHSTDEYRRLHVIVGDANRMDVPQALKLGTTSMLLWLLEHADMAEIDLNEALG
FT                   PLTLADPVEAMHTVSHDLTLAAPLPLETGGTTTAWQMQVTLRGLVYAAAATVYGTDTSG
FT                   EPAWPDRSTRNIMAMWGQALADVATVRHADDDGRLTMREQASRLEWLLKWQLLEKLRRK
FT                   TGSDWTDRRLAAVDLKWAALDPADSIFTRLAGQTERLVTDKQLAEAVGQAPADTRAWLR
FT                   AEIVRRFPEQVIAASWSHLTVRGESSGDENVENSMVSLDMSNPLKFTESLCSEAFERVH
FT                   TASGIVESLR"
FT   CDS_pept        688825..689655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0548"
FT                   /product="possible inositol monophosphatase"
FT                   /note="COG family: archaeal fructose-1_6-bisphosphataseand
FT                   related enzymes of inositol monophosphatase family"
FT                   /note="Orthologue of BL1796"
FT                   /note="PFAM_ID: inositol_P"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39329"
FT                   /db_xref="GOA:A1A0U6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0U6"
FT                   /protein_id="BAF39329.1"
FT                   /translation="MELRQVALEVARILQDAGKHALNDQMNPRDLKSFEMTDNHLSFTS
FT                   DIDKRLAQFISNRITYVDVFDGFWQFRPEECHPGERYWCVGGIDGAINFVRSMPEWTIT
FT                   VSLFEFNDQCSAQPILSVVHAPALGLTYLAVRGSGAIRIRKTPLGDKREKIMPSTTPSL
FT                   DYAVVSFGMSHVPEESKRALEVVSRIAGRPADIKRVGPASLDLCKVADGTYDAYFEAHL
FT                   HKWDVPAVSAGAVVVWEAQGHLSRWNGDLVHWRQENDVLATNGLIADDLRQYLA"
FT   CDS_pept        689940..691406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0549"
FT                   /product="hypothetical proteasome-associated protein"
FT                   /note="Orthologue of BL1797"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39330"
FT                   /db_xref="GOA:A1A0U7"
FT                   /db_xref="InterPro:IPR004347"
FT                   /db_xref="InterPro:IPR022279"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0U7"
FT                   /protein_id="BAF39330.1"
FT                   /translation="MPQLRDSGNHSTAPLDAHTKDEIQSFARIFGIETEYGVSVTGSDR
FT                   PCDAGQTAMMMFQPIVAEARSTNTYIENGSRLYLDVGSHPEYATAEARDPMDALALDAA
FT                   GELVMRDLALDAQRRLRSIQGAGSTVHVFKNNVDSAGHSFGCHENYLVRRFVPLKTIEQ
FT                   ELLPFLITRQLFTGAGRMGEQGFQITQRADFLDEAVSSATTRSRPMVNTRDEPHADPDA
FT                   FRRLHVIIGDSNRSQWATMMKLATTHLVLCVIEQAGREGKDSGFARFSFADASAANHKV
FT                   SRDLTGVEASFDMADGTVMEGGAVAIQERYLEIVERFVGQHPEVCSSLPRTDVHEVIRR
FT                   WRRVIEAFRSGVSETFADKVDWLAKRRLFDMLRNRAGGRLSVSKLEQLDMDYHDVANGA
FT                   LYASLCRRGAMRTLVNESQAHEAIDVPPHDTRAALRGRFIQSARSHNAQYSCDWTRLSL
FT                   TSPNRMDVTLLDPFDAQPSDRFLTILEALQ"
FT   CDS_pept        complement(691480..692280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0550"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1086"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39331"
FT                   /db_xref="GOA:A1A0U8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0U8"
FT                   /protein_id="BAF39331.1"
FT                   /translation="MSVGQEHDSGADDPDLIRLNKRSLFTPSASVAVEQHSAVPHVSRS
FT                   TYGTAKVEGRLTSPNARVPEIITQRCGGITVKGHTLKSFAYTTDAVIIRNTNANAILAV
FT                   YPFTGEPVITQALLTVAQMPLFVGVGGGTTTGPRVAELAMVAEMQGAAGVVINAPAPAE
FT                   TIETTMSMVDIPVIATVTEDDEITECKILAGAAIINVAAGARTAQVVASIRAHHPEIPI
FT                   LASGGGREDRILATIDAGADAITWTPPSAQQLQSQMMAKYRGEV"
FT   CDS_pept        complement(692277..692636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0551"
FT                   /product="possible MarR-type transcriptional regulator"
FT                   /note="COG family: transcriptional regulators"
FT                   /note="Orthologue of BL1087"
FT                   /note="PFAM_ID:MarR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39332"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0U9"
FT                   /protein_id="BAF39332.1"
FT                   /translation="MVDQRRQIIDEIHKLNILLIHTKLKTTRAQTMARATTHVRNVDAA
FT                   RRGMVPRPKPSKPIEADVHMLDCLNDEELSTLGELLQRIIDNTDTKLLDEEISERRKAI
FT                   HEFLMLNHTDEEVRE"
FT   CDS_pept        complement(692781..693062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="BAD_0552"
FT                   /product="DNA-binding protein HB1"
FT                   /note="COG family: bacterial nucleoidDNA-binding protein"
FT                   /note="Orthologue of BL1798"
FT                   /note="PFAM_ID: Bac_DNA_binding"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39333"
FT                   /db_xref="GOA:A1A0V0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V0"
FT                   /protein_id="BAF39333.1"
FT                   /translation="MAYNKSDLVSKIAQKSNLTKAQAEAAVNAFQDVFVEAMQSGEGLK
FT                   LTGLFSAERVKRAARTGRNPRTGETIEIPATYGVRISAGSLLKKAVTK"
FT   CDS_pept        complement(693217..695652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0553"
FT                   /product="narrowly conserved hypothetical membrane protein"
FT                   /note="COG family: predicted integral membrane protein"
FT                   /note="Orthologue of BL1799"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39334"
FT                   /db_xref="GOA:A1A0V1"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V1"
FT                   /protein_id="BAF39334.1"
FT                   /translation="MSHDFPTSKHETRIEDVPPKRNRDFADLLHALFAVLVGAAVILFS
FT                   IYLHGTTSGVESDVRSAGHVVSWLMDVPTSLLQQIAIVFITVSVLIQLLIAKEWLQSVV
FT                   SAIALILGFAAIWGISALISGSGNGTLIMSMMSNGTSVGTGLLPDFYAAMASFLTVAGP
FT                   RRTRSGTKWGWNILYTVAVLFVVLSWNSLSGVLVSFAAGRALGMLIRFMLGTQTNGAWG
FT                   NQVAQALRSIGIDVASLSRRLATYTDSGMLKTTLDDDLTENSRIYDAIDVDGHQYTVSV
FT                   LDNQVHMAGYLNQLWQWVRLTGVSMRRDRSSFDAIHHHYAMILGLQNAGLTVPGVYGVA
FT                   DSSESSILVFHRDHMPLECNPNTMSDHDMELFMTYLSEAHRHGFTHRRITPETLSRMEN
FT                   GQPVIAGWQNGDYGSAPPNYALDKVQLLVLLGALNGIDRAIACARRTWGDEQLIDLAPF
FT                   IQKTAVPAATRALSTCDKHMLNTLRSRIAALAPQEVADSMETVTLSRFSFRSFIAIALL
FT                   VVAVYVVFTQIQPAEMIKAVKEANIAMALVCVLFGLLAWFGSAMTLGCFMDADKRNPIG
FT                   LYCSQMASGFTAVSMPAGVGPAFVNLQFLRKSGYRNTAATAIMSAVWAVQGGTTIILLL
FT                   LIGIFTGRNTLSGMIPTNTLILVITIVALVISAAMAIPPVRHIVTEKYLPIVKSYARSL
FT                   INVLSHPKELAFGILGALILNISTGLGFWIALMAFGCHTNPVETTFIFLLANTLGSAVP
FT                   TPGGLGAVEAALSVAFTAVGIPSTIAVSATLVYRIAFYWLRIPMGAVAMKWLDRHNLI"
FT   CDS_pept        complement(695800..697242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BAD_0554"
FT                   /product="adenylosuccinate lyase"
FT                   /note="Catalyzes two discrete reactions in the de
FT                   novosynthesis of purines: the cleavage of adenylosuccinate
FT                   andsuccinylaminoimidazole carboxamide ribotide"
FT                   /note="Orthologue of BL1800"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39335"
FT                   /db_xref="GOA:A1A0V2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V2"
FT                   /protein_id="BAF39335.1"
FT                   /translation="MKLTDISPAIALTPLDGRYHKQTAPLVEYMSEPALNRERMRVEVE
FT                   WMILLANGFEGNGNQTIVPGVKPLTDDEQAYLRSIPENFGAEGIAQHAAYEAKTHHDVK
FT                   AVEYYIDDQLEKAADVLGHDTQLTGLKTLVHFACTSEDINNLSIARCVKNGVEQVWLPA
FT                   AQAIVDHLAQKADAYRDKAMLSLTHGQPATPTTLGKELAVYVYRLNRQLNKVKAQEYLG
FT                   KINGATGTFGAHLAACPDVDWVAVSREFVTNRMGLTWNPLTTQIESHDWQAELYGTISH
FT                   TNRILHNLCVDVWMYISRGVFAQVPVKGATGSSTMPHKVNPIRFENAEANLEISCSLLD
FT                   TLSATLVESRWQRDLTDSTTQRNIGSALGYSLLALNNLMGGLNSIHPNDVVIQAELDSN
FT                   WEVLGEPIQTAMRACELAGLPGMDKPYEKVKELMRGHEISKDDVERFIDQQAFDEATAA
FT                   RLKALAPATYTGVASKLVDFDR"
FT   CDS_pept        complement(697282..698841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0555"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1804"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39336"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V3"
FT                   /protein_id="BAF39336.1"
FT                   /translation="MNQRVTARIVGGKRFTTAEYREYFNASRILRDQANRLGTSRRSFI
FT                   AAGYELKIHPRATPLLSALTGASPRCTAQDHIELPYRQLLGRCEAHAEALQSMASQLNE
FT                   LSSLIAQAQSLYAQAEEASRKGLDIMLRGLFMSSRESAILALTASALMGVRRSYAKEGK
FT                   FNKFYLVESTAWMQESFVSVLGEHASRLNIQERPSKDTSILEYITKTLFMVTKPGAVIA
FT                   EGLSGKGSVNRGLKKIDRLLIPYFDKDHGDNLSVTRVYPKTKVVRGGTSTKDAIADQRR
FT                   LSEGPLNGERESGLEYGTIACCKYRKADGTYAWRIIIPGTDGNHDSPMDWYTNFELMSA
FT                   DERQRGTAESLRFLDETMKQAGIQPDDPVEIVGHSQGGIIAAAAATDFQDKYDIQHIAT
FT                   LGSPIANFEIPEKTRVTAIEMDDEGIAALDGEANPHTENWLTIRCSVHEEDAPKRAFPG
FT                   AEVSDSSGEKNSTHYPKYHEAGYRYAYDTGSKSVLDHDRHFQEVVEGELEEVQYYEGRI
FT                   SK"
FT   CDS_pept        complement(698838..699167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0556"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1805"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39337"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V4"
FT                   /protein_id="BAF39337.1"
FT                   /translation="MAAMNVSNAFLGAAPGVAAFNSLASLSGMSCRCRIGVRTTQTLIN
FT                   AKLVAASRLLDELDAAIASNRLADWTGTAAEEYRTRLNRIARQSALLRDDMIATSRLLW
FT                   SAGAA"
FT   CDS_pept        complement(699314..699886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ebpS"
FT                   /locus_tag="BAD_0557"
FT                   /product="cell surface elastin binding protein EbpS"
FT                   /note="Orthologue of SH1431"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39338"
FT                   /db_xref="GOA:A1A0V5"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V5"
FT                   /protein_id="BAF39338.1"
FT                   /translation="MTRTTMKPRASLTVRIVLAVMAALLVMAALWAIVNLAAVNSYNQA
FT                   TQSLQENISTSRKDDADWDKLHTRQQQTDAQFNEASAMKPLLLPQVRESIEHNSHVSSQ
FT                   LTDHASKKIKAEQSDQSASTDSNTADAQESDKSSHKNDENLSDEQRRKIEELLAQNAQS
FT                   TQSDPNDDSGSAAKKNPSTSSSQTKPW"
FT   CDS_pept        complement(699883..700902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0558"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Bcr"
FT                   /note="Orthologue of BL1807"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39339"
FT                   /db_xref="GOA:A1A0V6"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V6"
FT                   /protein_id="BAF39339.1"
FT                   /translation="MNHLTLSPALGWPVGGAVAVVLLACAIAQIVLHVRRRADSDETVW
FT                   ACVRRVLLCLTVSVMALTPSIVAPTNSRAVNATDVVVAVDVTGSMAVKDAQYGSAEQSS
FT                   RLDVAKQAVKDVTALYPNSSFAALRFGASGTLDVPLTPDSNAIDNWADTLAPEATSVSA
FT                   GSTLDAPIDQLLLTCKSIHDQHPDDAIVLYLFSDGEQTSSKARRTFSSLRRYLSDAFTV
FT                   AIGSEQGGNIPVIADGVDGNADQWVTDPDTGKPGVSRMNKDEMASIADELSGTALVLNA
FT                   SNTMRDGVSKEASDKWRVTQTTKKRTRTMPVVWPLAIVTLLLLACELGAWIIQSRSLL"
FT   CDS_pept        complement(700899..701966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0559"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Bcr"
FT                   /note="Orthologue of BL1808"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39340"
FT                   /db_xref="GOA:A1A0V7"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V7"
FT                   /protein_id="BAF39340.1"
FT                   /translation="MQLSWHWPWAFLAGVIVVLAVAGVTLLVAARHKTDGIESARTFSL
FT                   DDDLNTESASRLFRQWRVLSRLAVILLVVALALATALVARPSTVDEGEEKASSRDIVLC
FT                   LDVSGSALPYDREVIDTYRQLVDSFKGERIGLSIFNSTSRTVFPLTDDYELVSKQLGKA
FT                   SSILAGVESQDDIDKMKDSDYQAISDWLEGTQNRKESTSLIGDGVVSCAAMLPGFAYGN
FT                   ASADNAERQRAASIVLATDNVVSGKPTYTLDEALNLTKQAQITVDGLFSGPKQSEADET
FT                   TQKFKSAIEAHHGVFLTQSNGASVSSLVEEIESRRNHENESSNKAAMVDAPGWWTLALA
FT                   IVLMVWLALAWRLRR"
FT   CDS_pept        complement(701967..702488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0560"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1809"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39341"
FT                   /db_xref="GOA:A1A0V8"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V8"
FT                   /protein_id="BAF39341.1"
FT                   /translation="MLFLAEDDLVIKDQIHLENGLAVVIAVCLLLAVVLVALVVWLARP
FT                   SRKPAKIVNRGRHDALAGKTVWHQRIDDVVSRHARGELEREEAFAQLAAIARDFASTAT
FT                   GTDVRNQTLTDIEETPRTTGNQQGLTLLRQTIEALYPPEFADAERNHIARQATVEQAGE
FT                   WVANLVERWR"
FT   CDS_pept        complement(702488..703441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0561"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Acr"
FT                   /note="Orthologue of BL1810"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39342"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0V9"
FT                   /protein_id="BAF39342.1"
FT                   /translation="MIDQIRSDDPIRRKIETLGTTLSLPTVRKALGILEGAHASNKRFG
FT                   ADDVVDIHAYEPGDEAKRIDWKTSARAGRPMVVQRERPSTSKAWLLLDVGQEMTAACPS
FT                   SEQAYQVAANALCMFAALSLRRGDEVSMVFGDSASITRVPFNGGLAQFERTLDTALQRE
FT                   WTRPRNIDALLEYARRIRDKEALVVIATEEHALEERHLSAIRMIARTHPMVLIDVATIN
FT                   PFDVSHARVVLDGAGKRRVPAFLRRGNTAGQVRTHREYLAASIRHELNRCGSTVIRSDS
FT                   SERMFHEFVRMVSTALAQSTRNQLRAPSVLSLGDKA"
FT   CDS_pept        complement(703438..704505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0562"
FT                   /product="widely conserved MoxR-like protein in magnesium
FT                   chelatase family"
FT                   /note="COG family: MoxR-like ATPases"
FT                   /note="Orthologue of BL1811"
FT                   /note="PFAM_ID: AAA"
FT                   /note="PFAM_ID: Mg_chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39343"
FT                   /db_xref="GOA:A1A0W0"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W0"
FT                   /protein_id="BAF39343.1"
FT                   /translation="MALFPPKNPAPAPAPIPMPAAARPTTLSAEDIARARNIGSQIRGR
FT                   FAQTLVGQDNLRESLITTLVAGGHILIESVPGLAKTTAAQTLATSVSGSFKRVQCTPDL
FT                   MPSDLVGTQVFDFATQKFSTQIGPIHANFVLLDEINRSNAKTQSAMLEAMAEGATTIGG
FT                   QRIALPKPFMVIATQNPIEEEGTFNLPEAQMDRFMMKAVLTYPTEQEEQRMLAMLTRRG
FT                   SDTVDQHALTGDTVSISDVEFLRSAARRVHVSDAIMQYAVDIAATSRGAGTKPVQGLSS
FT                   LVRLGASPRASIALVRIGQANALLQGRDYVIPEDVKAFAHEVLRHRILMTFEALADGVT
FT                   SDQVVDSIVQAVPVP"
FT   CDS_pept        complement(704524..705228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="BAD_0563"
FT                   /product="Uracil-DNA glycosylase"
FT                   /note="Excises uracil residues from the DNA which canarise
FT                   as a result of misincorporation of dUMP residues byDNA
FT                   polymerase or due to deamination of cytosine"
FT                   /note="Orthologue of BL1812"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39344"
FT                   /db_xref="GOA:A1A0W1"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W1"
FT                   /protein_id="BAF39344.1"
FT                   /translation="MTHIKPLKDLVEPGWAQALADVEPQIHLMGDFLRSEIAAGRKYLP
FT                   ASRNILRAFTIPFDDIKVLIVGQDPYPTPGHPVGLSFCVAPDVKPIPRSLANIYTELTD
FT                   DLGVPMPANGDLTPWTKQGVMLLNRCLTVEPGKPGSHQGRGWEVVTDAAISALNNRRRP
FT                   DGSVKPLVAILWGRKAQTLEPLLTNAFIIKSPHPSPMSARYGFFGSKPFSRANQALIEA
FT                   GEQPVDWTLPSA"
FT   CDS_pept        705366..706079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0564"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1813"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39345"
FT                   /db_xref="GOA:A1A0W2"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W2"
FT                   /protein_id="BAF39345.1"
FT                   /translation="MRLQKMAKQDKETYESYAKDMFDNPPAGPMGVHRGARSMASRALP
FT                   YVIVVIVALLAGLLFWGVYSGEISNLRMPWSAKEDSSSSVSTADKADKKTDDTSKDAKT
FT                   ENKKSEDGKKTSTSDGQSKDASDANQNAEQNNDQNNGQDAASEQSVNLATEIRVVNATS
FT                   ITGYAKSKADALTQAGYTSVTPSNPTGNVPSQTVVWYQNEADKATAENVAQTLGISNVQ
FT                   QSSGLVTPIVVVLLN"
FT   CDS_pept        706354..707970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BAD_0565"
FT                   /product="groEL protein"
FT                   /note="60 kDa chaperone family; promotes refolding
FT                   ofmisfolded polypeptides especially under
FT                   stressfulconditions; forms two stacked rings of heptamers
FT                   to form abarrel-shaped 14mer; ends can be capped by GroES"
FT                   /note="60 kDa chaperonin (Protein Cpn60)"
FT                   /note="Orthologue of Rv0440_BL0002"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39346"
FT                   /db_xref="GOA:Q9REU4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9REU4"
FT                   /protein_id="BAF39346.1"
FT                   /translation="MAKMIAYDDEARQGMLAGLDKLADTVKVTLGPKGRNVVLDKTYGA
FT                   PTITNDGVSIAKEIDLDDPYERIGAELVKEVAKKTDDVAGDGTTTATVLAQSLVHEGLK
FT                   NVTAGSNPIALRRGIEKAADAIVKELVAAAKDVETKDQIAATATISAADPEVGEKIAEA
FT                   LDKVGQDGVVTVEDNNRFGLDLDFTEGMRFDKGYIAPYFVTNAEDQTAVLEDPYILLTS
FT                   GKLSSQQDVVHIAELVMKTGKPLLIIAEDVDGEALPTLILNNIRGTFKSCAVKAPGFGD
FT                   RRKAMLQDMAILTGAQVVSDELGLKLDSVDMSVLGTAKKVIVSKDETTIVSGGGSKEDV
FT                   AARVAQIRGEIANTDSDYDREKLQERLAKLAGGVAVIKVGAATEVEAKERKHRIEDAVR
FT                   NAKAAIEEGLLPGGGVALIQAAAKAKDDVKLEGDEATGAAIVFRAVEAPIKQIAENAGL
FT                   SGDVVIDKVRSLPDGQGLNAATNEYEDLLAAGVTDPVKVTRSALQNAASIAGLFLTTEA
FT                   VVANKPEPPAAAPAAGADMGY"
FT   CDS_pept        complement(708075..708365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0566"
FT                   /product="hypothetical protein"
FT                   /note="COG family: methyl-accepting chemotaxis protein"
FT                   /note="Orthologue of BL0003"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39347"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W4"
FT                   /protein_id="BAF39347.1"
FT                   /translation="MPQYQVDSEQIQSSSAAVNASIQSIRQAVQGMYGNLNNLQSVWRG
FT                   GAATQFTAVAEQWRAAQQQMEQSLESIQRALMQASTLYSETEMQASRLFAQ"
FT   CDS_pept        708499..709338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0567"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0004"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39348"
FT                   /db_xref="GOA:A1A0W5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W5"
FT                   /protein_id="BAF39348.1"
FT                   /translation="MHLGSVGVSRNGGRTAKGWNIAICMLLASVLGLCLMLWITPPVHA
FT                   DDSAGLGITATDDITDTQNLLGSNVSEITDAINQTKKETGVTVRLVYLDSFNAKGKPDK
FT                   WVSALLESLNPKPNTVMLAVASNDGNLVVAVSSNSEEWLKKKSTVDALSDAAQKPLMES
FT                   DPDWAKSATDMMNQISVQKKTSTSSRTIWIGVGGFAGALLLLVVILVVFHILRKKDVIG
FT                   HRRKGRHSGRHGAVAERIQPVKEWGAESENEDYVNPDTASTQDSESVQETSSEGSDA"
FT   CDS_pept        709342..710073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0568"
FT                   /product="response regulator of two-component system"
FT                   /note="COG family: response regulators consisting of
FT                   aCheY-like receiver domain and a HTH DNA-binding domain"
FT                   /note="Orthologue of BL0005"
FT                   /note="PFAM_ID: response_reg"
FT                   /note="PFAM_ID: trans_reg_C"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39349"
FT                   /db_xref="GOA:A1A0W6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W6"
FT                   /protein_id="BAF39349.1"
FT                   /translation="MSKPIEASIVVVDDEPSIRELLVASLHFAGFEVNTAASGSEAIEV
FT                   IERLQPDLIVLDVMLPDIDGFTVTRRIRQEGITTPVLYLTARDDTQDKVMGLTVGGDDY
FT                   VTKPFSLEEVVARIRAILRRTQQQVEDDPIIRVGDLEINEDSHDVSRAGQPIDLSPTEY
FT                   KLLRYLMDNEGRVLSKAQILDHVWQYDWGGDAAIVESYISYLRKKVDGIVIEDENGDKH
FT                   KVTPLIETKRGIGYMIRAPKN"
FT   CDS_pept        710148..711929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0569"
FT                   /product="sensor protein"
FT                   /note="COG family: sensory transduction histidine kinases"
FT                   /note="Orthologue of BL0006"
FT                   /note="PFAM_ID: HAMP"
FT                   /note="PFAM_ID: HATPase_c"
FT                   /note="PFAM_ID: signal"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39350"
FT                   /db_xref="GOA:A1A0W7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W7"
FT                   /protein_id="BAF39350.1"
FT                   /translation="MQPPRSLPKQNKVWSRFTRRIQAIPLSTKLVTCIIVLLTIGTIGI
FT                   SFSIRTLVGNYLLQKTDTQLINQAQLIFNSMDSLSSDTGDDGRSLMNTYYVEVRDSEYK
FT                   STGAGSVPMLRDGVVSEPSLPADGSIDGVTLGQPFTTRAVVHITTSRTPDHSIMQAAQS
FT                   PWRVVALPWNEKTRTGQVKDSGVVFIGLSLSDQIDTANTLTRFCAMVGIAVVLIGAILG
FT                   TILVQSTLAPLKRIEKTAAKIAAGDLSQRVPDLPESTEVGSLSMSLNTMLTRIEESFHA
FT                   QEETTEKMKRFVSDASHELRTPLAAIHGYAELYKMQRDMPGALERADESIEHIEASSAR
FT                   MTVLVEDLLSLARLDEGRGIDITQQVKLTSVVRDAADDLHALDPDRGISCGQVVLQPGT
FT                   DMDHPAQFAFQNGQMPQIELKGDASRLRQVVTNIVGNIHRYTPADSPVEISMGVLPASI
FT                   SPESLSRMPSNEQSLRHLVEAIEVGQSMQVGMNYAIVRFSDHGPGVPPEARSKIFERFY
FT                   TADPSRARQKGGTGLGMAIAQSVVKAHHGFICASGSEGTGLILTVVLPIAPVEPKPQPI
FT                   TASENRKNEKKNRKSKK"
FT   CDS_pept        712081..712473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspB"
FT                   /locus_tag="BAD_0570"
FT                   /product="cold shock protein"
FT                   /note="COG family: cold shock proteins"
FT                   /note="Orthologue of BL0007"
FT                   /note="PFAM_ID:CSD"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39351"
FT                   /db_xref="GOA:A1A0W8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W8"
FT                   /protein_id="BAF39351.1"
FT                   /translation="MPSGRVRWFDANKGYGFIQTGESTDDVFLPAAALPEGVKTLRKGA
FT                   KVEYSVIDGRRGPQAMGVTLVASAPSLVKATRPKPDDMAAIVEDLIKLLDSAGNQLRRH
FT                   RYPSPAESKKLATLLRAVADNFDVQE"
FT   CDS_pept        712480..713877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0571"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0008"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39352"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W9"
FT                   /protein_id="BAF39352.1"
FT                   /translation="MSDTTMDPKAIAQAVAVTVSDEDGQVGDFVEAIDLGDNVTDFRFE
FT                   SRVRGYEGWQWSVTLYHDVELDHWTVNESSLVPTDKALRPPKWIPWKDRLEPGDLAVTD
FT                   SIGTDPDDPRMEEGFRKTQDAETSDDTDDKPSVADETVQEPAMDGNASDESEKTDVSED
FT                   SEQPVTSEEDVEEAVEEFDLSRRHVLTPLGRSQTAKRWYEGPHGPKSLSTKTADGNPCS
FT                   TCGFFIPLKGELNLLFGVCANKWSPDDGRVVSIDHGCGEHSEIDPPEPSHLWVQSKPAF
FT                   DDMHIDIIAQAPRDERGSVELIEQLSSDDDHNPNEDEEGSDADIEANTIDDDASQEDVL
FT                   EHVASDDAPEVETTVTVVDENKPETSDDTESTDTAEPTESDEPVEQAEQVDSADSVNSA
FT                   ESFEPVEQMDETVVEPTAETTGQTENKSMEDESAEAESTEAESAAAETTESEMTEADSS
FT                   AQAESDE"
FT   CDS_pept        complement(713955..715019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0572"
FT                   /product="hypothetical protein"
FT                   /note="COG family: universal stress protein UspA andrelated
FT                   nucleotide-binding proteins"
FT                   /note="Orthologue of BL0009"
FT                   /note="PFAM_ID: Usp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39353"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X0"
FT                   /protein_id="BAF39353.1"
FT                   /translation="MDAKKRICLTYGNDQGGHQMSDTILQSNDVMDSRRGDIVVGVDGS
FT                   DESFAALRWALGEASLTGQQVNAVYAWTHSWDMGSQPEDEEQWAQMRHDIARRLREWVA
FT                   QASQGMTIDENRVKLTSVKATGTAALLEIGKDAQQIVVGRRSLGRVARWFLGSLSASLA
FT                   EEAKVPVTVVRILDDEEASVQDAIANALTPTEETVSYTMPGSPLPRNQRPVVVGVDGSE
FT                   TSKHALRFAIDFAALHHAPLQVMFCWQLKDLGVVKGYENAVAPISVGQAQAERMLDELL
FT                   DSVQVSSANIPDDFQIESHAFHIPASKGLIAASRYARHLVVGSRGLSGLDAHFLGSVSK
FT                   QIINFADCTVTVVH"
FT   CDS_pept        715102..717696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC1"
FT                   /locus_tag="BAD_0573"
FT                   /product="probable ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /note="Orthologue of Rv3596c_BL0010"
FT                   /note="ProbableclpC1_ ATP-dependent protease ATP-binding
FT                   subunit (EC3.4.-.-)"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39354"
FT                   /db_xref="GOA:A1A0X1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X1"
FT                   /protein_id="BAF39354.1"
FT                   /translation="MFERFTDRARRVIVLAQEEARTLQHNYIGTEHLLLGLIREGEGVA
FT                   AKALASKGVTLDDTRKQVEEMIGKGNASPNGHIPFTPHARQVLELSLREALQLGHSYIG
FT                   TEHILLGLIHEGEGVGTQVLIKMDVNLGELRSATIDLIRGNSSDGKNDSKGELANAGGV
FT                   QDRRNQTGSAILDQFGRNLTAEAAAGKLDPVIGRSNEIERVMVVLSRRTKNNPVLIGEP
FT                   GVGKTAVVEGLAQKINAGDVPETLKGKQVYSLDLGSMVAGSRYRGDFEERLKKVLKEIK
FT                   TRGDIVLFIDEIHTIVGAGSADGALGASDMLKPMLARGELQTIGATTTDEYRKYIEKDA
FT                   ALERRFQPIQVHEPTIAETIEILKGLRERYENHHHVTITDGALQAAAELSSRYIQDRHL
FT                   PDKAIDLIDEAGARLRIRRLTAPPELKELDAKAAKLAEEKDQAIKDQDFEKAAELRDKQ
FT                   EKIESERKEKESAWREGESDVKMVVDEDVIAEVISQTTGIPVFKLTQAESKKLMGMESE
FT                   LHKRIIGQDEAVSALSRSIRRARVGLKDPKRPAGSFIFAGPTGVGKTELAKALAEFLFD
FT                   DEDALIRVDMSEFSEKYAASRLFGAPPGYVGYEEGGELTEKVRRKPFSVVLFDEIEKAH
FT                   PDIFNTLLQVLDDGHLTDGQGRKVDFKNTIIILTTNLGTRDIAKAANTGFNLGTNTESS
FT                   YQRMKEQVSAELKQQFRPEFLNRLDDIIVFKQLTEPQVRQIVDLDVKQLNDRLFDRHMS
FT                   LELTDAAKDLLAQKGFDPLLGARPLRRVIQRDIEDAISEKILMGDLEDGQRVRVDAEGE
FT                   GILGEFTFTGEAFEEPNQKDNPAEATETATETDAATEPTASTEPADSAQSQN"
FT   CDS_pept        complement(717891..719318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0574"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0016"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39355"
FT                   /db_xref="InterPro:IPR007139"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X2"
FT                   /protein_id="BAF39355.1"
FT                   /translation="MADENVTASENTTETNEQAATPATQASKPAVPSPAAMKPHAPSPA
FT                   AFAKKAPQRPATSTGFSEADIKATEAFGRVADDGTVFVKEGEGEREVGQFPDASKEEAL
FT                   ALYARRYLDLKAKLDLFANRLKSSNVKNREIDESIKTLSAEIEQPAVVGDIEALKSQFE
FT                   ALKEAGAAKKAELSEAHKAAVAKALAERTAIVEKAEALANSLGDNTNWRSTADKFRSLF
FT                   QQWQDHQHNSVRLDKADADALWSRFSSARTTFNSARRKWAQGRDEERSNAKAAKEAIIA
FT                   EAEEIKDSTAWVETSRKFNELMDRWKKAGRAGRRDDDALWARFRAAADTFFNARQTDRE
FT                   QISSSEKENLAKKEELLTKAEALVPVKDEKAAKQARQALAAIQEEWDQIGYVPRDDMHR
FT                   IESRLDAVDKQIKAVEDAAWKQSDPEADARKSSFEEQLNAQLAELNAQIAAESDPKKKA
FT                   KLEAEKATKEQWLNAIK"
FT   CDS_pept        719433..720824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="BAD_0575"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="COG family:histidyl-tRNA synthetase"
FT                   /note="Histidine--tRNA ligase"
FT                   /note="Orthologue of BL0017"
FT                   /note="PFAM_ID: tRNA-synt_2b"
FT                   /note="PFAM_ID:HGTP_anticodon"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39356"
FT                   /db_xref="GOA:A1A0X3"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X3"
FT                   /protein_id="BAF39356.1"
FT                   /translation="MAKGASISGFPEWLPSERVVEQRVIDTLRNVFELNGFIGIETRAV
FT                   EQGSSLLKKGETSKEIYLLSRLQEVGHESDTPIEDRLGLHFDLTVPLSRYVVEHSGDLA
FT                   FPFKRWQIQKVWRGERPQEGRFREFVQADIDVIGNGDLPDHYEVELPLVMVSALERLRE
FT                   FGLPKATVHANNRKLSEGFYRGLGLTDIEGVLREIDKLDKIGADEVAKLLVEGCGADEA
FT                   QARACLELAELTAADGKELSDKFDALCAKHDIASDSDAYVLARQGLDTLAMIVDEAARI
FT                   RPGSVIADLKIARGLDYYTGSVYETFLDGAAALGSICSGGRYDNLASQGNKKYPGVGLS
FT                   IGLSRLVSYMLHTAGAHANRVSPASVLVAVWNEADRSASNLIANQLRSRGIAADVAPTA
FT                   AKLGKQIKYADKLGIPYVWFPADASEEGAQDEVKNIITGDQRPADAQSWEPDTVYAQQT
FT                   VTVEA"
FT   CDS_pept        720872..722671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="BAD_0576"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="Catalyzes a two-step reaction_ first charging
FT                   anaspartate molecule by linking its carboxyl group to
FT                   thealpha-phosphate of ATP_ followed by transfer of
FT                   theaminoacyl-adenylate to its tRNA"
FT                   /note="Orthologue of Rv2572c_BL0018"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39357"
FT                   /db_xref="GOA:A1A0X4"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X4"
FT                   /protein_id="BAF39357.1"
FT                   /translation="MSQTAYRTHHATEVTEQLVGQKVTLAGWVDRRRDHGGVAFIDLRD
FT                   NTGLVQVVIYDEEMARPLRSEFVIQVVGEVRLRPDGNENEHLATGKIEVVAESIEVLAK
FT                   SDALPFQVSTALENESENKLPGEDVRLKYRYLDLRRPSMQRNLKLRAQMSKAARHALEE
FT                   MGFEEIETPTMIKSTPEGARDFVVPARLVPGSWYALPQSPQLLKQLLMVSGVERYYQLA
FT                   RCYRDEDFRADRQPEFTQLDMEMAFVDQEDVMAMAEKVIAAIWKSAGYDIKLPIQRITW
FT                   QDAMDKYGSDKPDLRFGNPLIELTDYFKNTPFRVFQAPYVGAVLFKGGAATPRRQFDAW
FT                   QDWAKQRGAKGLAYVVFAENGELKGPVAKNLSEEERNGLKEAVGAEDGDAVFFAAGRRT
FT                   SSQELLGAVRVELARRAGLLKPDDFAFTWVVDFPLFKPTDDPDDDDVAVGHSKWTSMHH
FT                   PFTMPSKDWIDKFDKDPEHAMSDSYDIVCNGNEMGGGSVRIHRDDIQDRVLDVLGITPE
FT                   EAADKFGFLLEAFKYGAPPHAGIALGWDRTAAILAGADSIRDVIAFPKAGGGRDPLTGA
FT                   PAPISAEQRAETGVDYDPDEDED"
FT   CDS_pept        722865..724370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0577"
FT                   /product="similar to glutamine ABC transporter (binding and
FT                   transport protein)"
FT                   /note="Orthologue of lin0840"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39358"
FT                   /db_xref="GOA:A1A0X5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X5"
FT                   /protein_id="BAF39358.1"
FT                   /translation="MRICALFAVLAVVFAAFMTTVPHALASETGNPASVKGKTYKIGTD
FT                   TTFAPFEYRENGKMTGIDMELIRGIAKEEGFKVEIQSLGFNAALQALSSNQVDVVIAGM
FT                   SITDERKASYDFSNPYFQSGIQMAVAANNDDVTGYKDLKGRTVVAKTGSEGESYAKQHA
FT                   DKYGYKVTSVDQSSTMYEMVKSGNAVAVFDDYPVLAYGVSQNNGLKIVTPKVPHGEYGM
FT                   AVNKGMNADLLAAINDGLNKMIASGEYERIVAQYLGKQGAKEQAKSISGMITDNGDNSA
FT                   EQQKVGFLGLVKQSMPALLTGLRNTLLITLLSFAIALVLGVAFGLMKVSESKIAAGLAN
FT                   VYIAVFRGTPILVWAFFFYFGVPQLIGHSVNIWVAGALTLSLNSGAYLAEIVRGAVQSV
FT                   DSGQMEGARSLGLNHRQAMRRVILPQASKIAMPSIINQLVIMIKDSSLLLAIGFGELLY
FT                   QAQQLYAANFRVTETLLIVGVMYFVAITILTWLANIVDRKVNR"
FT   CDS_pept        724367..725107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0578"
FT                   /product="putative amino acid ABC transporter"
FT                   /note="ATP-binding protein"
FT                   /note="Orthologue of SMU.805c"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39359"
FT                   /db_xref="GOA:A1A0X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X6"
FT                   /protein_id="BAF39359.1"
FT                   /translation="MNENDVIIDVKDLHKSYGQTEVIKGVDMTVRKGEVICIIGPSGAG
FT                   KSTILRCLNGLEQATGGKIVVNGHDLTDSHVNIDQVREQVGMVFQHFNLFNNMSVIDNI
FT                   TLAPKLVHHETDEQARAHAMELLKTVGLAEKADAMPKSLSGGQKQRVAIARSLAMNPKV
FT                   MLFDEATSALDPEMVGDVLEVIRDLAAKGMTMVLVTHEMGFAREVATRVIFTDAGVIEE
FT                   EGTPDEIFNHPKSERLKTFLSKVL"
FT   CDS_pept        725242..726039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluA"
FT                   /locus_tag="BAD_0579"
FT                   /product="ATP-binding protein of ABC transporter for
FT                   glutamate"
FT                   /note="COG family: ABC-type polar amino acidtransport
FT                   system_ ATPase component"
FT                   /note="Orthologue of BL0021"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39360"
FT                   /db_xref="GOA:A1A0X7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X7"
FT                   /protein_id="BAF39360.1"
FT                   /translation="MSEMKETEAKRPIMPDAGADNRPLVELTHVEKHYGDLHVLKDINL
FT                   TVRKGEVLVIVGPSGSGKSTMCRTINRLETIDSGDIRIDGKPLPQEGKELAKLRAEVGM
FT                   VFQSFNLFANKTILENVTLAPIKVRHMDKKAAEDLAMDLLGRVGVASQASKMPSQLSGG
FT                   QQQRVAIARALAMQPKVMLFDEPTSALDPEMVNEVLDVMVELAHEGMTMLCVTHEMGFA
FT                   RKVADKVVFMADGQILEQSTPDDFFEHPKTDRAKDFLSKILTH"
FT   CDS_pept        726106..726918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluB"
FT                   /locus_tag="BAD_0580"
FT                   /product="glutamate-binding protein of ABC transporter
FT                   system"
FT                   /note="COG family: ABC-type amino acid transportsystem_
FT                   periplasmic component"
FT                   /note="Orthologue of BL0022"
FT                   /note="PFAM_ID: SBP_bac_3"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39361"
FT                   /db_xref="GOA:A1A0X8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X8"
FT                   /protein_id="BAF39361.1"
FT                   /translation="MLRRAVAAFCACACVFAVSACGADETGKIRIGIKFDQPGLGFKKN
FT                   GTYVGFDVDVAKYVAKKLGYSEDEIVWKESPSKQREAMLQNGDVDYIVASYSITDERKK
FT                   VVDFAGPYFVAGQDLLVRKDETGIDGPKDLNGKRLCSMTGTTSAVNVKEKFAKQTQLME
FT                   QPGMAECATALLSGIVDAATTDDIILAGLASASRGRLRVVGKPFTQEYYGIGVKKGNTE
FT                   LKNKINNAITDMIQDGSWQRAISDNTRGVAYTPNAKYNPPVPNGKGNK"
FT   CDS_pept        726918..727595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluC"
FT                   /locus_tag="BAD_0581"
FT                   /product="permease protein of ABC transporter for
FT                   glutamate"
FT                   /note="COG family: ABC-type amino acid transportsystem_
FT                   permease component"
FT                   /note="Orthologue of BL0023"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39362"
FT                   /db_xref="GOA:A1A0X9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0X9"
FT                   /protein_id="BAF39362.1"
FT                   /translation="MDGFLALFSQYNIPGAFLVNIELTLWSALFSTILGVILVMMRISP
FT                   IASLRTVSGAYVELFKNLPLTIIMVFMVLGAYAQLKFSFSDTFATNFFWLAVTGLSLYT
FT                   AAFVCESLRSGINTVPLGQAEAARALGLNFMQAATQIILPQAFRGSVAPLGNTLIALLK
FT                   NSTVAAAASVATETSTMMSEMIEYHADQIVPIFLIFAFGYVVLIIPIGMLTTYLSNKLA
FT                   VRR"
FT   CDS_pept        727602..728729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluD"
FT                   /locus_tag="BAD_0582"
FT                   /product="permease protein of ABC transporter for
FT                   glutamate"
FT                   /note="COG family: ABC-type amino acid transportsystem_
FT                   permease component"
FT                   /note="Orthologue of BL0024"
FT                   /note="PFAM_ID: BPD_transp"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39363"
FT                   /db_xref="GOA:A1A0Y0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y0"
FT                   /protein_id="BAF39363.1"
FT                   /translation="MASNESAVLFDQPGPKGRKTIRIVNWIAGIIFAVVVVLILMRLHN
FT                   PPDGENQLSWELWKPALDAEAWTDFYLPGLWATIRASVLAVVGAVVFGLVFGVGRLLPS
FT                   LLIRTISGAIVEFARAVPVLLLMIFFWRWFAFAGLPSPAYWAVVLALVIYNGSVVAELV
FT                   RSGVGNLPNGQREASLALGLTRTQSLLQIEVPQAIYAMLPAAVTQLVVVLKDTALGSII
FT                   MYTDLLQESRRLGSMYFNILQTLVVAAVVYFIVCWLLSRLAEWLPSRMQQHTAAPAEPE
FT                   PVAPIAIMDPSNVNQIAVAKEGVPLGGAQRVYHVHHRGTNASIHQWRQTRYAQGFDETH
FT                   PESQVKFDKNGHPIKDNPFKTKGDGKDKNKSEADE"
FT   CDS_pept        728890..729849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0583"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized Bcr"
FT                   /note="Orthologue of BL0027"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39364"
FT                   /db_xref="GOA:A1A0Y1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y1"
FT                   /protein_id="BAF39364.1"
FT                   /translation="MSSIAKTLNKVEDRLEKSENCDSVAEGLANAAKASELLSSVWTLP
FT                   PTQLLRFHHDTKVSDIDGDSTPGFDGNKDDAERFISISSSEIARYQRLMYANGVKGSHR
FT                   RLLIVLQGMDASGKGGIVRHVFSQGDPMGMHYHGFGAPKGEELDHDYLWRIKRELPNNG
FT                   WISIFDRSHYEDIVMPRIYKTQPEEMWQARYDEINRFESQLTADGCAIIKIFLVVSKDE
FT                   QKRHFLSRLDDPTKYWKFDPSDLEARARWDDYMAAWQDVFLRTSTEQAPWYLVPADNRW
FT                   YSRAVVSELLRNTLKNMNMIWPPLEVDADEMRRQLDTL"
FT   CDS_pept        complement(729831..732389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0584"
FT                   /product="probable DEAD box-like helicase"
FT                   /note="Orthologue of Tfu_0878_BL0028"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39365"
FT                   /db_xref="GOA:A1A0Y2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021904"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y2"
FT                   /protein_id="BAF39365.1"
FT                   /translation="MADDTNYGSLGALAPNWDEGERNIDTDEIYERFFTWVEDVKGVEP
FT                   WPHQEEAIMDLLAGDHVILNTPTGSGKSLVALGMHFAALCTGRRSYYTAPIKALVSEKF
FT                   FDLVEVFGRENVGMITGDTHINADAPIICCTAEILANQALREGRHADVGCVAMDEFHYY
FT                   GDPERGWAWQVPLLTLPDTQFLLMSATLGNVDAIADKLEDMTDTDVDIIADAPRPVPLT
FT                   YEYTLDPLEKTVELAFGKGETPIYVVHFSQDAALETANALASTGVSSKEQRAAIAEAIK
FT                   GTKFTTAFGKILQRLLRTGIGIHHAGMLPRYRRLVEQLAQQGLLPVICGTDTLGVGINV
FT                   PIHSVVLTALTKFDGTKMRKLRAREFHQIAGRAGRMGFDTEGLVIAEAPEFEIENAKAL
FT                   AKAGNDPKKLKKIKRKKAPEGFVTWNENTFDKLIDAAPETLVPHMKITHSMVLNEVEQG
FT                   GDARYRIDRLIDDSAQTPEQKERLHARADEIFQTLFDTNVIETEDRDDGGKDYFMTVDM
FT                   PDDFALDQPLSPFLLAALELLDPESDTYALDVISMVEATLEDPKQVLRAQERQARDEAM
FT                   IRMKEDGLDYDERMDRLQEITYPKPLEDMLQAAFDEYRHDVPWANDYWLSPKSVVRDMV
FT                   ETASDFTGYIARYNIARSEGTLLRYLSDAYRALARTVPQEKRDEQLDDIISWLRVVVRS
FT                   IDSSLVDEWEHAGTDTDASEAAANLAAPGAKQAVVEDRRGLTVLVRNAMFRRVQLMDLD
FT                   KPDELGALDKDWGYGVHEWEDTLDDYYDEHEYVNIDAKARSGELFILDESKENSEHAWK
FT                   VRQIIDDSDGDHDWAITGTVDLDATQSSGEVVFFDYSVSN"
FT   CDS_pept        732473..733873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0585"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized ATPase related to
FT                   thehelicase subunit of the holliday junction resolvase"
FT                   /note="Orthologue of BL0029"
FT                   /note="PFAM_ID: AAA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39366"
FT                   /db_xref="GOA:A1A0Y3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y3"
FT                   /protein_id="BAF39366.1"
FT                   /translation="MTDDLFAAMDAPDDVTRPLAVRMRPASIDDVVGQSRVLGEGSPLR
FT                   RLANPASKGSLTAPSSIILFGPPGVGKTTLAYIVAKQSGRVFEELSAVTSGVKDVRDVL
FT                   KRAHERLVSEGKETVLFIDEVHRFSKSQQDALLPSVENRDVTFIAATTENPSFSVIKPL
FT                   LSRSVVVKLESLEPDDLKTLINRAIASEHGLDNEIRITDEAVDEIIRMAGGDARKTLTI
FT                   LEAAAGALTGDKERKKGAKRPIITPDVVSKVMDVATVRYDKDGDDHYDVISAFIKSMRG
FT                   SDPDATMHYLARMLRAGEDPRFIARRIMIAASEEVGMAAPQVLQVTVAAAQAVAMIGMP
FT                   EARIILAEAALAVATAPKSNASYNAINAALADVDAGLIGQVPLHLRNAPTALMKSWGNH
FT                   EGYRYAHDWPGAVAPQQYMPDELQGREYYHPNDRGYEHEVKPRLERIRKILHEEDDNGD
FT                   GRSGQRNA"
FT   CDS_pept        734012..735523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0586"
FT                   /product="probable efflux-type transporter"
FT                   /note="COG family: permeases of the major
FT                   facilitatorsuperfamily"
FT                   /note="Orthologue of BL0037"
FT                   /note="PFAM_ID: sugar_tr"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39367"
FT                   /db_xref="GOA:A1A0Y4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y4"
FT                   /protein_id="BAF39367.1"
FT                   /translation="MKERNTTLETTDHNNRNNSENIKETPDERIPGKLIGAIVAVGSLA
FT                   FIGILTETVMTVLFPQLMREFNVNTATVQWITTIYLLTVAATMPLSSYLNRKFKHRVLF
FT                   LAAVALAMLGSLTMIFGHAFPVILVARIIQGIGSGVATPLMMNIILEQSPRSKVGRLMG
FT                   VGSLVITVAPAIGPTVGGAVSSILPWRAIFVIVIPVILLISLPVGLKCIEQHRPTEEAH
FT                   LNPLQFAAIVLALCGLVMFLNQAGVAVAAAVSGGVATAPAIFAVISLIVGLGSLFFFGW
FT                   SSRRSFSPLIRLGWLRDPMVLLHLIAYMLLPIVGIGFGYVITNLAQLSLGTNAFLAGAL
FT                   VLPGALIGAFFAPIGGTLYDRFGPVRPILGAFFLAICGPILLLVFSMRLTPATLAGFYF
FT                   IFGLGYALGFSNIMTNALRSIAPQFMPDGNAVFNTCLQFGGAAGTALFSTVLSVAQAGA
FT                   GKEGTEAFSHATAVGGSWTFTVMIVIVAVAICCLITAFRIGAKRE"
FT   CDS_pept        735629..736249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clp1"
FT                   /locus_tag="BAD_0587"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 2"
FT                   /note="COG family: proteasesubunit of ATP-dependent Clp
FT                   proteases"
FT                   /note="Endopeptidase Clp1"
FT                   /note="Orthologue of BL0945"
FT                   /note="PFAM_ID:CLP_protease"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39368"
FT                   /db_xref="GOA:A1A0Y5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y5"
FT                   /protein_id="BAF39368.1"
FT                   /translation="MSNLSAPLPVMAGEDMPAGPTDPIFNRLLKDRIIWMGEEVKDEMA
FT                   NRICAQMLMLAAEDPKKDIWLYINSPGGSITAGMAIYDTMQLIEPDVATVGLGMCASMG
FT                   QFLLSSGTKGKRFLTSHARVLMHQPSGGIGGTATDVRINAELIMDMKKTMSELTAEQTG
FT                   HTVEEIYRDNEYDHWFTAQEALEYGFVDKLVSTHDTMSATKGE"
FT   CDS_pept        736252..736953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP2"
FT                   /locus_tag="BAD_0588"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 1"
FT                   /note="Hydrolyzes proteins to small peptides with theATPase
FT                   subunits ClpA or ClpX_ ClpP degrades specificsubstrates"
FT                   /note="Orthologue of BL0944"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39369"
FT                   /db_xref="GOA:A1A0Y6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y6"
FT                   /protein_id="BAF39369.1"
FT                   /translation="MASEEAQFVARAERLAGPTGVVGFQGAAAREAAFAPQNRYVLPQF
FT                   EEKTPYGYKRQDPYTRLFEDRIIFMGVQVDDTSADDIMAQLLVLESQDPNRDVMMYINS
FT                   PGGSMTAMTAIYDTMQYIKPDVQTVCLGQAASAAAILLAAGAKGKRLMLPNARVLIHQP
FT                   AIDQGFGKATEIEIQAKEMLRMREWLENTLAKHTGRDIEKIRKDIEVDTFLTAQEAKEY
FT                   GIVDEVLEHRS"
FT   CDS_pept        736950..738371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="BAD_0589"
FT                   /product="ATP-dependent specificity component of the Clp
FT                   protease"
FT                   /note="COG family: ATP-dependent protease Clp_ATPase
FT                   subunit"
FT                   /note="Orthologue of BL0943"
FT                   /note="PFAM_ID: AAA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39370"
FT                   /db_xref="GOA:A1A0Y7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y7"
FT                   /protein_id="BAF39370.1"
FT                   /translation="MSLRWNDIFTNAIPLPGRGRGIVFSKRQICETKRLRMGRVVSYND
FT                   AVPRCTFCGKSESQVRKLVTGSGAAICDECIELCVDIISEERDKDAQLNILQLPKPAQI
FT                   SAYLDNHVIGQESAKKTLSVAVYNHYKRVNMEMRESSRIGKERMHGHDDSFEGVQVAKS
FT                   NILLLGPTGVGKTYLAQTLAHVMNVPFVIADATTLTEAGYVGDDVETVLQRLIQAADGD
FT                   VARAQQGIVYIDEIDKIARKSGENTSITRDVSGEGVQQALLKILEGTVASVPVEGTRKH
FT                   REMETVQIDTRDILFICGGAFVGLADIVAQRLGARESGFGAVWHDHEVPKRELLAQVSA
FT                   DDLADFGLLPEFIGRLPVVSVLEELTEDDLARILVEPENALVKQYQKLFAVDGVTLTFT
FT                   EGAIRQIAATSIRRGTGARGLRSIIEKTLEDTMFRLPSMEGVEEVVVDEAAVTGSGTPK
FT                   LLKVSTQKIPRLREA"
FT   tRNA            738459..738535
FT                   /gene="argU"
FT                   /locus_tag="BAD_t0030"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:738493..738495,aa:Arg,seq:acg)"
FT                   /note="codon recognized:ACG"
FT   tRNA            738577..738650
FT                   /gene="argV"
FT                   /locus_tag="BAD_t0031"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:738611..738613,aa:Arg,seq:acg)"
FT                   /note="codon recognized:ACG"
FT   CDS_pept        738838..740202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="BAD_0590"
FT                   /product="probable sodium/proton antiporter"
FT                   /note="COG family: Na+_H+ antiporter"
FT                   /note="Orthologue of BL0942"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39371"
FT                   /db_xref="GOA:A1A0Y8"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0Y8"
FT                   /protein_id="BAF39371.1"
FT                   /translation="MMATSKRGTWATIRRIAASDRISGLIMLGFALAGLLLANLPFTAH
FT                   AFEQLENFHIAIPHTNIDMGLGHWVQDGLLTVFFLTVGLELKQELTTGSLSNPKAAAVP
FT                   MLCAVGGMLAPPVLFIGVISLFAAAGSGQLVIASGTSFSFAQMSNGWAVPTATDIAFSL
FT                   AVLALFAKALPGSIRAFLMTLATVDDLLAIILIAVFFSSVNAWYWFLGIAVCAVVWYFL
FT                   VRMRKVPWLAVAIVGVLAWVMMFEAGVHPTLAGVLVGLLTPAHERFGEKTPRAERYADK
FT                   LQPFSALLALPIFALFATGVHFESLTLALFVSPVVVAVMVALVVGKPLGIMTTAWLSTH
FT                   VGGLKMAKGLRVRDMFPAACACGIGFTVSFLIASLAYQDAELSAEARFGVLVGSMVAAV
FT                   ISGILLSRQSKRFELEDGTKHKHHTGDEDAMNEVETVLEDGTVVVSQIIGTHQEQ"
FT   CDS_pept        complement(740299..740970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safC"
FT                   /locus_tag="BAD_0591"
FT                   /product="probable methyltransferase"
FT                   /note="COG family: SAM-dependent methyltransferases"
FT                   /note="Orthologue of BL0940"
FT                   /note="PFAM_ID: Methyltransf_3"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39372"
FT                   /db_xref="GOA:A1A0Y9"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Y9"
FT                   /protein_id="BAF39372.1"
FT                   /translation="MDRTSYTNLAKSWEYVEDHAFSRQSAELNAIRTAAEEAGIPQGSA
FT                   AQAELLRMLVRMLDASSVIAIGTGSVVETMQLINGLDNAGQLTAVDSSTQGIALIRKLF
FT                   NRLSDDTETTLRAVNASAGVFLPRLNAENYDLIVVAGDSENYAAAFAQAPRLLKPHAAI
FT                   VFTDVLAFDSATSAGGVLNPANRDAKSIAMRELLETVESDERFVTALTPTGTGLLVAVK
FT                   K"
FT   CDS_pept        complement(740972..741889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0592"
FT                   /product="probable iron sulfur protein associated with
FT                   succinate dehydrogenase"
FT                   /note="COG family: succinate
FT                   dehydrogenase_fumaratereductase Fe-S protein"
FT                   /note="Orthologue of BL0939"
FT                   /note="fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39373"
FT                   /db_xref="GOA:A1A0Z0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z0"
FT                   /protein_id="BAF39373.1"
FT                   /translation="MSGMENGMETVTLRVNRFTPRPERGRERGGSPFARKSSPFGDSGS
FT                   ARRRPRGKQWVQDYVVPARPEDTVLDCLLKVKRTIDPTLAFRYSCGHGMCGSDAVSING
FT                   TPTLLCTATVKAWAKQPSDAQVDEDGFRHTGEDVQPAQTQDADDLGVIELAPLPGFPVQ
FT                   RDLIADIDQMLGQIRKLKPYLQASGELATTADGKINAFEYLQNPQQLSKYELLSNCIAC
FT                   GTCEGSCPVYAGGEAFIGPAALIAASRFINDSRDGQTDARMDAIDSADGIAACQSVRAC
FT                   TRECPRGIDVGEEIWQLIAQIKER"
FT   CDS_pept        complement(741948..743804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="BAD_0593"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /note="COG family: succinate
FT                   dehydrogenase_fumaratereductase_ flavoprotein subunits"
FT                   /note="Orthologue of BL0938"
FT                   /note="PFAM_ID: FAD_binding_2"
FT                   /note="PFAM_ID: succ_DH_flav_C"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39374"
FT                   /db_xref="GOA:A1A0Z1"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z1"
FT                   /protein_id="BAF39374.1"
FT                   /translation="MSPKHVEDMYDAVIVGAGAAGLSAALGMLRSERMRQMRADGIEPN
FT                   VLVISKLQPLRSHTGSAEGGIAASLGNVEKDDWHWHYYDTVKGGDWLVDQDAAKLLAEQ
FT                   APATVIALEHAGVAFSRTDDGHIAQRRFGGHTKDFGKEPVRRAAYAADRIGHQILFSLW
FT                   QQCVAEGVEFAEEWYVTDLVVSEDHGKVEGVVAFDTHKGETHAIHARNVLMATGGAGRL
FT                   FHTTSNSWDLTGDGMALTLSAGLQLEDSEFVQFHPTGLAHTGILLSEAARAEGGMLRNS
FT                   DGEAFMEHYAPGHADLAARDVVSRSIMAEIDAGRGIADPKDPDGPKDCVWLDMTGIDAD
FT                   HMHEVLPQVVETIEQYADLDPTRDYVPVKPTAHYTMGGIPITTDGEVYRWVDGERAVVD
FT                   GLFAAGECSCVSVHGANRLGGNSLLDACLFGTRSGKAMAERVVDNPVNDPMAEPADEAS
FT                   IDAVSQAADKRSAQVKELLTRPSDDDDASSDNPYQLMADLGSVMEQAVAVRCDRNSIEQ
FT                   ALATLDDTLTPRAEALHAHSDSPTFNQEITAIWEVRHLLELGKAVLAASDARHESRGSL
FT                   KRLDFPERDDEHFLAHSMTDVSCQVSWQPVHIVDMPPKAREY"
FT   CDS_pept        complement(743873..745177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0594"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted
FT                   Rossmann-foldnucleotide-binding protein involved in DNA
FT                   uptake"
FT                   /note="Orthologue of BL0937"
FT                   /note="PFAM_ID: SMF"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39375"
FT                   /db_xref="GOA:A1A0Z2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z2"
FT                   /protein_id="BAF39375.1"
FT                   /translation="MMVTIDDETLARAVLTFCLDSADAMMYALVKGTGSAASALQLIAD
FT                   SGPGNHENVTAAACTSLDAAFINGVTRWGRTINARGMASFHGSLVSWQQRLASLPSKDP
FT                   DALRDWFTADGTQWIIAPHHPCWPSQLNDLSLRTDWASPLCLWGKGDPKALVSCPEPVG
FT                   IVGSRGVSDYGRQSAHELALRMARAGHLVVSGGALGTDAAAHWGAVKAMDEMSAALAGR
FT                   TVAVFAGGLNHIGPKSNQNLFEQIESHSGALISELCPGTVPEARRFLLRNRLIAALSST
FT                   LIVAQARARSGALNTAGWANELNRNLFAVPGDITMPHNTGCNRLIQDGRATIVCSLAEI
FT                   DELCHSAHRPQHVDLPDDTEHPQESTDESDDAILAAIKTCAEANGHVSADNLLDLMDKT
FT                   HPGEYPVSRIMRELGSLELEGRISMRSGWIIAEQR"
FT   CDS_pept        complement(745174..746703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0595"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted ATPase with chaperoneactivity"
FT                   /note="Orthologue of BL0936"
FT                   /note="PFAM_ID: Mg_chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39376"
FT                   /db_xref="GOA:A1A0Z3"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z3"
FT                   /protein_id="BAF39376.1"
FT                   /translation="MAIGSALSVGLIGLKAFIVQIQAFVSPGLPYFSIIGLPDTSLSEA
FT                   RERVKSACQASGFKWPETRVTVNLSPASMPKKGSSHDLAIAASVLSAAGAIAHDCLAGT
FT                   IVLGEVNLDGTVLPINGLLPIMLHAREQGIATIIVPYANLDEARLVPDVKAIGVRHVGE
FT                   LIELMGGDADYRIPEATHAVNADVGATGMCPPPGDMSEVMGQQAAKWALEVAAAGGHHL
FT                   MMTGPPGTGKTMLASRIPGIMSPLNETEQLEVASIRSLCGTLPGYGISDVPPFEAPHHT
FT                   ASTAALVGGGAGLAQPGAITRAHRGILFMDEAPEFSARTLQTLREPLESGYVAISRAKG
FT                   TTYYPARFQLIMAANPCPCGYAYGNGERCTCREKDRVKYFSRLSGPILDRIDIQIEVPP
FT                   VERISPGNAPSGDSSHAIRLRVIVARQMAQERFREFGWCCNAQATSTWLRANTSPKAIE
FT                   LVNRALASERLSLRGADRAMRLAWTLSDLAGKTSPGPEEMMQGISMRTRLA"
FT   CDS_pept        complement(746703..747155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0596"
FT                   /product="hypothetical protein"
FT                   /note="COG family: predicted endonuclease distantlyrelated
FT                   to archaeal holliday junction resolvase"
FT                   /note="Orthologue of BL0935"
FT                   /note="PFAM_ID:UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39377"
FT                   /db_xref="GOA:A1A0Z4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0Z4"
FT                   /protein_id="BAF39377.1"
FT                   /translation="MNHSSSHDVPAPTQPPEQILDSLARRLHDGTLRSRQIGELGEQYA
FT                   AAWLESQGWRTLDRNWHCRYGELDVVSRNPMGQIVFVEVKTRRTMRYGTPQEAVTASKQ
FT                   INLRHAAVQWLTAPEHRMPNSGVRFDVVTVVVQGDRPLLHHIEGAF"
FT   CDS_pept        complement(747325..748200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0597"
FT                   /product="possible pyridoxine kinase"
FT                   /note="COG family:pyridoxal_pyridoxine_pyridoxamine kinase"
FT                   /note="Orthologue of BL0934"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39378"
FT                   /db_xref="GOA:A1A0Z5"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z5"
FT                   /protein_id="BAF39378.1"
FT                   /translation="MSDEILYDRDPRYIPRVAAVHDMCGYGKCSLTAAIPILSAAGCDV
FT                   CPVPTALFSAHTRYEVFTFHDTTEILDGYLDAWRQENVDLDGVYSGFLGSADQVAIIKR
FT                   LYAEYPHALRLVDPVMGDGGEIYATYTPELCRAMGTLVDGADALMPNLTEASILTGRDY
FT                   PGQDIDDAQVDEILGALLAAGAKNVVLKGIDRGDGMIRNYVASASTGVAGKQELAHAKL
FT                   PFMTHGTGDAFASALCGAVMAGRPLAEAANIAGEFVRHAMESTQYQPNHEERGVSFELN
FT                   LDELTALTRR"
FT   CDS_pept        748531..749841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="BAD_0598"
FT                   /product="O-acetylhomoserine (thiol)-lyase"
FT                   /note="COG family:O-acetylhomoserine sulfhydrylase"
FT                   /note="Homocysteine synthase"
FT                   /note="Oahsulfhydrylase"
FT                   /note="Orthologue of BL0933"
FT                   /note="PFAM_ID:Cys_Met_Meta_PP"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39379"
FT                   /db_xref="GOA:A1A0Z6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z6"
FT                   /protein_id="BAF39379.1"
FT                   /translation="MANKNYRFETLQLHVGQEQADPATDSRAVPIYQTTSYVFHNFDHA
FT                   EARFGLADPGNIYGRLTNSTQGVFEDRIAALEGGTAGLAVASGAAAVEYAVRNITQSGD
FT                   HIVAAKNVYGGTFNLLRHTLPRDGITTTFVSAENPQEFEDAIQENTKLVYFETFGNPNA
FT                   DLPDFEAITAIAHKHHLPVIVDNTFASPYLFRPLEHGADVVVESATKFIGGHGTTLGGV
FT                   IVEGGKFNWAEVPGKFPTLTEPDPSYHGLNFYEALGGAAFVTRVRAILLRDTGATLSPF
FT                   AAFLLLQGTETLSLRVERHVQNALKVIDYLKTVPEVESISHPSIEGRKDNDLYKKYFPN
FT                   GGGSIFTFDIKGGKDAARVFIDNLHLFSLLANVADAKSLVIHPASTTHSQETLEELEDQ
FT                   GIHQGTIRLSIGLENIDDIIEDLESGFKALRESGLAK"
FT   CDS_pept        750045..750626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0599"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of TK2102"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39380"
FT                   /db_xref="GOA:A1A0Z7"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z7"
FT                   /protein_id="BAF39380.1"
FT                   /translation="MVKKREEDCIMAQDVKNDIKKAIQVNTIPLIAIMTAVTTVLTMFV
FT                   KIPTPTRGYLNLSDTMIFFSSYAFGPWVGGIVGGLGPALSDLISGYPQWAIFTFIIDGL
FT                   QAVLVGLLVREFKPANVVIGSLVAGVWKVFGYFIAGGILSGFGPALGEIIGNSFQMVVG
FT                   LIVGFALFSAVRKAYPPLVRLGNLSVKAGE"
FT   CDS_pept        750784..752409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO2"
FT                   /locus_tag="BAD_0600"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /note="Orthologue of TTE1589"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39381"
FT                   /db_xref="GOA:A1A0Z8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z8"
FT                   /protein_id="BAF39381.1"
FT                   /translation="MITVRDLSWQYEPLVDGGKPVDSLKHVSFDIKSGSFVGVIGPTGA
FT                   GKSTLCMALAGIIPNLADGTMTGLVEVNGMNTSRHSVSALSERIGYVQQDPEAQLFCAS
FT                   VEDEIAFPLENRGIAPDIIDKQIDVMLDLVGMTGYRKRVPASLSGGQMQRVAIAAALAA
FT                   EPDVLILDEPTAALDPEGKQEVFDVLERIRQTRSMTVIMAEQDTEHIAYWADQVLFMVN
FT                   GELVRNGDASLFVREKGLLESSGVQVADDPLPQVKAVQQGKKHKKDKKNQPERSKDVVI
FT                   SLDHVSYQYERGGNASKALDDVTFDIERGSFIGLIGRNGSGKTTLAKHLNGLIRPTQGT
FT                   VTVDGLDASKHSVGEMAAHVGFVFQNPDHQIFCSTTKEEIAFGPTALGLDGATVFKRVD
FT                   EMLTLFDLHRYEDVSPATLGYGERRAVALSSVLAMRTPILVLDEPTAGLDHRLAARFLG
FT                   TIEKLNQRGVTIVMISHDMRAVYRYCTHVLELEDGKVVQYGPIDRSEAAQKQSRTIRKP
FT                   RKSNGPVSATHVLLKVTKHEEGRH"
FT   CDS_pept        752409..753221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0601"
FT                   /product="cobalt transport protein"
FT                   /note="Orthologue of Moth_0708"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39382"
FT                   /db_xref="GOA:A1A0Z9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z9"
FT                   /protein_id="BAF39382.1"
FT                   /translation="MDADLYVPGDGWLHRADPRVKFLITVVMLVLCLVWRNWAFILDVL
FT                   IIEHLMLITDGVPLKRIGWVWKILAVIIVFIVVLWPIFDPSGTHVLWQWGWLKLTRENL
FT                   VMAAVMGLRIPALGFACFLTLFTTSQTKLIRGLTSLGMPYKAGLTLATALRYIPVFFSI
FT                   FQSVSAAQRARGLDLNGKKDATGKKRNVFVRLVDRFKSYLPIIIAVLIRAYKMSQSVGW
FT                   AMESRGLNLQGVRRTYRIQLKMRLSDWIILAVTAAATTGSIWLMLWQF"
FT   CDS_pept        753231..754250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0602"
FT                   /product="regulatory proteins"
FT                   /note="AsnC/Lrp"
FT                   /note="Orthologue of Tfu_1373"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39383"
FT                   /db_xref="GOA:A1A100"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1A100"
FT                   /protein_id="BAF39383.1"
FT                   /translation="MFQNEQRITITARDLKVVSALQCDGRMTMQALADKVGISVYAATE
FT                   SYRRLTESNIMSIVPVCNPLNLGNYSQVLVGLRINGNLDKALAMLKSMPQVTYVVCALG
FT                   DADIIAEAVVYSAEGMDHFLKHDLRALPGLTRLQVFSCGRLVLDDHNVSVVNRLLAAHG
FT                   ETGFLTKREASVGTGIPAHRLDMRFVRTFNELQHDGRASYATLGERLGVTHTAIRGRIK
FT                   KLEESGVMRIMATVSPMRLGGFRQAFLGLGVKPPYRLDTEQLLAIDEVTYAMSGVGLNG
FT                   ADYLIEVIADTDEDLWRVVDESIRPLPGVEQAWWASTVSVEKESYWLEPPQDGVLLDD"
FT   CDS_pept        754383..755174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0603"
FT                   /product="possible ATP binding protein of ABC transporter"
FT                   /note="COG family: ABC-type transport systems_ involved
FT                   inlipoprotein release_ ATPase components"
FT                   /note="Orthologue of BL0932"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39384"
FT                   /db_xref="GOA:A1A101"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A101"
FT                   /protein_id="BAF39384.1"
FT                   /translation="MDIRDTIKATNTAIAAVDLVKDYGSGNNTVHALRGVNVAFEKGKF
FT                   TAIMGPSGSGKSTLMHTLAGLDSATSGHIMFDGKDLTRMNDDQLTLLRRHQIGFIFQSF
FT                   NLLPMFTAEQNIVMPLTLAGEKPDRQWLNLLVETLGLKERLNHRPNELSGGQQQRVAIA
FT                   RALITKPQLVFADEPTGNLDSVSSAEVLSFLKRSVNELGQTIIMVTHDAVAASYADRAI
FT                   VFADGQIVADVDQPSAEQMNDLLMKERESATQTIYPARHAG"
FT   CDS_pept        755232..757877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0604"
FT                   /product="possible transport protein"
FT                   /note="COG family: ABC-type transport systems_ involved
FT                   inlipoprotein release_ permease components"
FT                   /note="Orthologue of BL0931"
FT                   /note="PFAM_ID: DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39385"
FT                   /db_xref="GOA:A1A102"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A1A102"
FT                   /protein_id="BAF39385.1"
FT                   /translation="MWSITLKLMRKTKRMLIPAGIAILIGTAFIASTFLFGNAMGDSLA
FT                   RQMTAMFGGANYAATANVDGLSDKEIDKAYSVTVGDFHVDQLKAVEGVKAVRVASESAV
FT                   TVSSDDDNVSGELITGASDASMLPVRISQGSQPKDANEIALPEQTAKTLGVNVGDTVTL
FT                   TSRYATTETGGKTKANDVRVVGLTADPEGAYSFYGGAIVGSDNLIALMQGADDFNAVNA
FT                   TAVYFDFAMDGNTVAAKTLNDAQKLLPAHYELSSRQNVSDEAVKSLGGNGTNVVTIFLM
FT                   CFGILAMFVAALVIANTFQVLVAQRRRTLALLRTIGAKKGQLYRSVLFEACALGLISSV
FT                   LGVAFGSLIMWGMCAGNVIRQGMRLIFSWQVFVVPIIFGIIMTMLAALGSARSATSVTP
FT                   LEALRPIELTDTKRAGIVRAVLGILMVVAGIAMAVFSVWRIQSTNGGQTAQANEFTMAV
FT                   LIAIAGAALIFLGMVLTAVFWLPALMKGAGTLVSLAGPSAKIAHGNIQKNPRRIAATGA
FT                   ALLIGVTLVSTIATGAASVKQTMNNTLATRYSVDVVASGEDLTQGMADKVAGIKGVTDT
FT                   VYAPAASVTLNGTDAAKPTTVLLIGVKNIDQVKHVMRVDLGDTSLSADDVLMPSYNAQT
FT                   GKKLAFANGKAEFDTTRNKNGDMTRPLTLHVTQRDYRRIFDSYGAVGFVDERHFANGDL
FT                   DTTTHMLLVKADTDQSGTSVNDLYDGIQSALSKSADAAVSGPIAERVTWAQMIDSMMML
FT                   MVGLIAVAVLVALIGVANTLSLSVIERTRESATLRAIGMTRGQLRASLAIEALLISLVS
FT                   GIAGILLGTLFGWLGAYVVFSLYGTVVFPFEWGVNGIVLAVAAVAALLASIAPARRAVK
FT                   VPPVEALAEA"
FT   CDS_pept        complement(757944..758693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0605"
FT                   /product="response regulator of two-component system"
FT                   /note="COG family: response regulators consisting of
FT                   aCheY-like receiver domain and a HTH DNA-binding domain"
FT                   /note="Orthologue of BL0930"
FT                   /note="PFAM_ID: GerE"
FT                   /note="PFAM_ID: response_reg"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39386"
FT                   /db_xref="GOA:A1A103"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1A103"
FT                   /protein_id="BAF39386.1"
FT                   /translation="MSEEQKIRVVIADDQELVRAGFAMVIGSQPDMAVVGQARDGAEAV
FT                   ALAETLHPDVVLMDVRMPGMDGIEATRRISALQHRFAPDGSALDDAHTRVIILTTFDLD
FT                   EYVMAAINAGASGFLLKDTEPETLLNSIRTVYQGNAIIAPSATKRLIEKMMDGDFAGTA
FT                   AAAPVSATSASASTATMYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLPTVKT
FT                   HVAHILSKINARDRVQAVVFAYENHLV"
FT   CDS_pept        complement(758770..761379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0606"
FT                   /product="histidine kinase sensor of two-component system"
FT                   /note="COG family: sensory transduction histidine kinases"
FT                   /note="Orthologue of BL0929"
FT                   /note="PFAM_ID: HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39387"
FT                   /db_xref="GOA:A1A104"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1A104"
FT                   /protein_id="BAF39387.1"
FT                   /translation="MSNFKQRLLSWMHGHVFAGDLIITLVIGVLLFGVTGGITYNPGLL
FT                   FDLKPSTQMAWEAAMLIPLLIRRWRPQTGALLCVALTLAHLIFGPCLLGADILALFMLY
FT                   SVIIYGNPKNTKAFIILALIIGLLASALVAWTMTNGPLLTGGKVHTWSSWNDPNPNGVM
FT                   VTKDTLGSIYTGTSMSEVADMMAQYMLVLTPIFEVCIISTVIVAFWQRARLATVCMMRE
FT                   RNEAIAARDQNERDIAALAERARIARDMHDVVAHTLSIIIVQSDGGRYAGTHDPAVARN
FT                   TMETIRHESERALHDMQRLLGVFGGSPHADYNDIGNLVEQAQNVSPDIRIRRNITGTAS
FT                   PEQLGEQASIASYHVVQEALTNIRKYAGPHVDVHIKESWNNGLLTLTITDNGHGAAANI
FT                   DGHTPGYGLLGMKERIESAGGSLQAGPQLGGGFEVMATLPYGGKEQVTEETGEQYASEQ
FT                   SESCNTTAISSKAKLSDEAIAPHTVVNISARIPDQPSEQTQETNQPTGRDHRSNALQHL
FT                   RITAPNLHDLLKSLKLKSVELANTSNSRGLNWVERVSAWTQHHYALMDSVGAVALVMLL
FT                   NRMSVTFFFDSSPHAQLSNAIAACCLLALALRRRFPETCALIVFVLSVVQLVFLGSIEV
FT                   GHIVASLCALYSAVLYGREHAWRWTGLAAVTCSALMGLKIAADQHGYATLFDAIAASVG
FT                   LTKPVSATSSSTAAFFTGVMYTVAVLILCAGIMAWARWTRSSDSNALVLQAREEALVAE
FT                   QEKQRILAANMERDRISASIQAEVTATLNSVISQAVDGIRMLDAAEAQGKEPTADEISA
FT                   AFKAIGEQGRAALKRMRELLGVLRETGFSDDAHAGSASELQLRPAAPLEEQLQRASR"
FT   CDS_pept        761557..762900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pap"
FT                   /locus_tag="BAD_0607"
FT                   /product="proline iminopeptidase"
FT                   /note="COG family:predicted hydrolases or acyltransferases
FT                   (alpha_betahydrolase superfamily)"
FT                   /note="Orthologue of BL0928"
FT                   /note="PFAM_ID: abhydrolase"
FT                   /note="Prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39388"
FT                   /db_xref="GOA:A1A105"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1A105"
FT                   /protein_id="BAF39388.1"
FT                   /translation="MTLLSEYYVPGLHIEDRSIKVPLDWTGHEPGHGFDGESISLFYRV
FT                   VTAPEHVHDDLPLLVFLQGGPGGSGPRPLGPSSDGWIEEAIKHFRVVLPDQRGTGRSSR
FT                   VDTHVIEGMDGDGKAGAAFLKRFLADSIVRDFEHLRRTEFGSARWVTLGQSYGGFLTLT
FT                   YLSLFPQGVIASFTTGGIPHVPADATDVYRHTFPRMAAKTKQFYERYPIDIERAAAVAD
FT                   ILQSRKVALPNGDPLTVERFQCLGSDFGMKPSFERVHWILDQAFLDGDGSASTSAELSD
FT                   EFLSSVMNATSSRPLYWPLQEFIYANGELETPICWAAQRVRCEHPEFAGDIRPLNFTGE
FT                   AMFPWMFEQERALRPFKPAMDVLMEDTHFGTIYDADQLARNEVPLQAAVYFDDMYVDSG
FT                   LQLDTLSRVGRSHYWTTNEFEHDGVHGSVVFKRLFNEALNRGDLEELF"
FT   CDS_pept        762961..763761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="BAD_0608"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="COG family:pyrroline-5-carboxylate reductase"
FT                   /note="Orthologue of BL0927"
FT                   /note="PFAM_ID: P5CR"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39389"
FT                   /db_xref="GOA:A1A106"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1A106"
FT                   /protein_id="BAF39389.1"
FT                   /translation="MSNPTIGFIGYGNMAQAIAEGLVAAGAIDGTDIVACAAHYDKLEK
FT                   TTAKVGATPLRTAAEVADAADVVIIAIKPYQIESVIKPIAGALANESTFVVSIAAGWDL
FT                   AKYRELFGADFGAMHIQCTIPNTPMAVGKGVLVTETDNTLTDAQNETFEKLFSSISLIE
FT                   RVDSAHMGIGMCIAGCAPAFTDMYIEALGDAGVKYGLQRATAYRLAAKMVEGVGALYLA
FT                   NETHPGAMKDAVCSPGGTTIKGVASLEESAFRGAVIKAVDAIEA"
FT   CDS_pept        763779..764879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0609"
FT                   /product="widely conserved hypothetical GTPase-like
FT                   protein"
FT                   /note="COG family: predicted GTPase"
FT                   /note="Orthologue of BL0926"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39390"
FT                   /db_xref="GOA:A1A107"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A1A107"
FT                   /protein_id="BAF39390.1"
FT                   /translation="MSLTIGIVGLPNVGKSTMFNALTRNNVLAENYPFATIEPNTGIVP
FT                   LPDDRLPVLAKLVHTEKIVPATVTFVDIAGIVKGASEGEGLGNKFLANIREADAICEVV
FT                   RAFEDDDIVHVNGKVDPSDDIETINTELILADLQTIENALPKLEKDLRGKKIEPAYMDA
FT                   VKQAKEILEAGETIDKAAREGRFDKDSVYDLHLMSAKPFIYVFNVDDSELQNQDLKTKL
FT                   AASVAPAPAIFLNAQFEADLTELDEDDAREMLADAGLEESGLDQLARVGYDTLGLSTFL
FT                   TAGEKEVRAWQIHKGYTAPQAAGVIHTDFEKGFIKADIVSYDDFVAAEGSMTKIKEEGK
FT                   LRQEGRDYVMQDGDIVEFKFNVSKGK"
FT   CDS_pept        764901..765329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0610"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of PAB3260"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39391"
FT                   /db_xref="GOA:A1A108"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A1A108"
FT                   /protein_id="BAF39391.1"
FT                   /translation="MRQALGPVGSGAFRVKDLYIAVFPAKGGTMSTSRAVRDAANPTMT
FT                   LHDCPLNARVVVDGIDLDDRHRFRLCEIGLAPGTGLRVVQRGAFGGRVIAFGNERVAVD
FT                   GGTARAVRVRFAQDWAVQDSAAQDKTARHEENGNTHEC"
FT   CDS_pept        765467..767434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0611"
FT                   /product="ferrous iron transport protein B"
FT                   /note="Orthologue of DR1219"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39392"
FT                   /db_xref="GOA:A1A109"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:A1A109"
FT                   /protein_id="BAF39392.1"
FT                   /translation="MTRRVVFVGNPNVGKSSMFNALLGARTRTMNAPGTTVSITCGQYH
FT                   YEKPKTAGNAQNWQFVDTPGTYSLAPMSPDEQVAVNALTGMSGMPVPDLAVVVLDATAL
FT                   SRSLYLLSMVVELGLPTVVALTMNDLAVRNGCGVDAERLSHLLDGMPVVAIDGRTGDGG
FT                   KALADAIAASFEGTPVPHGLTALPTVTADADMKTADGLSVWAELRADARLDWTAGILRG
FT                   LDMHAVDHVTLSDRIDRVLLHPVIGVLVFLAVLFVVFQATTTLASPMQDWIDVTFRGWC
FT                   TDGLDLLLGLFGPSVSGGWLRSLLVDGLLDGVVTVLTFIPVMGIMFLLLSILEDSGYMA
FT                   RAAFVMDRAMRALGLDGRAFLPIIVGFGCNLPALAATRTLSDSRQRVLTGMLVPFAACS
FT                   ARLSVFLVLAHAFFPKYAGLVVFLMYVASVMVILLVGVLLRHTMFRGLEPEPLMLALPA
FT                   YQCPRALQLARSVLLRLWGFIRGASVIIISMITALWLLQGIPVTANAGGFAHVDDVHDS
FT                   AYGVLADAVAPVFAPAGFDDWHASAALITGFVAKEVVVGSMSQSYHADEPDDAASQQAG
FT                   EGTLGQKLRASFDQSSHGHGKAAAIAFLLFTLAYTPCLATVAEMRRQFGTKVAARSVLL
FT                   SLAVAYVIAIIAFQTLRLIW"
FT   CDS_pept        767440..767772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0612"
FT                   /product="family M20D unassigned peptidase"
FT                   /note="Orthologue of BPSS0271"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39393"
FT                   /db_xref="UniProtKB/TrEMBL:A1A110"
FT                   /protein_id="BAF39393.1"
FT                   /translation="MERSGASAHGWRRTPRTADTYGDGRNGIVARIAGDIAAGLTVRQI
FT                   ADKRHLPVDFVDMAVERADKRGLLAVMDMRHACGETICQPDPASLVCAGCPFRIFPSSS
FT                   PYNRQG"
FT   CDS_pept        767787..768680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0613"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1511"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39394"
FT                   /db_xref="GOA:A1A111"
FT                   /db_xref="UniProtKB/TrEMBL:A1A111"
FT                   /protein_id="BAF39394.1"
FT                   /translation="MTVIGSQGVTRMDYQYQTTEQPSSPRKAWPIVLAVVVALIVACGA
FT                   GVCVYRNKQQEALATCRQSLAEFSSARKAVLDTSENGSELQKLIRGALGVNDIIDAFAD
FT                   AATSAENTVDTEGCKAEATITQLNLVAKTLDGATDSLNASLKSIQEKNAETALQDPKAD
FT                   SDGAAAGQSSNNPSGQSNGASSNSTSSNGTSDTKSSDESKKELQQSIDKADKLVDKLSK
FT                   DDSLTLTGRKLLSALSKAADSGQKLVESGNIKDSKYYKAAKVTLDEAIDMADNWVNSQA
FT                   AKAQWHAPACCFRSHV"
FT   CDS_pept        768749..769696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0614"
FT                   /product="widely conserved hypothetical transmembrane
FT                   protein with duf6"
FT                   /note="COG family: permeases of the
FT                   drug_metabolitetransporter (Dmt) superfamily"
FT                   /note="Orthologue of BL1444"
FT                   /note="PFAM_ID:DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39395"
FT                   /db_xref="GOA:A1A112"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1A112"
FT                   /protein_id="BAF39395.1"
FT                   /translation="MADAGQESSEGISVSKPVARVMMLVNAAVWGSGYTMLKHVQENMP
FT                   TQWMMFFRMASAVLLMAIVFFPRLRRIRLRRYIVPGLILALTYWLGFIFQLKGLETTSP
FT                   GRNSFFTDTYCVMVPFVVWAFTRKRPSWQHLVAAFVCAFGIGLVSLSGGGGAELMHMSF
FT                   GDAMTIIGAFFFALNLVLVGFIGKDFDAIALMLAEFVWCALLFGAGAVLTEGGPSMAWA
FT                   RWDIVLCIAYLVVGSTVIAQVFQTIAIQNLPTSEASVILSTECIFAMLVSVIFTGETLT
FT                   VPSLCGFALIFGAILLSEIQLPSAKRQRGTTEGD"
FT   CDS_pept        complement(769693..770823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0615"
FT                   /product="hypothetical protein"
FT                   /note="COG family: uncharacterized membrane protein"
FT                   /note="Membrane protein"
FT                   /note="Orthologue of BL1094"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39396"
FT                   /db_xref="GOA:A1A113"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A1A113"
FT                   /protein_id="BAF39396.1"
FT                   /translation="MDSRARLPIRPACPHEPEHLTLVIDFCKKWWTRIATKEMAFIGIV
FT                   TLAASLVASWLKQFPGFSLFGALIIALLIGMVAQFPIRKWYSSRSAEHKAGVKDAAGLI
FT                   SNKLLRLGIILLGFKLNLTVLFTQGIKCLPIAAVVVTLTIVVCYNIARKLGVDPQLAIL
FT                   VAGGTGICGAAAVMGLSGSIKVPPEKEDEKANNEVMAVAIIAIMGTIFALLEIALGPLT
FT                   GLSKTQLGITAGASLHEIAHAVAAGDAFGAVGIATIMKLSRVLMLVFAAIIIAIWWDRN
FT                   HSEMPADGKRKV