(data stored in ACNUC7421 zone)

EMBL: AP009384

ID   AP009384; SV 1; circular; genomic DNA; STD; PRO; 5369772 BP.
XX
AC   AP009384;
XX
PR   Project:PRJDA19267;
XX
DT   17-OCT-2007 (Rel. 93, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 14)
XX
DE   Azorhizobium caulinodans ORS 571 DNA, complete genome.
XX
KW   .
XX
OS   Azorhizobium caulinodans ORS 571
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Xanthobacteraceae; Azorhizobium.
XX
RN   [1]
RP   1-5369772
RA   Lee KB., Aono T., Kaneko T., Oyaizu H.;
RT   ;
RL   Submitted (19-APR-2007) to the INSDC.
RL   Contact:Hiroshi Oyaizu University of Tokyo, Biotechnology Research Center;
RL   Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan
XX
RN   [2]
RC   Publication Status: Online-Only
RX   DOI; 10.1186/1471-2164-9-271.
RX   PUBMED; 18522759.
RA   Lee KB., Backer P.D., Aono T., Liu CT., Suzuki S., Suzuki T., Kaneko T.,
RA   Yamada M., Tabata S., Kupfer D.M., Najar F.Z., Wiley G.B., Roe B.,
RA   Binnewies T.T., Ussery D.W., D'Haeze W., Herder J.D., Gevers D.,
RA   Vereecke D., Holsters M., Oyaizu H.;
RT   "The genome of the versatile nitrogen fixer Azorhizobium caulinodans
RT   ORS571";
RL   BMC Genomics 9:271-271(2008).
XX
RN   [3]
RX   DOI; 10.1128/AEM.01514-07.
RX   PUBMED; 17720818.
RA   Suzuki S., Aono T., Lee KB., Suzuki T., Liu CT., Miwa H., Wakao S., Iki T.,
RA   Oyaizu H.;
RT   "Rhizobial factors required for stem nodule maturation and maintenance in
RT   Sesbania rostrata-Azorhizobium caulinodans ORS571 symbiosis";
RL   Appl. Environ. Microbiol. 73(20):6650-6659(2007).
XX
RN   [4]
RX   DOI; 10.1128/AEM.00398-09.
RX   PUBMED; 19542345.
RA   Tsukada S., Aono T., Akiba N., Lee KB., Liu CT., Toyazaki H., Oyaizu H.;
RT   "Comparative genome-wide transcriptional profiling of Azorhizobium
RT   caulinodans ORS571 grown under free-living and symbiotic conditions";
RL   Appl. Environ. Microbiol. 75(15):5037-5046(2009).
XX
RN   [5]
RX   DOI; 10.1128/AEM.00238-10.
RX   PUBMED; 20382809.
RA   Akiba N., Aono T., Toyazaki H., Sato S., Oyaizu H.;
RT   "phrR-like gene praR of Azorhizobium caulinodans ORS571 is essential for
RT   symbiosis with Sesbania rostrata and is involved in expression of reb
RT   genes";
RL   Appl. Environ. Microbiol. 76(11):3475-3485(2010).
XX
RN   [6]
RX   DOI; 10.1128/AEM.02327-10.
RX   PUBMED; 21571889.
RA   Liu CT., Lee KB., Wang YS., Peng MH., Lee KT., Suzuki S., Suzuki T.,
RA   Oyaizu H.;
RT   "Involvement of the azorhizobial chromosome partition gene (parA) in the
RT   onset of bacteroid differentiation during Sesbania rostrata stem nodule
RT   development";
RL   Appl. Environ. Microbiol. 77(13):4371-4382(2011).
XX
DR   MD5; f06f2840614b00026b7cd1acc428aba1.
DR   BioSample; SAMD00060925.
DR   EnsemblGenomes-Gn; AZC_16r01.
DR   EnsemblGenomes-Gn; AZC_16r02.
DR   EnsemblGenomes-Gn; AZC_16r03.
DR   EnsemblGenomes-Gn; AZC_23r01.
DR   EnsemblGenomes-Gn; AZC_23r02.
DR   EnsemblGenomes-Gn; AZC_23r03.
DR   EnsemblGenomes-Gn; AZC_5r01.
DR   EnsemblGenomes-Gn; AZC_5r02.
DR   EnsemblGenomes-Gn; AZC_5r03.
DR   EnsemblGenomes-Gn; AZC_tmRNA01.
DR   EnsemblGenomes-Gn; AZC_tmRNA03.
DR   EnsemblGenomes-Gn; AZC_trnA05.
DR   EnsemblGenomes-Gn; AZC_trnA40.
DR   EnsemblGenomes-Gn; AZC_trnA43.
DR   EnsemblGenomes-Gn; AZC_trnA44.
DR   EnsemblGenomes-Gn; AZC_trnA48.
DR   EnsemblGenomes-Gn; AZC_trnA51.
DR   EnsemblGenomes-Gn; AZC_trnC30.
DR   EnsemblGenomes-Gn; AZC_trnD19.
DR   EnsemblGenomes-Gn; AZC_trnE03.
DR   EnsemblGenomes-Gn; AZC_trnE23.
DR   EnsemblGenomes-Gn; AZC_trnF14.
DR   EnsemblGenomes-Gn; AZC_trnG02.
DR   EnsemblGenomes-Gn; AZC_trnG10.
DR   EnsemblGenomes-Gn; AZC_trnG42.
DR   EnsemblGenomes-Gn; AZC_trnH28.
DR   EnsemblGenomes-Gn; AZC_trnI04.
DR   EnsemblGenomes-Gn; AZC_trnI49.
DR   EnsemblGenomes-Gn; AZC_trnI52.
DR   EnsemblGenomes-Gn; AZC_trnK25.
DR   EnsemblGenomes-Gn; AZC_trnK37.
DR   EnsemblGenomes-Gn; AZC_trnK38.
DR   EnsemblGenomes-Gn; AZC_trnL07.
DR   EnsemblGenomes-Gn; AZC_trnL17.
DR   EnsemblGenomes-Gn; AZC_trnL32.
DR   EnsemblGenomes-Gn; AZC_trnL39.
DR   EnsemblGenomes-Gn; AZC_trnL47.
DR   EnsemblGenomes-Gn; AZC_trnM13.
DR   EnsemblGenomes-Gn; AZC_trnM22.
DR   EnsemblGenomes-Gn; AZC_trnM53.
DR   EnsemblGenomes-Gn; AZC_trnN31.
DR   EnsemblGenomes-Gn; AZC_trnP20.
DR   EnsemblGenomes-Gn; AZC_trnP21.
DR   EnsemblGenomes-Gn; AZC_trnP26.
DR   EnsemblGenomes-Gn; AZC_trnP29.
DR   EnsemblGenomes-Gn; AZC_trnQ06.
DR   EnsemblGenomes-Gn; AZC_trnQ15.
DR   EnsemblGenomes-Gn; AZC_trnR16.
DR   EnsemblGenomes-Gn; AZC_trnR35.
DR   EnsemblGenomes-Gn; AZC_trnR41.
DR   EnsemblGenomes-Gn; AZC_trnR45.
DR   EnsemblGenomes-Gn; AZC_trnS01.
DR   EnsemblGenomes-Gn; AZC_trnS24.
DR   EnsemblGenomes-Gn; AZC_trnS33.
DR   EnsemblGenomes-Gn; AZC_trnS46.
DR   EnsemblGenomes-Gn; AZC_trnSec12.
DR   EnsemblGenomes-Gn; AZC_trnT08.
DR   EnsemblGenomes-Gn; AZC_trnT34.
DR   EnsemblGenomes-Gn; AZC_trnT36.
DR   EnsemblGenomes-Gn; AZC_trnV18.
DR   EnsemblGenomes-Gn; AZC_trnV27.
DR   EnsemblGenomes-Gn; AZC_trnV50.
DR   EnsemblGenomes-Gn; AZC_trnW11.
DR   EnsemblGenomes-Gn; AZC_trnY09.
DR   EnsemblGenomes-Gn; EBG00001107778.
DR   EnsemblGenomes-Gn; EBG00001107779.
DR   EnsemblGenomes-Gn; EBG00001107780.
DR   EnsemblGenomes-Gn; EBG00001107781.
DR   EnsemblGenomes-Gn; EBG00001107782.
DR   EnsemblGenomes-Gn; EBG00001107783.
DR   EnsemblGenomes-Gn; EBG00001107784.
DR   EnsemblGenomes-Gn; EBG00001107785.
DR   EnsemblGenomes-Gn; EBG00001107786.
DR   EnsemblGenomes-Gn; EBG00001107787.
DR   EnsemblGenomes-Gn; EBG00001107788.
DR   EnsemblGenomes-Gn; EBG00001107789.
DR   EnsemblGenomes-Gn; EBG00001107790.
DR   EnsemblGenomes-Gn; EBG00001107791.
DR   EnsemblGenomes-Gn; EBG00001107792.
DR   EnsemblGenomes-Gn; EBG00001107793.
DR   EnsemblGenomes-Gn; EBG00001107794.
DR   EnsemblGenomes-Gn; EBG00001107795.
DR   EnsemblGenomes-Gn; EBG00001107796.
DR   EnsemblGenomes-Gn; EBG00001107797.
DR   EnsemblGenomes-Gn; EBG00001107798.
DR   EnsemblGenomes-Gn; EBG00001107799.
DR   EnsemblGenomes-Gn; EBG00001107800.
DR   EnsemblGenomes-Gn; EBG00001107801.
DR   EnsemblGenomes-Gn; EBG00001107802.
DR   EnsemblGenomes-Gn; EBG00001107803.
DR   EnsemblGenomes-Gn; EBG00001107804.
DR   EnsemblGenomes-Gn; EBG00001107805.
DR   EnsemblGenomes-Gn; EBG00001107806.
DR   EnsemblGenomes-Gn; EBG00001107807.
DR   EnsemblGenomes-Gn; EBG00001107808.
DR   EnsemblGenomes-Gn; EBG00001107809.
DR   EnsemblGenomes-Gn; EBG00001107810.
DR   EnsemblGenomes-Gn; EBG00001107811.
DR   EnsemblGenomes-Gn; EBG00001107812.
DR   EnsemblGenomes-Gn; EBG00001107813.
DR   EnsemblGenomes-Gn; EBG00001107814.
DR   EnsemblGenomes-Gn; EBG00001107815.
DR   EnsemblGenomes-Gn; EBG00001107816.
DR   EnsemblGenomes-Gn; EBG00001107817.
DR   EnsemblGenomes-Gn; EBG00001107818.
DR   EnsemblGenomes-Gn; EBG00001107819.
DR   EnsemblGenomes-Gn; EBG00001107820.
DR   EnsemblGenomes-Gn; EBG00001107821.
DR   EnsemblGenomes-Gn; EBG00001107822.
DR   EnsemblGenomes-Gn; EBG00001107823.
DR   EnsemblGenomes-Gn; EBG00001107824.
DR   EnsemblGenomes-Gn; EBG00001107825.
DR   EnsemblGenomes-Gn; EBG00001107826.
DR   EnsemblGenomes-Gn; EBG00001107827.
DR   EnsemblGenomes-Gn; EBG00001107828.
DR   EnsemblGenomes-Gn; EBG00001107829.
DR   EnsemblGenomes-Gn; EBG00001107830.
DR   EnsemblGenomes-Gn; EBG00001107831.
DR   EnsemblGenomes-Gn; EBG00001107832.
DR   EnsemblGenomes-Gn; EBG00001107833.
DR   EnsemblGenomes-Gn; EBG00001107834.
DR   EnsemblGenomes-Gn; EBG00001107835.
DR   EnsemblGenomes-Gn; EBG00001107836.
DR   EnsemblGenomes-Gn; EBG00001107837.
DR   EnsemblGenomes-Gn; EBG00001107838.
DR   EnsemblGenomes-Gn; EBG00001107839.
DR   EnsemblGenomes-Gn; EBG00001107840.
DR   EnsemblGenomes-Gn; EBG00001107841.
DR   EnsemblGenomes-Gn; EBG00001107842.
DR   EnsemblGenomes-Gn; EBG00001107843.
DR   EnsemblGenomes-Gn; EBG00001107844.
DR   EnsemblGenomes-Gn; EBG00001107845.
DR   EnsemblGenomes-Gn; EBG00001107846.
DR   EnsemblGenomes-Gn; EBG00001107847.
DR   EnsemblGenomes-Gn; EBG00001107848.
DR   EnsemblGenomes-Gn; EBG00001107849.
DR   EnsemblGenomes-Gn; EBG00001107850.
DR   EnsemblGenomes-Gn; EBG00001107851.
DR   EnsemblGenomes-Gn; EBG00001107852.
DR   EnsemblGenomes-Gn; EBG00001107853.
DR   EnsemblGenomes-Gn; EBG00001107854.
DR   EnsemblGenomes-Gn; EBG00001107855.
DR   EnsemblGenomes-Gn; EBG00001107856.
DR   EnsemblGenomes-Tr; AZC_16r01-1.
DR   EnsemblGenomes-Tr; AZC_16r02-1.
DR   EnsemblGenomes-Tr; AZC_16r03-1.
DR   EnsemblGenomes-Tr; AZC_23r01-1.
DR   EnsemblGenomes-Tr; AZC_23r02-1.
DR   EnsemblGenomes-Tr; AZC_23r03-1.
DR   EnsemblGenomes-Tr; AZC_5r01-1.
DR   EnsemblGenomes-Tr; AZC_5r02-1.
DR   EnsemblGenomes-Tr; AZC_5r03-1.
DR   EnsemblGenomes-Tr; AZC_tmRNA01-1.
DR   EnsemblGenomes-Tr; AZC_tmRNA03-1.
DR   EnsemblGenomes-Tr; AZC_trnA05-1.
DR   EnsemblGenomes-Tr; AZC_trnA40-1.
DR   EnsemblGenomes-Tr; AZC_trnA43-1.
DR   EnsemblGenomes-Tr; AZC_trnA44-1.
DR   EnsemblGenomes-Tr; AZC_trnA48-1.
DR   EnsemblGenomes-Tr; AZC_trnA51-1.
DR   EnsemblGenomes-Tr; AZC_trnC30-1.
DR   EnsemblGenomes-Tr; AZC_trnD19-1.
DR   EnsemblGenomes-Tr; AZC_trnE03-1.
DR   EnsemblGenomes-Tr; AZC_trnE23-1.
DR   EnsemblGenomes-Tr; AZC_trnF14-1.
DR   EnsemblGenomes-Tr; AZC_trnG02-1.
DR   EnsemblGenomes-Tr; AZC_trnG10-1.
DR   EnsemblGenomes-Tr; AZC_trnG42-1.
DR   EnsemblGenomes-Tr; AZC_trnH28-1.
DR   EnsemblGenomes-Tr; AZC_trnI04-1.
DR   EnsemblGenomes-Tr; AZC_trnI49-1.
DR   EnsemblGenomes-Tr; AZC_trnI52-1.
DR   EnsemblGenomes-Tr; AZC_trnK25-1.
DR   EnsemblGenomes-Tr; AZC_trnK37-1.
DR   EnsemblGenomes-Tr; AZC_trnK38-1.
DR   EnsemblGenomes-Tr; AZC_trnL07-1.
DR   EnsemblGenomes-Tr; AZC_trnL17-1.
DR   EnsemblGenomes-Tr; AZC_trnL32-1.
DR   EnsemblGenomes-Tr; AZC_trnL39-1.
DR   EnsemblGenomes-Tr; AZC_trnL47-1.
DR   EnsemblGenomes-Tr; AZC_trnM13-1.
DR   EnsemblGenomes-Tr; AZC_trnM22-1.
DR   EnsemblGenomes-Tr; AZC_trnM53-1.
DR   EnsemblGenomes-Tr; AZC_trnN31-1.
DR   EnsemblGenomes-Tr; AZC_trnP20-1.
DR   EnsemblGenomes-Tr; AZC_trnP21-1.
DR   EnsemblGenomes-Tr; AZC_trnP26-1.
DR   EnsemblGenomes-Tr; AZC_trnP29-1.
DR   EnsemblGenomes-Tr; AZC_trnQ06-1.
DR   EnsemblGenomes-Tr; AZC_trnQ15-1.
DR   EnsemblGenomes-Tr; AZC_trnR16-1.
DR   EnsemblGenomes-Tr; AZC_trnR35-1.
DR   EnsemblGenomes-Tr; AZC_trnR41-1.
DR   EnsemblGenomes-Tr; AZC_trnR45-1.
DR   EnsemblGenomes-Tr; AZC_trnS01-1.
DR   EnsemblGenomes-Tr; AZC_trnS24-1.
DR   EnsemblGenomes-Tr; AZC_trnS33-1.
DR   EnsemblGenomes-Tr; AZC_trnS46-1.
DR   EnsemblGenomes-Tr; AZC_trnSec12-1.
DR   EnsemblGenomes-Tr; AZC_trnT08-1.
DR   EnsemblGenomes-Tr; AZC_trnT34-1.
DR   EnsemblGenomes-Tr; AZC_trnT36-1.
DR   EnsemblGenomes-Tr; AZC_trnV18-1.
DR   EnsemblGenomes-Tr; AZC_trnV27-1.
DR   EnsemblGenomes-Tr; AZC_trnV50-1.
DR   EnsemblGenomes-Tr; AZC_trnW11-1.
DR   EnsemblGenomes-Tr; AZC_trnY09-1.
DR   EnsemblGenomes-Tr; EBT00001698783.
DR   EnsemblGenomes-Tr; EBT00001698785.
DR   EnsemblGenomes-Tr; EBT00001698787.
DR   EnsemblGenomes-Tr; EBT00001698788.
DR   EnsemblGenomes-Tr; EBT00001698789.
DR   EnsemblGenomes-Tr; EBT00001698790.
DR   EnsemblGenomes-Tr; EBT00001698791.
DR   EnsemblGenomes-Tr; EBT00001698793.
DR   EnsemblGenomes-Tr; EBT00001698794.
DR   EnsemblGenomes-Tr; EBT00001698796.
DR   EnsemblGenomes-Tr; EBT00001698797.
DR   EnsemblGenomes-Tr; EBT00001698799.
DR   EnsemblGenomes-Tr; EBT00001698800.
DR   EnsemblGenomes-Tr; EBT00001698802.
DR   EnsemblGenomes-Tr; EBT00001698803.
DR   EnsemblGenomes-Tr; EBT00001698804.
DR   EnsemblGenomes-Tr; EBT00001698806.
DR   EnsemblGenomes-Tr; EBT00001698808.
DR   EnsemblGenomes-Tr; EBT00001698809.
DR   EnsemblGenomes-Tr; EBT00001698810.
DR   EnsemblGenomes-Tr; EBT00001698812.
DR   EnsemblGenomes-Tr; EBT00001698813.
DR   EnsemblGenomes-Tr; EBT00001698815.
DR   EnsemblGenomes-Tr; EBT00001698816.
DR   EnsemblGenomes-Tr; EBT00001698818.
DR   EnsemblGenomes-Tr; EBT00001698819.
DR   EnsemblGenomes-Tr; EBT00001698821.
DR   EnsemblGenomes-Tr; EBT00001698822.
DR   EnsemblGenomes-Tr; EBT00001698823.
DR   EnsemblGenomes-Tr; EBT00001698825.
DR   EnsemblGenomes-Tr; EBT00001698826.
DR   EnsemblGenomes-Tr; EBT00001698828.
DR   EnsemblGenomes-Tr; EBT00001698830.
DR   EnsemblGenomes-Tr; EBT00001698831.
DR   EnsemblGenomes-Tr; EBT00001698833.
DR   EnsemblGenomes-Tr; EBT00001698834.
DR   EnsemblGenomes-Tr; EBT00001698836.
DR   EnsemblGenomes-Tr; EBT00001698837.
DR   EnsemblGenomes-Tr; EBT00001698838.
DR   EnsemblGenomes-Tr; EBT00001698840.
DR   EnsemblGenomes-Tr; EBT00001698845.
DR   EnsemblGenomes-Tr; EBT00001698846.
DR   EnsemblGenomes-Tr; EBT00001698848.
DR   EnsemblGenomes-Tr; EBT00001698849.
DR   EnsemblGenomes-Tr; EBT00001698851.
DR   EnsemblGenomes-Tr; EBT00001698852.
DR   EnsemblGenomes-Tr; EBT00001698853.
DR   EnsemblGenomes-Tr; EBT00001698855.
DR   EnsemblGenomes-Tr; EBT00001698857.
DR   EnsemblGenomes-Tr; EBT00001698858.
DR   EnsemblGenomes-Tr; EBT00001698860.
DR   EnsemblGenomes-Tr; EBT00001698861.
DR   EnsemblGenomes-Tr; EBT00001698863.
DR   EnsemblGenomes-Tr; EBT00001698864.
DR   EnsemblGenomes-Tr; EBT00001698866.
DR   EnsemblGenomes-Tr; EBT00001698867.
DR   EnsemblGenomes-Tr; EBT00001698869.
DR   EnsemblGenomes-Tr; EBT00001698871.
DR   EnsemblGenomes-Tr; EBT00001698872.
DR   EnsemblGenomes-Tr; EBT00001698874.
DR   EnsemblGenomes-Tr; EBT00001698876.
DR   EnsemblGenomes-Tr; EBT00001698877.
DR   EnsemblGenomes-Tr; EBT00001698879.
DR   EnsemblGenomes-Tr; EBT00001698881.
DR   EnsemblGenomes-Tr; EBT00001698883.
DR   EnsemblGenomes-Tr; EBT00001698884.
DR   EnsemblGenomes-Tr; EBT00001698886.
DR   EnsemblGenomes-Tr; EBT00001698887.
DR   EnsemblGenomes-Tr; EBT00001698889.
DR   EnsemblGenomes-Tr; EBT00001698890.
DR   EnsemblGenomes-Tr; EBT00001698892.
DR   EnsemblGenomes-Tr; EBT00001698894.
DR   EnsemblGenomes-Tr; EBT00001698895.
DR   EnsemblGenomes-Tr; EBT00001698897.
DR   EnsemblGenomes-Tr; EBT00001698899.
DR   EnsemblGenomes-Tr; EBT00001698900.
DR   EnsemblGenomes-Tr; EBT00001698902.
DR   EnsemblGenomes-Tr; EBT00001698904.
DR   EnsemblGenomes-Tr; EBT00001698905.
DR   EuropePMC; PMC2075074; 17720818.
DR   EuropePMC; PMC2443382; 18522759.
DR   EuropePMC; PMC2725507; 19542345.
DR   EuropePMC; PMC2876453; 20382809.
DR   EuropePMC; PMC3127717; 21571889.
DR   EuropePMC; PMC3416630; 22752172.
DR   EuropePMC; PMC4959239; 26994081.
DR   EuropePMC; PMC5601337; 28778893.
DR   EuropePMC; PMC5772239; 29150498.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; AP009384.
DR   SILVA-SSU; AP009384.
DR   StrainInfo; 4177; 1.
XX
CC   This genome project was supported by Bio-oriented Technology
CC   Research Advancement Institution (BRAIN)
CC   Takakazu Kaneko
CC   Kazusa DNA Research Institute
CC   Department of Plant Genome Research
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5369772
FT                   /organism="Azorhizobium caulinodans ORS 571"
FT                   /strain="ORS 571"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:438753"
FT   CDS_pept        351..1268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0001"
FT                   /product="protein of unknown function"
FT                   /note="DUF299"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAF85999"
FT                   /db_xref="GOA:A8IFY2"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/TrEMBL:A8IFY2"
FT                   /protein_id="BAF85999.1"
FT                   /translation="MCCACMGPEGMPSCTRRPQTGGETVSSPHQNYFHLHLVSDSTGET
FT                   LINVGRAACAQYVNVSPIEHVYPLVRSTKQLDRVLAEIEASPGIVLYTLVDKEIRERLK
FT                   ERCRELSVPYMSVLAPVVQLFQSYLGGEPQPRVGGQHALDATYFKRIDALNYTVSHDDG
FT                   HLTDDLEEADVVLLGVSRTSKTPTSIYLANRGIKTANIPLVPNVPIPPNLSRLKKPLIV
FT                   GLIASPERIVEIRQNRLLGLNADTTNSSYVDRDAVSEEIANSRRLFARNGWPLIDVTRR
FT                   SIEETAAAIIGHLSERRRRSIVET"
FT   CDS_pept        1265..1876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0002"
FT                   /product="putative maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86000"
FT                   /db_xref="GOA:A8IFY4"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A8IFY4"
FT                   /protein_id="BAF86000.1"
FT                   /translation="MSLWRLPEPLLLASRSSARLAVLRGAGLPVEARPVAIDERAIEAE
FT                   ARGTGAAPDDVARVLAQAKALAASALAPGRVVLGADQTLALGGDILHKPPTLEAARAQV
FT                   RQLAGRTHVLHAAVAIVRDEEVLFETVETAQLTMRDLSDEAIESYFAAAGPQVIESVGA
FT                   YQIEGPGLQLFERIDGDHFTILGLPILPVLACFRSEGWVP"
FT   CDS_pept        1873..2718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0003"
FT                   /product="quinate shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86001"
FT                   /db_xref="GOA:A8IFY6"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IFY6"
FT                   /protein_id="BAF86001.1"
FT                   /translation="MKRVAIFGHPVIHSRSPLVHGYWLKQHGIAGDYVRHDVAPDEAEA
FT                   FFARFAEQGYAGGNVTIPHKEVAFNALAEADPVARALGVANTLWLEDGRLFGANTDAPG
FT                   FLSNLDVTAPGWDANPRVALVLGAGGASRAVLYGFLQRGFDKVLLANRTLARAEALAAH
FT                   FGPRVVPIGWDGVSASLKEAQVVANTTSLGMKGQPPLDLDLSVLADDAVVADVVYVPLE
FT                   TPLLKAAKARGLRTVDGLGMLLHQAVPGFARWFGVTPQVDAGLRDLIVADLAAKGQLGA
FT                   "
FT   CDS_pept        2723..3337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0004"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86002"
FT                   /db_xref="GOA:A8IFY8"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IFY8"
FT                   /protein_id="BAF86002.1"
FT                   /translation="MWIIGLTGSIGMGKSATAGLFRAAGVPVHDADASVHAMYRAEAVA
FT                   PVEAAFPGVTRDGAIDRRLLSERVLNDAEAMKRLEAIVHPLVRARERAFLEKAEAAGAH
FT                   WVVLDIPLLFETNRADAMDVVVVVTAPKEVQEQRVLARDGMTRERFEAILKRQMPDSEK
FT                   RRRAHVIIDTGRGFPAAKHQVEGLLRTLAGQGHTRRDRKTD"
FT   CDS_pept        3341..4063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0005"
FT                   /product="DNA polymerase III"
FT                   /note="DNA polymerase 3, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86003"
FT                   /db_xref="GOA:A8IFZ2"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8IFZ2"
FT                   /protein_id="BAF86003.1"
FT                   /translation="MREIVLDTETTGLEANKGDRVVEIGCVEMVNRILTGNTFHVYINP
FT                   ERDMPAEAFAVHGLSSEFLSDKPKFAEVADAFLEFIAGDTLVIHNAAFDIGFLNAELAR
FT                   LSREPIARDRVVDTVALARRKHPGASAKLDDLMKRYGIDASRRVKHGALLDSELLAEVY
FT                   SELLGGRQAMLVGLADETSEAPRLVVEVAVAARARPVPLPSRLSAEEIAAHREFIGGMG
FT                   EKGIWNQYLVDEIRETGT"
FT   CDS_pept        4153..4581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0006"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86004"
FT                   /db_xref="GOA:A8IFZ4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IFZ4"
FT                   /protein_id="BAF86004.1"
FT                   /translation="MSEKISAIEEACLAKGMRMTDQRRVIARVLSQSADHPDVEELYGR
FT                   ASAIDANISISTVYRTVKMFEDAGIIARHEFGDGRSRYEPVPDEHHDHLIDLRSGRVLE
FT                   FRSEEIERLQEEIARRLGYRIVGHRLELYVVPLDEEPS"
FT   CDS_pept        4578..5462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0007"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86005"
FT                   /db_xref="GOA:A8IFZ6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A8IFZ6"
FT                   /protein_id="BAF86005.1"
FT                   /translation="MSLTARNGPELASEEDPLADFGPERPALTRWLDRLRIACVLAGVG
FT                   VVTLVGIPLQWLSLRLNLPSRRLIPLLFHRIVLRLIGVRVKRIGAPAAQRPMLILSNHT
FT                   SWLDICVVGSLTPLFFVAKSEVGTWPLIGLFARFQRTVFVDRSRRTATGAVNQEIAARL
FT                   AEGDPVVLFAEGTSTDGNRVQPFRSALVGAVREAFAASGAVVVQPMAVSYVGLQGLPMG
FT                   RRHRPIASWYGDMDLAPHLLEVLRHGAMDVEVRFGAPITLADDHDRKAVTRAAETEVRR
FT                   LHLEALTGRSTGT"
FT   CDS_pept        5584..6978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="deoxyribonuclease/rho motif-related TRAM"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86006"
FT                   /db_xref="GOA:A8IG00"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IG00"
FT                   /protein_id="BAF86006.1"
FT                   /translation="MQEPRKLYVKSFGCQMNVYDSQRMADALAKEGYVETQDPADADLV
FT                   ILNTCHIREKAAEKVYSELGRLRKAKQDAGSDTTIAVAGCVAQAEGAEIMKRAPVVDLV
FT                   VGPQSYHRLPEMLARVRDGKRVVDTEFPAEDKFDHLPAPSAAATKKRGPTAFVTVQEGC
FT                   DKFCTFCVVPYTRGAEVSRSVSKIVGEARALVDQGVREITLIGQNVNAFHGEGPDGRTW
FT                   GLGRLLEELAGINGLARLRYTTSHPRDMDDGLIAAHRDLPQLMPYLHLPVQSGSDRILA
FT                   AMNRKHGREIYFEIIDKLRAARPDIALSSDFIVGFPGETEADFEDTLDLARRVGFASAY
FT                   SFKYSIRPGTPAAEHDHQLSEEVKSERLARLHQVLEASKTAFDRACMGRRFDILLEKPG
FT                   RLPGQLIGRSPYLQSVVVTAPGAGIGDFVTVDITDVGPNSLAGQVVDAVEDRGRTSDRP
FT                   LVAMEA"
FT   CDS_pept        6975..8174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0009"
FT                   /product="phosphate starvation inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86007"
FT                   /db_xref="GOA:A8IG02"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG02"
FT                   /protein_id="BAF86007.1"
FT                   /translation="MSVARTSDRERSVAVPSNGPARAAVSDPWALQGETGTTQVVLAFD
FT                   DNRLASQLFGHYGRNLALIERKLSVKAESRGNHVTLDGGRDGCEQARRVLEHLYEQLKR
FT                   GRDIGQGDVEGAIREAVSQGSLFDFDPSETRQSFDEIQLRRRPVRARTAAQDAYIRALK
FT                   RHTLVFGTGPAGTGKTWLAVAYCVHLLERRMVDRIILTRPAVEAGERLGFLPGDMKEKV
FT                   DPYLRPIYDALYDLMDRAFVERALQSGEIEIAPLAFMRGRTLANAAVILDEAQNATSMQ
FT                   MKMFLTRLGENSHMIVTGDPSQTDLPNGMTSGLAEAVRLLEGVEGVGISHFKAQDVVRH
FT                   ELVQRIVAAYEEHDATLIRRALVRKAPVKVEAVNDVIEGSAEEKAEPELSAPDEGRTHG
FT                   "
FT   CDS_pept        8233..8712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0010"
FT                   /product="protein of unknown function"
FT                   /note="UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86008"
FT                   /db_xref="GOA:A8IG05"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IG05"
FT                   /protein_id="BAF86008.1"
FT                   /translation="MEIDVLVEDDGWSALPDAAEIAIAAARAALASLGDEVPEGAEMSI
FT                   TLTDDARIRVLNREWRDKDKPTNVLSFPAAELPEGVVPQPLGDVIVARETVFSEALAED
FT                   KTPAHHLAHLVVHGTLHLMGFDHEDDDEAEEMEAAERQILAGLGIDDPYALPAEG"
FT   CDS_pept        8734..9720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0011"
FT                   /product="HlyC/CorC family transporter"
FT                   /note="with CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86009"
FT                   /db_xref="GOA:A8IG07"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG07"
FT                   /protein_id="BAF86009.1"
FT                   /translation="MSSTDQSSEQNGSEPQSFLDRLRSLLGTFRAHGSLRTDLVEVLDA
FT                   SGTSEEVSEFSPSERQMLRNILHLKEVGIGDIMVPRAEIVAVQKDITLGALLIEFAKAS
FT                   HSRLVVYDDTLDDPVGMVHIRDLLAFMTGLHPGENGEIEVAEGHVPDLSAVNLGQSLAD
FT                   TDLIRRLLYVPPSMPAVDLLVSMQAARIHLALVIDEYGGTDGLVSMEDVVEEIVGEIED
FT                   EHDDETALIQLQPDGSYLADARTALEDVAEVVGSDFVPGEAADEVDTLGGLVVTLAARV
FT                   PNTGEIIQLPGDYRVEVVEADPRRVKALRIIPPPAEAMAPEAVGSEL"
FT   CDS_pept        9734..11341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0012"
FT                   /product="apolipoprotein N-acyltransferase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86010"
FT                   /db_xref="GOA:A8IG09"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG09"
FT                   /protein_id="BAF86010.1"
FT                   /translation="MHLANRVRSLTGWRRLGFGLLAGALSALSTAPFGIWPALAVGFPA
FT                   LVLLIDGAGHARRRGRGAMLRSAAAAGWAFGFGYFLASLWWIGAAFLVDAEDFAWLLPV
FT                   AVLCLPAGLALFTALGAVLARLVWPSGPARLCSFAVAFTAAEWLRGHVLTGFPWNTFGY
FT                   GPAQTLELAQGAAFVGLWGLTFFSLLLLSTPVLLLRSGTFTRRAGWPLAALAVIALAYG
FT                   LGGYRLSLNPSRYLEQVRLRIMQPAIPQGEKFAYDRRQAVLENYLDLSGRPSALYPKGL
FT                   EDIGLLVWPESAFPFIYEREPWAKARIAATLPDNVTLVTGAARVGMPPEGQTSPFFNSI
FT                   RVMNARGEVQETADKVHLVPFGEYLPFQDFLESIGLEQLTRVRGGFASGDRLRPLKLPG
FT                   APDAAPLICYEAIFPGAVLPQGERPGFLLNVTNDAWFGDTPGPYQHFLQARLRAVEEGL
FT                   PLIRAANTGISAIVDPLGRIVAEQDLGVRGVVDGDLPQRLNAPPFGSRHAGGVLLVLMG
FT                   ITSSVAISRVRRQHARIG"
FT   CDS_pept        11440..11892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="praR"
FT                   /locus_tag="AZC_0013"
FT                   /product="putative transcriptional regulator"
FT                   /note="helix-turn-helix motif"
FT                   /note="PhrR-like regulator conserved in the
FT                   Alphaproteobacteria"
FT                   /note="praR is involved in the expression of reb genes"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86011"
FT                   /db_xref="GOA:A8IG10"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG10"
FT                   /protein_id="BAF86011.1"
FT                   /translation="MVKKAPNPIDKHVGSRVRMRRMMVGMSQEKLGEHLGITFQQIQKY
FT                   EKGTNRIGASRLQQISIVLSVPVAFFFEGAPSANPEADGEGFAEGHSPAYVSDFLATSD
FT                   GLALTRNFMRISDAKVRRRIVDLVSAIAGEELEAAPAPMAVALRSI"
FT   CDS_pept        11981..13174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0014"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86012"
FT                   /db_xref="GOA:A8IG12"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG12"
FT                   /protein_id="BAF86012.1"
FT                   /translation="MARESYLFTSESVSEGHPDKVCDRISDEIVDAYFRAAIENGFDTT
FT                   QVRVAAETLATTNRVVIAGETRGPSSVTPELIDSLARKAIKEIGYEQDGFHWQNAKIEV
FT                   LLHAQSADIAQGVDIAGNKDEGAGDQGIMFGYAVNETPELMPAPIFYSHKILKVLTDAR
FT                   HSGEAKQLGPDAKSQVTVRYEKGKPVGVTQIVLSTQHLDESMTSQDVRALVEPYILKAL
FT                   PEGWVDASTVWHVNPTGKFVIGGPDGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKV
FT                   DRSAAYAARYLAKNVVAAGLADRATIQLAYAIGVSDPLAVYVDLHGTGNVAEDKLETVL
FT                   REVVNLRPRGIREHLSLNKPIYARTSAYGHFGRAPEADGGFSWERTDLVSALKSALA"
FT   CDS_pept        13367..14059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0015"
FT                   /product="tRNA (guanine-N7)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86013"
FT                   /db_xref="GOA:A8IG13"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IG13"
FT                   /protein_id="BAF86013.1"
FT                   /translation="MTALSETEHKGAFYGRRVGKTLRQGQQQALARTLPRYLIDLPTVA
FT                   EPAALFPCPVDEIRLEIGFGGGEHLLSEAKRFPRAGYIGIEPFLNGMAKAVLELDLAPQ
FT                   ENVRLFNLDAALLLARLPEGSVSQVELLYPDPWPKRRHWKRRFVRPDNLDLLARALKPG
FT                   GVFRFASDVPDYVDWTLREVRAHPAFRWTQTRADDWRTPYEGWPGTRYEAKAIAAGRVP
FT                   TYLSFARV"
FT   CDS_pept        14157..15059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0016"
FT                   /product="putative transcriptional regulator"
FT                   /note="LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86014"
FT                   /db_xref="GOA:A8IG15"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG15"
FT                   /protein_id="BAF86014.1"
FT                   /translation="MFVRQLHYLVAVAREQHFGRAAEACHVTQPTLSAGLRKLEEELGY
FT                   PLVVRGHRFMGLTEHGARVLAWAQRIINDYDGMRQELAGSEAGLTGILRLGCVPPMLPA
FT                   LSGLLTAFCERHPLVRVQALSMSALAIQRGLDDQVLDAGVSYLTGTQPPKLHWLPFYEE
FT                   RYMFVRAAGGDDLPARISWAEAARSPLCLLTPDMQNRQIIDEALATAGAVSVPRIEANT
FT                   FFGVWSMVCSGAWASIVPHTHIATFGRMAGVCAIPLIDPDWRRPVGLVTPDRDPLAPVA
FT                   AAFRKLAARWSWNGEDAAS"
FT   CDS_pept        15401..16390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0017"
FT                   /product="uncharacterized protein"
FT                   /note="conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86015"
FT                   /db_xref="GOA:A8IG16"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IG16"
FT                   /protein_id="BAF86015.1"
FT                   /translation="MDLREAGSGWRVLRRTRIPGLPCPLCAHPAQSLTSRRDMNETVEA
FT                   LDPNEPRLITESGVAARIAAIVTPVLADLNLRLVRVKVTARDGGTCQIMAERPDGSMTI
FT                   DDCEAASRAISPVLDVEDPITGAYRLEISSPGIDRPLVRLTDFDRWAGHEVKVEMAVPV
FT                   DGRKRFRGILIGTRAELAVVKRTDAPKGEEPEVSLPVADIGEAKLVLTDALITEALRRA
FT                   KAAERGLGEDEEFEDDADEVFEGDEADEKAAKDAANAERANAKKAADKAEKRAGKVARK
FT                   AAKSEKAEKSQAKTGKARLSKAEVDDLAVTNPASRALRGGKPKAKETH"
FT   CDS_pept        16390..17988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="AZC_0018"
FT                   /product="transcription termination factor"
FT                   /note="C-terminal duplication"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86016"
FT                   /db_xref="GOA:A8IG18"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG18"
FT                   /protein_id="BAF86016.1"
FT                   /translation="MVAVSANRLELLQIADAVAREKTIDRGIVIAAMEDAIAKAARSRY
FT                   GQETDIHAEINPRTGELRLARHLLVVDEVENSATEITLDGARRHNPAAQVGDTIADTLP
FT                   PFDFGRIAAQSAKQVIVQKVREAERDRQYDEFKDRISEVVNGLVKRVEYGNVVVDLGRG
FT                   EAILRRDELLPREVVKTGDRIRAYIYDVRREPRGPQIFLSRTHPQFMAKLFAQEVPEIY
FT                   DGIVEIKAVARDPGSRAKIAVISRDQSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPW
FT                   NPDIATFIVNALAPAEVVKVVLDEDRERIEVVVPDAQLSLAIGRRGQNVRLASQLTGWD
FT                   IDILTEQEESERRQKEFAERTKMFAEALDLDEMMGQLLTSEGFTSVEEIAYVPVSELAS
FT                   IEGFDEETAAELQARALKHLSDVEEALDNERRELGVEDDLKTVPGVTSKMLVAFGKNDI
FT                   KSVEDLAGCATDDLVGWTERKDGETVRFPGALDGFELSREDAESLIMQARIAAGWISAD
FT                   EAEAQAEAAPDSEPA"
FT   CDS_pept        18010..18726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0019"
FT                   /product="protein of unknown function"
FT                   /note="DUF448"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86017"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG19"
FT                   /protein_id="BAF86017.1"
FT                   /translation="MLASMDQDETDGGPRALKGARAPDARLCLATRTVTPVSQMLRFVV
FT                   APDGAIVPDLGHKLPGRGAWVTATREALDQALKRKAFGRAFKGKGTSGPDLPDLVETLL
FT                   AADTRAALSLANKAGRVVTGTAKVESALASGDAAVLLHASDARPDGIRKLNGFARQMEA
FT                   AGLRPVAIVGCLPGVELDLALGRSNVVHAALLAHPTTAGFLARCRRLERWRMGTAASAP
FT                   EGHCPQPDRMQGTDTE"
FT   CDS_pept        18723..21899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0020"
FT                   /product="initiation factor 2 protein"
FT                   /note="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86018"
FT                   /db_xref="GOA:A8IG20"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IG20"
FT                   /protein_id="BAF86018.1"
FT                   /translation="MNDTKTPGDKTLHPAPGKTLTLKRPVEQGTVRQSFSHGRSKSVVV
FT                   EKVKRRVFAPGEAGAPSGTPAAAPAATPAPAAAAPRPATPAPAAPRPAAPATPAQPAAE
FT                   AKAPAPAPTPAPAAPAAPVAEAPKVEAPAPVAAKPEAAPAAPVAEAPKVEVPAPAPAPA
FT                   EPVAAQPAAPVAAAPAAPARAPEAPRPAVSAPRPAATTSSGSSSSSSRPAAGGAQRSGA
FT                   APQRPGTSGGPGRPGAPASGQRSGGPGSDRRGGPGGQNRPGQNRQGGSGVVLRTLTEEE
FT                   RNARASALADARVREVEERRMAEERRIAEEEARRRAERERAERAEREAAEARKREEESR
FT                   RALEDESKRRAEQEARKRFGEETGRSGGASAPSTSTARPLTPRPAGTTTTTGAPAAGEE
FT                   EDRRPRRGGGVPPRPAAPVKLPKSAGGEKHRGRLTVVTAQSGEEERQRSVASFRRRTQR
FT                   MTGHRGMQESKEKIVREVVLPETITIQELANRMSERAVDVIRMLMKQGQMVKITDVIDA
FT                   DTAELIAADLGHTVRRVSESDVEEGLFDSADAPEDLLPRPPVVTIMGHVDHGKTSLLDS
FT                   LRKANVVSGEAGGITQHIGAYQVTSPLGGKITFIDTPGHAAFTAMRARGAKVTDIVVLV
FT                   VAADDGVMPQTVEAINHARAAKVPLIVAINKIDKPDAKPERVRSELLQYEVQVESMGGD
FT                   TLEVEVSATKQINLDKLLEAISLQSEVLDLKANPDRPAEGTVVEAKLDRGRGPVATVLV
FT                   QRGTLRVGDIVVAGAEFGRVRALITDTGATTTEAGPSVPVEVLGFNGTPEAGDRLAVVE
FT                   SEARAREITEYRQRQKREKAAARSAVVRGSLEQMMSQVRSTGRKEFPLIIKGDVSGSVE
FT                   AIIGALEKLGNDEVQARIIHSGAGGINESDVTLAETSGAAIIGFNVRANKEARDSAERA
FT                   GIEIRYYNIIYDLVDDVKKAMSGLLAPITRETMLGNALILEIFNVSKVGKVAGCRVTDG
FT                   TVERGQHVRLIRDNVVIHEGKLATLNRFKDAVKEVLAGQECGMSFENYQDMRAGDVIEC
FT                   YRVEVVQRSL"
FT   CDS_pept        22131..22568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0021"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86019"
FT                   /db_xref="GOA:A8IG22"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IG22"
FT                   /protein_id="BAF86019.1"
FT                   /translation="MKTQDRSGSGPSQRMLRVGELVRHALADALQRGDHLDPALAGTII
FT                   TVPEVRMSPDLKIATCFVMPLGGKDVNTVIKLLAANQKLLRTEVARRVELKSVPSLRFL
FT                   RDTSFDEGARIDALLRRPDVARDLDTETDAEAGSETTKEED"
FT   CDS_pept        22568..23656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0022"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86020"
FT                   /db_xref="GOA:A8IG23"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG23"
FT                   /protein_id="BAF86020.1"
FT                   /translation="MNAPFPRPEEAEAAEQRAPGAPRGRGPRQQRDQAPRAPKRDIDGW
FT                   VLLDKPSGMTSTQAVAVVKRLFAAKKAGHAGTLDPLASGCLPIALGEATKTVPYIMDGR
FT                   KTYRFAVTFGVETDTDDSEGKSVATSDHRPSDADIEAALDSFLGEIMQVPPAYSALKIA
FT                   GERAYDIARGGNEVVLEARPVTIHRIEIVERPDADTVVLEAECGKGTYVRAIARDLGRM
FT                   LGTRGHVSMLRRACVGPFLEEDLVPMDELQARAEASEADLFDALDPVDSALEEIPHLSV
FT                   TPSDAHRLRCGQSVILRGRDAPILDGHVAIFCQEALIAIGDAQGGEVLPHRVFNWAKSH
FT                   RPRPAGGAPAARLHRDPPVEEA"
FT   CDS_pept        23689..25350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0023"
FT                   /product="putative oligopeptide ABC transporter"
FT                   /note="periplasmic binding protein component precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86021"
FT                   /db_xref="GOA:A8IG24"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG24"
FT                   /protein_id="BAF86021.1"
FT                   /translation="MRHASCFSGGGGVSAVWEGRRLMTFRLLRAAALIASVALAGAAKA
FT                   ESVVRYGISMADIPLTTGQPDRGAGAYQFTGHTIYDPLVAWEMNVADRPGKLVPGLATE
FT                   WKVDPADPKTWIFTLRKGVKFHDGSDFTADAVVWNLDKVLNDKAPQYDQRQAAQVRTRL
FT                   PSVASWKKIDDYTVAITTKDVDSFFPYQLLWFLISSPAQYEKVGKDWDKFASAPSGTGP
FT                   FKLDKLVPRERAELVKNEAYWDKTRIPKSDRIVLIPMPEALTRTNALLSGQVDIIETPA
FT                   PDAVPQLKAAGMKIVTNVTPHVWNYDLSKLPDSPWADVRLRKALNLAIDREGIVALMNG
FT                   LAMPAKGQVDASSPWFGKPTFDVKYDPEAAKKLVKEAGYSVEKPLKTTFIIAQGGTGQM
FT                   LSLPMNEYIQQNLKDVGIDVEFKVVELETLYTHWRKGAKDPINKGISSNNIAYVTSDPL
FT                   YALIRFFDSRQVAPVGVNWGYYSNPKVDALIDEAKRTFDPKKQDELMAQVHAQVVDDAA
FT                   LVWVVHDTNPHAMTPKVKSFIQAQHWFQDLTTIGLQ"
FT   CDS_pept        complement(25773..26543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0024"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86022"
FT                   /db_xref="GOA:A8IG26"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG26"
FT                   /protein_id="BAF86022.1"
FT                   /translation="MKITAEDITPVAFTVGLFVIWEAACRLFRIDAFILPAPSAIFAAA
FT                   AQFWWPLLRNSFVTLWTTVAGFALAVVFGIALGLVVGWSRAIYRGLYPVMIGFNSIPKV
FT                   AVVPILIMWFGIGEIPAILTAFLISFFPIVVNVATGLATTEPELEDVLRALGASKLDIM
FT                   RKVGIPRTAPYLFGSLKVAITLAFVGAVVSETIGANAGVGHLMVQAGSNFQMPLVFAGL
FT                   LALAVQGIFMYAVFAVLERRMAGWAFRASMSAAG"
FT   CDS_pept        complement(26540..27424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0025"
FT                   /product="ABC transporter"
FT                   /note="nucleotide binding/ATPase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86023"
FT                   /db_xref="GOA:A8IG27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG27"
FT                   /protein_id="BAF86023.1"
FT                   /translation="MPLRRRGRYPLPGPPPQGGRERHLEAHPPQGKPTALIRLDDVTLS
FT                   YKGRTGDVTALAHTSIEVARGEFAAVVGPSGCGKSTLMKLVTGLIRPTQGAVSVEGKPV
FT                   NGPVKLAGMAFQHANMLPWRSVLDNVMLPLEIVEPHRSRYRREKAAYRERALDLLGVVG
FT                   LRDFADRYPWEMSGGMQQRASLCRALIHEPALLMLDEPFAALDAFTREELWVVLRDLWQ
FT                   RLGFTVILVTHDLREAAFLADTIHVMSARPGRVVETRRVEFPRPRPLEVCYEPAFTQLV
FT                   HELRGKIAEVRQA"
FT   CDS_pept        complement(27643..28701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86024"
FT                   /db_xref="GOA:A8IG29"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG29"
FT                   /protein_id="BAF86024.1"
FT                   /translation="MCLASCQRTGGRPMRHMLRGLIGALGFIAAAALPARADTDIKFAL
FT                   DWKFEGPSAPYFVAIDKGYYKAEGLNVTVDTGPGSVAGIARVAAGTYPLGFFDINSLVK
FT                   FNDQNPDKALKAILMVYDKPPFSIVTLVKTGISKPKDLEGKVLGAPAPDGAYAQWKAFV
FT                   KENAIDADKVKIENVGFPVREPMLADGKVDAITGFSFSSYFNLLQKGLKPEDIKVLLMS
FT                   DYGLVLYGNAVIVNPDFAKAHPKEVAGFVRATIKGIIETARDPEAAIKSVMKRNETGDE
FT                   KIELARLKMALKDNMITEWVTKNGIGGIDVDRMTKSIEQIAVTYDFKEKKPAAADIFTA
FT                   EFLPPAAERMPK"
FT   CDS_pept        complement(28797..29981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0027"
FT                   /product="cysteine synthase"
FT                   /note="cystathionine beta-synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86025"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG30"
FT                   /protein_id="BAF86025.1"
FT                   /translation="MRYPQIAAAPVNNGLVMKIEPLSAVPSLTSPAAGAAPSERDARRI
FT                   WADQALRILERDARRSADTHLLPFEAHRLGGIDIYLKDESSHPTGSLKHRLARSLFLFG
FT                   VCNGQIREGITLVEASSGSTAVSEAYFARLLGLPFYAVMTRTTSPEKIADIEREGGRCH
FT                   FVDDSSAVYAEAAALAERLGGLYVDQFTNAERVTDWRGNNNIAESIFQQMQGEPRSVPT
FT                   WIVMGAGTGGTSATIGRYLRYRHHATRLCVADPEGSVFYDAFRTGDRSLTSCPGSRIEG
FT                   IGRPRVEPSFIPEVIDHMIRVPDAASIAAMRVLARRLGRKVGPSTGTAFHALCMLAAEM
FT                   MGRGETGSLVTLICDRGERYLRSYYDDAWVAAQGFELGSHEARMETFLDQGGPF"
FT   CDS_pept        30024..30701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marR"
FT                   /locus_tag="AZC_0028"
FT                   /product="putative transcriptional regulator"
FT                   /note="MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86026"
FT                   /db_xref="GOA:A8IG32"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG32"
FT                   /protein_id="BAF86026.1"
FT                   /translation="MREPFCAISFRSAPDTRKIPRAGSIREQLHLCLTPCLLPYGGEGH
FT                   FMESKSLKILEQDVSGQRSDEQTFGSDPLQRVTLGYLINLIARLLAQSLKARNGVEGIL
FT                   PGQYPIVLELLTKDGPTQRDLCDFVKIEQSTMANTLKRMERDGIIERRASLEDGRQATV
FT                   HLTERGRKLAEVAVVNAFDVNRVALEPLDREAQVQLRTSLIAMAERLESDLAEHRGGRG
FT                   HGA"
FT   CDS_pept        30815..31822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0029"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86027"
FT                   /db_xref="GOA:A8IG33"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG33"
FT                   /protein_id="BAF86027.1"
FT                   /translation="MKAAIIRSHGGAEALELVEDWPRPVAGAGDVVLRVKASALNYHDV
FT                   FTRRGMPGIKLDLPVVPGLDLAGEVVETGEGVTDFTVGDRVLVDPLNRVEGGLMGETVD
FT                   GGLQQYARVRAHQLVPIPEGVTYEQAAALPVAYGTAHRMLFTNGGIKAGDTVLVLGASG
FT                   GVGTGTVLLAKLAGAHVIACGSSAEKLERLKAMGADEVIDYTRSDFTKDIYARFGKPHR
FT                   RTYDGGVDVVVNFTGGDTWIPSLRALKRGGKLLTCGATAGFDPKEDLRFIWTFELKILG
FT                   SNSWAREDLVALLDHIAAGRLSPVIDRVLPLEDAREALRLIEEREVIGKVVIAP"
FT   CDS_pept        31868..32296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0030"
FT                   /product="uncharacterized protein"
FT                   /note="possibly involved in aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86028"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG34"
FT                   /protein_id="BAF86028.1"
FT                   /translation="MNDTPVPAVPDRAELDARIRRAPYHQWLGLSVVEAGDGEIVVEVP
FT                   WREEFVVNPDIGYTHGGILATLVDLVADWAIATKLGRPFPTVDLRVDYHRPAMKGVLRV
FT                   RGKVIRIGSSFSTSEAYVEDESGKLLASGRGTYATSTK"
FT   CDS_pept        complement(32599..35883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0031"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86029"
FT                   /db_xref="GOA:A8IG36"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG36"
FT                   /protein_id="BAF86029.1"
FT                   /translation="MKDLEDFFVSAVQRAHVSRSRHGLSVKDKAEWRKEPSKRGRSWIT
FT                   QTYPPESAMPAPTSPVSASLPPSPMPPFEAPFAPDDVALARPLLAQGTLAPEAEARIDA
FT                   LAARLITAIRKGSNAGGVGGIEEVLREYALSTKEGLALMTLAEALLRVPDSATADRLIE
FT                   DKLAQGDFLNHDSRSSALLVNASSWALGVTARVIQPGETPEGVLGKLAKRIGLPAVRTA
FT                   TRQAMKVLGNHFVLGQTIHAALDRAESASGRAYRYSFDMLGEGARTFTDAKRYFDSYAT
FT                   AIDDIGRRAGNMKLPDRPGISVKLSALHPRYDAVNRERVLIELVPQVIELARKAKAYDL
FT                   NFTIDAEEADRLELSLDVIDAVLADPGLAGWDGFGLAIQAYQKRAAAVIDHMAALAERL
FT                   DRRLMLRLVKGAYWDTEVKRAQERGLDDYPVFTRKAMTDLNYMACARKLLALRPRIFPQ
FT                   FATHNALTIATITELSGGTGGFEFQRLHGMGDAAHGERLAAHPDVGCRTYAPVGGHRDL
FT                   LAYLVRRLLENGANSSFVSVAGDPDVPVSDLLRRPATLIGNAEEARNRHIPLPPDLFGP
FT                   GRRNSHGVELGCRSVLAATLTDIAGHRREVTASTLIDGVAHAGATRTVVSPIDGSAIGR
FT                   VVEADAATADAAVAAALKGFVAWDRTPASERSARLRRAADLLEARQAAFLALLQDEAGK
FT                   TLDDGISEVREAVDFLRYYAGEAERLCGAGETLPGPTGESNVLRLRGRGVFVAISPWNF
FT                   PLAIFLGQVSAALAAGNAVVAKPAEQTPLIAFEAVRLLHEAGVPASALHLVTGDGLIGA
FT                   RLVEAPKVAGVVFTGSTEVARIINRTLAGKDGPIVPLIAETGGINAMIVDATALPEQVS
FT                   DDVVTSAFRSAGQRCSALRILFVQEDVADKMIEMIVGAADALKVGDPRDASVHVGPVID
FT                   AEAKAKLEAHIRALTGTARVHYAGTAPTRGTYVAPHVFELKQAADLKDEVFGPVLHVVR
FT                   FKAGGIDGVLDAIAATGYGLTLGLHTRIDSLVEKVTERLPVGNVYVNRNIIGAVVGVQP
FT                   FGGHGLSGTGPKAGGPHYLLRFASEQTVTINTSAAGGNAALMTQGE"
FT   CDS_pept        35923..36297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0032"
FT                   /product="leucine-responsive regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86030"
FT                   /db_xref="GOA:A8IG37"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG37"
FT                   /protein_id="BAF86030.1"
FT                   /translation="MGLSPTSAGERLKRLQRDGFVSGFGARLDPQKLGLGFLVFIEVHL
FT                   DKTTPDAFERFARAVRLAPEVLECHMVAGGFDYLLKVRLPDMTAYRRFLGNVLLGFPGV
FT                   RETRSYAVMEEVKSDAPLPV"
FT   CDS_pept        36399..36869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0033"
FT                   /product="putative MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86031"
FT                   /db_xref="GOA:A8IG38"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG38"
FT                   /protein_id="BAF86031.1"
FT                   /translation="MFPELRLLCFEDLATGMTETLTKTIASSDVVGFAEVTGDRNPIHL
FT                   SEHFAARTPFGTRIAHGLYTASLISAVLGTRLPGPGAVYISQTLNFRAPVKIGDTVEVK
FT                   VEVAELIPERRRARLACTCRVGEEVVLDGEAWVKVPPRSETERSPLARPAAG"
FT   CDS_pept        36908..37612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0034"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86032"
FT                   /db_xref="GOA:A8IG41"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG41"
FT                   /protein_id="BAF86032.1"
FT                   /translation="MVSRGAERLLRAPGRSGTQAGTTTDEEGAVQIWGRGNSTNVRKVL
FT                   WCAAELGLAYEHVNAGGAFGLVNEPAYRAMNPNGLVPCLKDGDLVLWESNVIVRYLARQ
FT                   YGQEPFAPKDAKAWAGADKWMDWASLSFGAPFRDVFWNLVRLPPEQRNMAEVARGTEQC
FT                   ARLMTLADAALAETPYLSGRDLGIGDIPLGCIAYGWFSMPIERPELPHLAAWYARLTER
FT                   PAFQSAVMTPLT"
FT   CDS_pept        complement(37661..38899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0035"
FT                   /product="putative periplasmic protein"
FT                   /note="involved in polysaccharide export"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86033"
FT                   /db_xref="GOA:A8IG42"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG42"
FT                   /protein_id="BAF86033.1"
FT                   /translation="MTGRGWSPQCAMVSGVGIGDGTFMRKVSGWPLLLPAVALSLSGCE
FT                   SLPQVGPNAQEVVSQSVEQNTQRYEVVDIDNAVLDVVRLRAQDTLYTSFGHSGPARSPL
FT                   VGVGDFVAVNIWEAGAGGLFSAPVVAGSFTTGSKTATIPDQVVKPSGTISIPYAGEVQA
FT                   AGRTTEAIQDEIVKALTGKAIQPQVLVTVTKPVSSTVTVTGEVVQGARVPLTAKGDRLL
FT                   DVIATAGGVRAPVNETFIQLSRGNRTVRVSMERVVSDPRENVFMQPGDVLTVVRDPQVF
FT                   LAYGATGANAEVPFNSSGITLATALVKAGGLQDNRSDPSGVFVIRYEPEFIARKLRPGS
FT                   PLVVPGGLTPVVYRLNLRDTNSLFVAQHFPIFNRDVIYVTNAPITDVQKAMQIFVLVSS
FT                   PATTGASLYTSMK"
FT   CDS_pept        39314..46714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0036"
FT                   /product="putative fatty acid synthase transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86034"
FT                   /db_xref="GOA:A8IG44"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG44"
FT                   /protein_id="BAF86034.1"
FT                   /translation="MGALRFKGPLRENPAGTTSTAIIGAACRLPGAPNEAAFRRLLKDG
FT                   VCAVQPAPVGRWSVERFLHPRASEPGFSYSFAGGFLEAPFDFDPTVFGMSPREAAQMDP
FT                   QQRLLLEVVWEALEDARIAPSSLAGTEVGVYVGASSLDHGNLLASDPAAIESHFMTGNT
FT                   LSVVSNRISYAFDWHGPSFTVDTACSSSLVAFAQALSDLKAGRIDTAVVAGVNMLLTPA
FT                   SYIGFSRASMLSPTGLCRPFSAAGDGYVRSEGAVAFVLRRSDLAAPGSIRALAVAGGVN
FT                   SDGRTSGIALPGVEGQRALLERLYGEARLRPDDIAFVEAHGTGTRIGDPVEATAIGSVL
FT                   GRGRAAPLPIGSVKSNIGHLEPASGVAGILKAVQALETRELPPSLHLDELNPLIDFADL
FT                   NLLPVREAVALDPAAPVLHAGVSSFGFGGTNAHIILASAPAVVPKAEPQAEAPQHLVIS
FT                   AATADALRAAAGAYADALSNGIDPERLAAAVAGGRETQRYRAVAVLDAADVVAAGLKEL
FT                   AETGTSKAVATGAAPAGAPKVCFVYSGNGAQAVGMGRTAYLRNAAFRQRFDEIDAAFKA
FT                   IGAGGVKEDMFASDLDARIGLASVIQPLMFAVQAALSAALVAEGLKPDMVLGHSIGEVA
FT                   AAEAAGAIDLLQAARIIHARATSQEGARGRGLMAVFAATRERMETFLDGFGREELEIAA
FT                   DNGPASITLSGATDALKRATKEARRQRIASRTLDMEYPFHSRFLDDTETAFRTAAGSVR
FT                   ARPATTAMISTVTGAPIGADLLGEDYWWRNVRAPVLFRDAIEAAAGMGATLFVEMGPRP
FT                   ILTSPITETLKEKGAVAAVLPSFTEADDREPRRDPVLWVVANARANGAPLPPAPGGAVD
FT                   RTLPLPSYPWQRTTYHFQGTTAALDLFGGAAPRHPLIGGRLAEGMPEWRTFLDYEVVPY
FT                   LADHVVGGEVVVPGAAIVEMVLAVARELRPEGPLGVEDCDIFQPLVLAPQAMREISVRY
FT                   AAATGDVELFSRPRFGADEWTLHARGRLVDVAHAPRTPAKPRGRLIRATAEEIYARTEA
FT                   CGLGYGPAFRLAKSIKRDAKTIEVELKPADAGTGAFTRPQLLHPASLDAALHGLFLLIV
FT                   MEPGVRRTYLPIRLGRLALFRDHPVVTAATITVDRHTDHSLKVHILLKDADGAVVAEVE
FT                   DALLKSVVLSRTDPDDGFLYVERHRTARSGAVRDVVGEVLAGVKAVDLPTPSDAPLMLR
FT                   AVLRAAAHRSLSRLADADGFIDWQALALTGRLAAPARAYAAMLAEELILAELATVDGEG
FT                   VRLAPDSGLPEPARILRTLAADYAGASADLLLATRMAGALDEFLATGTPVAHRPEVLEQ
FT                   FAAQSALLSSAAEALVRAAEAVAKDETPRILIAEPDGRGLVAALLPLARSGRVRLTVGG
FT                   LDAARLERLERRLPASVPVEMLLLDAAEGVPAGFDLALVAGWRLSGEDSATLLGRLAVQ
FT                   VKAGGALAVAQPAPDAVVDFLLGTEPDWFARSADPAFPVGRMPSTDETRSGLLAAGCRR
FT                   VESVELADGGTLLVAEAPDVEAGAATGRTVRLLESDASLLANALAGAFAARGVVLEQAD
FT                   VAASLAPSDADLVLLADGAGANDRARIEDGVLRLARLLADQPEGAAKPRLWVVVRGAHT
FT                   APLDPVADALWGFARVATNEYADVDIRLVDVAPGLPEADAAARVAGLIAAPGTEREVLF
FT                   DAEGAEVLRVRRGVPQATEALPDEAGLTLHFPRRGALDHFAWGQKPRTAPGRMDVEVEV
FT                   EAAGLNFRDVMLAMGLLDDDVLDDGMAGAVFGFECAGRVARVGAGVTDLKPGDEVVGFA
FT                   SNAFSSHVTAPRRVFMPLPAGTTAESAASIPVAFLTAWYGLVELARLKRGDSVLIHGAA
FT                   GGVGLAAIQIAKARGARVIATVSTPDKRALVELFGAQEVHDSRSLAFADAIRTAHGGVD
FT                   VVLNSLSGEAMRASLKCLKPFGRFVELGKRDYVANTELGLRPFRRNLTYFGVDLDQLLA
FT                   HDPKLVAKGLKDLARGFERGDYAPLPYRAFGADGIGEAFRLMQSAGHVGKIVVRPPAPA
FT                   EVRAPATASAAFAPEGVQLVVGGAGGFGLETALWLADQGARTIVVASRRGALEEKDIAR
FT                   VETLRQRGVTFAVERVDASDRASVDALIARVAAAHGPIGGVYHTAMVLQDGLIRTIDAD
FT                   ALDRVLAPKVDGARHLDAATRGQPVRQFVMFSSVSALIGNPGQGAYVAANAYLEGLARR
FT                   RRAEGLPALAVGWGAIADAGVLTRDQSTAEQLERITGMTGMASAEALGRLGRLLAAGDA
FT                   LTEPVVYCARWQRAGLMRDLPILSTPAFAEVFAEEGGAGEAVELDLASLLAGKSDTEAQ
FT                   KVLGELIAARIARILRLSAQDVDLDRPFAEMGMDSLMALELSMSIEHEFGVNLPLVAIT
FT                   SVPNVRELSRRLLQSLRAPQAAEEIDADDRRLISMHGGDEADFSDVGERLASRRDQVTR
FT                   VM"
FT   CDS_pept        46711..48075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0037"
FT                   /product="aminotransferase class I protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86035"
FT                   /db_xref="GOA:A8IG46"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG46"
FT                   /protein_id="BAF86035.1"
FT                   /translation="MTKKADAGRLSDTERSAFLSSMRRTAAPQPARTAAVAAPVRDVSF
FT                   ETLPGFKMLKTQRAAADLLGLSNPFYQTHATRAGAQSIIGNRPVINFASYDYLGLNGHP
FT                   EITAAVAEAAAEWGTSVSASRLTAGERPFHQQFEAELAALYETEDALVFVGGHATNVST
FT                   IAALLTPKDLVIHDALAHNSIVVGAELSKANRRIFPHNDLDALETILETARDKHERCLI
FT                   VTEGLFSMDGDGPDLARLVDIKTRWGAWLMMDEAHSLGVLGATGRGIFEHQGVDPRGVD
FT                   IWMGTLSKTLVGCGGYIAGSSDLITYLKFQAPGMVYSVGLPATTSIGSMTALRIMRREP
FT                   ERVARLQANGQRFLEKARAAGLDTGDSWGYAVSPVVLGDSLRTVMLAGRLLERGINAFP
FT                   IIPPGVPEKSARLRFFISASHTAEDIDTAVAAVTEEIARLDAEGVSVAKVADLMK"
FT   CDS_pept        48093..48857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0038"
FT                   /product="putative short-chain dehydrogenase"
FT                   /note="reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86036"
FT                   /db_xref="GOA:A8IG48"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG48"
FT                   /protein_id="BAF86036.1"
FT                   /translation="MAAELTVITGASSGIGAALARALAKPGAALALVGRNAERLESVAQ
FT                   DCRARGALCVTGALDVCDRPALEAFLDGLGEPVGLFIANAGILDGRRDGETVESGAAAH
FT                   RVLDTNLLATVDALHMVLPGMRARRKGRLLLIASLAAFAPLPDAPAYSAAKAGLLSYGL
FT                   ALREALHGEGISVCVACPGYVTSAMSAQHLGHRPGEITADDAAARILGALERDAAVSGF
FT                   PFTLYWSSRLSLLVPAFVRRLGMKGLRFRVGG"
FT   CDS_pept        49017..50222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcbD"
FT                   /locus_tag="AZC_0039"
FT                   /product="WcbD protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86037"
FT                   /db_xref="GOA:A8IG49"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG49"
FT                   /protein_id="BAF86037.1"
FT                   /translation="MSVTERSLPAIVTNLLSGAKPPPGVGRAAEAYLAALTWRKHLARI
FT                   GFCLLVVAPTLLATVFYGLLAAPRYVSEVKFIVRSVSSQRATGLDMLFRTFGISKTVDD
FT                   ANVIQQYLQSRDALQGVIDAGVDVKAIFQRPEADWWSSYPYFWRRDTTESLFDYFSNRV
FT                   SVVEDSTKGILELKVVTFRPEDSLLLSKTLLKLAEGMVNRMNERAQRDAMGSAQREVNF
FT                   AMETVIKAQGELTAFRNKEIIVDPSKSTFSLIETIGNLSTDLSFAQAELKQMLTTSPNS
FT                   PQIPTQRAKIAALEERVRVERAKMAGGDNSLANKIATYEQLALRRDLADKSLSNAMNAL
FT                   DVARQEARRQHIYVEEVVEPNLPDESTEPRRFRSVMAVLVFGFAIFAVIWIVSVGYGEH
FT                   TQ"
FT   CDS_pept        50219..51061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0040"
FT                   /product="putative capsule polysaccharide export
FT                   inner-membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86038"
FT                   /db_xref="GOA:A8IG52"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG52"
FT                   /protein_id="BAF86038.1"
FT                   /translation="MTLVERLRAFAEVPQPETGTRRPFGAAFLVQTRVVMALMLRGALS
FT                   RYGHENLGFFWLMGEPLLMTCGVMAMWSMAGMDHGHGVGLVPFVLTGYTMLTLWRHIVG
FT                   HMAHAMGHGAGLMFHRNVRMLDNLCGNVILESLGGLSAFFIAYIPLYMADLVPPIHDPL
FT                   LLLGGWAMITWLGLGFGMIIAALSEFSEAVSRFIPPVMYVSIPATGAFYMLEWMPEKAQ
FT                   AVLVWSPLVHPFEMFRGGLFGDMVGAKFSFGYMSLVCTILTAVGLAMVRAAEKHVHVQ"
FT   CDS_pept        51058..52308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcbD"
FT                   /locus_tag="AZC_0041"
FT                   /product="WcbD protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86039"
FT                   /db_xref="GOA:A8IG53"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG53"
FT                   /protein_id="BAF86039.1"
FT                   /translation="MSQPVQTSNSEDRAVAEPAVPRIAPQRHIELVPIAPEALPQHVGA
FT                   EGRPHVAVQPWWRRHGLFLGLFVLPVFAALLYFGLIASDIYTSEAKFLVRASARSVAGS
FT                   LSAMMPGDSMSRAADETYAVSEYMLSRDAAAELAKTAGLRDVMDRSEADMFNRYPSWFG
FT                   KENEEQFYRAYRRMVDVVPDGGTGISTLVVRAYRADDAQAVAKALIAAGEKFVNKLNLR
FT                   SNEDAVKFSESMVKETQLRLSDVEARLAAYRNSQLVVDPEKESTQSLAILGKMTTEISR
FT                   LEATLSQQMAMAPDSPAITPLRERIAAYRTEMQKQQKNVVGGADSIASKLQGYELLILE
FT                   RDLAGRALAVATASLESARQEAQSQRIYLQEVTEPNLPDQALQPKRLLAIFVVAFLSLC
FT                   VYWIARSFIANTLDHQA"
FT   CDS_pept        52317..53015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzt"
FT                   /locus_tag="AZC_0042"
FT                   /product="putative ABC-2 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86040"
FT                   /db_xref="GOA:A8IG55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG55"
FT                   /protein_id="BAF86040.1"
FT                   /translation="MVRGDVPPPPALGGLPDGISLDGIVKEYHTPIGNRRVLDGISFDI
FT                   ARGEKIAILGRNGAGKSTLMKIIGGVEKPTKGKMRFGMSMSWPIAFAGGFDHTMSGLDN
FT                   IRFISRLYGVPEQEAVARVDQFAELGRLLNLPVKTYSTGMRSRLMFGLSLAVDFDCFLV
FT                   DEMISVGDQRFQRKCHEEMFVKRAHCSMILVSHDTNIIRNYCKKALVLKNGRGRVFEDL
FT                   ELALRIYDSL"
FT   CDS_pept        complement(53082..54158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkbM"
FT                   /locus_tag="AZC_0043"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86041"
FT                   /db_xref="GOA:A8IG57"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG57"
FT                   /protein_id="BAF86041.1"
FT                   /translation="MNSNDFGPPANFINGGIYEKENLDVLMSFVRDDTVFLDIGANLGF
FT                   YSLKVAQRNKLHGKIHAFEPHPTLVRLARASSYLNGFSQLAADDGVIVVHQCALGDTNG
FT                   EVTLAYPDGHLGGGGMAAAAAGTTAVVTPVHRLDDFLGPDFTFDLAKIDVEGFELEVLR
FT                   GMQGLIARSPKAVLLFEKLERNRGYEADIEAVLRGAGLHLFGITADSLLFPIADGELSA
FT                   YSGYVVASHDPDIERNRNHFRIYPRQFLASAERVKERTRDMLVVGGEAGDIIFHGPYWY
FT                   LHRGIYRLTLEGTTDGIIEVVLAHHFGYPTTSVLLGPDNLTADVLIETDLPQFELVCRP
FT                   KNNRATVSLKSIRIQRLG"
FT   CDS_pept        54255..54383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0044"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86042"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG59"
FT                   /protein_id="BAF86042.1"
FT                   /translation="MLDLLDRIAQAREALQYLDHLGAHGGTFATHRTRAFSIRMKL"
FT   CDS_pept        complement(54406..55500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0045"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86043"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG61"
FT                   /protein_id="BAF86043.1"
FT                   /translation="MPGPGMSEKRSYLMSVFGTPSALTRWIINVSVAIAREVSADHTFI
FT                   AAASLDDLRNSWAAKKSGSIIFHSDSPREELRRIFLKNNYPLVLVSEPLWRVACYCITT
FT                   RQLDPILAARITTQSACTLSTLQDCAFIFRVSEANYQDRAVDLIEQLLNFYGIEASVSS
FT                   LPGLLAEMRLADRPDMTVEESLSLLFPDYNHDAQYPRSSLAEDARFVLSQYEPLLRDLA
FT                   PVEFIWPPTVCFKFEPEIAYLDGSVEMVGAARILIGGHSLCLPQGRWRARVFVEISENL
FT                   SGNRLRSDVFAEDQVFATVTAVLPKSGLFYYDIDFECQDPFYPIIIQLAITEGAIEGWL
FT                   TLREISIVNVDLYPRKSGRPVQAA"
FT   CDS_pept        complement(55673..57070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0046"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86044"
FT                   /db_xref="GOA:A8IG63"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG63"
FT                   /protein_id="BAF86044.1"
FT                   /translation="MRGCHAAQIVACSRPLHLARGSRMSRPAQSPTVMIDGYNLGLEKG
FT                   TGVATYARNLSYACRDLGLRTEILYGAPFGPGRSELLREISFFDPFKPKSALESALRTA
FT                   GRLVPRPGGPKAFEVPVTGAVILGSQRSRLPHFDRIWNAPDVFETATTQFAVTNGFMNV
FT                   RGLPRTDIMHWTYPLPLTLPGARNIYTLHDLVPLRLPYTTLDHKGRYLRLTQKLVQTAD
FT                   HIVTVSETSKRDIIELLGCPPEKITNTYQSAEIPQKYLDRSEEEVRADIEGAFGLPYKG
FT                   YFLFFGAIEPKKNVGRLIEAYLGTQMDAPLVLLGNAAWKSHEELRLLNDSSQKYIEQVG
FT                   TRTFTRERVRRLEYAPFSLLVSVIRGAKATVFPSLYEGFGLPILESMLLGTPVITSDIG
FT                   ATAEIAGDAALLVDPYDTGSIARALRAVHDDADLRADLAARGRARAEFFSLARYAERVQ
FT                   AMYERLV"
FT   CDS_pept        57345..58745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0047"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86045"
FT                   /db_xref="GOA:A8IG65"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG65"
FT                   /protein_id="BAF86045.1"
FT                   /translation="MVSVPVAYDVTRLFLGPLSRTPRGIDRVDFGLAARLFRQSSFPCV
FT                   GVMPTLHGTRAFSHHAVRRGLVRLQQLWAERQGGDKTAIWTDLVAELTGQRVGSATIPA
FT                   PAPLTALQRARRMTSLLAATGFSFGNSARTHVPERAVYVNVGHISLAMPFFLRWLDARP
FT                   DVTPVFMLHDVIPLDTPEYVSPSSVRHHATMVASTARHAAGLLVTTQTAQRTVRDALAR
FT                   IGRTDIMTLAQPLPLSRVFDTTAEPDPALAGVPYFVICGAIEPRKNHELLFNVWRGLTA
FT                   ELGAKAPHLVIIGSPGWKCDEILQPVRNNPQMCRHVHVASGLSSPALKRLLAGAIALLM
FT                   PSHAEGFGLPLIEAMRLGVPVMASDIPAHREVVDAQALLLDPRDPLAWDAAIRHWADGG
FT                   RPQVHPRSRQDTVDERETYFSGIEDFLEACAAERAKQLGPVARRTTAAGGALIGKPASA
FT                   ESSALDSF"
FT   CDS_pept        58811..59533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0048"
FT                   /product="putative CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86046"
FT                   /db_xref="GOA:A8IG68"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG68"
FT                   /protein_id="BAF86046.1"
FT                   /translation="MGVDASGVRLRGVRSSVTKPTESLFERFHESFLAGPERRLLRWMA
FT                   ARLPAFVMPDHLTAFGVFGALVVFIGYLAAFLSPNFLWLANFGLLIHWYGDSMDGTLAR
FT                   VRDIQRPKYGYFLDQNIDVIGNLLIAAGLGLSPYARLDTALLALTGYHMCSIYVFVRNV
FT                   VRREFHLAVMGFGPTEVRIGILVMNLTILIAGAPTFTLFGQLFTWCDLVLLGTFVLLTV
FT                   MFAISFAEEAKQLAREGE"
FT   CDS_pept        59670..60692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0049"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86047"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG71"
FT                   /protein_id="BAF86047.1"
FT                   /translation="MTIQRGTEDRAIDLMYLGRIRFSSSVSALSDSDFSRHVVRSAGHL
FT                   GRPAQTSAAKGAEGRARFVFDALFGEPSLPLETYRAALSALGAGLGYARLDDFAALFAA
FT                   IFPEPDALLAHREGICRAIAENGALGLGADVDTDLLRLKRTAFPWIFAGPTRSRVEALF
FT                   NILLRRPPQADELDRLDDAVRAGDLDAAGVVHLLVTSDEFGPQAIAGAAVARHVAGTVL
FT                   ETLMKRDVGEVAVNAYSQSIQNGYPLSGFLEELINSPEFRARIGALGSATPAVQQDNLA
FT                   PLTRLAEGLLVEHLAERGCAFPAAPPLGVESSSPEQLRSLLFTLAMLAKSQANGEKSVH
FT                   "
FT   CDS_pept        complement(60784..61911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wbpY"
FT                   /locus_tag="AZC_0050"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86048"
FT                   /db_xref="GOA:A8IG72"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG72"
FT                   /protein_id="BAF86048.1"
FT                   /translation="MKTVFLDITELRGNPVRTGIQRMVRQLLKAWPTDVEAVPVVYDSV
FT                   REALRIISQETVEFLIESGDTPSMPLRDAVDQVNFLDDPARSPTVTLREGDKVHIPELF
FT                   FDEKRTVFHRKAIASGVDLSVWIPDFIPWLRPECFPRIPSFHPYMHYLWLVFEARKRAF
FT                   ISAAVRDDFECRIYRRPSQGTIVTDLGADAINIGQQTFNADRKDLIFLGTLEPRKAQHV
FT                   VYNAFIGRTRHPDLRLTFIGAIPEHGIPADFMPLVKSKRPDVRLLTEANDSDVAEIFKG
FT                   ARATVYTSQVEGYGLPPMESLYAGVPVIVRDNLPALVGKPDFGQLRLGRGDEEDIRSAI
FT                   DIIGDDQRCAALWEDARRFPSRTWQAVARQIADWA"
FT   CDS_pept        complement(61908..64343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0051"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86049"
FT                   /db_xref="GOA:A8IG75"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG75"
FT                   /protein_id="BAF86049.1"
FT                   /translation="MPPETKPAAPACSRGRPISVLSEALMSATHPVAIYVDARALQDPD
FT                   YRFRGIGQHASSLLEALRRRSWNGPRPRLIAVVDVAREPLHDQHRRIFDEVTSRTSPSN
FT                   MGSRKGAVWYITLSPMTHDPVWARHFLEDTSIYRICLFYDLIQLQYPERYLANAKARTE
FT                   FLICLSWLSRYDAFAAISQFTADELIARVKVPAGKVFVSHVAVRQSLEPEVNEAPLPRS
FT                   ERRWIVVAGGGDPRKNVECAIRAHARSAKLAEAGIKLVIFGNYPETMRAEFRSIYAEEG
FT                   GTFKDLQFLAHQTDSELHNIYRQGLATVVPSRAEGFSIPIIESSAAGTPALASDVGAHP
FT                   ELIRDAAWRFDPDDPEKLQAQLEKLALDPVAWTELQTEQRDLWQGYRERIIGQRFIDGI
FT                   LERQPAQLPSAAVLRKAKPKIAILTPLPPAHSGVADYSAYTLRPLKAVADLHMFTQTPG
FT                   AFWEEGWAGLGRVSDLKFRSDRFDAVISIAGNSDHHSEIIDYLLENGGACIAHDARQLD
FT                   FYMHVKGAQKTVELASAEMGRPVSLSEVTTWLQNQRNLPVLFLSEIVRAANPTIVHSPK
FT                   TADIIEQLYGTKVKVLPFAQYRDLPADILETSCRESARRKLGIPSDEVVLTTFGAAGAT
FT                   KGLEALIPTLGMLHRWGVKARLVFCGEAQMGFFQHIIDAATRIDIEPYLTYFDKPVSEE
FT                   TYVDYLAASDIGIQLREYFMGGLSGALNDCIAAGLPSVANTHLAEAMNAPGYVRRVPDG
FT                   LSPVLIAEAVMELLEQGIHLRRPAEQARAAHAERQPKEYCRQLLAALGIDAGALSANR"
FT   CDS_pept        complement(64367..65605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0052"
FT                   /product="S-adenosyl-dependent methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86050"
FT                   /db_xref="GOA:A8IG77"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG77"
FT                   /protein_id="BAF86050.1"
FT                   /translation="MMSEAYRKIDGCRVSGSKNLVTVLQLGHQELTGVFPAPGQAVTSG
FT                   PLDLVWCPDSGLLQLAHTYNSSEMYGENYGYRSGLNASMVRHLTQKIGFLEKLSGVKPG
FT                   DVVLDIGSNDCTSLKAYSTQGLKRIGIDPTGAKFRQYYPDDVKLVPDFFSAANFRSVSD
FT                   QAATVVTSIAMFYDLDDPIAFARDIASVLAPNGIWHFEQSYMPAMLRTTSYDTICHEHL
FT                   EYYSLGVVKLIVEAAGLKLIDVQMNGVNGGSFAVTAAPKGSTLPANEAVINWLLEQEDR
FT                   MGLNTVRPFREFEDRVFRHKADLTRLLKALAADGKKVFGYGASTKGNVTLQFCGITTAE
FT                   MPVIAEVNPDKFGKVTPGTHIPIVSEAEARAMKPDYFLVLPWHFKEGILQREQEYIAKG
FT                   GKFIFPFPEIEIV"
FT   CDS_pept        complement(65771..66748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0053"
FT                   /product="GDP-6-deoxy-D-lyxo-4-hexulose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86051"
FT                   /db_xref="GOA:A8IG80"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG80"
FT                   /protein_id="BAF86051.1"
FT                   /translation="MPGNPVLLLVGGTGFVGGHLAPALVAAFPRHRRVMLSRGEASARP
FT                   DWETLEGDLSDAVAMDRIVAELRPEVVIHLAAQASVVSDPNATWVVNCGGTFNLARAVA
FT                   RHVPRGLFFFSSSGEIYGESFNDGPAREDTAPRPMNAYAGSKLAAEAVLRALLPQEWRL
FT                   VIARAFNHTGPGQDERFVLPSFAAQIARIEAGQIAPRIRVGNLAAERDFLHVKDVVAAY
FT                   IALLHYEGPERRILVNVASGHVYGISDLLERLRGSARRPFEVEIDPARMRPSDIPCAAG
FT                   DPSLLKQLVNWTPRHSIQETLDELLDWWRAAVLSGRGEGVSTNH"
FT   CDS_pept        complement(66752..67729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0054"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86052"
FT                   /db_xref="GOA:A8IG81"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG81"
FT                   /protein_id="BAF86052.1"
FT                   /translation="MTKRALITGITGQDGAYLSQFLLEKGYEVHGVVRRSSHLGVADHR
FT                   LRWLGVEKDVAMLDGNLSDLSSLIRLVEQVKPDEVYNLAAQSFVASSWQQPILTANITA
FT                   VGVTNVLEAVRIVAPQARFYQASSSEMYGKIQEAAQSETTPFYPRSPYAVAKLYGHWIT
FT                   VNYRESFGLHASSGILFNHESPLRGIEFVTRKVTDGVARIKLGLEKELRLGNIDAKRDW
FT                   GHAKDYVRAMWLMLQQDAADDYVVATGTTTTVRDMCRIAFSHVGLNIDDHLVIDPAFFR
FT                   PAEVDVLLGNPAKAKAKLGWEPQITLDQMIREMVDADLARLKRA"
FT   CDS_pept        complement(67996..69003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="tetratricopeptide region"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86053"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG84"
FT                   /protein_id="BAF86053.1"
FT                   /translation="MVPSDIMIGNIISHLSPKRVFAVRHLRAADAARDAQNWALAVAGY
FT                   RAYLDLMPQDWGIRVQLGHALKESGDLRAAEAAYSAAATGNPSDADVLIHLGHLLKRLN
FT                   RPAEARTFFERSVALLEENANLPGGDRLLQAAKEGLASQALATADAARDAKKWRDAAEH
FT                   YRTYLDAFPGNQAIWIQLGNVAKEAGDFSTADDAYSKAIALDATNYEPHLQQGHLLKRL
FT                   GRPDQARRAYVRANELGAGWLAQTELARPGEHPSEGAPTQPPAPADAATAELRNAADAE
FT                   LRSRNWIKAFETYQRYTSANPSDKEAWLNLAKTLTHIGRYRLAEDARMRAERLA"
FT   CDS_pept        complement(69126..70532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0056"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86054"
FT                   /db_xref="GOA:A8IG86"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG86"
FT                   /protein_id="BAF86054.1"
FT                   /translation="MLQLLQKPAPILEERGPDWFAPARPRPHDKRLPPLDLILAAKRNL
FT                   ISLWHVNDYRPTHGDMRLFGRQVFLANSPETVKYVMATRHDNYERKSPQMRRALENLLG
FT                   DGLFISDGETWRRRRPLVSDIVHKNRVPAFGLTMEAVTLSFVERWRARPAGEPFNALTE
FT                   MAELTAEIISRAVFGNELGARAAHDVVDAFTRYQGLIDNFNIGYFLGANEGLPVFRGPR
FT                   LRRSVAQLDRVIDKVVTDHLEGRGEHDSMLDLLVKRQQKSPDLGLDVSALRNEAATIFM
FT                   AGHETTAGVLTWAWYLISNAPWVEEAVLAELDRVCGSRTPTVDDVAQLDWCRSVIEETL
FT                   RLYPPVPILARQAKDADTIAGIDIDPAALVVVVPWLLHRSEGLWDQPERFRPERFLTDR
FT                   PTPYTYIPFAIGPRICAGLAFGLTEAILCFAILIQQFRIRVLPGTKVEPVSRLTLRPAG
FT                   GLPVTAERRV"
FT   CDS_pept        complement(70625..72052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0057"
FT                   /product="GDP-mannose 1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86055"
FT                   /db_xref="GOA:A8IG89"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG89"
FT                   /protein_id="BAF86055.1"
FT                   /translation="MMVSRHKIVPVILAGGTGTRLWPLSRQSLPKQFIALVSENTLYQD
FT                   TLLRVAESDVFLPPVVITGTDFRFFAKRQAAEIEIHPTVLLEPVRRDSGPALLAAAAYV
FT                   RDQHGPETLVLALAADHVVSNPDAFRACVNSAAEAASKGHIVTFGIRPQGPSTAYGYIK
FT                   PGTVVEGTDAALVDRFVEKPDAETAARYVADGYLWNSGNFLFPAGLMLEEGARLEPEMT
FT                   AHAEAAIAKAKPDLTFLNLDSAEFSASKAISIDFAVLEHTQAAAVVAGDFGWSDIGAWD
FT                   AVHDVNAQDAHGNVTHGSVSLMDSRNSYVYTDGKLVAGIGLDGISVVATDDAILVMPSE
FT                   RSQDVKKLVSELSSAKRNEVNEHLKMHRPWGTYQTICRGDRFHVKKIVVEPGGKLSLQK
FT                   HYHRAEHWVVVRGTAEVTVDDKVFTVNENESTYLPCGSVHRLANPGRIPLELIEVQTGS
FT                   YLGEDDIVRLEDVYSRQ"
FT   CDS_pept        complement(72227..72811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0058"
FT                   /product="cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86056"
FT                   /db_xref="GOA:A8IG91"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG91"
FT                   /protein_id="BAF86056.1"
FT                   /translation="MVKLNKIYTRTGDDGSTGLGTGERVRKDDLRVAAYGTVDETNATI
FT                   GLVRLHLAAYPQVDAILARVQNDLFDLGADLCVPERPGAPPPPYEPLRITAPQVRRLEE
FT                   DIDRLNAELDPLKSFILPGGTPAAAHLHLARTVARRAERDMVTLAESDGEQVGMEALRY
FT                   INRLSDLLFVAGRYVNGHGANDVLWVPGAHR"
FT   CDS_pept        complement(72830..73024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="hypoxia induced protein conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86057"
FT                   /db_xref="GOA:A8IG93"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG93"
FT                   /protein_id="BAF86057.1"
FT                   /translation="MMNWTIYLLIPLALAAVAGVLILGLVNLAAGGSPQRSQKLMQLRV
FT                   LFQFGAVVLVMITIYAMRH"
FT   CDS_pept        73266..74600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0060"
FT                   /product="general substrate transporter"
FT                   /note="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86058"
FT                   /db_xref="GOA:A8IG96"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG96"
FT                   /protein_id="BAF86058.1"
FT                   /translation="MTSSPSTGPDHQAKRPLSGQDIRTLVLSALGGALEFYDFIIFVYF
FT                   VVVLGKLFFPPEMPQWLVQLQAFGIFAAGYLARPLGGIVMAHFGDKAGRKRMFTLSIFL
FT                   MALSTLGISFLPSYQVIGYAAPILLLSMRVLQGAAIGGEVPGAWVFVSEHVPGRHVGLA
FT                   CGILTCGLTSGILLGSLVATAINTIFTPADILSYAWRIPFLLGGVFGFASVYLRRWLQE
FT                   TPVFKEMKARKELAAELPLKVVLHRHTPAVIISMLVTWFLTAAIVVVILMTPTLLQKPP
FT                   YGISAPLALEANVAATFFLSIGCVLSGALSDRLGGGRVLAVGSVLLGIATYALYTLVPA
FT                   RLDLVVPLYAAAGFTVGVIGAVPFIMVRAFPPAVAFTGVSFSYNVAYAIFGGLTPLFIS
FT                   LAMQLDPLAHAHYLLLIAALGVVVGLMVRPPLHAAAKTERVGARA"
FT   CDS_pept        74861..76906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0061"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86059"
FT                   /db_xref="GOA:A8IG98"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A8IG98"
FT                   /protein_id="BAF86059.1"
FT                   /translation="MGVPMSRFRLGIGYKLGIVSGILVLLSGSVIISRQIASSRIQAAT
FT                   EASDVQDSILQKIEAAGATITRIQANAKDIRLSFSSNEVDGLLGRVSSDVTKGMDLMDE
FT                   ASDLTQAAATRDAYKAIRTRFGDIGKAVTEIAKAQKLELESFDRRTGITVRWDGALDDA
FT                   KASLLDLNSRLGENAISDLSLLDRKLQQINLASWRFIATEDTKQLPVIEMNAKAGRATL
FT                   DSVLQTAGTDPNTEGPVKTVRTFFEEYLKYVQDGVDQVMLKRKILEERLTPASREVAQM
FT                   IQQASSNAASGSKQADAAAESARTDGMFQILVFSCISIVAAIVAWAYSGFGIALPIRRV
FT                   SAVMNEISGGNLAAEIPYGTRNDEVGDQARALAVFRDGLIEAERLREERAEEERLAALQ
FT                   RKTEMHDLADRFESAVGAVVDMVATAATNLQTAAQTLTSTAEQTTAQATAVAAAANQAT
FT                   VNVQTVAAAIEELSASAREIGSRLSRSSEVADRAVSEVDHTNGQMTELRTSADQIGNII
FT                   SLIDNIAGQTNLLALNATIESARAGEAGRGFAVVAQEVKGLAGQTAKATADISERISGI
FT                   QDSTGDVLGAITGIAHTIAEISEGTTAIAAAMEEQNATTAEVSRNIQQAAAGANEVTSN
FT                   IAGVERAAQASSNAALQVLSSATDLSHQADALRAEVQNFLRSVRAA"
FT   CDS_pept        77105..79129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0062"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86060"
FT                   /db_xref="GOA:A8IGA0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGA0"
FT                   /protein_id="BAF86060.1"
FT                   /translation="MAKFKVGIGLKLGIASVVLVLLSGGVIVSRQVAITEIREANAEVR
FT                   QQQAVFDLLQEIHLLLSRIRVNTAEMRLSFANLDNENYLKQIKKDVASAKERLDKAIAV
FT                   EPHEDDRASFRKLKALFDDMGTAAAAVYQTEADQLDAVDARPGIRMAARVAFANLTTQL
FT                   TNVGDADAAREVEPLEAMLEQVNMASWSFLVEEDTKQLNIISVNEDSGHKALDAIQERL
FT                   GGISMVASDLAAARKAFDDYIKSIRDGIAQAQARQKIVAEKAVPAMAATLKMLQEATDD
FT                   GMKQSQEADAAATAALDSGMGQILIFSIIAILAAIGAALYSVFGIARPIQHVSAAMEEV
FT                   SGGNLQAQIPYETRGDEVGDQARALAVFRDGLAEAEQLREQRALEERAAAERRKEEMHA
FT                   LADRFEAAVGAVVETVASAASELQGAAQTLTTTAEQTTNQASAVAAAANEATANVQMVA
FT                   AAIEELSAAANEIGHRLSRSTEVAGRAVSEVDQTNGRMTELRGSADQIGNIVGMIDTIA
FT                   GQTNLLALNATIESARAGEAGRGFAVVAQEVKELAGQTAKATADISSRIHGIQDSTGDV
FT                   LSAITGIAQTIAEISEGTTAIAAAMEEQNATTAEVSRNIQQAASGTTQVTSNIAGVERA
FT                   AQASSQAAQQVLSSATGLTRQADALRAEVQHFLSTVRAA"
FT   CDS_pept        complement(79264..81534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0063"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86061"
FT                   /db_xref="GOA:A8IGA3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IGA3"
FT                   /protein_id="BAF86061.1"
FT                   /translation="MLPSAPCGGGAARASRRLAHGSPSSSEKKETFMFDIHREELDWGG
FT                   RTLVLETGKMARQADGAVFASYGDTTVLATVVSAREPKPGQDFFPLTVNYQEKTYAAGR
FT                   IPGGYFKREGRPSEKETLVSRLIDRPIRPLFADGYKNDTQVVVTVLAHDLENDPDVLSM
FT                   VAASAALTLSGVPFMGPIGGARVGFVGDEYVLNPTIEELKDSALDLVVAGTSDAVLMVE
FT                   SEAKELSEEVMLGAVMFGHRHFQPVIEAIIRLAEKAAKEPRPFEPVDHSALEAKIREIA
FT                   EADLRAAYKIKQKQARYEAVGAAKSKVKKYFEQLAIDGQEAPKAQDVAEVLKGLEAKIV
FT                   RWAILDDGIRIDGRDVKTVRPIVSEVGILPRAHGSALFTRGETQALVVATLGTGEDEQF
FT                   IDSLEGTYKEHFLLHYNFPPFSVGETGRMGSPGRREIGHGKLAWRAIHPMLPAKHEFPY
FT                   TLRVVSEILESNGSSSMATVCGTSLSLMDAGVPLKSPVAGIAMGLILEGEKFAVLSDIL
FT                   GDEDHLGDMDFKVAGTESGVTALQMDIKIAGITEEIMKVALAQAKDGRAHILGEMSKAL
FT                   TSARAELGEHAPRIEVMKIAVDKIREVIGSGGKVIREIVEKTGAKINIEDDGTIKIASA
FT                   SGDSIKAAINWIKSIASEPEVGAIYDGTVVKVVDFGAFVNFFGSKDGLVHISQLSKERV
FT                   AKSSDVVKEGDKVKVKLVGFDERGKTRLSMKAVDQTTGEDLEAKAKSEKDAAKEGDEAG
FT                   AAE"
FT   CDS_pept        complement(81867..82136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0064"
FT                   /product="ribosomal protein S15"
FT                   /note="bacterial chloroplast and mitochondrial type"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86062"
FT                   /db_xref="GOA:A8IGA5"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IGA5"
FT                   /protein_id="BAF86062.1"
FT                   /translation="MSITPERKQALISEYGAKAGDTGSPEVQVAILSERISNLTEHFKS
FT                   HNKDNHSRRGLLKLVSQRRSLLDYLKKKDEGRYKTLIGRLGLRR"
FT   CDS_pept        complement(82367..83248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGA8"
FT                   /protein_id="BAF86063.1"
FT                   /translation="MSVIPFPRRSTAPDVRSGAIPGLDPEVMVGMPHLGFGGLSETWLL
FT                   KECGHRHWLALAQAAGQRVPDFRDATGAPVYAAFCGVSLANARLDRVAENDTLIFASTL
FT                   ARISATQFVSRHSVRAPDGVVAELELVSVFVKRQVEGRNRSVARVRPEGLPPLDPGEVS
FT                   RTSALAAALRGGEWDTHMGFARTQAHECARVMLTPCPSQDFNGAHFLYFAAFQAFADRA
FT                   EWELLAPPAGTLTLARDLVYHGNIEPGERLAACLLGVRETPGELAHWLRLAREDGTPLA
FT                   DIFTRRALPPIR"
FT   CDS_pept        complement(83252..84553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0066"
FT                   /product="putative flavoprotein involved in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86064"
FT                   /db_xref="InterPro:IPR024000"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGB1"
FT                   /protein_id="BAF86064.1"
FT                   /translation="MRSGDETMPEAANESVPHHAVVVVGGGQAGLSISYYLKARGLDHV
FT                   VFEKDVAMGAWSKQRWDNFCLVTPNWQCQLPGHPYEGPEPDGFMKKDEIIAYLDAFKRK
FT                   VDAPLREGVAVKRVKARAGGGFEVTTSAGTVTADQVVATSGGYHTPIIPRLAERLPASI
FT                   HQLHSEQYRNAQSLPQGAVLVVGSGQSGAQIAEDLHLAGRTVHLAVGDAPRCARFYRGK
FT                   DVVTWLAEMGYYDMPVERHPLREGVRDNTNHYVTGRDGGRDIDLRKFATEGMKLYGLLD
FT                   GLDGTTLTFAPTLKSALAEADRVYNGINAAIDKHIAEKGIAAPPPSVYEPVWEPEADPV
FT                   ALDLAAEGITSIIWCIGFQPDFRWLDAPVFNGAGHPQHYRGVTQVPGVYFLGLPWLHTW
FT                   GSGRFSGIDRDARYVADRIEELAKGETMPLKAAG"
FT   CDS_pept        complement(84570..84848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86065"
FT                   /db_xref="InterPro:IPR023846"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGB3"
FT                   /protein_id="BAF86065.1"
FT                   /translation="MRFHIRWPDGRAEACYSPSLVIKEHLDVGASYPLADFLARSRTAL
FT                   TIASDRVEAKYGFPCSRALGQLARIEAAARAFSDTPNPCVHVDAFEE"
FT   CDS_pept        complement(84850..86028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0068"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86066"
FT                   /db_xref="GOA:A8IGB5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023986"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGB5"
FT                   /protein_id="BAF86066.1"
FT                   /translation="MSLSIALLAHSTNPRGGVVHALELGEALDRLGHRATVHAPDAKGD
FT                   GFFRPAACATHCVPAAFISGGTTALVETRISDYVRHFEDAAHRRFDVFHAQDGISGNAL
FT                   ATLKARGLISGFARTVHHMDAFADPRLAALQHRSIVEADTLFVVSRAWQDRIAETFDRE
FT                   ATLVGNGVDTARFSPAPDGREGALRTRLGLGAGPVILAVGGIEQRKNTLALLDAFIQLR
FT                   ALHPQAQLVIAGGASLLDHDSYRQAFRHALRASSLPPGAVIIAGPLPQADMPALYRIAD
FT                   VLAFPSLKEGFGLVVLEAMASGIPVVAPAIAPFTEYLGADDVAWCDPLVAHSIADALLS
FT                   ALAPALRPRLVAAGKRVVAAHGWDATAAAHLPAYAALAAGAPPHRIKDMAYA"
FT   CDS_pept        complement(86025..86999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0069"
FT                   /product="putative selenophosphate synthetase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86067"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR024030"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGB9"
FT                   /protein_id="BAF86067.1"
FT                   /translation="MERALDSLAQTLRASSGLAAKADIASVAARLGLNGASAVPVGDDC
FT                   AAIPDGEGYLLLAIEGFMNAFVAGDPWFAGWCGVMVNASDIAAMGGRPLAVVDAVWADG
FT                   EEGAQPVLEGMAAASAAFGIPVVGGHTNIRNDRGQLSVAILGRAKRLLTSFDARPGQTL
FT                   IAAIDLRGRYRAPFSNWEAATDAPPARLKGDMALLPEIAEAGLSRAAKDISQGGAIGTA
FT                   AMLAESSGTGVRIDPFAIPRPEGVDLARWLTTFPSFGYLLAADPADVPALIARFTTRGI
FT                   AAAAIGEMTAERQVVIAHGTEREIIWDFARRPLIGCAPPEAAA"
FT   CDS_pept        complement(86999..87538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0070"
FT                   /product="putative histone acetyltransferase"
FT                   /note="HPA2 and related acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86068"
FT                   /db_xref="GOA:A8IGC2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024035"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGC2"
FT                   /protein_id="BAF86068.1"
FT                   /translation="MFDPFKPFTASEFQVKFATEHWERDGAANLRRRVFCAEQGLFAGD
FT                   DRDGIDTHAIPIVALSLWGVAADAVVGTVRIHEAEPGTWWGSRLAVAEEYRHVGTLGSS
FT                   LIRLAVSSAHARGCRRFLAHVQSQNALLFRRLRWRTLEEIELVGRPHHLMEADLAYYPP
FT                   FAAAETGFLAFPRRAA"
FT   CDS_pept        complement(87538..88518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0071"
FT                   /product="biotin synthase-related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86069"
FT                   /db_xref="GOA:A8IGC5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016779"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGC5"
FT                   /protein_id="BAF86069.1"
FT                   /translation="MTLDGMTIMVPVHTAPAAQSPYEIARGSNGATRILRDGLPLAEVS
FT                   FPLRPRFYDRVTADGVPYWKIATLHGRDVLATTVLQECVRYQSRAKTCQFCAIGQSLEA
FT                   GRTIARKTPEQLAEVAKAAVELDAVTHMVMTTGTPPGKDRGCSVLMESTAAVKAAVDLA
FT                   IQVQCEPPDDDIWFKRMHEAGADSLGMHLEAVTPEVRARIMPGKAQVPIARYLSAFEAA
FT                   VPVFGKGQVSTYILAGLGDTREAILAMCEELLKRGVYPFVVPFVPISGTPLEGHPGPQP
FT                   AFMKSVLQPLAAMVRAAGLRATDIKAGCGKCGACSALSTYERGIA"
FT   CDS_pept        complement(88580..89662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0072"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86070"
FT                   /db_xref="GOA:A8IGC7"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR023919"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGC7"
FT                   /protein_id="BAF86070.1"
FT                   /translation="MEKSMSTPEKRIVRAAAVQIAPDLDDGKGTLERVLNAIAEAAGKG
FT                   ADFIVFPETFLPWYPYFSFIAPPVLTGGEHMRLYEHAVSVPGPVTDAISAAARRHAMVI
FT                   VLGINERDHGSLYNAQLIFDADGTLKLKRRKITPTFHERMIWGQGDGAGLQVVETKVGR
FT                   VGALACWEHYNPLARYALMAQHEEIHAAQFPGSMVGPIFADQMEVTIRHHALESGCFVV
FT                   NATGWLTEDQIARISPDEKLRRALTGGCMTAIVNPEGSHLVPPLTSGEGMLVADLDMSL
FT                   ITKRKRMMDSVGHYARPELLSLHIDNRPAVPMQSVAAVSAPPAFGSPRDEADASDRRAH
FT                   HPAADSGADDRVAVLRGPAR"
FT   CDS_pept        complement(89840..90322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86071"
FT                   /db_xref="InterPro:IPR023847"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGD0"
FT                   /protein_id="BAF86071.1"
FT                   /translation="MPAVTAPAHQKGDFFVDYEDKKFEDVKALPGEKALVTFHTVAFEG
FT                   SIGFVNLLQATRLKRKGFETSILLYGPGVTLGVQRGFPKLGDEAFPGHMNFNNQLTKFM
FT                   EEGGKVYACRFALQALYGHGEPSLIPGITPISPLDVLDLVLLHRRDNAFILDTWTL"
FT   CDS_pept        90637..92052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="AZC_0074"
FT                   /product="putative transcriptional regulator"
FT                   /note="GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86072"
FT                   /db_xref="GOA:A8IGD2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGD2"
FT                   /protein_id="BAF86072.1"
FT                   /translation="MLRTRFGPFVIMLDWTPDLARSDKPRYLAIADLIAEDIRAGRLSV
FT                   GDRLPPQRKLAHRLEIDFTTVARGYVEAQKRGLVESRVGQGTFVRGLPRAEPRPRTARP
FT                   DLVDLTMNLPPEPDDPELVARMQDGLAEVSRDLVALLRYQSFGGAPADKDAASAWLGRR
FT                   ALVPAQERVFVTPGAHAALVGIFSLLAKPGDVILCEALTYPGARSIAAQLGLTLVGLPM
FT                   DADGIDPDALADAVKRHKPKALYLNPTLQNPTTLTIPEARRAAIVAVARRMGLRIVEDD
FT                   AYGFIPAHGLPPLAAMAPDLTWHVAGLAKCIGAGLRAAYVIAPEAKAGWPFAAALRAAN
FT                   VMASPLTVALATRWIEDGTADTILRFIRAETAARQALAADILPKGTFRADPLSFNLWVE
FT                   LPEPWTRSAFVGHMQATGIGIVASDAFCTDGNPPEAARVCLGGPVGRDKVRHALEYMAH
FT                   ALAHSPAAASTVL"
FT   CDS_pept        complement(92086..92694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86073"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGD5"
FT                   /protein_id="BAF86073.1"
FT                   /translation="MSDRLSRRTALLLGAGALASVAAPATAQVIAPTANTVFVLPGVGQ
FT                   VTTLTYRAKVVSANPATRRVVLETPNGKRWAVKAPLIVGDLSLLRNGETIIVRLVPGLV
FT                   TALGKARQGVPGEVINDVGLNDGLPGWPEGFGVRRVTITTILVNIDKVGGTISFEGPDG
FT                   YVRTIKAADQKVLADLAQVNIGDLCQITYVEAMAFNALP"
FT   CDS_pept        93103..94164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0076"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86074"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGD8"
FT                   /protein_id="BAF86074.1"
FT                   /translation="MKRDIPDEAPFSLPALLGKSMGVAKEGFAKLPFARDLPFARDAVS
FT                   DARPIFMPGTLPAASQKLVTDFRAISGIRHREAVPFGEPIVLGRLGALEVRLARTAADV
FT                   RRAQRLRYKVFYEEMSAVPDTPSRLARRDFDAFDAVCEHILVLDHDAGKMVLGRKKPKV
FT                   VGTYRLLRQEVANRHGGFYSQGEFDVGRIVSAHPTLKFLELGRSCVLKPYRNKRTVELL
FT                   WHGIWTYVLRNKIDAMLGCASLEGTDPDKLALPLSFLHHNALAPEEWRASALPSRYVEM
FT                   NRMAKADINPKAALLSLPPLVKGYLRLGGFIGEGAVVDHQFGTTDVLVVLPVSVISPRY
FT                   VEHFGPSANRHAI"
FT   CDS_pept        complement(94306..95091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86075"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGE0"
FT                   /protein_id="BAF86075.1"
FT                   /translation="MTPEERALIDGLFDRMRAVEGQPRDAEAEALIARRSSEAPHATYT
FT                   LAQTVLVQEHALQQAAARIQELEAQAQKAQQAPAQPTSFLGGLLGSRGTSVPTAGARSD
FT                   GPMGLPQGYNAQQAQPPGYAPQPAPQGYGQASGPWGQQPQRPGLFGGGGGGGGFLQGAL
FT                   ATAAGVAGGALLFQGIQGLMSHGTGPIANQAASLLEQPAAAAGDLASQAQEALGGAPDT
FT                   NVADSGSPDPWNTASADPGYTDAGYDDGGDFGGDDSNWA"
FT   CDS_pept        complement(95251..96849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0078"
FT                   /product="malate synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86076"
FT                   /db_xref="GOA:A8IGE3"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGE3"
FT                   /protein_id="BAF86076.1"
FT                   /translation="MSTPALPSGVAITGAMAPRFEEILTSEALAFVAELHRTFNATRLA
FT                   LLAKRAERQARFDAGELPDFLPETKSVRDAEWTIAPLPQDLLDRRVEITGPVDRKMIVN
FT                   ALNSGAKVFMADFEDASGPQWTNMIEGQINLKDRWAGRIDFHDPSNGKDYKLGATPAVL
FT                   IIRPRGWHLPEAHVTVDGEEVSGALFDLGLYAFHNAKAALAQGSGPYFYLPKTESHLEA
FT                   RLWNDVFTLAETRLGLPANCIKGTVLIETLPAVFEMDEILYELRNHVAGLNIGRWDYIF
FT                   SFIKRLGKNARFLTPDRARMVMSEAFLKAYGALLVKTCHRRKAFAMGGMAAQIPVKNNP
FT                   EANEAAFAKVRADKEREAGDGCDGTWVAHPDLVPVAMEVFNRLMPNPNQLDKLRSDVSV
FT                   SRDDLLVVHQGPRTEGGLRENIRVGVQYIEAWLRGRGAVPLYNLMEDAATAEISRAQIW
FT                   QWIHLSAKLEDGRTVTGELFTSLLNDEMAKLRETLTPAVYDKGRFPEAIKLFSDMTLAD
FT                   TFEEFLTLPAYRLVA"
FT   CDS_pept        complement(96908..97624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0079"
FT                   /product="thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86077"
FT                   /db_xref="GOA:A8IGE6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IGE6"
FT                   /protein_id="BAF86077.1"
FT                   /translation="MARHRVSWRTAKVYLAFHFASGRGRVMPHPFDLSLYLVTDRRLTA
FT                   ERGLLETVEEAVAGGVTLVQLRDPEAKGRALAEEARALIGLLRPKGIPLIINDRVDVAA
FT                   AVGAEGVHLGQDDLDPAAARAILGPDAIIGLSVGSLEELSASNLGPVDYVGCGPINATG
FT                   TKGDAGGAIGIEGFAFLRSHIALPMVGIGGLKAEDAEAVMQAGANGIAVVSALCAAPDV
FT                   TEAARTLKTIIETSRR"
FT   CDS_pept        complement(97665..98990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0080"
FT                   /product="glycolate oxidase"
FT                   /note="iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86078"
FT                   /db_xref="GOA:A8IGE9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGE9"
FT                   /protein_id="BAF86078.1"
FT                   /translation="MKTEFSLAQLADPHTSEAEKILRTCVHCGFCTATCPTYVLLGDEL
FT                   DSPRGRIYLIKDMLENGRPATEEEVKHVDRCLSCLSCMTTCPSGVHYMHLVDHARAHIE
FT                   HTYKRPFFDRLNRALLAAVMPYRGRFRLALAGAALAKPFAPLFDAVKPLKPLAAMLRLA
FT                   PGFPRGRSPSEDPGVHPAKGPRRARVALLGGCAQPVLRPETDEAAIRLLNRLGVEVVRV
FT                   EKEGCCGSLVHHMGKEEQGLALARANVDAWCAEMDKSGLDAILVTVSGCGTTIKDYGHM
FT                   LRLDPAYAEKARRVSAIARDISEYLGTLGLPKAEKPMGRKIAYHAACSLQHGQKVKGTP
FT                   VQLLRTVGFEVAEPFESHICCGSAGTYNMLQSEIAVQLRDRKVANLGKLAPDIIAAGNI
FT                   GCMTQIGSGTDTPVVHTVELLDWATGGPVPAAVAAAGLSAAA"
FT   CDS_pept        complement(98987..99862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0081"
FT                   /product="uncharacterized protein"
FT                   /note="conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86079"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGF2"
FT                   /protein_id="BAF86079.1"
FT                   /translation="MMDAARDMAGARTAIGRLRPAVLPPSLPSPARGEGSVAHAKPSCF
FT                   EPPRSSPRNAPPPPLRGRAGEGGNAAPTGSTLSATAPEPPMPNEERPTAHRPISPRLKG
FT                   NAKALRREMTDAELTLWQHLRAHRLEGAPFRRQAPMGRYVADFVCHPARLIVELDGGQH
FT                   GGPEDQARDNWFAAQGYAVVRYWNNDVLGNLGGVLEDLSARVIERVKVESVLPPSPTLP
FT                   RKGGGGDDLPLPTPKRLRAPLPPAHREPSPLEGEGREGGKTAGPENARSETSPTPIRTR
FT                   TPASTGGHAR"
FT   CDS_pept        complement(99859..101070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE"
FT                   /locus_tag="AZC_0082"
FT                   /product="glycolate oxidase subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86080"
FT                   /db_xref="GOA:A8IGF5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGF5"
FT                   /protein_id="BAF86080.1"
FT                   /translation="MTDILTVADEAGLVEAVRSALEARKTLEVAGRGSKRGLGRPTQTD
FT                   ATLDLSRMSGVTLYEPEELILSARGGTPIAEIEALIAARGQMLAFEPMDYGPLLGTAPG
FT                   HGSLGGVFACNLAGPRRISHGAARDHALGARAVSGRAEAFKSGGRVVKNVTGYDLPRLL
FT                   TGSFGTLAVLSELTLKVLPRPPLAETVILPGVPPEAAARAMSAAMGSSCEVSGAAYLPV
FT                   PVSGRIPELGTDGPAVALRLEGFEPSVKARRAMLIAVLQPFGGVEVAEGDASARLWAAV
FT                   RDALPFAGTGERAVWRLSTAPASGPLLAAELAGDLGADTFCDWAGGLVWLLLPGEASHA
FT                   DEVRTALARHGGHATLVRGTAAERASVPVFQPLEAAHDALTRRVKASFDPVGLLNPGRM
FT                   HAGM"
FT   CDS_pept        complement(101086..102645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="AZC_0083"
FT                   /product="glycolate oxidase subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86081"
FT                   /db_xref="GOA:A8IGF7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGF7"
FT                   /protein_id="BAF86081.1"
FT                   /translation="MPDFRIETIIVAATRTILGTTAMTGLRLPEADASVLARRDEIITA
FT                   LRAIVPGEGVIDREREMRPYESDALTAYRQLPLVVVLPSNTQQVSQVLRYCHENNIRVV
FT                   PRGAGTSLSGGALPLQDAVLLGMGKFNRVLDIDFPNRCAVVQPGVTNLGITKAVEHEGF
FT                   YYAPDPSSQIACTIGGNVGENSGGVHCLKYGLTTNNVLGVELALITGEIVRLGGKHLDA
FT                   GGLDLLSVVIGSEGLLGVVTEVTVRLLKKPDTARAVLVGFPTSEDAGECVARTIAAGII
FT                   PAGIEMMDKDAIAAAEAFVKVGYPLDVEALLIIELDGPEAECAHLLEEVAAIARGCNAS
FT                   TLRVSQTEEERMGFWAGRKAAFPAVGRISPDYLCMDGTIPRKALPLVLSRMRELSEKHG
FT                   LKCANVFHAGDGNLHPLILYDANKGEMDAAEAFGADILRLCVEVGGVLTGEHGVGIEKR
FT                   DLMPEMFDEVDLAHQQRLKCAFDPESLLNPGKVFPTLHRCAELGRMHVAGGALPFPDLP
FT                   RF"
FT   CDS_pept        102741..103676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0084"
FT                   /product="transcriptional regulator"
FT                   /note="LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86082"
FT                   /db_xref="GOA:A8IGG0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGG0"
FT                   /protein_id="BAF86082.1"
FT                   /translation="MIGNLGDLEIFARIVTAGGLSAAGRELGLSPPVVSKRVQRLEERL
FT                   GTRLFQRTTRKVTLTEAGQGFYDRVVAILASVEEAESQLARRSSEARGLLRVSAPTSFG
FT                   RLHIAPHLGPLLDANPELTVDLELSDAFVDIVGDGFDIAIRIADLTDSSLVARRLAPVH
FT                   RVLCATPAYLARAGMPKTFADLADHVLLATHGQDPWRLQGPDGPVTQRVHSPLRTNSNE
FT                   VVREAVLAGVGIALRSTWDVGPELNSGALQVVLPAYRASHRVGVYAVYPSRRFLPQKVR
FT                   VFIDHLAQLYGSVPPWDAGLEHLFEPQTGA"
FT   CDS_pept        103742..104458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azlC"
FT                   /locus_tag="AZC_0085"
FT                   /product="putative branched-chain amino acid transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86083"
FT                   /db_xref="GOA:A8IGG3"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGG3"
FT                   /protein_id="BAF86083.1"
FT                   /translation="MPHSPKDHVSVTAHGMMEGARVMIPLMPGLVLFGMAFGAAAAQKG
FT                   FSLLEASLSSGLVFAGLAQMVALEGWTKTWTPGGLLALAFLTMAVNMRHFLMSASMRPW
FT                   LGQLPGWKAYPSLLLMADNNWAAAMRYRANGGSDAGFFIGSGIITWFVWVASTAAGQVI
FT                   GGGLPDPKKFAIDVVVPAFFVAMLVPNWKGRREAVTWGVAAAVSVGASFLLPGWWFIVI
FT                   GAVAGAVAGGFADDKR"
FT   CDS_pept        104487..104753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86084"
FT                   /db_xref="GOA:A8IGG6"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGG6"
FT                   /protein_id="BAF86084.1"
FT                   /translation="MALATAFNRASGFFLMRLIPLTPRVRKIIDCLPGAVLVALIAPTV
FT                   AHGDLAMAAGLAAAYVVTKITRSDFIAVLAAMAVGVGIRAWMG"
FT   CDS_pept        complement(104768..105631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="Lipase including active site"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86085"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGG9"
FT                   /protein_id="BAF86085.1"
FT                   /translation="MMQRRHAELEKLPDGLRSLDRRPSFGVAPGNKSRQKRRRHDGEPM
FT                   TFRFGFASLRVFACALAALVLSMAMAGSASAQTGPRVYLMRGLANVFSTGLDDLASKMQ
FT                   AKGIWAQVYEYGQWQQLADDAVSWSRAHNKAPVVIIGHSLGADSAIEMAERMTAMGIPP
FT                   RLVVTFDPVGVTQIGRSGGRFVNYYQSHNGFGKMLTTGPGFSGTLSNRSQDAAAAQGID
FT                   HFNIEKADYLHQQVITMVRALGSRPKPRPAPAPAMATPAVPAPSATPASAPASVPAAST
FT                   ASATAH"
FT   CDS_pept        complement(105649..106398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86086"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGH2"
FT                   /protein_id="BAF86086.1"
FT                   /translation="MPAARHRDEPAHGADRDRRPSRTVPLPLPPLPPDTPMSTAVGPLR
FT                   NRVDPFGDIAAHPARGLLMGNRGGRIHDPGTRTLTGRAWVSRQWICCALTFRDRRRAVM
FT                   GEGYTELFFLDEVVAFAAGHRPCFQCRRVAADAFSAAWAKGEGRLPPGAGEMDRRLHAE
FT                   RLDGTRRRKHPRRLGDLPDGAVFAGEDGPVAVKDGRLLRFSFAGWAPLHGGPGLDATVP
FT                   TLTPPSVLTALAAGYQPLWHPTAQHRP"
FT   CDS_pept        complement(106632..107171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86087"
FT                   /db_xref="GOA:A8IGH5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGH5"
FT                   /protein_id="BAF86087.1"
FT                   /translation="MTRQLPVGIATITVRRRPGCRHQGVLTVAGRAIPVALGRSGIGCD
FT                   KREGDGRTPAGVWHPVRVLYRADRVTRPATSLPVAAIRPDDGWCDAPEDRRYNRPVELP
FT                   FPASHERLWRDDRLYDLLLVIDHNTRPRVKGRGSAVFIHLARPGYRPTEGCVALKPADL
FT                   SRLLTRLDARTRIIIS"
FT   CDS_pept        107300..107986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0090"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86088"
FT                   /db_xref="GOA:A8IGH8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGH8"
FT                   /protein_id="BAF86088.1"
FT                   /translation="MANAWKILVVEDDPELREALIEQLALQEEFETVSAGTAQDALEAA
FT                   KNGAIDLVLMDVGLPDMDGRDAVRQMRKNGFKAPVIMLTGHDTDSDTILGLDAGANDYV
FT                   TKPFRFAVLLARLRAQMRSHEASEDAVFAIGPYSFRPGAKMLLTDRGSKIRLTEKETAI
FT                   LRYLYRAGKTPVARETLLQEVWGYNSGVTTHTLETHIYRLRQKIEPDPSNPTLLATQAG
FT                   GYKLVP"
FT   CDS_pept        108065..108547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0091"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86089"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGI1"
FT                   /protein_id="BAF86089.1"
FT                   /translation="MSLDQDVVLLQSVPTFRALSAEALRALAISVEERRLSPGEVLFRA
FT                   GEPADCGYVVRTGRIEVFTAKGDRRAQRLEVTPGGLVGEMALILERPRPADAVAIDAAT
FT                   VLRIPRTTFLRVLESFPEAAVELRKLIAQRVETVLRSLDGLRDKLETPVRPPARKG"
FT   CDS_pept        108562..108999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86090"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGI4"
FT                   /protein_id="BAF86090.1"
FT                   /translation="MPMPMEYQHASEEFERFLADARDTAGLGTRNQTYTVVQSVLLTFR
FT                   RRLDVHQAIRFAQVLPPVLRAIFIADWDTTVPPVPFTDRETLAREVQALRPHHNFATAA
FT                   SITDVATALRRHVDMAKFKAVLARLPEGAAAFWHVADPERT"
FT   CDS_pept        complement(109021..109893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0093"
FT                   /product="exodeoxyribonuclease III protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86091"
FT                   /db_xref="GOA:A8IGI6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGI6"
FT                   /protein_id="BAF86091.1"
FT                   /translation="MAGILTCLLLPPAVAALSLTVCTWNINSVRIRLDIVKETVERLKP
FT                   DVLCLQETKCQDDKFPLAAIRELGFPHIALNGQKGWHGVATFSKRPFDAIEKQEFCGKG
FT                   DARHIAVTLGGAGGLSAPVTIHNFYIPAGGDEPNPEVNPKFAHKLAFLDEAIAWEKLTE
FT                   AGRPAGAHAILVGDLNIAPLETDVWNHKQLLSVVSHTPVEVDLLTRFQAAGPWIDVMRE
FT                   FVPPTEKLFTWWSYRSPDHTVNDRGRRLDHVWTSRSLAGKAKAMTVLKEARSWEKPSDH
FT                   VPVAVTFEV"
FT   CDS_pept        complement(109936..110331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="glutathione-dependent formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86092"
FT                   /db_xref="GOA:A8IGI8"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGI8"
FT                   /protein_id="BAF86092.1"
FT                   /translation="MAFRGSCQCGTVRYEVARLHSDIVHCHCQTCRKTHAADHISTARV
FT                   LREDFRWLDGQDRLTAFESSPGKLRLFCSLCGSHLVADRAEQPFVIVRVGTLDDDPGTR
FT                   PVLHIWASHRVPWLADGDDAPYYDEVP"
FT   CDS_pept        complement(110372..111445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0095"
FT                   /product="putative outer membrane lipoprotein-sorting
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86093"
FT                   /db_xref="GOA:A8IGJ0"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGJ0"
FT                   /protein_id="BAF86093.1"
FT                   /translation="MTAAGVPEKETYKRGYARERDSRCCRKWMMPRLFPLLAFLTVTAA
FT                   APAALAQGVLLPPGEVPNASGGVSGADLFSPQPIAPQMTPRQLTPPQPTAPQQIPPSAA
FT                   PRPATAQPAPSAAPPAPAAQAAPATPPASAPLPQQRPASANQPRPPAAAQAPAAAPTSP
FT                   RVAPPAQAQQALPQAGQQGQIERASPATIEKLTTYWNSVQTLVGTFVQVDADGTRKTGD
FT                   FYMQKPGRVRFEYNPPTQIQLISNGQNVAVRDRRLNTQDLTPLNQTPLRFILAERIDLT
FT                   RNSNVLGVYQDNLYIQVIMQESVPMMGTYRLQILFDAKDFQLRQWTVTDPQGYDTSVAI
FT                   YDLNYTQRPDPSLFVIN"
FT   CDS_pept        complement(111605..114049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="AZC_0096"
FT                   /product="FtsK protein"
FT                   /note="possible FtsK/SpoIIIE family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86094"
FT                   /db_xref="GOA:A8IGJ3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGJ3"
FT                   /protein_id="BAF86094.1"
FT                   /translation="MPVRRRSASALTMRAHGGGMDFIPESVRLAIRRRSSEICGVVVLG
FT                   AAAFALLSLMTWSASDPSLSNATNAKVSNLLGRPGAVLADLLMQLFGLASLAIILPLAI
FT                   WGWRLLTFRPLKGEKLRIVALTFGALGTSAFLGALPAFGAWPMPTGLGGVMGDLIPRLF
FT                   LLLTGSFGSFLESAVTGLLGGTLALAGLYVACRPNPPEDEAEEVDEPYDAEEVERGAMI
FT                   SLGALTHTFLSLKARLSGRRRSRTYVPSTPAARGPVVAGGRMEPRFAASAPAPVVPEAP
FT                   VPDEETYVAPPPRSRSHGKRVPVAMPGRRGFYELPDLGLLAAPPPSKGPTMSAEALQDT
FT                   AKLLESTLEDFGVRGEIVQVRPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSAISAR
FT                   VAVVPGRNAIGIELPNQRRDKVLLRELLSTKDFSENGQKLAIALGKTIGGEPVIVDLAR
FT                   MPHLLVAGTTGSGKSVAINTMILSLLYRLPPDQCRLIMVDPKMLELSVYDGIPHLLAPV
FT                   VTDPKKAVVALKWAVREMEDRYKKMSKLGVRNIDGFNARVADAQKRGESLARTVQTGFD
FT                   HETGEAIYEREEMELGPLPYIVIIVDEMADLMLTAGKDIEGAIQRLAQMARAAGIHLVM
FT                   ATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDMLYMAGGGRI
FT                   SRVHGPFVSDEEVEHVVRHLKAQGAPDYVDAVTADFDEDGDEDGAVFDKSGMGEGGDIY
FT                   SQAVAVVLRDKKCSTSYIQRRLQIGYNRAASLVERMEKEGLVGPANHAGKREILVTDEA
FT                   AE"
FT   CDS_pept        complement(114063..115271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0097"
FT                   /product="putative aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86095"
FT                   /db_xref="GOA:A8IGJ5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGJ5"
FT                   /protein_id="BAF86095.1"
FT                   /translation="MPDTMPTSATTPSDDRRSPFVRLADLLAGIEPGRPPLIAAVGEPQ
FT                   HAFADFVASALHDTLEGFGRYPRQEGTPEFRAAVAEWLGKRYTLARPVDPDREVLALNG
FT                   SREGLVSATFIARRRGPERKGAPIVLVPNPLYAAYRAGAELAGCEVVPMPTTRESGWLP
FT                   DLDALDPALLDRAVVLFLASPANPQGAVASREYLTRLMEMTRRHGVYLFADECYSEIYL
FT                   EEEKPTGVLEVAEGNFSGILSFNSLSKRSSLPGLRVGFVAGDPVFLRDFLAFRGIACPQ
FT                   VPEPLQAVAVAALQDEAHVIASRMLYKSKFDIADRLLHKRFGYKRPDGGFFLWLDVSDA
FT                   GGGEAAALRLWKEQGLRTVPGGYLASRDLTGHNPGEPYLRVAMVHDLTTSEEVLNRLIA
FT                   GLS"
FT   CDS_pept        complement(115469..116455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0098"
FT                   /product="riboflavin kinase"
FT                   /note="FAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86096"
FT                   /db_xref="GOA:A8IGJ7"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGJ7"
FT                   /protein_id="BAF86096.1"
FT                   /translation="MTSLPRAGRLPMPASQLSFQVVQGIRPLPEPLARPVLAIGNFDGV
FT                   HRGHQAVIATARAMGARLGRPTLALTFEPHPRSFFQPSVPLFRLTPAREKLDALEATGL
FT                   AGAIVLPFDGTLAALSAEAFVAEVLVGTFGIAGAAVGFDFHFGKARSGSPAFLKEQGAQ
FT                   HGFPVEVVEALLEADDTISSTAIRRALESGQVGHAAHMLGRHWSLRSVVIHGDKRGRDL
FT                   GYPTANLALPEEIQLAFGIYAVKLTVDGIPHDAVASYGRRPTFDNGRALLEVHIFDFSG
FT                   DLYGREVEVAFHGYLRPELKFSSVDELVRQMDADSRAARAILAASGS"
FT   CDS_pept        complement(116518..117564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0099"
FT                   /product="putative HAD-superfamily hydrolase"
FT                   /note="subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86097"
FT                   /db_xref="GOA:A8IGK1"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGK1"
FT                   /protein_id="BAF86097.1"
FT                   /translation="MHPPRLTCLPAQGGCARLGLVKPGAAWHLTGAPGRSLRRGTGSPL
FT                   PPRRGDGFMNDVAPPRSALPLLSGFSEIAGNYDLILCDVWGVIHNGVSAFPAACHALEQ
FT                   VRATGASVFLVSNAPRPNAFVMAMLDGMGVPRTSYDGIVTSGDVTRSVLADRPGARMFH
FT                   LGPARDLGTYEGLDLVHTPLGEAELVVCTGLLNDDVETPDDYRPMLEQMRARDLAFVCA
FT                   NPDIVVERGDRLIYCAGAIAQLYDELGGSSLYCGKPHPPIYAEALKRTLTVRDSVPVPS
FT                   RILAIGDALRTDVTGAAGAGFDSLFISSGIHAIELRSEHGAPPDMELVEQLFAAGPRPN
FT                   AVMPRLSW"
FT   CDS_pept        117655..118461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86098"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGK3"
FT                   /protein_id="BAF86098.1"
FT                   /translation="MMGLRISAPAWTDRRGPERRRAVALRTGACVLAGLAAVLIAAPPV
FT                   HAQPAPAAPAPAAARQGSGSGPLRDVRYCELLPMSIGLNGVSAQVFNTLGHSDCPQANW
FT                   DGLTDGELRKAFDALYTARNGPRFFLMDQIIASGATAKGEVVTVNGITLEKRAEVQLTL
FT                   AELHDKPYQERAIDRSTVYRFDAGKPVFELTSPDGSVYVMQSYAQIVDPKLTYADLPGL
FT                   GAKLKLPAGWTYAMKTPAQDLILSANGKATVLQDDLKNTYQKITPR"
FT   CDS_pept        complement(118506..120116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0101"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86099"
FT                   /db_xref="GOA:A8IGK6"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGK6"
FT                   /protein_id="BAF86099.1"
FT                   /translation="MSRQREMPRFCCACQMRRRSGRRLRHPANSTAARKTVFSRPLRTV
FT                   ARAPLHHDTHRRRIPRGAVSFRMFGVMIPVSTFKDRRVAVFGLGGSGLATAQALLAGGA
FT                   EVIGWDDGEAGRKKAEAAGITVSDLHEADWSGFAALVLAPGVPLTHPTPHWTVGLAQAA
FT                   GVEIIGDIELFCRERRALKPTAPFAAITGTNGKSTTTALLSHLMKVGGRDVQMGGNIGT
FT                   AILSLEPFKAGRVHVVECSSYQIDLAPGLDPSVGIHLNLTPDHIDRHGTFEHYGAVKER
FT                   LIAGVQPGGTAVVGVDDAPSAAIADRAEAAGIHVVRISVKQPLADGIWLDGETLVVSEK
FT                   GAEVFRLPLTGIGSLRGAHNAQNAAAAMAAARGLGLAYEVIAVGMQRFPGLAHRMEQVG
FT                   TRGKVLFVNDSKATNADAAERALASFSDVFWIAGGKPKAGGITPLKPFFPRVRKAYLIG
FT                   EAAADFAATLGDVPHEVVGTLDRAVAAAARDAAASSLDHPVVLLSPACASFDQYPNFEV
FT                   RGDAFRHLVEELPQETAPA"
FT   CDS_pept        120137..122482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0102"
FT                   /product="RNA binding S1 protein"
FT                   /note="resolvase, RNase H-like fold"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86100"
FT                   /db_xref="GOA:A8IGK8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGK8"
FT                   /protein_id="BAF86100.1"
FT                   /translation="MAAPSADIARIIAGEIAAKPAQVVAAVGLLDEGATVPFIARYRKE
FT                   VTGGLDDTQLRTLEERLSYLRELEARRASVLQSIETQGKLTDELAAKIRAAGTKAELED
FT                   LYLPYKPKRRTKAEIARERGLGALAEAILADRTKEPSVLAQGFLKEEVPDVKTALDGAR
FT                   DILVEMFAENADLVGRLRGHLQANARIVSKVVAGKEEAGAKFRDYFDHWEKWATVPSHR
FT                   ALAMLRGRNEEFLTLDIEVDWDDASPVKPVERMIAASVNVGPVGGGPGDAFLRDVARWA
FT                   WRVKLSLHLSIDLMTAMTEKAEEEAIRVFARNLKDLLLAAPAGSRTTIGLDPGIRTGVK
FT                   VAVVDGTGKLLGTSTLYPFQPRNDIAGASAELARLIVKHQVELIAIGNGTASRETEKFA
FT                   ADVIAKLPGTKPRTVVVSEAGASVYSASALAAAEMPDLDVSLRGAVSIARRLQDPLAEL
FT                   VKIEPKSIGVGQYQHDVDQNRLAKSLDAVVEDAVNAVGVDLNTASAPLLSRISGLGASL
FT                   AEAIVAHRNQVGAFANRKELLKVARLGPRTFELCAGFLRITGGTEPLDASSVHPEAYGL
FT                   AKKIISACGRDIRSLMGDSATLKRLDPAVFVDERFGLPTVRDILSELEKPARDPRPEFR
FT                   TATFMEGVNTMSDLKPGMLLEGTVTNVAAFGAFVDIGVHQDGLVHVSALADRFVKDPHE
FT                   VVKAGDIVKVRVVEVDVARKRIALSMRKDGGEVRAARPQGGPPQGRPLPGGKFTAGPKP
FT                   GNDGRRNAPPADGALAAALAEAMKRKGN"
FT   CDS_pept        122532..123230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0103"
FT                   /product="aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86101"
FT                   /db_xref="GOA:A8IGL1"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGL1"
FT                   /protein_id="BAF86101.1"
FT                   /translation="MAQKVIGLIGGLSWESSAEYYRLINEAVRARLGGVASARCLMWSF
FT                   DFAEVEALQAAGDWDAATALMVDAARRLERGGADVLLICSNTMHRMAGEVAGAVGVPLL
FT                   HIADPTAARVKAAGLTRVGLLGTAFTMEQDFYKGRLAARHGLDVLVPEAEDRAVVHRII
FT                   YEELVQGRIEAASREAYRAVIARLVARGAEAVILGCTEIMLLVKPEDSTVPLFDTTALH
FT                   AEAAVAFALG"
FT   CDS_pept        complement(123394..124230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0104"
FT                   /product="esterase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86102"
FT                   /db_xref="GOA:A8IGL3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGL3"
FT                   /protein_id="BAF86102.1"
FT                   /translation="METLSTAKSHGGVQGVYRHVSEATGTEMTFAVFVPPQAARGPVPV
FT                   LWYLSGLTCTHANVMEKGEYRAAAAAHGLMIVCPDTSPRGPGVPDEPDNWQFGCGAGFY
FT                   VDATQAPYAANYRMASYVRDELPALVARHFPADMARQGIFGHSMGGHGALTLALKNPDR
FT                   YRSCSAFAPIVQPATAGWSQPAFEKYLGADPAAWRAYDATALIADGARFPGFLVDQGSA
FT                   DPFLTTGLRPGLLEVACQEAGIPLTLHMREGYDHSYYFISTFMPDHIAWHAERLKG"
FT   CDS_pept        complement(124230..125357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0105"
FT                   /product="glutathione-dependent formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86103"
FT                   /db_xref="GOA:A8IGL5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGL5"
FT                   /protein_id="BAF86103.1"
FT                   /translation="MKSRAAVAWEAKKPLTIETIEIGGPKAGEVLVEIMATGVCHTDAY
FT                   TLDGLDSEGKFPAILGHEGAGIVREVGAGVTTLKVGDHVIPLYTPECRQCKTCLSQRSN
FT                   LCTSIRATQGQGLMPDRTSRFSCEPVNGRGGEIFHYMGCSTFSNFTVLPEIALAKVRED
FT                   APFDKICYIGCGVTTGIGAVVYTGKVWPGANVAVFGLGGIGLNVIQGARMVGADKIIGI
FT                   DINPAKVEMAKKFGMTDFINPLEVGSDKVVSAIQDLTDGGADFTFDCTGNVTVMRQALE
FT                   ACHRGWGTSIVIGVAPAGAEISTRPFQLVTGRNWRGSAFGGARGRTDVPKIVDWYMEGK
FT                   INIDDLITHTMPLDEINTAFDLMHEGKSIRSVVIY"
FT   CDS_pept        complement(125429..126955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0106"
FT                   /product="hypothetical ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86104"
FT                   /db_xref="GOA:A8IGL9"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR014588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGL9"
FT                   /protein_id="BAF86104.1"
FT                   /translation="MKVSIELGLSSQGAPAPVPMDLEELLATRLLVQGNSGSGKSHLLR
FT                   RLLEQSAPWVQQAVIDPEGDFVSLAEKYGHVVVDASRNESDLHRIASRVRQHRVSVVLD
FT                   MEGLDSEQQMRAAAAFLGGLFDAERDHWYPMLVVVDEAQLFAPAAGGEVSDETRKASLG
FT                   AMTNLMCRGRKRGLAGVIATQRLAKLAKNVAAEASNFLMGRTFLDIDMARAADLLGMER
FT                   RQAEMFRDLMAGHFVALGPALSRRPLPVKIGSVETGARSVTPKLLPLPDAPAENMQELI
FT                   FTAAPDEDERLPPPPRRAPAPVPTENILSQLARATREAPVQAGPAAPTMSPEERQAAID
FT                   QALKEILSDPEAGFRTAAVLYQDFLVRCRIRKVAGEALSLRAFRRRLAIAHAGIDSGEL
FT                   EKEDSPWGEVISMAGQLPEDMQSVFLVLARAAHDGKPCPSDAGVAHAYGTRSLGRARRL
FT                   LAYMEEQGAIVCRTDGRGQRIIAIPGLAWETAPGDPNAPHETVSRSEAAE"
FT   CDS_pept        complement(127075..128340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0107"
FT                   /product="putative permease"
FT                   /note="the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86105"
FT                   /db_xref="GOA:A8IGM1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGM1"
FT                   /protein_id="BAF86105.1"
FT                   /translation="MAPTRYRWFVIFLLFAITVVNYIDRAAIAYAITAMERDLGLSPAA
FT                   AGSILGAFGVGYAITTLLGGFAVDRYGARLVLTISAVLWSLSIGGTAMATGFASLYAAR
FT                   VLLGVSEGPNFPALTGAVSRWLAPNERATALGNALVAVPVALAIGGPIVTQLLAHLDWR
FT                   TAFGVLFALSIMWVPLWLVFFRNRPEDSRFVNAAELAHIRTPDATGPAKPAAGHGPGLA
FT                   RLLLTNPTLVSNYWAFFVFGYFLFFFMTWLPSYLEQAYHLNLKQVGLFTVLPWLAAAVA
FT                   LWSMGRWSDHLLRTTGRLRVARSYLIAGSQLVAALAIVPVALTDNLAVAITGITVAVAA
FT                   SMGSNAAYYAVNVDVVPERAASALGIMDFAFALAGFLAPAITGWVLALRGSFTDGFALM
FT                   AALALSSVVVVLLFHHPDRHRA"
FT   CDS_pept        128479..128976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fef-1"
FT                   /locus_tag="AZC_0108"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86106"
FT                   /db_xref="GOA:A8IGM4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGM4"
FT                   /protein_id="BAF86106.1"
FT                   /translation="MAVLDLVRFPDPRLRQPAEPVTVFDGALADRAQDLLDTMRAAPGI
FT                   GITGPHAGLMIRLVALELPETAPAFYVNPRVLRASPEMGRHPEGSVSMPGVVEEVERPA
FT                   RVRVAFQGLDGTGHEVEADGLLSVCLQHEIDQLDGIFWIQRLSRLKRERVVKKYEKLLK
FT                   AG"
FT   CDS_pept        129022..131625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0109"
FT                   /product="helicase"
FT                   /note="C-terminal:DEAD/DEAH box helicase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86107"
FT                   /db_xref="GOA:A8IGM6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGM6"
FT                   /protein_id="BAF86107.1"
FT                   /translation="MGVSTLTQRRDGALPDVFQRWFAARGWAPRRHQLDLLASARAGRS
FT                   VLLIAPTGAGKTLAGFLPTLVELTEARSPEARKAKAKAKKAEGQPVGRTPPPRTSPLHT
FT                   LYISPLKALAVDIARNLEAPISEMGLPIRVETRTGDTPSSRRQRQRRDPPDILLTTPEQ
FT                   IALLLASKDAEFLFSGLKRVVLDELHALVTSKRGDLLALALARLRTIAPGLQAVGLSAT
FT                   VAEPDDLRRYLVRQADGLPKKETLADLVVAAGGAAPDLSMLESKARMPWASHTALHALE
FT                   EIYALIGAHRTSLVFVNTRWQAEMLFQELWRINDDNLPIALHHGSLDVEQRRKVEAAMS
FT                   AGRLKGVVCTSSLDLGIDWGDVDQVINVGAPKGSSRLMQRIGRANHRLDESSRAVLVPA
FT                   NRFEVLECRAALEAVAAGAQDTPPEREGALDVLAQHVLGSACAAPFSADALYDEVRSAA
FT                   PYRALSREDFDAVLDFVATGGYALRAYERFAKIRRTKDGLWRVANPQVAQTYRMNVGTI
FT                   VEATMLKVRLVSARGAPRTGPAGRPRFGGRMLGEVEEYFIETLVPGDTFVFAGEILRYE
FT                   TMVEDEVYVSRTTATEPRVPSYAGGKFPLSTFLAAGVRALLASPSRWAALPAQVREWLE
FT                   LQKKRSRLPGRKELLVETFARSGRYYLVAYSFEGRLAHQTLGMLLTRRLERARLKPLGF
FT                   VANDYALAVYAAGDMGAAAKDGRLSLDALFDADMLGDDLEAWLAESALMKRTFRYCAVI
FT                   AGLIERRFPGKEKTGRQVTISTDLIYDVLRRHEPGHILLRAARADAATGLLDVRRLSDM
FT                   LMRIRGHIVHQPLERVSPLSVPVLLEIGRESVGGPETHEALLAEAEEELVREAMG"
FT   CDS_pept        131658..132230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86108"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGM9"
FT                   /protein_id="BAF86108.1"
FT                   /translation="MLSGESNVIPAFGPSGVIPPFTGQSAASRALVSPYAASATEIVLR
FT                   FAQSPERTEIVRGLLAYRAALADIGIVDGFQWIDGSFVEDCETIRGRPPNDVDVVTFAH
FT                   RPHIASSGEAWAQLAQTNEPLFVPKATKASFQCDAYFIDLQKPPHLLVQDTAYFNGLFS
FT                   HQRDTAQWKGMVLIPLRSDDAAARAMI"
FT   CDS_pept        132241..133167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86109"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGN1"
FT                   /protein_id="BAF86109.1"
FT                   /translation="MLKRLERDATKADLAAVEALLNARSAEDDPIGHLQFSRRRDDLNQ
FT                   RLQQIEGRPSTNAEVGLFFGGRPVLGSYGIQADFGANAIAEFQKLVSSAHAVVERPLGT
FT                   RGPVPQRDRTQLMLTDVARGSFGFILQQAEDPQLVDSAMKNVLERTTDLIFRVASPDQE
FT                   SFDNIAEDVDNRLFNALRSFFKVLGDAGATLRIVEDRREFTLHRDEVELARERTETSTL
FT                   HETEETAEGLFYFLPDGRRFELDQGSDAGVLKGTVSPACMDWLTSSGTQIRPGILGTFR
FT                   RVQMRVREIRGRGHRSHKSYTLLTVID"
FT   CDS_pept        133168..133569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86110"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGN4"
FT                   /protein_id="BAF86110.1"
FT                   /translation="MLGISSAPSLLQPGAFSRSLVHCTGGEDAMANLFRGLAPEQLWQA
FT                   INPWRFFENASFTGISVNLGQSGNPQAEEAILDEVGSYGRQIGRIGDALDVIMAHMDKT
FT                   GLSPEEQDKLTALRFQLEAVRKVKARNGS"
FT   CDS_pept        complement(133620..134552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86111"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGN7"
FT                   /protein_id="BAF86111.1"
FT                   /translation="MATIKTAEIEQFVQMVDGNYAGNLAHPELAAAYYPLSLSFETEVN
FT                   QEIDPFSEEYFQQQLALYKEISGRELNQWDGELHPVDVPSLVNASNPLGLAHAPFIAEH
FT                   VRALTTMFTLSSLDVRPNILDMGAGHGVSSEIFAFCGAHVHAVDIDPQLSLLSKVRAAA
FT                   RGYDIRRSTLNFDDLSSVPDNHYSAAFFFQSLHHCLRPWVLIETLKGKIVADGVIAFTG
FT                   EPVQAGWKNWGIRMDQESIYVARKFGWFESGWSHDFIRECFARNGFTLKFFSGGHGGGE
FT                   IGVATADPGKLARCVAAAAHHGFAERYPG"
FT   CDS_pept        134947..136050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0114"
FT                   /product="NADH flavin oxidoreductase"
FT                   /note="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86112"
FT                   /db_xref="GOA:A8IGN9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGN9"
FT                   /protein_id="BAF86112.1"
FT                   /translation="MPLLFEPLTLRGLALDNRIVIAPMCQYSAKEGAATDWHLIHLGTL
FT                   AMSGAGLLIIEATGVTPEGRISPFDLGLYSDETEAALAGVIARVKAQIPAEGMPRFAIQ
FT                   LGHAGRKASSAQPWKGGGQVPEAEGGWQTVAPSALPFRNADAPPAALDDAGLDRLRTAF
FT                   AEAARRAARIGFEAVEIHAAHGYLLHQFLSPLSNARTDAYGGSLENRMRFPLEVFEAVR
FT                   AALPDSVPVIVRVSGTDWVDGGWDIEGTIAFAQALKARGADAIHVSSGGLSPLQQIPVE
FT                   PGYQVPLAKAVKEATGLPTIAVGLITEPKQAEAVLAAGEADAIGIARGALYDPRWGWHA
FT                   AAELGASVTAPPQYLRCQPSGLRHLFR"
FT   CDS_pept        136376..137077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0115"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86113"
FT                   /db_xref="GOA:A8IGP1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGP1"
FT                   /protein_id="BAF86113.1"
FT                   /translation="MLARVDSASQPLTALHGCAVWLDPRGALVWPDERLLVVADLHLEK
FT                   GSAFARRGQMLPPYDTVETLARLEALVHAHQPRTIVSLGDSFHDRWGAERLDDEARHRL
FT                   AALQAGRSFIWVAGNHDPEPQAGLEGEWVRELSLGSLVFRHEPSEHHTPGEVAGHLHPV
FT                   ARLSVRGRSIRRRCFATDGRRVVLPALGAYAGGLNVRHGALAGLFAGPFEAHMLGEGRT
FT                   YRIASTACLMD"
FT   CDS_pept        complement(137083..137709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marR"
FT                   /locus_tag="AZC_0116"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86114"
FT                   /db_xref="GOA:A8IGP5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGP5"
FT                   /protein_id="BAF86114.1"
FT                   /translation="MQGDRQMPWEAVVFRGGAERRAGPSRPRPDPQQADIAGVPARGGG
FT                   MKDPIAKSIGYRLNHTARLQRALSARLLADLGLFPGQESVLKMLVEQDGRTMGELATAL
FT                   RVRPPTASKTIARLTTQGLVERRATDGDGRLVRVFLTSTGRERGLAVDGIWEALETEIV
FT                   DGLDNKERKRLRKLLRKVEKNLAARLGADHGADDEPEGAEDDEEA"
FT   CDS_pept        complement(137866..141282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0117"
FT                   /product="outer membrane autotransporter barrel precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86115"
FT                   /db_xref="GOA:A8IGP6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGP6"
FT                   /protein_id="BAF86115.1"
FT                   /translation="MRCLSSSVSRTAIACALAFAPAPVLAASFTVPTGSTNTTVQTLTG
FT                   TQTGAVSVGGTLSTTASSVTLGIATGTGVVLNNAGTISSGNRAVDTTSTVTGLLTVNNG
FT                   GAITATDDGFRINGTLAGGTLLLSNSGTIVSSTGQALDFDKATATNAIVTITNSGSIQS
FT                   SGSDAVRLGGGTISLSNSGTISTTSAGKRAIKFDTASNVDTLVSLSLTNGIGGLISGTD
FT                   DAIKIAGNAGSTSAAVIAINNAGTIRSTAGGQGIDLGDLTSTSLKITITNQSTGLITAS
FT                   DNDGVKAGMNTVVSNYGTITSNYTTTSADAQNYSAVKFDGASGAVHNYAGGVISGAYHG
FT                   IKASGLTDNIDVINDAGGTITGRNGSGVNSNGTGSVLNYGIITGSFDPAASFGDGDGVD
FT                   IDHIGTIVNYGTIQALGSKGTKPGETKPSTSEGIAIGGGSITNGSATVRTALISGANNG
FT                   ILADDSNSGSIYGALTVTNYGTIQGLNGYGIQVVNNAGFATTITNYGTISGTTYAVAMG
FT                   NGNDLFVYEAGSSVNGAVKGEGGTDTLRLGEVAGTFNLSLLGDSATYQGFEILDLAIGS
FT                   GWTVTGSSSFSGATNVTGASLTLNNASLAASVVTVGGSNAVLAGTGTIGSLVANSGATI
FT                   SPGLTASGLGTLSVNGAARFNSGSTYAVTVTNSGASDRIAVSGATTLSTGASVSVQAIA
FT                   GLYNFRQTYTILTSAGGISGTFGPVSSNFAFLTPSLSYDANTVYLALNRNDTTFASVAT
FT                   TRNGRQAAAAVEAGGPNTALYNAVATGSITASQSAFQLLSGEAQASFGTTAFNQNQMVG
FT                   DVIDARLRQSNYAGATGAAAGLGAGGPTAYANERAVKAGPFSSAAAPAPAPQAWTGWVQ
FT                   GYGQWNHLSGNGNASTLDSTVGGVLAGLDTSVNNWTLGFAAGYGWSNSSVANLGSQVNS
FT                   DTAQFAFYAGTAFGALKLRAGATLAYSNVDSNRVVVVGSLTERPTASYDGWSGGFFGEA
FT                   GYALPVGPVAFEPFAQLAWSGVNMGSFAETGAPVTGLSSSGLSFDTWYTTLGLRAAGAV
FT                   SFAGYNIVPHASVGWRHAYGDVTPALAVTYLNTGTGFTVQGLPIAEDSAVLGAGLDLAL
FT                   GKGFTVGVSYDGAFASSSQSNAVRGTVGFTF"
FT   CDS_pept        141365..142000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0118"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86116"
FT                   /db_xref="GOA:A8IGP9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGP9"
FT                   /protein_id="BAF86116.1"
FT                   /translation="MTPPLLTGGRRAVPVTRGRAASAIRGCASGGSGGRVVDAGRANRP
FT                   AAKPVYDIGGRELRVRWRDAGARRRTRGPACVEVSPEVSPVPTIAIIDDDEAVRRATES
FT                   LIRSLGFGTRSFASAEDFLKSAERDQADCVITDIHMAGMSGVDLQSRLRAEGDMVPLIF
FT                   ITGYPEEKVRRQVDAAGAFGFLAKPFEGNAMIDCIDRALEARAARRPV"
FT   CDS_pept        142680..144356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0119"
FT                   /product="malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86117"
FT                   /db_xref="GOA:A8IGQ2"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGQ2"
FT                   /protein_id="BAF86117.1"
FT                   /translation="MADTKMASQLKHVESTKAPLHALASSGLALLHEPNQNKGTAFSRD
FT                   ERQALGLEGLLPHAVESLDRQVERVLSHLDTKMDDLERYIYLIGLEDRNETVFYKTIMS
FT                   DPKRFIPILYDPTVADACLTFGNLYRRARGMYITRHMKGRIAEVLRNWPRKDVRFICVS
FT                   TGGRILGLGDIGANGMGIPIGKLQLYTACAAVPPDCLLPVLFDIGTTNESLRADPFYLG
FT                   TREPPLAEAELDELTEEFITAVQEVFPDCCVHFEDWKGTDAIRMLDRYRDRILTYNDDI
FT                   QGTASVALAGIAAAMNITGGKLSEQRVLFLGAGSAGIGISKLIAAEMQTKGLTAEEARA
FT                   RIALFDVNGLVEASRTDLTEAQKLYAHKGPPTKDFVKFIKEFKPTVLIGVSTKAGAFNQ
FT                   QVVEAMSQLNERPVIFALSNPTTKAECTAEQAYTWSKGKALFAAGVQFDDVEFEGKIYR
FT                   PGQANNFYIYPAIGLATYVARPKRLTDECFIVAAHATADQVGPALCAKGMLYPSQDQIL
FT                   ETEVTTATRIVEYMFDAGLAQVERPRDIRAWIEGQLYKPHY"
FT   CDS_pept        144457..146133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0120"
FT                   /product="putative transmembrane protein"
FT                   /note="YidE/YbjL duplication"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86118"
FT                   /db_xref="GOA:A8IGQ4"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR022457"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGQ4"
FT                   /protein_id="BAF86118.1"
FT                   /translation="MSSVIATIQKYPEIAIYLTIAIGFWVGNLKIGNFSLGTVTSTLLA
FT                   GLLIGQANISLPPVLQSTFFAMFLFAVGYAVGPQFVRALRSDGLPQVVFAVLVCISGLV
FT                   TAVILGKLLGYNAALTAGLLSGGYTNSTVLGVATDLISQSGLDPQQLKMALSLMPVAYA
FT                   VTYPFGTAGSAWILATLAPKMLKFDLAAECEAYEKAHGTGVGNGTTAYREFSARAFRVN
FT                   NPELIGKSVREIERLFNHEIFVRRVRNGNRIVDCDDCTVIHENDVVAFSGSLSALIAYQ
FT                   DRFGVEVKDVPLLDFSTELLDLVVTNRAYANKTLGEILRTLFGKPGRGVFLTKFVRSDL
FT                   AMPLNSEITIQRGDVLTILGAKEDVAKIAKELGYADRPLENSDMAFMGFGIVVGSLLGA
FT                   ITVHVAGIPLSFGTSVGAIVAGIFCGYLRSTKRTFGRIPGPALWVFNNVGLNGFIAVIG
FT                   LNAAPGFVSGLQTYGVTLFLAGTVVTMVPLFVGLFLGHYVFKFNPAIMLGACAGARSTT
FT                   AALGALQDAGRSKVPALGYTIGYAVSRLVMAVLTIVVVNVF"
FT   CDS_pept        complement(146543..147796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0121"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86119"
FT                   /db_xref="GOA:A8IGQ7"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGQ7"
FT                   /protein_id="BAF86119.1"
FT                   /translation="MTSLNQILLNPAIQLGADLDGWFAAGGGLGLDAALADPGAIIPAL
FT                   EAAGLRGMGGAGFPTHRKWAAAAAAQNTDRTVVCNGNEDEPGTFKDRHLLRWTPHQVIE
FT                   GALIAALAIGARRVFLYINPQQIEALAEMRRAVAQWADTDRLRAVERRIGATLELTVFP
FT                   TSGRYIGGEETAVISSLEGGFPFPRRKPPFPAESGYRGTPTLINNTETLANVPHILRHG
FT                   AAWYRRLGLGEAVGTKLYSLSGDVLRPGLYELPMGTPLQDLIFVHGGGMLEGKAFKAVF
FT                   TGGPSNTLLTARDLDVALDFDSVRARRSRLGTGAMIVISEGTSIVRKVAEYIDFFAKGS
FT                   CGQCPPCKAGTFQMARLLDRVDSGRAVPADLAALYNLCQILPGSGRCGLIDGAVTVVES
FT                   SLHTFPAEYRIGEPSPVP"
FT   CDS_pept        complement(147793..149415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0122"
FT                   /product="L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86120"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGR0"
FT                   /protein_id="BAF86120.1"
FT                   /translation="MTIQIPYAAALAAIASGSAPPVRSDDLPVETLLARFHPDHGPRAR
FT                   VPLRIGANAGDACHPELARLLESNALIDDLDLARATPLATDVLVIGGGGAGAAAAVTAA
FT                   RQGARVIIAGKLRIGDSNTVMAEGGIQAAVGAEDSLQRHFDDTVRGGHGRGEHMLIAQM
FT                   VRDAPDVIRWLIDLGMAFDLSQDKALGQTLVRKRAGGTTAARILCHRDFTGLEMMRVLR
FT                   EAVELQGGIEQFMRCPAVELLSHEDGSCAGAVLYDLERRSFLLVRANAVVLATGGSGRL
FT                   HLQGFPTSNHYGATADGLVLAYRLGARMRDLDSFQYHPTGVAWPRHLAGGLISEAARSA
FT                   GAVLLNGLGERFVDELQPRDVVAAAILRECAEQRGIMRDGETGVFLDVRGALAARPDLL
FT                   ERDLVSLGHLAAKCGLDPRTEPFLIYPTLHYQNGGIEIDGDGATAVPGLFCAGEVTGGI
FT                   HGRNRLMGNALLDIISFGRRAGARAAEARPPHAPGRGGLSHVHRWRRELARAGLPADLR
FT                   APQLYPTYGNFALRRGTTDRGNP"
FT   CDS_pept        complement(149420..150238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0123"
FT                   /product="4Fe-4S ferredoxin"
FT                   /note="iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86121"
FT                   /db_xref="GOA:A8IGR1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGR1"
FT                   /protein_id="BAF86121.1"
FT                   /translation="MRGVGAARSRSGLYWHAPCCPERVIAARAIPRRGAPCRPQHAGPP
FT                   RDPRRKFTVRETVHLTIDGCEVAADPTQSILQAYARSGAELTANVGCLGQGVCGSCRCL
FT                   IRKDQERQVSTALACETRVEAGMQVSFIDHFLPAHVHRYDLSDIRDSWGLLGQIRAVFP
FT                   EAAYCRHCSGCDRACPKGLPVQSGVASAVAGDLAAAAAVFDPCVMCNLCTLACPENIRP
FT                   NHLGLFVRRAIAALTLRPVDLMRRLRDIETGAMTVEGPQPATASGEPAEG"
FT   CDS_pept        150421..151446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0124"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86122"
FT                   /db_xref="GOA:A8IGR5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGR5"
FT                   /protein_id="BAF86122.1"
FT                   /translation="MAYPALARALLTEPHRPRVACGPVQGFSMFAVMTGALLPVVFLMF
FT                   LGWLGGRKGYFRREDVNVFAALVMRFALPFSLFLGALNTPPEKLQNLPFILCMAFGFVG
FT                   TYIVALVIARLAFRHDLKTSAIQALVCTFPDMAYFGAPILLAVCGPSGFLAVLVGNLIT
FT                   SFIILPLTIVLSRWGEMASGPDESGVADILKSSLWRTVTNQMVWLPILGVILSFSGVTL
FT                   PAALKHSVELVATTAGGVSLLALGLMFFGERPSVNLDVTVNVGMKNVLQPALMALGIFL
FT                   FGVDAEFARQALIVGAVPTAIAASMFAVRNRTYAMPASDSVVIGTVLAVFTEAFLIAVV
FT                   L"
FT   CDS_pept        151469..153466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0125"
FT                   /product="histidine kinase A"
FT                   /note="ATP-binding region N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86123"
FT                   /db_xref="GOA:A8IGR7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGR7"
FT                   /protein_id="BAF86123.1"
FT                   /translation="MDALAVNAKQARMPTWAGQVPCRYRHRCGARCGGKVPAGLDPVHL
FT                   THLECVMTFRRRDFLISLALAVLCAVVAGWAGYKMVCAAGINEQHALAERRMDIANETL
FT                   EREIEKYGLLPRTAAVSPNVIDFLSRPATAEGVAEINRQLRTLNDSAGTLQTYLVDPSG
FT                   RIVASSNWSEKDSFIGRDISYRPYFQNAQPGRTTGYYAVGTTGDAPGYFLASAVEDGGR
FT                   RLGVVAVKLGLDQLERLWLGQPEPALMVDDNGIVVVSSVPDWKFGALRPLPAATLAHLE
FT                   ASQQYNHREIRTLDWKVLTTFRNGSFLVRAGTPAGTATYLAAGRPVPDLHMHMIVLSEP
FT                   REVYRVAWGWAIACAALAALACALLHVLNMRRLSIRERLAMREALQASHDRLEILVEAR
FT                   SAELRRANEGLRREVSERIQAVKQLQSFQEELIRTENLAVIGQLSAGIAHEINQPLAAL
FT                   STLSANAVRFLERNDLATVRLNLGRISDLVARMGALTGQLRSFARRSTGEIGATAVGLR
FT                   VDGAVALLAHRLTKDGVVVELLPPGGVLTVLCDPVRLEQVLVNLISNAVDASSDLRVPH
FT                   IQVSWGAEGESGIIRVRDNGIGLTDAVKAHLFEPFFTTKKTSGLGLGLAISADIIRGFG
FT                   GALTADNNPDGGATFTITLPLAEQKETCDA"
FT   CDS_pept        153459..154787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0126"
FT                   /product="Fis-type transcriptional regulator"
FT                   /note="helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86124"
FT                   /db_xref="GOA:A8IGS0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGS0"
FT                   /protein_id="BAF86124.1"
FT                   /translation="MPDLKVLIVEDDEDVRLGCLQALELEGLTVIGAKCVEQVPRMAPQ
FT                   DFPGVVVTDIRMPGMDGMAYLRQLVEADADLPVILITGHGDVATAVQAMRDGAYDFIQK
FT                   PFSPEQLVGVVQRALEKRRLTMEVRALRRQVAAIGGLESRIVGRSAAVVELRALVQDLA
FT                   ATPTDVMILGETGCGKELIARCLHDLSGRTGPFVALNCGGLPETLFESEIFGHEAGAFS
FT                   GAAKQRIGKVEHAQRGTLFLDEIESMPMAMQVKFLRVLQERVVERLGSNRLIPVDFRVI
FT                   AATKADLGALSEEGKFRADLHFRLNVATIDLPPLRDRREDIPLLFQYFVSQAALRLDRP
FT                   APEIRDSHIRELMAHKWRGNVRELRNEAERYVLGLKSSIGQGASDTPAPLSQTVEVFER
FT                   GIIAEELRRQHGNISRAAEALRIAKTTLFDKIRKYGIETAPLV"
FT   CDS_pept        154824..155720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0127"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86125"
FT                   /db_xref="GOA:A8IGS2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGS2"
FT                   /protein_id="BAF86125.1"
FT                   /translation="MEIRTLRAFVEVVRQGGFSNAAKAILATQSTVSKAVRQLEDELGL
FT                   PLLDRLGHSSRLTAAGEIVYRRAAVMLAEREDLVSELDELRGLTRGVLRLGLPPLGSNI
FT                   LFAPLFALYRQRFPGIEIKLHQHGSRRLEEMVLAGEMDLAGSLLPVAPDFAWQSIHQEP
FT                   IVALLPASHRLAGAARVDLGDLAADPFLLFQEGFAIDTVLQAACERRGLKPQVAVRSAQ
FT                   ADFLVELVAAEVGVTFLPRMIADQRPRPGVARVLLDEPGTDWHMALVWRKGGYLSRAAL
FT                   AWLDLSREVLAANAAAA"
FT   CDS_pept        complement(155742..156386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0128"
FT                   /product="nucleoside diphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86126"
FT                   /db_xref="GOA:A8IGS6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGS6"
FT                   /protein_id="BAF86126.1"
FT                   /translation="MTKTPFQDEPARIDILDETLIYKGFRRFERYDLRLHTPGAEPVVQ
FT                   TREILRVGGAVGILAIDPVRDAIVLLRQFRLTAHMATGRGELIEIPAGLIEPGEDPALT
FT                   ARRECIEETGLDPVEVDFLFSCLVSPGAVDEMAWFYLAFVDASNLPETTGAADETEVIR
FT                   PFLVPLDRAIAALDDGSSLANGYLRLALMWIALHRADVAARGEAWLARRAA"
FT   CDS_pept        complement(156383..158020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0129"
FT                   /product="ABC transporter"
FT                   /note="ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86127"
FT                   /db_xref="GOA:A8IGS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGS7"
FT                   /protein_id="BAF86127.1"
FT                   /translation="MTETSAPLLSVQDLSVAFRREGREQIAVNRVSFDVKPGETVALVG
FT                   ESGSGKSVTALSVLKLLPYPSASHPSGRILFKGRDLLTASDRELRAVRGNDVTMVFQEP
FT                   MTSLNPLHTIDRQIGEMLILHRGLSGTAVRTRTLELLHEVGIPDPESRLGAYPHQLSGG
FT                   QRQRVMIAMALANEPDLLIADEPTTALDVTVQAQILKLLKDLQARLGMAMLFITHDLGI
FT                   VRKIADRVCVMQKGEIVEQGGAEETFLHPKHPYTQALLKAEPKPDPAPAAPEAKVVVSA
FT                   QDLKVHFPIKRGILRRTVGHVKAVDGVSVEIHEGETLGVVGESGSGKTTLGLALLRLIS
FT                   SKGPIAFLGQRVDGLSFAGMRPLRAHMQIVFQDPFGALSPRMSVADIVEEGLLIHQRKL
FT                   SQDEREARVIAALQDVGLDPESRFRYPHEFSGGQRQRISIARAMALEPSFVVLDEPTSA
FT                   LDMLVQAQIVDLLRALQRKRSLTYMFISHDLRVVSALASRILVMRNGTVVEEGPAREVF
FT                   EHPREAYTQALFAAAFNIETAHAGVTAQ"
FT   CDS_pept        complement(158017..158466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0130"
FT                   /product="pilT protein"
FT                   /note="N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86128"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGT0"
FT                   /protein_id="BAF86128.1"
FT                   /translation="MSVPRVYLDTNVFIAAFEMTGAHSDHAWWILKGIEAGTIIGVTSE
FT                   ITLAEVLVKPMERDDEALADAYEGMIAPAPYFETVSVGRDVLTTAARLRAGRHSLRLPD
FT                   AIHVASAQIAQCSVFITQDERIALPDDLRRLGVTPFTLDDILGQP"
FT   CDS_pept        complement(158463..158726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86129"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGT2"
FT                   /protein_id="BAF86129.1"
FT                   /translation="MPGGRAMNRIVREHYPVEKLPDDLRAAVEDESSVRVVLERETAAP
FT                   PAGEMAREGHFSRWRHLRQTRFETPEGVVAHVRALRDEWDRR"
FT   CDS_pept        complement(158740..159897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0132"
FT                   /product="peptide ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86130"
FT                   /db_xref="GOA:A8IGT5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGT5"
FT                   /protein_id="BAF86130.1"
FT                   /translation="MSAMDTTANALPATDAPRKRPFFSPLNQRRITNFRHNRRGWWSFV
FT                   LFMVLFVLSLFAEFIANNKPILIRYDGAYYAPVLRAYPETAFGGDFETEADYRDPYLQK
FT                   LIAEKGGWMIWPPIHFSYSTHNLDLPTPAPSPPTWMLTEQQCAAVAEKKGVKGCAGLEY
FT                   NWLGTDDQGRDVLARLIYGFRISVLFGLALTLISSVVGVAAGAVQGYFGGWVDLLFQRF
FT                   IEIWTSIPSLYLLLIISSVLVPGFWVLLGILLLFSWVSLVGLVRAEFLRARNFEYVQAA
FT                   RALGVGNFTIMMRHLLPNAMVATLTFLPFILSSSVMTLTALDFLGFGLPPGSPSLGELL
FT                   SQGKANIQAPWLGLTGFFTVAIMLSLLIFIGEAVRDAFDPRKTFA"
FT   CDS_pept        complement(159894..161006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0133"
FT                   /product="peptide ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86131"
FT                   /db_xref="GOA:A8IGT8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGT8"
FT                   /protein_id="BAF86131.1"
FT                   /translation="MLAYIVRRLALMVPTILGIMLVSFVVVQFAPGGPVERVIAQLTGD
FT                   DVSATARVSGGGGDFAGGAQAPGAGGGGADASKYRGAQGLDPNFIKELEKQFGFDKPPA
FT                   ERFALMIWNYVRFDFGRSYFRDISVLDLIAEKLPVSISLGLWMTLLTYAISIPLGISKA
FT                   MRDGSRFDVWTSAVIIVGYAIPSFLFAILLIILFAGGSFLDWFPLRGLTSDNWAQMSWP
FT                   QRIGDYAWHLVLPLTSMVLGAFATMTLLTKNSFLEEIRKQYVITARMKGLPERAVLYRH
FT                   VFRNAMLIVIAGFPSAFISAFFTGSLLIETIFSLDGLGLLGFESVLNRDYPVVFATLYI
FT                   FSLAGLLIGLVSDLTYMLVDPRIDFETRDV"
FT   CDS_pept        complement(161054..163003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0134"
FT                   /product="putative ABC transporter solute-binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86132"
FT                   /db_xref="GOA:A8IGU0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGU0"
FT                   /protein_id="BAF86132.1"
FT                   /translation="MSAGTDRRTLLRLAAAGGAAAFLPGLGAGRARAQTPPPAPASEGG
FT                   AAAPAVERHGLSSFGELKYPKDFKNFDYVFPGAPKGGTFSQIGPTAAYNQSFQTFNSLN
FT                   GYILRGDGAQGIALIFDSLMVRASDEPDAVYGLVASSVSISDDGRTYRFRLRPEARFHD
FT                   GTPLTAEDVAFSLNTLKAQGHPLIRQALREFTGAEAEDKGTVVLSFTAQRPRDVPSYAA
FT                   TLPIFSKAYYGKHKFEETTLDPPLGSGPYKVGRFEVGRFIEYLRVADYWAADLPVNRGR
FT                   HNFDVLRFEYFRDREVGFEAFKARAYLFREEFTSRAWATQYDFPALKTGRVKREVLPDE
FT                   TPSGAQGWFFNTRRAKFLDPRVREAIALAFDFEWTNKNLMFGQYERTWSFFQNSDLMAK
FT                   GLPSPAEEKLLAPFRDALPAEVFGEPYVPPVSDGSGQDRALLRRAAALLKDAGYTIQQG
FT                   RLVDGKGTALTIEFLDDDGAFERHTSRFIANLKLLGIEASFRIVDPAQYQARLKDFDFD
FT                   MVVRRYSVSLNPGDELRAYFGSEAARLPGSNNLSGISDKVVDALIADAIAAQTRADLVT
FT                   ACRALDRVLRAGRYWVPQWNKASFWIAYWDVFDRPAVKPKYDRGTPDTWWWRKGIADPP
FT                   PVVEPGPASPQKDG"
FT   CDS_pept        complement(163000..165000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0135"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86133"
FT                   /db_xref="GOA:A8IGU2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGU2"
FT                   /protein_id="BAF86133.1"
FT                   /translation="MRGKCVRQRIFRYHFPLITPCFCRRVRRDMRSVLAGRRPAASSPE
FT                   SSMLVKIRRIALATAILACTAPAFAQAQQAAAPAPFRFATSLMGEPKYKPDFKHFDYVN
FT                   PDAPKGGVVRFAEDGTFDSFNFVVPRGTVGAGIGNIYDTLTTQSRDEVATAYGLIAEGL
FT                   SYPADFSSVTYRLRAEAKWQDGTPITPDDVVWSFQVLTKNNPGQAFYYRHVKSVEKTGQ
FT                   REVTFTFDQGGNRELPQIVGELLVLPKHWWTGTDANGKARDITQGTLEAPLGSGPYRIK
FT                   SFVPGRTIVYERVKDYWGKDLPVNVGRNNFDELRYEYYRDDTVALEAFKADQYDWRIEP
FT                   SAKNWATSYDFPAKQQGKVVLEMFENRASGVMQAFIPNLRRAKFQDPRVRRALNYALDF
FT                   DGMNHTLFFDQYKRIGSFFSGTELASSGLPTGAELDILNGVKDKVPPGVFTTPYTNPDN
FT                   PSEQDRRANLRKAADLLKEAGWQVKGKQLVNAKGDAFTLEILIASPAFERVALFYKPAL
FT                   ERLGIQTSVRLVDSSQYVNRVRARDFDMIISGWGQSLSPGNEQRDYWGSDSADREGSRN
FT                   YAGIKDPAVDALIEKIIYATDRQQLVAATHALDRVLLWNDYVIPAWTLGFTRTARWDRF
FT                   AHPPALPQYSFEFPDIWWWDAAKAAKIGGGN"
FT   CDS_pept        complement(165098..165661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0136"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86134"
FT                   /db_xref="GOA:A8IGU6"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGU6"
FT                   /protein_id="BAF86134.1"
FT                   /translation="MDSFELNKIAGAVLGTLTLTLGLGIVSEILFTPEAPAKPGYEIAV
FT                   PEGGATGQAAPKAAAEVPIAQLLPTASVEKGANVAKRCASCHNFAEGAGAKVGPDLYGV
FT                   VGRKKASVAGFAYSSALQGKGGDWSFDDLNAFLTNPKAYVPGTAMAFAGIPKESERADL
FT                   IAYLNTLSHSPLPLPKAADAAPAK"
FT   CDS_pept        165723..166604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0137"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86135"
FT                   /db_xref="GOA:A8IGU8"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IGU8"
FT                   /protein_id="BAF86135.1"
FT                   /translation="MPHGFTRRQLGTNHFERCRATRIRRAPMPRVAGAPQQNSLSWNMA
FT                   FSASDVLVLIPARLAASRLPGKPLADVGGRPMIVEVARRAVAAGIGRVAVATDAVEIAD
FT                   AVRAAGFEAVMTRADHPSGSDRIFEALGVLDPDGAVQVVVNVQGDLPTIAPETIRAALV
FT                   PLEEGPADIATLTAVITEEGERTDPNVVKVVGTPIGENRLRALYFTRATAPTGEGPLYH
FT                   HIGLYAYRRAALERFVSLPPSPLEKRERLEQLRALEAGMRIDVAVVDAVPLGVDTPEHL
FT                   ERARALLASNDN"
FT   CDS_pept        166615..167472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0138"
FT                   /product="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86136"
FT                   /db_xref="GOA:A8IGV1"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGV1"
FT                   /protein_id="BAF86136.1"
FT                   /translation="MNRRIVFQGEPGANSHIACREVFPDYEAVPCPTFEDAFIAVDNGS
FT                   AELAMIPIENTVAGRVADIHHLMPRSSLQITAEFFLPLSHQLMAVKGASLSTIKTVQSH
FT                   VMALGQCRKAIRTLNLTAVVGGDTAGSAREIADAKDITRAAIAPRLAAEIYGLDILAEN
FT                   IEDEAHNTTRFIILKREADWAPAGNGPVMTTFVFRVRNVPAALYKALGGFATNGVNMTK
FT                   LESYQLDGEFTATQFYADVDGHPDDRNLKLALEELAFFSREMRILGVYPAHPFRTTRSP
FT                   KPEA"
FT   CDS_pept        complement(167488..169290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0139"
FT                   /product="putative xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86137"
FT                   /db_xref="GOA:A8IGV3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGV3"
FT                   /protein_id="BAF86137.1"
FT                   /translation="MTPVPGASPAKRPQGLLNRLRRLVMLEHGTPHRPRRRPPALVFGL
FT                   EDKVPAGALIALSGQHAMLALTFLIYPLVAASQVGLSQPETNAVLTACTLCIGIATMLQ
FT                   CARSRVGSGYLIVHVPSPGALPLAIQALTLGGVGLMAAMTLLVGVSQLFIARIVRPLRV
FT                   LLPPEVCGVAVTTLGISLAEPALRRALGLDRGSSVVDDNALIVSLVTVALIVGIAIFTP
FT                   RRIKIFAVLIGASSGWALAAWLGIEQPGGAALLASAPLVALPSLHLPAFEIAPSLLPLA
FT                   ALSVMLNIVDVLSITVSLEKMNDAEWRRADMRAASRAVTTSGIGNVLNGLVSGFQSGLS
FT                   SSAVGLAFATGATARIIGFVAGALIFATAFFPKAIVALTLIPAPVVGGILIYTTAYLLV
FT                   AGMELILSRRLSERRVFLVGLSILAALSVALLPIKGQFPGWIQPLVSTPMSVGAFCAIV
FT                   LNLIFRIGISQESGFTAGLGTDPYPTMRDFLERQGDLWGARRDVIAAAIPVGAQALELL
FT                   LENSIATGEVEVRARFDETHLDVFLLYDGAVLEPPKARPSPEALLGDDAEVAAFCAYMI
FT                   QKLSDHVTFGQSSGRARIALRFDH"
FT   CDS_pept        complement(169331..170269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0140"
FT                   /product="MutT/NUDIX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86138"
FT                   /db_xref="GOA:A8IGV6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGV6"
FT                   /protein_id="BAF86138.1"
FT                   /translation="MLASSSSPLGPWPALGYVGNPLDRAAQRRGEADALARRSDAQAYL
FT                   LGGELVALKAGKGEVHGPLFSLPEAQDWGGSEPLFLGLEDGAPRFGLFFPVENRERMEA
FT                   AGLIVTDLRSIAVGGLVEARHLGPIACAKALGAWHQRHRFCSNCGAPTRVVEAGWRRDC
FT                   PSCGGQHFPRTDPVAIMLTYSGDKCLLGRQPRFAPNMWSCLAGFVEPGETFEEAVRRET
FT                   FEEAGITTGKVAYHSAQPWPFPMSLMIGCLAEATSTDIVIDPLELEAARWFDRAEAAAM
FT                   LTRTHPDGLFAPPPVAIAHHLIRAFVEGATA"
FT   CDS_pept        complement(170340..170858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86139"
FT                   /db_xref="GOA:A8IGV9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGV9"
FT                   /protein_id="BAF86139.1"
FT                   /translation="MARPPPTSRPLYRRPRAEWQARLAPAFDSSSSAAMTDSFTLDPRL
FT                   AADGPALGDLPLCHLRLVEDARFPWVVMIPRRAARVEIIDLAPQDRATLMEEIATVSSA
FT                   LKSVSGAQKLNVAALGNMVPQLHVHIVGRTAGDAAWPGPVFGAGTRMPYGEDARSAFVS
FT                   RLKASLRLP"
FT   CDS_pept        171204..173045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0142"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86140"
FT                   /db_xref="GOA:A8IGW1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGW1"
FT                   /protein_id="BAF86140.1"
FT                   /translation="MSADTPEDMPAFDLPAATPAPAPQAAPYRVLARKYRPQNFDDLIG
FT                   QEAMVRTLSNAFASGRIAQAYILTGVRGVGKTTTARILARALNYEPMDGSPGGPSLDLS
FT                   VFGKHCKDIIESRHVDVMEMDAASNTSINDIREIIEGSRYRPVMARYKVYIIDEVHMLS
FT                   TAAFNGLLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRVEAGVLAAHLSRIC
FT                   AKENVSVDAEALSIVARAAEGSVRDSLSLLDQAIAHGGGAVTGEEVRRLLGLADKARVI
FT                   DLFDALMKGDMPRALAEFRDQYDSGADPAVILTDLAEFTHLVTRLKIVPDSASDASLVE
FT                   AERIRGVEMAEALSMRVLSRTWQMLTKGIAEVQQAAKPAQAAEMVLVRLAYAADLPTPD
FT                   EALRKLKDMPAPEASAPPSPPSGGGGGMGGGAMTAMAAGGGARLSVAARSEPAPQRVAA
FT                   EPVAVAGPQLSSLADVVALATQKRDLMLKHAVESHARLVHFEEGRIEISMAPGGDPNLV
FT                   QDLSRKLAEWTGRRWLVSLSSKQGEATIAEIARAAREEREDGIRAEPLVAAVLSQFPGA
FT                   QIVDVRIKEEVPEATLAPVEEVDSGPDADEDGLSPFD"
FT   CDS_pept        173098..174195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86141"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGW3"
FT                   /protein_id="BAF86141.1"
FT                   /translation="MVREEIFASPTLRVVRGAGDRSGPVVVTFEPYADFPSLDRAGFGA
FT                   AFFAQQGIEAFHVIPARNDWYQDADMPAALAAIRAAVGEGRRLATYGSSMGGYAAYRFS
FT                   GRLRADVVLACSPQYSVDPARVPWEKRWKRAAEGLRFPFDAEPVRREARAYLFYDPRTA
FT                   DRRHARLIGREMPVCHVRLPHAGHPCLPLLREMGLLGPTVEAVVRGTFDPQALEAEVRQ
FT                   RSDRSPRYLMHKALALPRVLRGRRVRLLDRALALAPDDPWVSLTYGWVLASHRDWDKAD
FT                   ARFRKALALSPDDPSLLYVYRRFLERAGRHAEALAVQEAIVRRFPEAIVHVAELDRVRA
FT                   QQARKGLLKRLIAALPGRGSHTARP"
FT   CDS_pept        174292..174612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="103"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86142"
FT                   /db_xref="GOA:A8IGW7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGW7"
FT                   /protein_id="BAF86142.1"
FT                   /translation="MRDLMGMMKQAKELQGRMQQVQEELENTEVDGASGGGLVTVRVSA
FT                   KGATKSVRIDPSLMKPEEVEILEDLIVAALADARAKAEKVMAEKMQELTGGLPLPPGLK
FT                   LF"
FT   CDS_pept        complement(174619..174993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="globin-like"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86143"
FT                   /db_xref="GOA:A8IGW8"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGW8"
FT                   /protein_id="BAF86143.1"
FT                   /translation="MHDHVTPQTIADLLDRFYAKARAHERLGPVFNAAVDDWPEHMATL
FT                   NAFWGSIMLASRQYKGNPLAMHRALPLTPDLFGDWLALWRQTTGEMFTPELAALFVEKA
FT                   ERIAESLKAGLFFNPAALRR"
FT   CDS_pept        complement(174993..176153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0146"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86144"
FT                   /db_xref="GOA:A8IGX2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGX2"
FT                   /protein_id="BAF86144.1"
FT                   /translation="MLETLKRLIPPIGPVSPSEQVRAACGALLGIFLTGFITRLALGSG
FT                   SAVPLLIAPMGASAVLLFAVPSSPLAQPWSILGGNLVASTVGVTATMWIPDPFLAGGVG
FT                   VGGAIALMLALRCVHPPSGAVALTAVVGGPAVTKLGYAFVLWPVMVNSLVILSVAIAYN
FT                   NLTRRRYPHLAPLKTPAPAAQEARAATFAHQDIIAALREADELIDVDPSDLEDILHRAQ
FT                   LRAFDRRSDGLTCGDIMTRHVLAVSPATPILEAMELLRSGRTKVLPVTSDKAEVIGVLT
FT                   QTDLLDKVDWDHKGPRLGFGRRVSAALRAGRAPDGTVEEIMSTPVTAVTAEMRVAALVP
FT                   LMSQSGMHHIPVVDAKGQLAGVVSQGDLIAALIQGRGEAPPAQVAS"
FT   CDS_pept        176330..176935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="AZC_0147"
FT                   /product="recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86145"
FT                   /db_xref="GOA:A8IGX4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IGX4"
FT                   /protein_id="BAF86145.1"
FT                   /translation="MSRAVAGPEIERLIQLLGRLPGLGPRSARRATLHLIKKRETLMAP
FT                   LGLALQDVLGKIVECQVCGNVDVRDPCTVCTDIHRDSSVLVVVAEVADLWALERANAIN
FT                   AKYHVLGGVLSPLDGVGPDDLNLTKLVERVGAGGVNEVILALGATVDAQTTAHYVTDLL
FT                   RETGVKVTRLAHGVPVGGELDHLDEGTLSAAIRARTAL"
FT   CDS_pept        complement(177197..177853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86146"
FT                   /db_xref="GOA:A8IGX6"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGX6"
FT                   /protein_id="BAF86146.1"
FT                   /translation="MHIEPGILSAAKVVAANAAAIATLATYAPKLVRNPVILVKTVLAA
FT                   AFFSVFMEIFHLPVGASELHFVGASAVYFIFGFVPTLFGFALGLLLQGALFEPQDLVHL
FT                   GVNSLSLMVPLIAVHETFGKRFFARDESKLPVSWAQILKFDAAYYSGVVSMVGFWLLMG
FT                   NEATPVYDWAIFAASYLPLVLCEPIFTFVALKLLGRIENNSAVRRFTVVGELATR"
FT   CDS_pept        complement(178214..180433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0149"
FT                   /product="NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86147"
FT                   /db_xref="GOA:A8IGY0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IGY0"
FT                   /protein_id="BAF86147.1"
FT                   /translation="MTANRPALPTRDKAVSDLSATEASDEHAALSQEIASHDARYYQED
FT                   APVISDADYDRLRRRYEDIEARFPALKNDDSLSRKVGAAPSAKFAKVVHQVPMLSLQNA
FT                   FSDEEVEEFVARVRRFLNLAESAELAFTAEPKIDGLSCSLRYEGGVLVRAATRGDGTQG
FT                   EDVTANVRTIAEIPHRLTGAGVPDIIDIRGEVYMGKADFLALNARQEEAGKPVFANPRN
FT                   AAAGSLRQLDPEITRSRPLRFFAYAWGQAEPGPPGASQHEVVDAFRRFGLPTNPLTIRV
FT                   TDAAGLLAHYRKIGAERASLGYDIDGVVYKVDSLALQERLGFVSRSPRWAIAHKFAAEQ
FT                   ATTVIEAIEIQVGRTGALTPVAKLTPVTVGGVVVSNATLHNEDYIRAIGGNGEEIREGI
FT                   DIRVGDTVVVQRAGDVIPQVVSVVLDKRPAGATAYQFPHHCPVCNSQAVREVDPKTGKQ
FT                   DAVRRCTGGLICPAQAVERLRHFVSRNAFDIEGLGEKQAHAFYEWKLIAEPADIFRLQA
FT                   RNEQSLSKLENREGWGRTSAQNLFAAIEARRTIALDRFIFALGIRHVGETNAKRLARHY
FT                   GSVEALRDAAIGAEMPTEMEEASEETPPTRRRKPQGNEVWQEMTDIDGIGAVVAEAVVE
FT                   FFREPHNRQVVEELLKEVTPQPLEAVASTSPVSGKTVVFTGSLERMTRDEAKAMAERLG
FT                   AKVAGSVSGKTDLLVAGPGAGSKLEKARSLGVKTITEDEWFDLVG"
FT   CDS_pept        180547..182496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86148"
FT                   /db_xref="GOA:A8IGY2"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGY2"
FT                   /protein_id="BAF86148.1"
FT                   /translation="MAGMRNTILGAACLGLAGFGGISSAAAQAASDDAALVDRGAYLAR
FT                   AADCMPCHTGDKSKPYGGGLPFKTPFGVMYSVNITSDPQYGIGSWTFDDFKAALHNGIR
FT                   KDGAYLYPAMPFDAYTGITDDDLKALWAFVRRIQPVAQPDRENELKFPFNVRLGLLAWR
FT                   ELFFTPATFKPTAGKSDSWNRGAYLVEALGHCSDCHSPRNIMGAVKSKDIFTGSEVDGF
FT                   YAPDIASAALAKNWTKDTLSQFLRTGSAPGKTSVFGPMAEVVHESLAYLTPGDIDAMVT
FT                   YLLDSPPPKDKPAPEAASPLPHDVYVRAAKSYIDNCAPCHRDGGVGAGVAVPPLAGNPA
FT                   VTAAEPYNVIMAVLGGLPAGGTYGAMPSFAGRLSDSQVADLVNYVRTSWGNGGTANATA
FT                   GMVAAWRATAHVPDYGTQVASSFDCPKVGGAPGNSGPDAKVVASLTQMIQGGSRAIDKL
FT                   ADAYTSASGDSSPNGVVDALTAAYCPVVAASQAPDWQKYGDLRRWTLQVAAAISPRLAS
FT                   GTIPDVPVIWAVPAGTGLIGREPASLAAKLACPANDGKQVPKALGDAAVALLGTPKPPV
FT                   SGDAAKTYATTLVQQNPKARRADVANALILAYCPAVAALPGTSIAEQNNLLNSFGQQVI
FT                   GTLQLLPTPTVAAK"
FT   CDS_pept        complement(182522..183283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0151"
FT                   /product="protein of unknown function"
FT                   /note="DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86149"
FT                   /db_xref="GOA:A8IGY4"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGY4"
FT                   /protein_id="BAF86149.1"
FT                   /translation="MAADAKTSPRPHAGMMPHEHAIRTTKAPMSRSTPPVPTLGAALRR
FT                   GVRLHRRLAIAVGVAIVIVLFAPMLSFRTRLLVGWDAGIALWLILTLHMVNGSNAAKIR
FT                   ARAAEEDEGAAAILIGCLLASFSSLVAVVMEAGATAHASGAAAAHILLAIGTLALSWCF
FT                   IHGIYALHYAREYYAPDVDCHPMLGFPGSQEPDAWDFMYFSFTIGTSAQTADVSVNSAR
FT                   MRRFVLGHQLVAYAFNASVLALGVNVAAGLV"
FT   CDS_pept        183296..183916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86150"
FT                   /db_xref="GOA:A8IGY8"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGY8"
FT                   /protein_id="BAF86150.1"
FT                   /translation="MRSRLRMEASMTIPNDARGGIAPGGPLLPGLSQMRHSWGWFVALG
FT                   AVFILLGFVALAHLVASTFATALYVGAMILVAGVVQVLHAFRVREWSRFAVWLVCGLLY
FT                   VVAGGLIMSEPLLAAGVITLMLGVAFVVSGVFRIAAGLGARGTDGWIFIVLSGVVTLLL
FT                   GAVIIAHWPVSSLTILGLLLGVELIVNGVATLVFGLALRGKGV"
FT   CDS_pept        183920..185131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0153"
FT                   /product="putative opgC protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86151"
FT                   /db_xref="GOA:A8IGZ0"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGZ0"
FT                   /protein_id="BAF86151.1"
FT                   /translation="MAEPRRARGEGARTGTVVRLPVRARPAPAPRDLRLDFFRGLALWL
FT                   IFLDHVPTNVLNMVTLRNFGFSDASEIFVFISGYTAAMVYGRVMHERGFVIASARALKR
FT                   AWQLYVAFVFLFVVFLAQISYVAGRFNNPLYAEETNVLRFLDEPDVTLIQALLLRFKPA
FT                   NTDILPLYILLMAALPLVLAGLLRRPNLTLGLSVALYAVTRAMGWNLPGWPEEHVWLFN
FT                   PLAWQLLFVFAGWCAIGGSERLEPVLRSRVAVVAAGLFLVVSAVVVLSWSVPALDGVVP
FT                   EELGELIYPISKTDMSLLRFFHFLALALVVVHFVPRDWRGLTSPLARPLVLCGQHSLEI
FT                   FCLGVFLSFGAHLVLVEVSGRLWVHMAVSLAGIAIMVALAAVMSWYHENEKRRGPERPP
FT                   GGPA"
FT   CDS_pept        185128..185913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86152"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGZ4"
FT                   /protein_id="BAF86152.1"
FT                   /translation="MIRRVGPWMIALALACLTPGTLAAQPAAPAASAVRACPAPDRYLT
FT                   PKVPLRRAAEAVRKGKRLRVLVFAAVRMPAITETVEAKRYPASLAAALSQRLPGVDVTV
FT                   TTRMEPRAGAGESLPLLNAALSAPVAPSGYDLVIWQLGSTDVLKGTDMSAFGTKLSSGV
FT                   QAIHARQADAIVITMQYSPRTDFMFDAGPYLQALRWTVKSEGAALFNRYDIMRYWAEEG
FT                   TFDLSDLQPGASMFEDVHRCVGDLLARFITNGMAAPETQ"
FT   CDS_pept        185918..186700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0155"
FT                   /product="putative lipolytic enzyme"
FT                   /note="G-D-S-L precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86153"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A8IGZ6"
FT                   /protein_id="BAF86153.1"
FT                   /translation="MRLMSLFRLGVLALPLTLPAVAHAETPVCSTVTSQPTLRLPRAAD
FT                   KLAKTKQLTIVVLGSSSTAGVGASGPDRTYPARLQQELAARFPGTTITVLNRGVNGEDA
FT                   PENVRRMDRDVAPAQPDVVIWQVGTNALLRQFGLGNIGETIRTGITQLRGYGAEVVLMD
FT                   PQYAPWVVADPDSKPMVKLIDDVGREMNVPVFHRFAMMQVWHDRDKISFPQMSAFDGLH
FT                   GNDFAYDCLGRSLAYSVAMGLKAPSQPAVASTAVPRPR"
FT   CDS_pept        complement(186764..187384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0156"
FT                   /product="phosphoglycerate mutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86154"
FT                   /db_xref="GOA:A8IGZ9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IGZ9"
FT                   /protein_id="BAF86154.1"
FT                   /translation="MDRLLVLVRHGQSEWNLKNLFTGWRDPNLTDQGVSEARRAGALLA
FT                   AEGLSFDVAYTSALTRAQRTCQLVLEEMGLTGLRTIADQALNERDYGDLSGLNKDDARA
FT                   KFGEEQVHVWRRSYDISPPGGESLRDTVARVLPYFVQEILPSVLRGERTLVAAHGNSLR
FT                   ALVMVLERLSPEGIMKRELATGAPILYRLGADATVSEKRDILI"
FT   CDS_pept        complement(187515..188405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0157"
FT                   /product="bacterial dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86155"
FT                   /db_xref="GOA:A8IH01"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH01"
FT                   /protein_id="BAF86155.1"
FT                   /translation="MRAGHLPRLTRRPSDRARIRFRERSDVSDLRVVINGAGGRMGQEL
FT                   LRAVLNGEGLSLAGALEHSTSGHLGEDAGVLAGLKPAGVTIESDAAATLNGTDVVIDFS
FT                   TPASSVRLAERLAEAGIAIVIGTTGFSAAENAAIEAAARRTVVVKSGNMSLGVNMLAAL
FT                   TRQAAAALGIEFDIEIVEMHHARKVDAPSGTALLLGEAAAEGRGIHLPDWTAKARDGVT
FT                   GPRRPGDIGFASLRGGSVVGEHAVIFAGPSERVELVHKAESRTIFANGALTAARWAKGR
FT                   EPGLYSMVDVLGLAG"
FT   CDS_pept        complement(188409..189044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0158"
FT                   /product="putative uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86156"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH04"
FT                   /protein_id="BAF86156.1"
FT                   /translation="MSELGTPKGYWVARVDVHDPEGYHPYTLANGPVIAAHGGRFLVRA
FT                   GNFKTMEGDSRARNVVVEFPSFDAAQAAYYDPAYQAAIDLRRPYSQADLVILEGVSEDL
FT                   PPLEPPGVPGYWIMRISLRNPQGYRAHAEMVGDRVAAFGGVPVARGGRIAIVEGTARGR
FT                   NVIIRFPDVHAAVECYHSPAYQQAIPLRQAVAETDFIIISGYDGPQPG"
FT   CDS_pept        complement(189075..189785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0159"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86157"
FT                   /db_xref="GOA:A8IH08"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH08"
FT                   /protein_id="BAF86157.1"
FT                   /translation="MTDVSPDIRDRLIVALDYPNVGAAEALVWQLGDAVSFYKVGLELT
FT                   VGGGLDLAADLIDAGKKVFLDLKMHDIGNTVEKATAAAAERGVSLLTVHAYPQTMAAAA
FT                   RGAKGSALQVLGVTVLTSYDEADLAAAGYAQGVTETVRRRAIQAQEAGIAGVICAPTDA
FT                   AMVRAATSPDFQIVTPGVRPAGSAAGDQKRFATPADAMAAGANRIVVGRPITGAADPSA
FT                   AARSILEELAKAAG"
FT   CDS_pept        complement(189787..190362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0160"
FT                   /product="putative fructose-2 6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86158"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH09"
FT                   /protein_id="BAF86158.1"
FT                   /translation="MTSFLYVSHPQVEVNPAVPVPDWGLSAVGRARAAAFAASPVLTGF
FT                   RRIISSTETKARETAAILAGALGLTVEVRDAMHENDRSATGYLPEAEFQQVANAFFAAP
FT                   DESIRGWERAIDAQSRIVAAVASALAEAPDVPTVFVGHGGVGTLLLCHHASYAISRSHD
FT                   QPPVGGGCWFRSTHTTAPDRWRPIEEAA"
FT   CDS_pept        complement(190435..191043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0161"
FT                   /product="phospholipid N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86159"
FT                   /db_xref="GOA:A8IH14"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH14"
FT                   /protein_id="BAF86159.1"
FT                   /translation="MLHTPPRREVSVKPRLNDEMRFLQSWFQNPLKTGAVSPSGRALAK
FT                   MMASYLDPAIDGPVIELGPGTGPVTRALIARGFAPERLFLIEYNPEFCALLRKRHPGVT
FT                   VIQGDAYAMYEILKDRLDAPAVGTISSLPLFTKPPQERDRMVNEAFDLSRPGAPFVQFT
FT                   YAVVSPVPLKPGEIHGERSPRVWRNLPPARVWAYRRPSA"
FT   CDS_pept        complement(191159..192157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0162"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /note="bacterial and archaeal type"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86160"
FT                   /db_xref="GOA:A8IH16"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH16"
FT                   /protein_id="BAF86160.1"
FT                   /translation="MLKFCNQFRAIALLCEHPVSCVRKPGFSILGNKERGVMPKPLRKA
FT                   ILPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAVAAGIEHIVFVTGRNKAVIED
FT                   HFDRQFELEKTLADRGKTKELAQLDRDTPKAGTTSFTRQQLPLGLGHAVWCARDLIGDE
FT                   PFALLLPDMLHLPNGNGKGCLTEMVETYNKTGGNVISVYEVPDDQTNQYGIVGLGKETS
FT                   AKAHEITQMVEKPAAGTAPSNLAISGRYILQPTIFDLLAKQEQGAGNEIQLTDSMLKLM
FT                   ERERFFSVRFDGSVYDCGSKIGFLMANVAYALSRPDIAPEFRTELGHFLGN"
FT   CDS_pept        192244..193236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0163"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86161"
FT                   /db_xref="GOA:A8IH20"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH20"
FT                   /protein_id="BAF86161.1"
FT                   /translation="MAVLVTGGAGYIGSHMVLALVDAGEPVVVLDNLSTGFRWAVHPSA
FT                   TFIEGDVADADLVARIVAEHDISAVVHFAARIVVPESVADPLGYYLANTVKTRALLDAL
FT                   VKADVPHMIFSSTAAVYGMVGNDPVAEDALLSPISPYGRSKLMSEWMLEDTAVATPLRY
FT                   VALRYFNVAGADPAGRSGQSTAGATHLIKVACETALGKRAAMSVFGTDYPTPDGTCLRD
FT                   YIHVSDLVAAHLDALNHLRRGGASGVYNCGYGRGYSVLEVIETVKAVSGVDFTVNYAPR
FT                   RPGDPAAIVAKADRIRAAIGWTPRLDDLETIVRHALDWERSLEARKSAA"
FT   CDS_pept        193410..194771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0164"
FT                   /product="lytic murein transglycosylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86162"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH23"
FT                   /protein_id="BAF86162.1"
FT                   /translation="MMAVKTTRSTRMAARTGRTTARGLAAAFAAAVSLVAVAPAGAQAQ
FT                   VTGSIFSGFQPQQPPAPERAGHPLMQPEAIAQAQANFPNCIAALQPLAQSKGVSPASFQ
FT                   RLTAGLEPDMKIMDYLDSQPEFSKTLGDYVTMLVSQTRITKGREMLEKYKPIFEKVEKA
FT                   YGVDRYVVAAIWGIETSYGDPKGIGTRSVLRSTATLACIGRRQDYFRDEFIATLQIIDR
FT                   GDVPADHMKGSWAGAFGPTQFMPTSFLRYAVDFDGDGHRNVVDSIPDVIASTANNLKLD
FT                   GWQFGQTWGYEVVLPQNFDYRYVDRTKRYSMAQWASLGIRRANGQAFPRPSDTGFLLLP
FT                   SGAKGPAFIMLPNFGAILRYNPADAYALAIGHLADRLRGGGDFVQAWPKEERALSRTER
FT                   LELQTRLSQMGYDIGNIDGILGQKTRVAVQDFQTRAGMIPDGYPNLDVLARMRQ"
FT   CDS_pept        complement(194784..196136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0165"
FT                   /product="histidine kinase A"
FT                   /note="ATP-binding region, ATPase-like histidine kinase,
FT                   HAMP region, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86163"
FT                   /db_xref="GOA:A8IH26"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH26"
FT                   /protein_id="BAF86163.1"
FT                   /translation="MTRFKLPLRLALIIAGGLVIAQMLMTAAYFTDRRLNGEGVAGSMA
FT                   TQVGALAQLLDRLPEPDRALALDAVSGPGFRARIAPQPETGETKRPPLLERVPLLERLI
FT                   RAQLGKNDPREVTVVLDTAFGGRWIPMMLSWPARELRMTVGLADGRFLLVRARGELTAR
FT                   LFGVPVGLVAGLLGIAVALATVLAVRRETRPISELSAALDRFGTSLEPQRVEPRGAPDV
FT                   RRLAETFDAMQRRIVELVRNRSLVLGAMSHDLATYVTRLRLRIALLPEGPQTARAQRDL
FT                   EEMQALLADTLDFARGSFTGRDGASTDFAALVAEECAGREAEGAPVHFSAPSVPCRVAA
FT                   APSALKRLAANLIGNAIAYGGRADVSLMRDGDAVDLVVEDRGPGVPEAERERVFEPFYR
FT                   LDASRSRETGGAGLGLTIVRQITDSIGGTVGIADRPGGGARVTARLPLVAD"
FT   CDS_pept        complement(196133..196870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0166"
FT                   /product="response regulator"
FT                   /note="consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86164"
FT                   /db_xref="GOA:A8IH29"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH29"
FT                   /protein_id="BAF86164.1"
FT                   /translation="MSQGASATTLLIVEDDREIRSLLADFLGREGYDTRLAADGRAMDA
FT                   ILAGIRPDLVILDIMLPGEDGLSLCRRLRAQGDVPVLMLTAKGDEVDRIVGLEVGADDY
FT                   LVKPFNPRELLARIRAILRRVQAAARVGEDPRRQDIAFGGLIADLDARSVRTPDGIALD
FT                   LTSAEFDLLACFLERPRRVLSRDQLLDWTRGRSADPFDRTIDVAVSRLRRRLSLVAPEA
FT                   AQLIKTVRNGGYIFALPPGGKGN"
FT   CDS_pept        197066..197362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="cysteine rich repeat"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86165"
FT                   /db_xref="GOA:A8IH31"
FT                   /db_xref="InterPro:IPR001893"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH31"
FT                   /protein_id="BAF86165.1"
FT                   /translation="MWRMKMRSNTRALRLRDLLLPAVLLVPVAVSAISAPAAAQNAQAQ
FT                   QMFQKACGSDVKKYCSDVQPGGGRIIQCIKANEASLSDTCKSALVQIKAQSGR"
FT   CDS_pept        complement(197627..201367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0168"
FT                   /product="N-methylhydantoinase"
FT                   /note="ATP-hydrolyzing 5-oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86166"
FT                   /db_xref="GOA:A8IH34"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH34"
FT                   /protein_id="BAF86166.1"
FT                   /translation="MSLLVGEASLLSSARPGGLRCAANCMPYKEQHMSSPASQTPATWE
FT                   FWIDRGGTFTDIVGKKPDGTLVAHKVLSENPEAYKDAAVHGIRELLGLPAGAPIPQRLV
FT                   SAVKMGTTVATNALLERKGDRTLLVTTSGFKDALKIGYQARPKIFAKKIVKPDMLFERV
FT                   LEVDERVRADGTVEQAPDLGAVRAGLLAAKANGIEAVAIVFMHGYRFPAHEAQVAALAR
FT                   EIGFPQVSVSHEVSPLIKLVGRGDTTVVDAYLSPILRRYVRQVADELGADNQAADAAIR
FT                   LMFMMSSGGLTAADLFQGKDALLSGPAGGVVGAAKTGEIAGLNRIIGFDMGGTSTDVCH
FT                   FDGELERAFDTEVAGVRIRAPMMQIHTVAAGGGSILHYDGARFRVGPDSAGANPGPACY
FT                   RRGGPLAVTDANVMLGKLIPDFFPKIFGPAQNEPLDAGAVRKKFEAMAAEIGDGRAPEA
FT                   VADGFVTIAVENMANAIKKISVERGYDVTRYALNCFGGAGGQHACLVADALGMTRVLIH
FT                   PFSGLLSAYGMGLADIRALRTKAVGARLESAALAAVETLRDALTAETVAELAGQGVTGT
FT                   AVTNEAKLHLRYEGTDTALPVTLADIATMTAEFEERHRSQFGFISPEKPIVVEAIEVQS
FT                   FGGGAGIAEPDRPLDTSAPREARRTRFFSRGAWHDAPVVLRADFRPGMAVQGPAIVIEP
FT                   NQTVVVEPGWRAEVTAKDHLLLARTEVLKRAGAVGTHADPVMLEVFNNLFMSIAEQMGV
FT                   TLQNTAYSVNIKERLDFSCAVFSGSGELVANAPHMPVHLGSMDRSVETVIRENAGDVKP
FT                   GDVFALNAPYNGGTHLPDITVVTPVFNADGSDLLFWVASRGHHADVGGVAPGSMSPLAT
FT                   NIEEEGVYIDNFKLVDQGRFREAELVALLSGAKYPARNPVQNVADLKAQIAANEKGVRE
FT                   LNKMIATFGLDVVKAYMGHVQDNAAESVRRVLDRLSDSEFTYEMDQGTVIKVKISVDKQ
FT                   KREATVDFTGTSPQQPNNFNAPEPVTRAAVLYVFRVMVEDEIPMNAGCLRPIRIVVPEA
FT                   SMLSPRYPAAVVAGNVETSQAVTNCLFGAMKAMGASQGTMNNLTFGNATYQYYETICSG
FT                   SPAGPGFDGTDGVHVHMTNSRLTDPEVLETRFPVLLEDFHVREGSGGKGQWNAGGGTYR
FT                   RIRFLEPMECALLSSHRRVRPFGIASGEPGAVGEGYVRRTDGTMEKLEGCAQTELAAGE
FT                   AVIIVTPTGGGYGDPALRGKA"
FT   CDS_pept        201482..202105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86167"
FT                   /db_xref="GOA:A8IH38"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH38"
FT                   /protein_id="BAF86167.1"
FT                   /translation="MAPVPQGTGTGAPCAFPIFRPGSRGMIRRLLDGLYLLSGVLAAIF
FT                   LLVIFLLMIGLSSGRDIGFDIPAGDDFASWSMVAMSFLGLAHTFKKGEMIRVGLLLERL
FT                   TGRKRQVMELFALTVGIVFLAYFTKNAIQLTYDSYRFDDMSQGVIAVPLWIPQTGYALG
FT                   ITILLIAMIDEFVHVASGHHPRYEKEPPKTPEELIERVASGGGV"
FT   CDS_pept        202102..203424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctM"
FT                   /locus_tag="AZC_0170"
FT                   /product="TRAP C4-dicarboxylate transport system permease"
FT                   /note="DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86168"
FT                   /db_xref="GOA:A8IH40"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH40"
FT                   /protein_id="BAF86168.1"
FT                   /translation="MSMVEHLGLVPLSIILLMLLVAVLASGVWIAIGLAIVGYAAMVLT
FT                   TDIPIGQVLATTVWASSASWTLAALPLFIWMGEILFRTRLSEEMFRGLAPWLQWLPGRL
FT                   LHVNIVGCGIFAAVSGSSAATCATVGKIALPELEKRGYDQQMALGTLAGSGTLGLLIPP
FT                   SIPMVVYAVTANVSVLQVFLAGFLPGLLVMGLYSGYVILWSLLNPGKTPPRDPPMSFRR
FT                   KMQESAKLIPCLLLILGVFLSLVTGLATATECAAWGVLGALALALWSRTLTWRLFIESL
FT                   MGATRLTCMIMLIIAGAAFTTAAMAYTGIPVALAEWVQGLNLTPGKLALALTVMYIILG
FT                   CLIDGISMIVLTAVIVLPMIKQAGFDLVWFGVYLVIHVEMAQITPPVGFNLFVLQNMSG
FT                   RDTWAVAKAAFPFFILLNVAVLIITAFPEIVLVVPRWVFPG"
FT   CDS_pept        203458..204447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctP"
FT                   /locus_tag="AZC_0171"
FT                   /product="TRAP dicarboxylate transporter"
FT                   /note="DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86169"
FT                   /db_xref="GOA:A8IH44"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH44"
FT                   /protein_id="BAF86169.1"
FT                   /translation="MTRLRTIAAALIAGGLAALSAGTASAQTKWNLPTGYPQDNFHTEN
FT                   IAQFAKEVDSASGGKLLITVHPGASLFKVPEIKRAVMTGQAQAGEVLMSVHENEDPIFG
FT                   IDTVPFLATSYPAAKKLWDASRPAVEKKLDSQGLKLLFAVPWPPQGLFSKTAVTKVEDL
FT                   KGVKWRAYNPGTSRIAALVGAQPVTVQQAELAQALATGVVAALITSGATGYDVKIWESV
FT                   PYFYDIQAWLPKNMVFVNKAAFEALDKPTQEAVLKAAAAAEARGWKTSEEKSTWFLKEL
FT                   AAKGMTVAPPSPELKAGFEKVGKDLTADWEKKAGENGVAIIKAYEAAK"
FT   CDS_pept        204451..205122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86170"
FT                   /db_xref="GOA:A8IH46"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH46"
FT                   /protein_id="BAF86170.1"
FT                   /translation="MARGGGHGFRPLPPCAMKRVAPASAGAPGRRGEIMTRRPADDSPS
FT                   APSGGPLATPAVGSIVSSAHLAEGGALPALSEVEFGLNMISHAYSRWMVRCMSAAGVPD
FT                   LSALDVQVLHHVVHRDRPKTIADLCLVLDVEDTHLVTYAAKKLQALGLVSGGRRGKEKT
FT                   LTATPAGKRACARYREVREALLSSAVAATGIAPEKLSEIAAVLRALSGHYDQAARSAAS
FT                   L"
FT   CDS_pept        205223..205699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0173"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86171"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH50"
FT                   /protein_id="BAF86171.1"
FT                   /translation="MQLSIRNRTTGGLSRSEVRRQMAKLVLLPRPYVSAVILALTGGVA
FT                   TAGAPALAQQAGDTGSYVDVTIETACQVLEPVIERGLAARGVKVVKAVQLCPSRTGVLV
FT                   HQPEKNMFFLRDAVRVASASGERIVPFSAEVRYTVNAQGRPDWTQVEFRCEDKR"
FT   CDS_pept        206027..207199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86172"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH51"
FT                   /protein_id="BAF86172.1"
FT                   /translation="MEDNVVGRPQDHTSALDRGTPPMTGLRLVADDLTGALDAAIAFVT
FT                   PGQHVPVYWNAPPSVAPSRLSIDSGTRETDAASARARVAALLRNITPDADTLFFAKLDS
FT                   LLRGQAAAEIAAWMEALQPRRCIIAPAFPRQGRVTRGGIQYLCRDGAERPVGADLRATL
FT                   EAEGHPVHLRRPGEAMPEGVSLWDSETDTDLAQIVAAGRPADGTTLWCGSGGLAAALTG
FT                   HPSGIDVAPRTLPRPILGLFGTNHPVTVAQLAACGDAVLALSADGPDNAAALGNKLAAD
FT                   GVALARLALPEGTPRPVAAARIAEAFSSLVAQLDPPGTLIVSGGETLRSLCAALGAERL
FT                   DLYGQIESGVPCSILRGGRFDGVHIISKSGAFGAPSLLRRLTETSEGDDA"
FT   CDS_pept        207196..208221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0175"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86173"
FT                   /db_xref="GOA:A8IH54"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH54"
FT                   /protein_id="BAF86173.1"
FT                   /translation="MTPHLAITMGDPAGIGPEIIAKACERLKDRLASGHLRLLVIGSNA
FT                   ALHGAQKALGSTVAIPEVSADDAEWPALACLQACPEGEPILPGVASVDGGRFAYHAVER
FT                   GVRLAQAGRIQGIVTGPLNKETLNRAGFHYAGHTEMLAELTGARGSVMLLAHGNMRVSH
FT                   VTTHVALKDVPKRLTPERLRYVIERTDEALRGLGLERRRIAVAALNPHAGEGGLFGTED
FT                   MDVSEPTIAKAVADGFDVVGPVPGDTVFVKLRGGQFDAVIAMYHDQGHIPVKLLGFNVN
FT                   PETGKWDALSGVNITLGLPIIRTSVDHGTAFDIAGKGIANELSLIEAIEYAEKLAASRG
FT                   A"
FT   CDS_pept        208303..209433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0176"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86174"
FT                   /db_xref="GOA:A8IH57"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH57"
FT                   /protein_id="BAF86174.1"
FT                   /translation="MTLAFSPIDLVRPPRIAFGSGTLSAVREWLAARGLKRALVVADGF
FT                   NAGRIELLGLEGAVEVFGEVKPEPDLPNLEALLAKAESFGPDVVIGFGGGSAMDLAKLA
FT                   AVLPGSGQSLHDVVGPEKVAGKRAALIQVPTTAGTGSEAGTRALVTDPVTQNKLAVQSL
FT                   HMLADLAVVDPDLTLTVPPAVTAATGVDAMAHCVEAFTSRKAHPTIDLYALEGARLVGR
FT                   FLPRAIKDGSDREARAGLALASLYGGFCLGPVNTTAGHAVAYPLGTRHHIAHGAANALI
FT                   FPHVLAFNAPAVPEKTAQVLAALGFPASSDPAVVLKATREWCAALGCEMRLSAYKVPAD
FT                   DLPIMATEAHAIRRLLDNNPRDMSREDILAIYQAAL"
FT   CDS_pept        209469..210359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0177"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86175"
FT                   /db_xref="GOA:A8IH60"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH60"
FT                   /protein_id="BAF86175.1"
FT                   /translation="MSKISGCFVAIVTPFDENENLNEQALRRQVERQVSCGNGVFCAGT
FT                   NGEFYTLSFAEKVRVAEICVEQAAGRVPVLAHIGEISTHQTIALGKEIQKLGVAAVSAI
FT                   TPSFIACSQDELIAHYRRVADALDVRLYLYNIPARTGNTLQPETVRTLASHPSIIGIKD
FT                   SEGTQASIDGFLTIARERDDFDVLVGPDSLVLHGLKNGAQGSISGLGNIAPQTLNRIWT
FT                   SFSKGDLADAEAAQERYSALRKELYAHGFPPSMVKRALRLAMPEVGASRGPALVSDAAN
FT                   DAILPISKAYAEAVG"
FT   CDS_pept        210388..211725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0178"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86176"
FT                   /db_xref="GOA:A8IH63"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH63"
FT                   /protein_id="BAF86176.1"
FT                   /translation="MNAGKTPVNQQPHPAALSGATAKPATRIRWFVVALMWLAIAINYI
FT                   DRTVLSAAAPHLSKEFNIPPDQMGLILSAFFWSYALLQIPAGWFSDRFGQKIGLGASVA
FT                   WWSIATAATGLASGFNSLFAMRVALGVGEAGAYPANAGIASKWFPDKERATVSGLFDSA
FT                   SKFGGAVAMPLIIWMIAMVDWRWTFGIIGLVGVVWSVVWWWFYTETPEQHPRISPSEVA
FT                   YIREGQTRQHGKDATLGMKWYQLLRYRNIWAMCLGFFTINYISYFFITWLPTYLVKEKG
FT                   MGMLAVGFVAALPLISGLVFEIFAGWLSDHIVKKKLLSLTATRKLFLIIGLTMALCIGL
FT                   AAFTESVVLTILLLCIAKSGTTISASQVWALPGDVAPKNMAGTVAGLQNMVSNFGGVVG
FT                   PIVTGFIVAATGSFAMALLFSAGLGLLGILNYAFLLGKVVPIESRS"
FT   CDS_pept        211749..212726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0179"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /note="NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86177"
FT                   /db_xref="GOA:A8IH65"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH65"
FT                   /protein_id="BAF86177.1"
FT                   /translation="MSFTVVSVGGPLAPEGEALIVKAGGRVVSTAPYPARADLIALLAS
FT                   EQPDAIVVRVVEKIDADVMRASPRLKLIAKHGAGTNDIDVEAAAALGLPVIAAVGANAH
FT                   SVAEHALALLLALAKDIRTQDAFVRGGGWEKRVYKGFELRGRTLGLVGLGMIGRSFAAM
FT                   VQPLGMTVFGYDPFAAPEAFGPHVERVADLDDMLGRCDVISLHCPLTPQTEGLINARAL
FT                   GLMKPGSLLINTARGEVVDEEALVAALKNGPLGGAGLDSFAHEPPSPTHPLWSLPNVIL
FT                   SPHIGGVTEDARRQVSTMTATNVAALMTGETISPRFYVKPKPKA"
FT   CDS_pept        complement(213011..213448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0180"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86178"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH67"
FT                   /protein_id="BAF86178.1"
FT                   /translation="MRDTGVNSLSREDVLKYSQTVCDGLRDDDDGVRREVLAHAGNRWS
FT                   LGVIHTLGVYGQLRHAEIARRMHGVTQRMLTRTLRHLERDGLVIRHDFEETVPHVEYAL
FT                   SETGLELLVRMVPLWTWIVENADSFRAARAAFDRTHGTDKT"
FT   CDS_pept        213518..214474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0181"
FT                   /product="putative isoflavone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86179"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH69"
FT                   /protein_id="BAF86179.1"
FT                   /translation="MNDAVSTVKSRNILVLGAGELGMPVLRNLARRAKTIDGAKISVLL
FT                   RQSAVASGDPAKQRDISEIRGSGIEIVLGDLVSNSIDQLAALFSCYDTVIGCAGYAAGI
FT                   NTPMKLAKAALRSGIPRYFPWQFGVDFEAIGRGGPQDIFDAQLDVRELLRSQDKTEWVI
FT                   ISTGMFMSYLFEPEFGVVDLENSEVHALGSLDTAVTLTTPDDIGVLTAEIVFFEPTIRN
FT                   EIVFLAGDTVTYAQVADKLEAALARPFKRSVWSVPFLMEQLARDPKNMMRKYRAAFAIG
FT                   RGVSWDKAGTFNDRQCIPVTDVSALIDSGLRIGRRSE"
FT   CDS_pept        complement(214996..217191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0182"
FT                   /product="putative outer membrane receptor protein"
FT                   /note="mostly Fe transport"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86180"
FT                   /db_xref="GOA:A8IH71"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH71"
FT                   /protein_id="BAF86180.1"
FT                   /translation="MAMIRSATARGLLRQASLPAFLLAQAALASSVHAQTSGGPAPSAS
FT                   TQTIVNGDTEILLTTLTVQAEDQGGQTHGYQPLSSSSATLTEMPILDIPQAVNVVTNEV
FT                   IVDQAAHSLDDVLANVSNVTIANTLGATQDAVTRRGFGDNRDGSILTNGMRTVLPRSFN
FT                   LTTDRVEVLKGPASTLYGIQEPGGVINLITKTPQQTFGGSLSATASSFGGGYTDLDITG
FT                   PIAGTNLAYRFMAEYQDEDYWRSYGTTRQTILAPSLAWYGDKTTVTLAYNHRDYTEPFD
FT                   RGTIFNLTTGQAVNVPRRTRFDEPYNITQGASDLFQANAVHQLNDSWKLKLNYSYSRDV
FT                   YSDNQARVVSYNASTGALTRRSDATQDSTQYDHNLRADLSGTVNLAGFKNEVLFGASYN
FT                   YYDVLRTDMMRCANRTGFNIYNPVYGQLASCTTVSAADSDQSAQQSVYNAYAQDAFYLT
FT                   DQWILVAGASLQYYEQTAGKGRPFNLNTSADGGEFMPRAGLVYKATDWLSFYVNYATGF
FT                   VPQVSIASYIGTLPPETSVSYEGGLKFEIMKGLTGTAAVFDIEKKNVLYSELVDGESVA
FT                   RTAGKVRSRGFEFDVAGALTDRTNIIASYGYADVTVLQDPQYAGNTLANSAATTYSLFA
FT                   TYDFGRIWGDNSLKVGGGLNGRSRAAGDAANSFWLPGYTVFDAFAAYTIGSAKPITVQL
FT                   NVKNIFNTTYYTSTQGSNLGVAVGDPLQALLSARLAF"
FT   CDS_pept        217580..218509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="AZC_0183"
FT                   /product="putative ferric enterobactin transport
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86181"
FT                   /db_xref="GOA:A8IH74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH74"
FT                   /protein_id="BAF86181.1"
FT                   /translation="MSYWPLRPIRRRSARKAGSGGAAGMRSVGVETAVGAAGAEGEPGD
FT                   DGLRTRCLQVAYGRRLVIDGVSLSVPSGRLTALIGPNGSGKSTLLGAMARLLAPRAGAV
FT                   LLDGRSVHHMPTRALARALGILPQSPVVPESLTAYELVSRGRYPHQGALKRWSESDEQA
FT                   VVRAMRLTGTLDFADVPVDRLSGGQRQRCWIAMTMAQETPVILLDEPTTFLDLRYQVEV
FT                   LELLRTLAHAHGRTVVAVLHDLNLALAYADCVVCLKEGRIHAVAQEGEPLTSETVREVY
FT                   GLAVTRVSHPITGAPVFLPLPSTVGGAP"
FT   CDS_pept        218506..219558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0184"
FT                   /product="putative iron compound permease protein of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86182"
FT                   /db_xref="GOA:A8IH76"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH76"
FT                   /protein_id="BAF86182.1"
FT                   /translation="MTLVLSAPRLAQPLRLAGLVGVVALLFVVSLLHLGFGARPIAPRV
FT                   VLEAFLAFDPASFDHRVVRDLRLPRLCAGLMVGAALGVCGALLQAVTRNPLGEPHVLGL
FT                   NAGATFAVVTTLTLGPWLGRAGVPVPAPATLLAARPLVAALGAGVMFAAVMTIGAAGRL
FT                   GATPLKMTLCGVALSGFAAALTSAQLILDDQTLATLRLWLAGDLSGVSRTAVWGVLPWF
FT                   AAGLGLAFALSGRLNVLGLGDDVARGLGVNLTRTRGAALVAAGVLCGAAVSLAGPVGFV
FT                   GLLVPHVARTLFSRDHRLLLPLCAMLGASLLLAADLAARALAAPREFATGVVTALIGVP
FT                   VFLLLAARSR"
FT   CDS_pept        219555..220598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0185"
FT                   /product="putative ABC-type Fe3+-siderophore transport
FT                   system"
FT                   /note="permease component"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86183"
FT                   /db_xref="GOA:A8IH79"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH79"
FT                   /protein_id="BAF86183.1"
FT                   /translation="MMVGLAGYRHVRLGPLAVRVRPRAVSVGLGLLLLLLATAAFALAR
FT                   GSLVLPTREVIAVLLGQDAPKAVLHIVADVRLPRVLLALLAGGMLGLAGATMQSLTRNG
FT                   LADPGLIGVKEGASIGVLAVLFFAPDVDPAWRPLAGLAGGLVTALIVCALARDLSGLRF
FT                   VLLGIGMSWLLSAGLLVFLTTADVNDVETALVWLAGSLHGAAWPTLPGAALWEGVGLVV
FT                   LAATARGADASLLGRGAAIGLGVRPGMLDTVRLAVAVLMTAAAVSAVGSLGFVGLMAPH
FT                   AARLLLGGGQAGLLAGSALVGALMVLAADTLGRLAFAPLQIPAGIVMAVCGVPVFLFML
FT                   WLRRDRL"
FT   CDS_pept        220613..221587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0186"
FT                   /product="putative ABC transporter iron compound-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86184"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH81"
FT                   /protein_id="BAF86184.1"
FT                   /translation="MLAIFLRRALAPCVLAALMLTGAIADAGAQTRAFSDDLGRTVQVP
FT                   VHPLRIVSLHDLDITLPLIELGAPPVASHGRVAPDGSRFLRAGKLLAGVDFDSGGIAFI
FT                   GANAIDLEAVAAAKPDLIITLTTRDTPVAQLERIAPTVSLDHLKGGPEGLYGKLAELTG
FT                   TKPRLAQLEARYRAQIAQLRAVVDTGKVTVATLQANQGKITVFHTDRALGRVLRDAGFR
FT                   FPALLNSIPEGGRLDVSAERLPDLDADLVFDTFRSDRGGGPAEEWAAMETVFPGFCDVL
FT                   LACRGGRFLLLPRDETISNTYAALSLLVPVVQAQALRLRPAWR"
FT   CDS_pept        221684..222574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0187"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86185"
FT                   /db_xref="GOA:A8IH84"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH84"
FT                   /protein_id="BAF86185.1"
FT                   /translation="MSTPSGNRKVKVDRLGERLRTRGASLSPSLKAVADYIDENRRLVL
FT                   SKSALDIAAETGTSDATVIRAIQALGFSGLRELKRTLSAHLGGVIPSVDKMSSTTEQLQ
FT                   RSVDTSIDFVRDGHLAGIEKITAPENRVAMAAAVELLRGAQGIGLFGIGASAILADYAA
FT                   RLLIRNGRHAYALNRTGIGLGEQLLAMRRGDVLIMMGQSSAHREGTAALEEARRLGVRM
FT                   ILLTGAAAPAFGKQADVIIRVPRGRSELVPLHGLVLMALEMLVIGLAAVEPERSTQSLE
FT                   RLHTLYEDIRKPPRG"
FT   CDS_pept        223492..225831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86186"
FT                   /db_xref="InterPro:IPR024501"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH86"
FT                   /protein_id="BAF86186.1"
FT                   /translation="MAGESATPAPLQPGTWGQPGHQAAPWSGVFAEAWSRAFTGTAPLP
FT                   PGIGTLPAGPLVDYLVDAAQRSVLFIDLMRRRGNEQQDITSRPMATVLSFDHDVLVSGR
FT                   ALPRPINYFLSRIVPPPGAKVDPDKRPVVVVDPRAGQGPGIGGFKTQSEIGEALANGHP
FT                   VYFIGFSAQPEPGQTFLDVVEGQVSFFERIVAMHPDAPRPFAIGNCQAGYQTLMVAMLR
FT                   PDLFGPCMVAGSPMSYWQGVHGKNPMRYSGGLLGGSWLTALVSDLGRGKFDGTWLILNF
FT                   DSLNPANWLWGKQYDLYAAVDTEAQRYLGFEKWWGDFITLNGDEIQFLVDELFIGDGLT
FT                   RNEMRSSDGTVFDLRNIASPLIVFTSLGDNISPPPQTLGWILDLYKDVDAIHAEGRTIV
FT                   YCLNQTVGHLAIFVSAKVGAKEDEEMVRLMDLIDCLPPGLYELVISPASEEEVKAGGHP
FT                   WHSRFEARSLEDIRAFGRNSVEDDRAFAAVRRVSEINLSLYRTFLQPAVRALANPHMAE
FT                   LLFATNPLRLSYSLFADSNPFMKPVAKAAAEVTAARKPVPPDNPFLAVQKLWSDQISAG
FT                   LDAFRDLRDRAVEQAFFGIYGSPVLQGMLGLNLDEKVRELPPTSPQKRAFLTQKMAEFR
FT                   DRVDEGGFNEALVRSVLFVIAADRQLDERCAAALKETCLRLTQLSISDFKSLVRRQFYI
FT                   LLLEGIAAVEAIATLVPDGAARQSLLNDAAAVAGANGTLTIGEQQNIEKLAEVLGVAAP
FT                   HSPAPVLPADTHRSAPSTLQIAPAGA"
FT   CDS_pept        225969..227330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0189"
FT                   /product="phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86187"
FT                   /db_xref="GOA:A8IH87"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH87"
FT                   /protein_id="BAF86187.1"
FT                   /translation="MPIITNRAFEDIRPGDAASVSRTLTPGDLRAWATAFGDAGLVAGI
FT                   GPGQAATGIASSLFAALAGSALPGPGAIIRSAAVTVHGPLPADHLLNVDLTVREARAAD
FT                   KVLILDARLADRDGVAIATGVLEVAAPQASVRVEIPEHRLDCLLDQCRTLEPMPTAVVH
FT                   PLSLDALAGAIDAAAAGLIVPVLYGPESGIRSLAETGKFDLSGCRIIATSGEEDSAARA
FT                   AAAAGAGEVQALMKGSLHTDVLLHAVMQKEAGLRTGRLLSHCALIAMPTYARRVVVTDA
FT                   ALNIAPDTDQKRDICQNAIGFARALGVAVPKVAVLAAVEMVRTKMTATLDGAILAKMAD
FT                   RRQIVGGIVDGPLDLDAAVDAEAARVKHIVSPVAGAADVLLAPNIEAGNMVYKNVSFMA
FT                   DAQTAGLVVGARVPVMLTSRADTAAARLFSAATAALYADALAREPEAILPATAD"
FT   CDS_pept        227370..228551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0190"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86188"
FT                   /db_xref="GOA:A8IH90"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH90"
FT                   /protein_id="BAF86188.1"
FT                   /translation="MTDAVLVVNSGSTSLKFAAYAAGADAVPPLLCRGVVDSMTSDPHF
FT                   IAKAPDGTPIDAHEWGEGQNLGHGRALSFIIQWLEQHEANIKVVAAGHRVVLGGTRFEG
FT                   PVRITPEVLDYLDGLSAMEPSHQAYNVRGARELAQDFPGLPQVAMFDTSFHRSMPEVAQ
FT                   VYALPAELRDTGVRHWGYHGISYDYISRQVPKYVPDARRVIVAHLGGGASMCAMLDGRS
FT                   METTMAFAGLTGLPMATRSGDVPADVLFYLLKTQGHDVASLEKLLYGKSGLLGLSGVTG
FT                   DMRQLQDSKDPAAVLAVDAFVYAMTKFTGAYAAVLGGLDALVFTAGIGENSPIVRAALC
FT                   ARLEWLGVKLDPAANTANGPRISATDSRVGVFVIPTNEELMIAQHTLALLQTA"
FT   CDS_pept        228599..231274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0191"
FT                   /product="plasma membrane-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86189"
FT                   /db_xref="GOA:A8IH94"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH94"
FT                   /protein_id="BAF86189.1"
FT                   /translation="MRVTLFTMTRRVRRRSGEIGVRGLAMSQSVAAAPAISGRTPPAKA
FT                   KPADGGSSRLDADAIAAKFAELSSSPQGLSSADAARLHQTYGPNTIAAHEESRWSKLLG
FT                   YFWGPIPWMIEAAALLSLIRLDWPDFIVVMGLLLYNAVVGFWQDSKAASALAALKKGLA
FT                   LKARVLRDGNWITVDTSDLVPGDVVSISGGETLPADLILTEGKYLSVDQAALTGESLPV
FT                   SKSVGDSGYSGSIVRQGAMTALITATGNATFFGRTAKLVASAGAKSHAEKAVIQMGDFL
FT                   IILSAALALLLVVAQVHRDIVAEGHWEWAHAGAIVQLVLVLLVASVPVATPAVMSVTMA
FT                   LGALALSKQQAIVSRLSAIEELAGVDVLCSDKTGTLTMNQLTLQPPIPWGSAAPDELIL
FT                   GAALASQKQSADAIDKAVLAGLKDPKVLDQYRQVDFTPFDPVSKKTAAAVAGPDGKTVH
FT                   YAKGAPQVIAALCGLGPDGGNAYFDAVAKLAHDGTRALGVARSDDGTHWTLLGLLPMLD
FT                   PPRPDAAATIAHAQKLGIAVKMVTGDDVAIGSEISRQLGLGDHLLVAGEVFGEDANPEH
FT                   IAIDAVRAVEVADGFGRVFPAHKFEIVKALQEGGHIVAMTGDGVNDAPALKQADCGVAV
FT                   SGATDAARSAAALILTAPGLSTIIAAIMEARAIFERITSYIYYRIAMTLNIMLVVVLTY
FT                   LVYNFMPLTAIMIVVMALLDDIPIMTIAYDNVKVQDRPVRWNMHRIISFSTVMGIMALV
FT                   QSFGIVMLGMFWMKSPGLTAILPMDQAHVQTMLFLQLAAGGHLLFFVSRVQGTLFKPPY
FT                   PSLPVMGAVMGTQVFAIFMCAFGWFMPALPWLLIGIVWVYCLVWTLIMDLVKLLYFHMV
FT                   DRRDRQRSIIDSSIGPAMPH"
FT   CDS_pept        232529..235405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0192"
FT                   /product="cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86190"
FT                   /db_xref="GOA:A8IH96"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH96"
FT                   /protein_id="BAF86190.1"
FT                   /translation="MTGLQQRRPSSAGPPRRPPFLQETLHDAPAHHGCASVFRSEAACS
FT                   HDTRQETEQMNTVVKPASLKAERLDSRKLSMRAVVEARNDVDMTLANMNARLDGLTFAE
FT                   AERRLAASGPNEVARDRRPPAVIQFLLAFKNPFIAVLILLAAINSVTDIILPLRKGEDP
FT                   DYTTVTIILTMVMLSALLRFWQEYRSGNAADALKAMVRTTATVIRRASPTSGPEIREIP
FT                   MAQIVTGDIIRLSAGDMIPADIRLVESRDLFVSQAALTGEALPVEKYDTLGAVAKKSAG
FT                   AAAGEQTGLLDLPSICFMGTNVVSGTATAVVVATGTHTYFGSLAKTIVGSRAETAFDRG
FT                   VNSVSWLLIRFMLVMAPVVFLINGLTKGDWMEAFLFALAVAVGLTPEMLPMIVSSNLAK
FT                   GAVAMARHKVVVKRLNAIQNFGAMDVLCTDKTGTLTQDKIILEHHVDIEGKPDDDVLRF
FT                   AWLNSHHQSGVRNLMDQAVVHFAERAPEVLHSVMSYGKVEELPFDFVRRRLSVILEDRW
FT                   GRQLLICKGSVEEMLAISTRVRDGETTRVLAEPERDRLLALARAYNADGFRVLVVATRE
FT                   IPDGASKSHYTIDDERDLVVQGFLTFLDPPKETAGPALAALAAHGVTVKVLTGDNEVVT
FT                   AKICREVGLDPGLPLLGREIEQLDDAALRLAVEQRTIFAKLTPLQKSRVLTALQANGHT
FT                   VGFLGDGINDAPALRDADVGISVDSGTDIAKESADIILLEKSLMVLEEGVVRGRETFGN
FT                   IIKYLNMTASSNFGNVFSVLVASAFLPFLPMLAIHLLIQNLMYDISQLSLPWDRMDEEF
FT                   LRKPRKWDARNIGRFMIWMGPTSSIFDITTFALMWFVFAANTPEQQSLFQSGWFIEGLL
FT                   SQTLVVHMLRTQKIPFIQTRAALPVMLMTGLVCALGIYIPFSPLGAMVGLQPLPWQYFP
FT                   WLAATLLSYCLLAQGMKTFYIRRFRQWL"
FT   CDS_pept        235606..236682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0193"
FT                   /product="putative sensor nodulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86191"
FT                   /db_xref="GOA:A8IH99"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8IH99"
FT                   /protein_id="BAF86191.1"
FT                   /translation="MLGATLSRTVSVSRSWVVLAMLIALMTAIFVVDTVTNYAVAAAVL
FT                   YTAVQLIATRFLSVRTVIILTGASIVLTLLSFELTRSGAYEVGVVNTAISVVVIGVTAY
FT                   LGLKLKSAQQSADETRERLLRMARLMTLSQLTTSIAHEVSQPLAGIATSASASRRWLTQ
FT                   QPPNVERALAAIERVASDACRANDVLARVRGMARREATSKASFDFNEAVREVLDLAGGD
FT                   MLRTGAQVSLSLAENLPAAFADRVQIQQVIGNLVLNAMEAVSALPNRLPRLTISTALEP
FT                   AGMISFSISDNGPGVSPDTAQHLFDAFWTTKEQGFGLGLTICQTIVEANGGRIWMLPAP
FT                   PEAGATFVFNLPTAGSAA"
FT   CDS_pept        236679..237323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0194"
FT                   /product="nodulation protein W, DNA-binding response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86192"
FT                   /db_xref="GOA:A8IHA1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8IHA1"
FT                   /protein_id="BAF86192.1"
FT                   /translation="MTSSNDPKPVVYIVDDDHSVRAALQDLFASVTLDAMAFSSIREFL
FT                   EHPRTAGPACLVLDVRMPAQSGMDFYLQMDSLGLRMPVIFITGHGDIAMGVRAIKDGAV
FT                   DFLTKPFRDHDLLDAVHTAIARDQQRLHQEEILSELQRRWESLNTGERDVLRLVVRGLL
FT                   NKQIAAELSVKEITVKVRRARVMQKMRAASFADLVRMADQLELGAETRRNS"
FT   CDS_pept        complement(237509..238828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86193"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8IHA4"
FT                   /protein_id="BAF86193.1"
FT                   /translation="MSVEKIDTLVIGAGQAGLAMSAHLNRAGVPHLVLERARIAERWRS
FT                   ERWDSLVANGPAWHDRFPDLQFSDVDTAVRPDDFPHKETVADYFVAFAQKIAAPVRCGV
FT                   DVLKVERLEGRTGFRVETSLGTIEAQRVVAATGPFQRPSIPALVPEDAPLRQMHSTAYR
FT                   NPDQLPDGAVLVVGAGSSGVQIAEELMRAGRTVYLSVGPHDRPPRAYRGRDFCWWLGVL
FT                   GKWDAAAQEPGKEHVTIAVSGARGGHTIDFRRLASEGMVLVGRTESFKDGVLSFAPDLA
FT                   ENLDNGDANYRALLDEADAYVARNGLDLPEEPEARIRVPDAACITDPLATLDLKAAGVG
FT                   TIIWATGFVSDYSWMKVNAFDANGRPRHQRGVSTEAGVYFLGLPWQSRRGSSFIWGVWH
FT                   DAKYIADQIVIQRSYIAYHAAAGAAPDATAPHAIAEVAPA"
FT   CDS_pept        complement(239006..240178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0196"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems"
FT                   /note="periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86194"
FT                   /db_xref="GOA:A8IHA6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8IHA6"
FT                   /protein_id="BAF86194.1"
FT                   /translation="MLPEEKKTMAPISGAPRALSRRRLSLGAVALAATALLGFGAPAKA
FT                   QETVKLGFIGPLSGGNAQQGLAARNGFQLAVDQANAAGLPFKIEPVILDDAANPQTGVS
FT                   AALKLTNDPKVVAATGHWNSGVALATIPVFSRAGVPFVIWGAISPKITEKNNPMVSRVV
FT                   TTLVNTNAPLAKWAAANIGKRIAIVSDTSDYGAANLDNFKKFFEADGGTIIAAESAPVG
FT                   TTDFRALLTKIKAANPDAIYFGGVVAEAGLVRQQMAQLGMTQPMIGVDGFYDQEFIKIA
FT                   GPAATGTIVGIAKEVGNPKLDAMTEAYKGANFAEPVGSYTKNAYDATNIIIEALKTAGT
FT                   KDKAAIAKAIRAIDYDGAMGRTSFDENGQTKRAVVLELREVKDGAWVTRP"
FT   CDS_pept        240486..241436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0197"
FT                   /product="putative inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86195"
FT                   /db_xref="GOA:A8IHA9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8IHA9"
FT                   /protein_id="BAF86195.1"
FT                   /translation="MPRAASPKGGAMDDIVFQQIVNWITLGSIYALIALGFSLLFGVLN
FT                   IIHFSHGDVSLLAPFLALAAVSAVGSALGDAASPAVFLLALAIAIGLTGVIGVLLDIVV
FT                   IQRFRKAPAMMALVATVALGIVLRELIRHLFPNGSNPHAFPRLVSGDITLGRFNVPVFS
FT                   LMVVAVSVACVCALFLMLNGTRLGLHIKAVSQDRDAARLMAIDPGRIFRATFFVASAIG
FT                   AVGGLFFSSYAGMARFDFSVDVGLIGFSAAVVGGLGSMPGAIIGSLLIAGLDTLVQAVV
FT                   PNGASYRLVFVFLLVIAVLVFRPSGLMGRTLVEKV"
FT   CDS_pept        241433..242611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0198"
FT                   /product="ABC branched chain amino acid family transporter"
FT                   /note="inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86196"
FT                   /db_xref="GOA:A8IHB1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8IHB1"
FT                   /protein_id="BAF86196.1"
FT                   /translation="MMTDSLAMRRSASARVGDALTVVAVELVGALYLRQFLLTDDWRLV
FT                   IALLAAFAGALVLMERQPALEARIEGAFAAQSRLAMLLGIAIVLAFPFALEGNTYALHL
FT                   CVISMLYAVLALALNFQLGSANIPNFATGASYGIGAYASALLALNFGVSFWLALPAAAI
FT                   VATVFGFLLGIPSMRTRDSYLALVTIAFGVVVNQLLNNLDFTGGPNGLVGIPVPELFGH
FT                   SFASPLVILGAELPPQANFYYLSALLVLVSILFAERLHDSRVGLAWNALRADELAARCQ
FT                   GINVTWYKVLAFAVDAFLAGFAGTIYAFYVGFISPDNFTFLVSVTIMTMVIAGGMDNIL
FT                   GVIVGAFLLTLLPEKLRAFSDYRILFFGVTVIAFLMIRPQGLFPQRLRRYGD"
FT   CDS_pept        242615..243427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0199"
FT                   /product="ABC branched-chain amino acid transporter"
FT                   /note="ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86197"
FT                   /db_xref="GOA:A8IHB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A8IHB4"
FT                   /protein_id="BAF86197.1"
FT                   /translation="MGFDASSPVVLEGENLTMRFGGIVAMAQVEFSLRRGEILGIIGPN
FT                   GAGKSTLLNIITGIYIPSSGEVRLEGQKLNGVPAHRIVARGIARTFQSSRLFGDLSVLD
FT                   NVIIGRHTHTKSGVFDAIFRRGKAKAELATSAAHAERLLKSVSRSLYDQRHRPAGELAQ
FT                   ADRRRLEIARALATEPKVLLLDEPSSGMDDADTDALMDDIRSVCAEQPDLALMIIEHDM
FT                   RLVASLPHRVMVLDYGQKLADGPYEEIRKIPRVQEAYLGRKAGQHAGA"
FT   CDS_pept        243459..244112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0200"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86198"
FT                   /db_xref="GOA:A8IHB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IHB5"
FT                   /protein_id="BAF86198.1"
FT                   /translation="MLRDVSFSVKAGELVCILGPNGAGKTTTFRAISGLLPLSAGRVRI
FT                   MGQDLATLRTEALSALGIGFVPEGRRLFAEISVRDNIRLGFEAQKGQGRFADRLEQMLD
FT                   LFPRVRERINQRAGTLSGGEQAMVALARALIGAPKLVVMDEPSLGLSPKLIDEYFDTVA
FT                   EINRRGTTVLLIEQNAETALSIAHRGIMLVKGRVVASGDAATLLSNDAVRHLYL"
FT   CDS_pept        244109..245257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0201"
FT                   /product="acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86199"
FT                   /db_xref="GOA:A8IHB7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8IHB7"
FT                   /protein_id="BAF86199.1"
FT                   /translation="MSTLDLLDRLIAFPTVSRDPNRELIAFVQAFLGQHGIASEIIATP
FT                   DGRKANLFATIGPTDRPGIMLSGHTDVVPVEGQAWTADPFRLRVADGRAYGRGAADMKG
FT                   FLAAALALAARAAARPLETPLHLALSHDEEVGCVGVRSLIERLSTASVRPRLCIIGEPT
FT                   SLRVATGHKGKLAARATCCGVEGHSALAPKALNAIHLACDFVGLLRTHQDRIAESGARD
FT                   ADYDIPYTTLHAGVIAGGTALNIVPNRCTVDFEIRNIAQDDASEVLTRLLDDAARLVAE
FT                   RRAAFPAADIAVEVVNDYPGLATPKEAEVVAFVQALVDDASTFKVAFGTEGGLFDARLS
FT                   IPTVICGPGSMDQGHKPDEFIALDQLEACDRMMDRLLHRLAA"
FT   CDS_pept        245340..245753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0202"
FT                   /product="L-PSP endoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86200"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8IHC0"
FT                   /protein_id="BAF86200.1"
FT                   /translation="MIHRRIRPFNTAKTYPEQRLDNDLAQAVVARGTTIFLRGQCPQDL
FT                   DTAEDVGIGDPVAQTHKVMQNIRQLVEESGGTMEHVCKLVVYLTDVRHREAVYRTMGEY
FT                   IRGVHPVCTGLVVVALARPSWLVEIDATAVIPD"
FT   CDS_pept        245764..246438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0203"
FT                   /product="protein of unknown function"
FT                   /note="DUF1028"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86201"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIW1"
FT                   /protein_id="BAF86201.1"
FT                   /translation="MTFSIAARCARTGRFGVAISSSSPAVAARCAHVRAGVGAVCSQNV
FT                   TDPRLGPAALDLMALGASATGAVEALAGSRPYMAFRQVTAVDAKGRVAVFSGDKALGTV
FT                   AVAEGTDCVAAGNLLATDRVPAAMVAAFEAAPGDLGDRLIAALTAGLREGGEAGPVHSA
FT                   GLLMAGEEAWPVADLRVDWDETRPIAALADLWQLWKPQMEAYVQRALVPDAAPSFGVPG
FT                   DA"
FT   CDS_pept        246528..247478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0204"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86202"
FT                   /db_xref="GOA:A8IIW2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIW2"
FT                   /protein_id="BAF86202.1"
FT                   /translation="MRYTLRQLEYFIAAGETGSITLASERISISQPSISTAISHLEQEL
FT                   GVQLFVRHHAQGLSLTPVGRKLLAEAKHLIEQAEGLYAVASEATDQVRGQLSVGCMVTL
FT                   APMILPELSHGFTTAYPGAQIRHVEANQERLLDGLRRAEIDIAVTYDLQIPDGVTFTPL
FT                   ASLPPHVVVSEAHPFARLSAVSLKDLADEPLILLDLPISSEYFLALFLQEGIQPRIHSR
FT                   SAYQEVVRTMVANGYGYTLANVRPRSDIALDGRRVVRVRIAGEHRPMVVGTATVSQFKK
FT                   SRLLQSFEAHCRSFISDAYIPGMVAPAIDRRTRRT"
FT   CDS_pept        complement(247502..247981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0205"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86203"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIW3"
FT                   /protein_id="BAF86203.1"
FT                   /translation="MAGNAQIDKYAPFGKYPCMTTDRPETDEPQVGTCTPTLPGFTCGL
FT                   DATLRVIAGKWKPLILYFLAQGGPTRYGELRRAVRDVSDKMLIQQLKELEADQLVKRTD
FT                   YKEVPPRVDYALTPLGQSLAQALVPLCQWGTENMEDVTRVYAERASWGARTSRAT"
FT   CDS_pept        248012..248746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0206"
FT                   /product="glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86204"
FT                   /db_xref="GOA:A8IIW5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIW5"
FT                   /protein_id="BAF86204.1"
FT                   /translation="MDRLKGKTAVVTGGGSGIGLGAARRFVEEGAFVYLFGRRADVLEA
FT                   AAKELGSSARAVPGSVTDLADLDRLYAAVKSERGGLDIVFANAGTGNFAALGAITPDQY
FT                   EQTFDVNVKGVLFTVQKALPLMRAGGSIILTGSTTGTMGTPQFSIYSASKAAVRNFARS
FT                   WAEDLRGTGIRVNVLSPGPTLTDLALEVVGKEAFEALGATTPLGRIGDPSETGAVAAFL
FT                   ASSDSSFMTGGEVFVDGGFAQV"
FT   CDS_pept        complement(248789..249175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marR"
FT                   /locus_tag="AZC_0207"
FT                   /product="putative transcriptional regulator"
FT                   /note="MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86205"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIW6"
FT                   /protein_id="BAF86205.1"
FT                   /translation="MAKVRHSRIDCSPGCAVEAAVGLIEGKWKSVILFHLLAGTLRFNE
FT                   IRRHVQNVTPRTLTNQLRELEEDGLITRKVYAQVPPKVEYSLSPLGRSMEPVLLALKTW
FT                   GDANIGLYGKPLAAEGAPLSPPAP"
FT   CDS_pept        249289..250308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0208"
FT                   /product="putative zinc-dependent alcohol dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86206"
FT                   /db_xref="GOA:A8IIW7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIW7"
FT                   /protein_id="BAF86206.1"
FT                   /translation="MSMKAIGYRQSGPIDRDDALVDIEIDRPAARGRDLLVEVAAISVN
FT                   PVDTKVRKRAAPPEGEWKILGWDAVGRVVEVGEGVTRFRPGDEVYYAGSLTRPGANSAF
FT                   HLVDERIVGRKPATLSNPEAAALPLTAITAWEMLFDRLDIVKSVPGAANAILIVGGAGG
FT                   VGSIAIQLVRALTDLTVIATASRPETQDWVRALGAHHVVDHSAPIAAQVAALGLGAPAF
FT                   VFSTTETHRHLAEIAELIAPQGRFGLIDDPDGLDVSVFKRKSVSTHWEFMFTRSMFETA
FT                   DMDAQGRLLDEVARLVEAGKVRTTLTQTLRPISAATLKTAHAILESGKARGKIVVEGF"
FT   CDS_pept        250467..251234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0209"
FT                   /product="isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86207"
FT                   /db_xref="GOA:A8IIW9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIW9"
FT                   /protein_id="BAF86207.1"
FT                   /translation="MRLTRRARFDPPLQGTSMDPTFTGPYADTATPVLPRTEMTLDLAR
FT                   TALVVIDPQIDVMSPKGLAWPAVGESVTETNIVANLVTLFRAAKAAGITVAVSPHYYYC
FT                   WDHHWRWQSPLEKFQHDVGAFDRKGPYTLDGFRASGADFMEEFKPYIEDGKTIICAPHK
FT                   LYGPQTNDLKLQLGKQGIRQVIVAGMLANMCVESHMRDLLEAGYEVAVVRDAVAAPKLP
FT                   DGDGYLAALINYRFMANGLWTTQETVARLTPAG"
FT   CDS_pept        251352..251561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0210"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86208"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIX0"
FT                   /protein_id="BAF86208.1"
FT                   /translation="MTVHFAGEQPTVPQAAAWSAATLGAGEAYEAACLAQAAGISREEA
FT                   MGLVRRHGTHRATLMAAARRLKRG"
FT   CDS_pept        complement(251571..252689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0211"
FT                   /product="choloylglycine hydrolase family protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86209"
FT                   /db_xref="GOA:A8IIX2"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIX2"
FT                   /protein_id="BAF86209.1"
FT                   /translation="MRTRRNPMLRTLTTALSLAAMMNAALACTAVDIVAADRTVIAGRT
FT                   MEWAFDMKWTLVSRPKGFPVKLTAPKALNLPERTVEAKYALVGVSANIIPGGALVEGQN
FT                   AAGLGMSGNFLPGFTTYQTVTPQDKNYVEVLSFGAWALGNFATIAEVKEALKTTKVWSD
FT                   PSAASGPTAPLMHFVFTDRAGASIIVEYVEGELHIHDNVAHVLTNAPTYDWHLTNLRNY
FT                   LNLSTVGVEQRQIGNVDVTALGQGGGLVGLPGDYTPPSRFVRASALRHGMTPPKDGAEA
FT                   VQAVVHVLNTVDIPVGVAQSRLPNGQLVSDYTQWVSIKDLTNNRLQIADYAHRTSYLTI
FT                   DLAPLFALDKPAERLITDLPYPAGVGADVLKP"
FT   CDS_pept        253122..255080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86210"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIX4"
FT                   /protein_id="BAF86210.1"
FT                   /translation="MEDGFFSKNIRAHDSENALEICQYLLASGRADLFRGQTFDWARLI
FT                   PSLFRLTEEKRKFAYEELRLFSEWANGVPQMRNYHGNDDAITAIAQHYGIATSFLDVTT
FT                   DPRVALAFAKSERAASDDDAVIYCFLEGALRHIEGIKIVKISVENLWRLEVQSGLFLDY
FT                   ITDSIVDAVKSMAIKIHFPRALRSAAETRRLYPLRKSALESVLDQWFYKRQIEGALDQF
FT                   VPHVKNQVVVRRQTYPGIFRWREIPELTPEWLSKDLRWVQPPIESVRITGRPLDLKIRL
FT                   QVSDPLRDAKNLRELILPAICEAFAAGRLLSFDFELSGVGKRYSKRISQIANWVWDGIR
FT                   VLPYKISELASAMANMLTILSHVSKRTKHSSNLAQILFGETDIIEVAPVGGHIEAGFVS
FT                   KSDLDVARNYAGGRGFTKYSLKMLTESPDILNDFITDPWLLFDFLKFKRIFIEQFVPTA
FT                   IIGFWENWVDDKDEISKLRWSVPFNPALLGYVSRFQYRFSSPLAAERDVSRLVLINNDM
FT                   DKDDISESFLFCMPHIMGGGGPFLLKLHGYGHDARPIWEIPDAVQRAVWIFDIGGISVL
FT                   EVSSSLNSASTDDEIHADGLGAFEVWLIAKGLMEEVNGKSLGEIRPIYESFWRDLSVSN
FT                   KKMEKYYKEALGREMGR"
FT   CDS_pept        255364..256974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0213"
FT                   /product="peptide chain release factor 3"
FT                   /note="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86211"
FT                   /db_xref="GOA:A8IIX6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIX6"
FT                   /protein_id="BAF86211.1"
FT                   /translation="MLDQTPEAPASAGGQPDFTRRRTFAIISHPDAGKTTLTEKLLLAS
FT                   GAIRQAGQVKARGERRRTRSDWMEIEQQRGISVTSSVMTFERDGIVFNLLDTPGHSDFS
FT                   EDTYRTLSAVDAAVMVIDVAKGIESQTRKLFEVCRLRDIPIFTFINKVDREGQDPLGLM
FT                   DDIAATLALDLTPFTWPIGLGTDFRGLIDVPGKRALLAEERGGPLTRIVPYEDPIDLLG
FT                   LEGVEARIVEEAVESLSLALGVLPPFELESFREGHLSPVFYGSAIKEAGVAQLLAGLGG
FT                   FGPSPLPRNANGRTVEPAEANVSGFVFKVQANMDPNHRDRVAFVRLCSGVFKRGMKLFN
FT                   AREKRHMAIANPIFFFAQERETVDEAVAGDIIGIPNHGMLRVGDTLSEGETIRFEGIPD
FT                   FAPEILRRVLLADPMKSKQLQKALHDLAEEGVTQVLRPLTDPAPIVGVVGTLQLDVLSS
FT                   RLDKEYGVPIRYESVSFVTARWITGDRAEVDRFAETSRSSIALDRDDQPVYLARSQWVL
FT                   DRAIEEWPKLKFVAVKERG"
FT   CDS_pept        257064..257930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0214"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86212"
FT                   /db_xref="GOA:A8IIX7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIX7"
FT                   /protein_id="BAF86212.1"
FT                   /translation="MSIELGRAQDPALQKIITDAFEARAEIGFSTAGQIREAVNEALAL
FT                   LDSGAARVAEPAADGSWQVNQWLKKAVLLSFRLNDMDLIPGGPGGAAWWDKVPSKFAKW
FT                   GASEFRAAGFRAVPGAIVRQSAYIAPNVVLMPSFVNLGAHVGEGTMVDTWATVGSCAQI
FT                   GKRVHLSGGVGIGGVLEPLQAGPVIIEDDCFIGARSEVVEGVVVRKGSVLSMGVFISAS
FT                   TKIIDRTTGEVFIGEVPAYSVVVPGSMPGKPLPDGTPGPSLYCAVIVKRVDEKTRAKTS
FT                   INDLLRD"
FT   tRNA            258233..258322
FT                   /gene="trnS"
FT                   /locus_tag="AZC_trnS01"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:258267..258269,aa:Ser,seq:gga)"
FT                   /note="codon recognized: TCC"
FT   CDS_pept        258473..258643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0215"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86213"
FT                   /db_xref="GOA:A8I0R5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="UniProtKB/TrEMBL:A8I0R5"
FT                   /protein_id="BAF86213.1"
FT                   /translation="MAQKKHKPEEIVAKLRQVDVLVSQARPVAEAIRAIGVTAFTYYRW
FT                   RKEFGGLRATR"
FT   CDS_pept        258640..258750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0216"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86214"
FT                   /db_xref="UniProtKB/TrEMBL:A8I0R9"
FT                   /protein_id="BAF86214.1"
FT                   /translation="MKRLKDLEKENERLRKAVSDLTLEKLILKEAASGNF"
FT   CDS_pept        258786..259619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0217"
FT                   /product="integrase"
FT                   /note="catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86215"
FT                   /db_xref="GOA:A8I0S2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8I0S2"
FT                   /protein_id="BAF86215.1"
FT                   /translation="MAKLGVSERLACRVLGQHRSTQRKVPVGRADEAGLTADIIELATR
FT                   YGRYGYRRITALLQASGWVVNVKRVERIWRREGLKVPSKQPKKGRLWFNGGSCLRLRPE
FT                   HPNHVWSYDFVEDRTHNGRKFRMLNVIDEFTRECLAIRIDRKLNSTAVIDVLTDLFVLR
FT                   GVPSHIRSDNGPEFIAKAVRDWITAVGARTAFIAPGSPWENGYCESFNSKLRDELLDGE
FT                   IFYSLAEARIVIEDWRRHYNTERPHSALGYKPPAPAVIVPQVPPTSNAPNRPTMH"
FT   tRNA            complement(260230..260304)
FT                   /gene="trnG"
FT                   /locus_tag="AZC_trnG02"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:260270..260272,aa:Gly,seq:ccc)"
FT                   /note="codon recognized: GGG"
FT   CDS_pept        260628..262496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0218"
FT                   /product="aminopeptidase P"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86216"
FT                   /db_xref="GOA:A8IIY5"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIY5"
FT                   /protein_id="BAF86216.1"
FT                   /translation="MSDPAFPASSAHAPRFHARFQSFEETADGSAGPGRLAALRAELAR
FT                   RGIGGYVVPRADAHQNEYVAPGEERLAWLTGFTGSAGLLIVLPEVAALFVDGRYTLQAA
FT                   AQVDTGAFTVVPLAETSPERWLEANLPVGLSLGFDPWRTTLDGRDRFARAVANAKGVLV
FT                   SVAEDPVARLWTDRPEPPRAPLRLLDAALAGEETPSKLARVREALGKDRLDGALISDPH
FT                   ATAWLFNVRGGDVAHTPLPLAWSLVPAEGRPQLFLSPAKLSHEVRAVLSDVADVRHEDD
FT                   LEAALTDFAAGRTVRLDQATAPVHLAEVVERAGGKVAKGADPVSALKARKNAAEIAGMR
FT                   AAHLRDGVALTRFLHWFDGAAASGTLTEIDAVEALETFRRETGQLTDVSFPTISGAGPN
FT                   GAIVHYRVTRATNRTLQPGELFLLDSGAQYPDGTTDVTRTLAVGTPTADMRAHFTLVLK
FT                   GHIALSRAIFPKGTTGAQLDTLARQFLWAAGLDFEHGTGHGVGAGLSVHEGPARISKLG
FT                   HVALEEGMILSNEPGYYRPGAYGIRIENLILVEPRAIAGAEKSFFGFETLTLAPIDRRL
FT                   IDTDLLTAEEIAWMDAYHARVAREVGPALDGDEQAWLAAATAPLKS"
FT   CDS_pept        262604..262756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86217"
FT                   /db_xref="GOA:A8IIY6"
FT                   /db_xref="InterPro:IPR021738"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIY6"
FT                   /protein_id="BAF86217.1"
FT                   /translation="MSTILIIILVLILVGALPTWGYSSSWGYGPGGIVGVLLIVVIVLA
FT                   LTGRI"
FT   CDS_pept        263212..265023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86218"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIY9"
FT                   /protein_id="BAF86218.1"
FT                   /translation="MDAILDTPPPGEEDGEAARVRAALARVLASDEFSSSPRLADFLRF
FT                   VVEAKLGGRAEEIKGYTIAVEALGRPASFDPQSDPIVRVEATRLRRALERHYSGAGVDD
FT                   EMEIVIPKGSYVPHFRPRGAAAEVLPEETQRPTGEDAIPVVAPQVAGSGLRRWGVPAVV
FT                   LVFLVMLGTLGVRAVSGAWPFASLFAQAEGPRDLADRLGMPIIDVRPFETVGSRAPTQA
FT                   ETHAIEARLRDAFARFDFVDVMEPGQEASVRECRDPPPRSVFALSGLAEGREDGTFSLL
FT                   VRLSDRCEGTIVWSADFEGLRRGSDMPATEQRVVRDIAVALMQSYGVLPTRARSQARAD
FT                   ASPSGFGCIAQVYSLSRGSEAETPQGVRECLAREARQHTGFGLAHAVTAQIALDEIRRN
FT                   PAAPADPDMLAQMLRNAELAADLAPTSAYASKVLAKVDYMRGERDAALAAAERALALNP
FT                   LDYDVAADVGMVRIGLGQPEQGEALLNFARAHGALRTPMQDAFIAISAFLREDAHAAAG
FT                   VLAPLQLHPSPQTRIGLALALKALGRTEQEHEVVMALVRETPDGAAGVRRVVHTMLPYA
FT                   DTAEPVLSELEQAGLGPRAVSAGSTRG"
FT   CDS_pept        complement(265162..266469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="AZC_0221"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86219"
FT                   /db_xref="GOA:A8IIZ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IIZ0"
FT                   /protein_id="BAF86219.1"
FT                   /translation="MSDFSPREIVSELDRHIVGQGKAKRAVAIALRNRWRRQQLQGHMR
FT                   EEVLPKNILMIGPTGVGKTEISRRLARLAGAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   EVGIGLVREQKRKDVQARAHLAAEERVLDALVGANSSSTTRDAFRKKLRAGELDEKEVE
FT                   IEVQAGAQGMPMFEIPGMPGAQMGAVSLGDMLGKAFGGRTKARRVLVKDAHPLLLTEEA
FT                   DKLIDQEATTQEAIYAVENNGIVFLDEIDKIAQREGRSGADVSREGVQRDLLPLIEGTT
FT                   VSTKHGPVKTDHILFIASGAFHVSKPSDLLPELQGRLPIRVELEALTRADFVRILTETE
FT                   ASLVKQSVALMGTEGVTLDISPDAVEAIADVAVEVNSTVENIGARRLQTVMERVLDELS
FT                   FTAPDRSGETVSIDAAYVRERVADLAKNADLSRFIL"
FT   CDS_pept        complement(266559..267152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0222"
FT                   /product="ATP-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86220"
FT                   /db_xref="GOA:A8IIZ3"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIZ3"
FT                   /protein_id="BAF86220.1"
FT                   /translation="MHRRRKVLSKAPSAEPYMHSPDTIYGTTIVTVRKGNRVAIAGDGQ
FT                   VTLGQTVLKANARKVRRLGKGDVIGGFAGATADAFTLFERLEAKLEQYPGQLQRAAVEL
FT                   AKDWRTDRYLRRLEAMMIVADANVSLVLTGTGDVLEPEAGVAGIGSGGMYALAAARALL
FT                   DREDAPEAIVRRSLEIAADICVYTNRNIIVETIG"
FT   CDS_pept        complement(267171..267617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0223"
FT                   /product="protein of unknown function"
FT                   /note="DUF985"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86221"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIZ4"
FT                   /protein_id="BAF86221.1"
FT                   /translation="MMSDLSHLSAAEIIAKLDLKPHPEGGHYRETFRDMAPEGTRAAST
FT                   AIYFLLQAGERSHWHRVDASETWHYYAGAPLSLHLAPEGEATRTLTLGTDLTAGQEPQG
FT                   VVPPFVWQAAESLGAWTLVGCTVAPAFLFSGFQLAPPDWKPDWA"
FT   CDS_pept        complement(267618..268391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0224"
FT                   /product="glyoxalase II"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86222"
FT                   /db_xref="GOA:A8IIZ7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIZ7"
FT                   /protein_id="BAF86222.1"
FT                   /translation="MPLDIRVIPCLSDNYAVLLHDPLTEATAVVDAPEPGPIMDALELE
FT                   GWDLTHILITHHHADHVDGVLALKAQYGATVVGPKAEAATIPALDVEVVDADPVGLGSA
FT                   IGRVIETPGHTAGHISFVFPEEKLLFAGDTLFVMGCGRALECDPPVLWHSLQRLRTLPD
FT                   DFSLYCGHEYTVANGRFALSVDPDNGALRARVADAEAARREGKPTIPALLGDERLTNPF
FT                   LRADDPDMAERLGLAGADPAAVFTELRARKNVFRG"
FT   CDS_pept        268547..269293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86223"
FT                   /db_xref="GOA:A8IIZ8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIZ8"
FT                   /protein_id="BAF86223.1"
FT                   /translation="MFLDVVDLRSFYAQPLGLVTRRLIARSIRARFPDVTGLSILGLGY
FT                   ATPYLGVFREEAERCIAVMPAAQGVVRWPSTAPTLAALSDELELPLPTSSMDRVIAVHL
FT                   LEMTPNAADVLREVWRVLAPGGRLLAIVPNRRSVWARLDTTPFGNGSPFSRGQVVRLLR
FT                   EALFTPVGWGEALYVPPVSSKWLLRTAIAWERAGGRLSLPFAGVHVVEATKQLYRPAPV
FT                   KRVRLAPALEPGLVPVAVPGGYGRTG"
FT   CDS_pept        complement(269301..269984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetR"
FT                   /locus_tag="AZC_0226"
FT                   /product="putative transcriptional regulator"
FT                   /note="TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86224"
FT                   /db_xref="GOA:A8IIZ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8IIZ9"
FT                   /protein_id="BAF86224.1"
FT                   /translation="MRTYSDIRRACQVHIRTVCILSEGDMASGRRAQMMEETRAKLIGA
FT                   ARKAFAEKGYAAASMDELTAEVGLTRGALYHNFGDKKGLLQAVIDQMDAEMLVRMQAAQ
FT                   QSAPSPWLAFEAEGVAYIEMSLEPEIQRIMLLDGPAVLGDPSQWPNQTACLRRTTATIE
FT                   TLIAAGTIRPMDAEAAARLVNGAALNAALWIAAADDPHAVLKKAVEAFRYLVSGLRTPA
FT                   GAGTT"
FT   CDS_pept        270093..270491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0227"
FT                   /product="putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86225"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="InterPro:IPR038743"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ02"
FT                   /protein_id="BAF86225.1"
FT                   /translation="MRTSEALFPAGRQALYEINRYSAAIRSGDLLFVSGQVGSRSDGSP
FT                   EPEFEAQVQRAFDNLAAVLKAAACTFDDIVDVTTFHTDPERQFEAVTAVRTKAFPQAPY
FT                   PNWTAVGVTWLAGFDFEIKVIARVPQAA"
FT   CDS_pept        complement(270526..271176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="AZC_0228"
FT                   /product="methionine biosynthesis MetW protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86226"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ03"
FT                   /protein_id="BAF86226.1"
FT                   /translation="MAYRDRTLDESAVRSQGGRVDLVVVAEMVAPGSRVLDVGSGDGEL
FT                   LDLLATTRGCDARGIELSREGVNAGVARGLAIVQGDADVDLAHYPDDSFDYVILSQTIQ
FT                   ATRRPRWVLEQMLRIGRHAIVSFPNFGHWRSRFDLLVYGRMPVTDNMPYAWYETPNIHF
FT                   CTIRDFVALAETLDARMEQAVALDSSGHRVRVNMPWWVWNLLGEQAVFLLSRK"
FT   CDS_pept        complement(271180..272391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0229"
FT                   /product="homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86227"
FT                   /db_xref="GOA:A8IJ06"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ06"
FT                   /protein_id="BAF86227.1"
FT                   /translation="MGETVKIETGRQTAEDVKARREADEPHSPLVRFGADKPLRLDAGV
FT                   ELRGLQVAYQTYGEPNADRSNAILVCHALTGDQHVANVNPVTGKPGWWETMVGPGKPID
FT                   TERFFVICANVLGGCMGTTGPSSTNPATGRAYGLEMPVVTIRDMVNAQAMLLDHLGIER
FT                   LFCVAGGSMGGMQVLQWAASYPERVFCALPIATAARHSAQNIAFGEVGRQAVMADPDWR
FT                   GGDYLNQGVAPHRGLSVARMAAHITYMSDQALHRKFGRRLQNRVLPTFGFDADFQVESY
FT                   LRHQGESFVQRFDANSYLYVTRAMDYFDLAADYDGVLANAFRSSKTRFCVVSFTSDWLF
FT                   TTQDSRAIVHALNASGASVSYAEIESDKGHDAFLLEEPELFDISRGFLDSAARAAGLPP
FT                   ARTR"
FT   CDS_pept        272764..276420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0230"
FT                   /product="helicase"
FT                   /note="C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86228"
FT                   /db_xref="GOA:A8IJ07"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ07"
FT                   /protein_id="BAF86228.1"
FT                   /translation="MIRMLPCRMSSSRLAGASGRRRALPTNGAGHALFLPKFGNRPRGT
FT                   QNRARSGAALRFGRALFASCSWGLRRLSRFGTGRAEGNETGTVRLVRFGRPSFRPCSGH
FT                   SGGSTGRVAFASRYGTELSPELPDPADRMDDVTKLAVLPPSIRARGVTAVLGPTNTGKT
FT                   HLAIERMLGHESGLIGLPLRLLAREVYQRVVERVGAKNVALITGEEKIKPKNPRYWVAT
FT                   VEAMPRDVDVAFVAIDEVQLATDLDRGHVFTNRLLNRRGRFETMLLGSATMRPLIQKLM
FT                   PGVTMVERPRLSTLMFAGEKKISRLPRRSAIVAFSAEEVYSIAEFIRRQRGGAAVVMGA
FT                   LSPRTRNAQVELYQNGDVDYLIATDAIGMGLNLDVDHVAFASDRKFDGWQFRRLNPMEM
FT                   AQIAGRAGRAMRDGTFGTTGRCPPLDQELVERLEAHDFENARVLQWRNAVPDYRTIRTL
FT                   TDSLALPPREEGLTRAPTGDDVQVLEIMSRDADVTARVTSPAVVERLWDVCQVPDYRKV
FT                   SPGAHAELISTLFQYVGTGGRIPDDWFARQIALTDRAEGDIDTLSSRIAQVRTLTFVAN
FT                   RPDWLGDPEHWQGVTRGVEDKLSDALHERLAQRFVDRRTSMLMRRLRENTMLETEISKT
FT                   GDVTVEGHVIGHLQGFQFAPDPTAGGEEAKALRAAAQKALAGEIETRANRLSQAVDEAF
FT                   VLSHDGTVRWTGEPVAKLIPGDEVLKPRFKIIADEHLTGPARDQVEARLTLWVNAHIEK
FT                   LLGSLNKLATAEDITGIARGIAFQIVESLGVLERTKVAEEMKTLDQTARATLRGYGVRF
FT                   GAHHIYLPALLKPAPRTLAAQLYALKHGGLQQKGLDELPHLAASGRTSIPVDHEIQKGL
FT                   YRAVGFRVCGERAVRVDILERLADLIRPALAWRPNSPGPKPPGAVDGRGFTVTVGMTSL
FT                   AGCSGEDFASILKSLGYRMERRAAPPPEADTAAVTEAAPAPEAAEPLTPAPEGAIEADL
FT                   LFEASEAPAPVEAHEDASHEDAPHEEHDALVEEVAEAAETEAVIAESADPTAAESAEEV
FT                   GAVEAPAAGDATPAEAAEAVAGEANPEEPALIEVWRPGRPPGAPRREGAPGQKREGRGD
FT                   NRGGERRDGRPGGQRRNGPPGDRPGQGHRPPRPEGEGEAAAQGERQGNRPPRSERFRVP
FT                   QGDAPRGPRPERHGGGAPQQQDRRREKQADPDSPFAALAALKARLEAEKKGK"
FT   CDS_pept        276448..276729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0231"
FT                   /product="RNA-binding S4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86229"
FT                   /db_xref="GOA:A8IJ10"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ10"
FT                   /protein_id="BAF86229.1"
FT                   /translation="MAADEDRQRLDRWLWHARVVRTRAAAADLVRSGHVRLDGQRVTGA
FT                   AHPVKLGQVLTVSLNAGVRVLRVRGFAERRGDATSVADLLDDITDESR"
FT   CDS_pept        276807..277142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0232"
FT                   /product="ferredoxin II"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86230"
FT                   /db_xref="GOA:A8IJ11"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ11"
FT                   /protein_id="BAF86230.1"
FT                   /translation="MAYVVTENCILCKYTDCVAVCPVDCFYEGENMLVIHPDECIDCGV
FT                   CEPECPAEAIKPDTEPGLEKWLSLNAEYAKTWPNITLKRDALPDAKEWDGKPGKEDKFS
FT                   AEPGTGD"
FT   CDS_pept        complement(277210..277704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86231"
FT                   /db_xref="GOA:A8IJ14"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ14"
FT                   /protein_id="BAF86231.1"
FT                   /translation="MSGAPICLRPCPCAATLTLLNGSDKGGCRMSRTFSLAGMVSAVVV
FT                   AGLVTPAQALLPPKYYDQARRQAANIIVLEVAAVAEPAEPFGTCAVSGHVRKVERGKLY
FT                   APGAAVTVGVPCRKPGAQPPLGGTIYADVGALRAATYGRAYLDARGNLLLSQYQMLATA
FT                   P"
FT   CDS_pept        277799..279394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0234"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="C-terminal:siroheme synthase, N- terminal"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86232"
FT                   /db_xref="GOA:A8IJ15"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ15"
FT                   /protein_id="BAF86232.1"
FT                   /translation="MSSPGVDATLGKRSVGEDNLRSRGADRGDADPMSAERTPSETGRA
FT                   PRQREGGRMEKLARLPVFFALQGRRVLVAGGREPAVWKAELLSAAGARVEVIAPDVCEE
FT                   MWHLAAAAPGGPIAIHKRRWSPDDLPGAAIAIADAEDEAEAEAFAAAARAVGVPVNVVD
FT                   KPAFCDFAFGAIVNRSPLVVGISTDGAAPVFGQAIRAKIEALLPQGFKAWAQAAQSWRS
FT                   AVSALGLSFQGRRRFWESFAARAMAEPNRPPEDADRDALLAVAEAGQALPEVGSVVLVG
FT                   AGPGDPELLTLKAVRALQSADVVLYDDLVSDAVLDFARREAKKMLVGKTGYGPSCKQDD
FT                   INALMVQLAREGRRVVRLKGGEPMIFGRAGEEISACRAAGVRVEVVPGISAPQGAASRL
FT                   VASLTHRDHARRLQFVTAHARDGKLPRDLDFKALSDKAATTVVYMPRRTLPDLVAELAA
FT                   AGVDLATPAVAVFSVTRADEQMVWSPLGSLVTAVAAAVDEGAAGPCIVLYGHALSAAEG
FT                   AEALLDPAPRTAQI"
FT   CDS_pept        279463..280275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0235"
FT                   /product="putative molybdenum cofactor biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86233"
FT                   /db_xref="GOA:A8IJ18"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ18"
FT                   /protein_id="BAF86233.1"
FT                   /translation="MAFSADEIERYARHIVLHDVGGPGQQKLKAAKVLVVGAGGLGAPA
FT                   LLYLAAAGVGRLIIVDDDAVSLSNLQRQVIHRTADIGRPKTDSAKEAVEALNPHVEVET
FT                   HAVRLTPANALDLISRADVVLDGSDNFATRYLVSDACVLAKKTLVTAALGTFDATLTTI
FT                   SAHETGPDGTPNPTYRCLFPEPPPPGTVAPCAEAGVLGALAGIAGSMAALEAIRAIVGF
FT                   GEGLVGKLLMMDARSMRFETLSYGWDEDNPLTGTGARITDLSAHEKAA"
FT   CDS_pept        complement(280301..281308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0236"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86234"
FT                   /db_xref="GOA:A8IJ21"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ21"
FT                   /protein_id="BAF86234.1"
FT                   /translation="MEMARRKPLVVVTRKLPDVVETRMRELFDAELNVDDVPMDQAALV
FT                   EAVKRADVLVPTLTDRIDTAVLSQAGENLRLIASFSNGVDHIDVATALARGITVTNTPG
FT                   VLTEDTADFTMALILALPRRVTEGAQVLTGDQDDWAGWSPTWMLGRRIWGKRLGIIGMG
FT                   RIGQAVARRAKAFGLQIHYHNRRRLPGAIEDALEATYWDSLDQMLARMDIVSVNCPHTP
FT                   ATFHLLSARRLKLLKREAYVVNTARGEIIDENALARMLEADELGGAGLDVFEQEPAVNP
FT                   KLVRLARQGKVVLMPHMGSATLEGRIDMGEKVIVNIRTFMDGHRPPDRVLPSML"
FT   CDS_pept        281546..282145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0237"
FT                   /product="protein of unknown function"
FT                   /note="DUF1058"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86235"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ22"
FT                   /protein_id="BAF86235.1"
FT                   /translation="MVLGHLSSPDRLRRAKGRADMRITWRHLSQARRALMALLMVTMLP
FT                   GMALAADDDKGAGTGLPVPRFVSLKADRVNVRNGPNRDQDVAWIFTRAGLPVEITAEFE
FT                   TWRRIRDADGAEGWVYHSMLSGRRTALVAPWSKDTTITLRDKPDANARAVARLEANVLG
FT                   TIKSCDGKWCRILGDGFDGYVEQNKLWGVYPNEKVD"
FT   CDS_pept        complement(282284..282757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0238"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86236"
FT                   /db_xref="GOA:A8IJ25"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ25"
FT                   /protein_id="BAF86236.1"
FT                   /translation="MDDQDSNDFLAENAAQIVSAFVAHNSISAAELPNLIQTVHATLAA
FT                   LTGQKPVEAAPKQLVPAVSVKRSITPDYIICLEDGLKFKSLKRHLMSKYGLTPDEYRKK
FT                   WDLPYDYPMVAPNYALTRSAMAKEIGLGRAKSTPAKAPEAKDAPARKPRAKKA"
FT   CDS_pept        complement(282911..283672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0239"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86237"
FT                   /db_xref="GOA:A8IJ26"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ26"
FT                   /protein_id="BAF86237.1"
FT                   /translation="MNLNAIRAIYVFEMARTRRTLLQSIVSPVLSTSLYFVVFGSAIGG
FT                   HMGEIGAVSYGSFIVPGLIMLSILTQSISNASFAIYFPRFVGTIYEILSAPISAVEIVV
FT                   GYVGAAATKSVILGLITLGTAALFVEVRIEHPFWMLGFLVLTAITFSLFGFVIGIWADS
FT                   FEKLQMIPLLIVTPLTFLGGSFYSIDMLPPFWRNLSLFNPVVYLVSCFRWSFYGNADVH
FT                   VGISVAMTFMFLGFCLLAVGWIFKTGYRLKT"
FT   CDS_pept        complement(283763..284683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0240"
FT                   /product="ABC-type multidrug transport system"
FT                   /note="ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86238"
FT                   /db_xref="GOA:A8IJ29"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ29"
FT                   /protein_id="BAF86238.1"
FT                   /translation="MQPILSLRGVSKTYASGHSALKNVSLDIRKGEIFALLGPNGAGKT
FT                   TLISIICGLVRASSGSIEAAGHDIVSGYRAARSLIGLVPQELTTDAFETVTATVRLSRG
FT                   LFGKKPDPALIERLLKDLSLWDKRDAKIMTLSGGMKRRVMIAKALSHEPQILFLDEPTA
FT                   GVDVELRRDMWRLIRDLREAGVTIILTTHYIEEAEEMADRIGVIRAGELILVERKEDLM
FT                   RKLGRKELTLHLPAPLAAVPPALAAHPVTLAPDGLSLTYTYDAAAGPEAIAAFLKEVAA
FT                   ADVAFSDLETRQTSLEEIFVSLVHA"
FT   CDS_pept        284995..285465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="AZC_0241"
FT                   /product="transcriptional regulator"
FT                   /note="AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86239"
FT                   /db_xref="GOA:A8IJ30"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ30"
FT                   /protein_id="BAF86239.1"
FT                   /translation="MALLDAIDRKILSILQQDCRITMQELADRVGLSASPCHRRVRLLE
FT                   ERGVITRHVALVDQAAVGLPVSVFISIKLERQKEEDLDRFARSISTWPEVLECYLMTGP
FT                   RDYLLRVVVPDLAAYETFLKTKLTRLDGVASIESSFALGQVKYSIALPVAAS"
FT   CDS_pept        285496..286344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0242"
FT                   /product="extracellular solute-binding protein"
FT                   /note="family 3 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86240"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ33"
FT                   /protein_id="BAF86240.1"
FT                   /translation="MSRSGRRRIGGPADPEESFMDRRSILSLLCVSAMLGLAAPAAHAE
FT                   DALEAIQSRKAVRIAVPTDYPPYGFVGPDLKPQGLDIDMAELIGKKMGVKVELVPVSSA
FT                   NRIPYLQTGKVDLVISTLGKNAEREKVLDFSSAYAPFYQAVFGGKSVPVKAPGDMAGHS
FT                   VAVTRGAMEDQELEKVTPPGVTVKRYEDNAATAAAYVAGQTELVAISSAAAGTIMMKNP
FT                   QTNTEFKFLIKESPCFIGIAKGEDTLKAKVNAIIAEAKKDGTIDAMSKKWLGREAGDLP
FT                   L"
FT   CDS_pept        complement(286399..287016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0243"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86241"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ35"
FT                   /protein_id="BAF86241.1"
FT                   /translation="MTRTDTLSFVHRFEPATVPGRAPLLLLHGTGGDETDLLPLGRAVA
FT                   PGAALLSPRGQVLEGGMPRFFRRLAEGVFDEADVRRRADDLAAFITEARAAYGLPAPIA
FT                   LGFSNGANIAAAVMQLHPGVLAGGVLLRAMVPLQEAPVADLSGTRILMVSGAMDPIVPE
FT                   ANARTLAATFAGMKADVRHEVLPVGHGLSQADLTLAQRWLGQ"
FT   CDS_pept        complement(287073..288095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0244"
FT                   /product="dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86242"
FT                   /db_xref="GOA:A8IJ37"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ37"
FT                   /protein_id="BAF86242.1"
FT                   /translation="MPWRRGRSALSVEPSQPLIRRFQTPSTEVTTMSHGIHHITAIAGP
FT                   AQRNLDFYTRVLGLRLVKKTVNFDDPGTYHFYFGDEAGAPGTILTFFPWAHVAPGRLGL
FT                   GETEETVFRIPEGAVGYWLHRLIENGIAHQPPEERFGDKVISFKDVDGMRLALVGVPGI
FT                   EAEPAWTGSDVPAEMAIRGFHSAKLLIEDTARTGAILTDVLGFKEVARAGSLVRYQAPG
FT                   TTIGGIVDLHGAGGFLPARLGGGSVHHIAFRAKDDAEEMEMVKKLAENHGIRATEQKDR
FT                   NYFRSVYFREPGHVLFEIATDIPGFAVDEPASSLGQALKLPSFLEPRRAAIEDVLPVLA
FT                   "
FT   CDS_pept        288138..288725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0245"
FT                   /product="DoxD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86243"
FT                   /db_xref="GOA:A8IJ39"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ39"
FT                   /protein_id="BAF86243.1"
FT                   /translation="MPCVCGEPIVCPSPEPWRSQTEAAQGRTALRRAAPAAFRASRGPH
FT                   GWRLPMLDLRTAAYGATALRITLGLMFISHAYLKFAIFTVPGFEGYLAAQGLPTFLAWP
FT                   IVLGEFIGGTAILVGFYGRVVSLALIPLLVGALMVHAPNGWVFNVAGGGWEYPAFLAMA
FT                   AFAQGLLGDGAFALKSVTLSELIGTKATPRAA"
FT   CDS_pept        288774..289805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0246"
FT                   /product="transcriptional regulator"
FT                   /note="LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86244"
FT                   /db_xref="GOA:A8IJ41"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ41"
FT                   /protein_id="BAF86244.1"
FT                   /translation="MPFPSGAGLWFLRRVWCGGMRVAEPFKNLAWDDFRLIKAVADARS
FT                   LPAAAVQMGVNHSTVFRRLKQIEEALGVALFVRHRTGYALTPAGEEVVALAERVDADIT
FT                   SVTRKIAGRELAPAGELRVTTNDSLLVHLLMPMLARFREACPSVRLDVVLGNQALNLSK
FT                   RDADVAIRASDTPPDNLVGRRVARIGWALYGLARRFPSADAIAQMDPAAEDWVSLGDGF
FT                   GGMKVVKDTLARIPPERIAYRVNTVFGLAEAIEAGLGIGYAPCFIADPRPALVRLAPPE
FT                   PAYAADLWLLTHPDLRHAARVRVFLDFMAGEIARYRVFLEGAAEGGDAVAEQALASEEA
FT                   GEG"
FT   CDS_pept        complement(290060..290761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0247"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86245"
FT                   /db_xref="GOA:A8IJ44"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ44"
FT                   /protein_id="BAF86245.1"
FT                   /translation="MIDLHYWPTPNGHKITLFLEETGLPYTIHPVNISAGDQFKPDFLK
FT                   IAPNNRMPAIVDHDPPGGGAPVSVFESGAILLYLAEKTGQFLPKDVRGRYQVLQWLFWQ
FT                   MGGLGPMAGQNHHFVQYAPEKIPYAMERYVKETNRLYGVLNRRLEGRDFIDDEGYSIAD
FT                   MAAYPWIVPHERQQQKLEDFPNLKRWFEAIKARPATERAYEKGKQVNTTPTVNENSRSV
FT                   LFGQTAANVKA"
FT   CDS_pept        290949..291422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86246"
FT                   /db_xref="GOA:A8IJ45"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ45"
FT                   /protein_id="BAF86246.1"
FT                   /translation="MSKTTRATQALQKAGIAFTAVSYDYDPDAPRVGLQAAEAIGAEPG
FT                   RVLKTLMAEVDGKPVCAVIPSDREVSMKKLAAAFGGKSAHMMKPADAERLTGYHVGGIS
FT                   PFGQKRQVPTAMEETALAFPAVFLNGGQRGLQVEVDPKAACAALNAKPAPLIA"
FT   CDS_pept        291477..291749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86247"
FT                   /db_xref="InterPro:IPR021327"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ48"
FT                   /protein_id="BAF86247.1"
FT                   /translation="MDAHDEKIRELAYQIWIEEGQPEGRAEIHWDMATELVAQTENYPA
FT                   TLRPVPTEDGPPEEPADIQNNLGEFPTLTDQGEQVPPSRKAVPED"
FT   CDS_pept        291749..292696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0250"
FT                   /product="protein of unknown function"
FT                   /note="DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86248"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ49"
FT                   /protein_id="BAF86248.1"
FT                   /translation="MAARHPPADVRIGVSGWTYAPWRGAFYPEGLGAKRELAYAAQVFR
FT                   SLEVNGTFYGLQKPEVFARWAAETPDDFLFAVKGPRFITHMKRLKAVEAPLANFFASGV
FT                   LKLGRKLGPVLWQLPASFPFNEARLDAFLSLLPRNMATASELARRHDARLEGRAAVGAE
FT                   TDGPLRHALEIRHDSYRTPAFTDLLRHHGVALVCADTVEWPLLMDATADFIYVRLHGSQ
FT                   ELYRSAYPPEELDRWAARVRHWREGQAMTDGAFIDARSVPKRPRDVFVYFDNTDKLHAP
FT                   DDARALMTRLGQTPGHPDVPVRRRRKIGAAEAHP"
FT   CDS_pept        292693..293286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0251"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86249"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ52"
FT                   /protein_id="BAF86249.1"
FT                   /translation="MTGPEALAALARDAANCIRCPLYRDATQTVFGEGAADAPLMLVGE
FT                   QPGDQEDRKGHPFVGPAGGVLDRALEAAGIARGAVYVTNAVKHFKFERRGKRRLHKGPN
FT                   AGEIAACRWWLDRELALVRPSLVVALGASAAHALLGRAVTISRTRGRVMEASGDVRLLV
FT                   TTHPSAILRVPDAEARAKAFDALVADLVVAREVA"
FT   CDS_pept        complement(293290..293817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86250"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ55"
FT                   /protein_id="BAF86250.1"
FT                   /translation="MVRHQPGPAQLYAGSPTGRDCLPQPPALSCLRTEARREAMARAAG
FT                   RFGNTSRSGPRLGALLTLLVPAAAGAAPPAEAPNVVIIAVAAVQEPDGATDCTVKGQVR
FT                   QVEKGTRLAIGQNVTLTVPCRRAGAKARSGTPDSATLSAAPYGRVQLDTTGTLLRAPYE
FT                   PLADAPPPPPSE"
FT   CDS_pept        293823..295274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0253"
FT                   /product="putative FAD/FMN-containing dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86251"
FT                   /db_xref="GOA:A8IJ56"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ56"
FT                   /protein_id="BAF86251.1"
FT                   /translation="MPACYEASRCAEAGMDRIDTVLKAVPEDLVTTDQDVVARYLTDFR
FT                   KYMTGASRAVLRPRTTEDVRRIVALCAEHGVPLVPQGGNTSYCAAATPGVAGDELVLSL
FT                   ERLNAIREVDAPNLSLTAEAGCVLSVLQETADAAGLMLPLDLGSRQSCQIGGNLSTNAG
FT                   GVSVLKYGMARDLVLGLEAVLPDGQLLDVLQPLRKNNTGYDVKQLLLGAEGTLGIITAV
FT                   SLKLVRKSVQTVTAFLAIPEIDALTQILARAQAYTGECITSFEYVSDHSLRMLLAARSE
FT                   LRHPLTAPNPHYVLLEAQTASPVFPLEDAVSQLLEQLMEEGLVTDGTLASGGAQRDALW
FT                   VLREHIPEAEVANGGSVKHDVSVTTSRLPAFVKEASALVEDHSEGGRLSIYGHVGDGNV
FT                   HFNVVAPVGAVPATYKAWFEREVSPRIYDLAVAMGGSFGAEYGIGRVKLDLLDRYGNPA
FT                   KIALMRAIKTAVDPKNILNPGKVVR"
FT   CDS_pept        295625..297832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0254"
FT                   /product="methyl-accepting chemotaxis receptor"
FT                   /note="sensory transducer precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86252"
FT                   /db_xref="GOA:A8IJ59"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ59"
FT                   /protein_id="BAF86252.1"
FT                   /translation="MVAADMNIHSIKIRIIALSALCVVTVAGALLGYGLYAASQTSRYV
FT                   TESVGDLLDSTSRDSLQRLASVQAAAIRTEIDSAFDAARVMARALEVVAENDGVGSARD
FT                   QRRGQLNALLLSVLKNNTRFNGTYSAWMPDALDGADPLNIGRKDIGSDATGRALPYWTR
FT                   DAAGNIALQPLVEYDSRDLHPNGVMKGGWFIGPQTTGKESILAPLPYVVQGKSVYLATM
FT                   SVPIMVGGRFAGVAGADFDLSFVQSLAEKVDRSIYKGQGTVSIVTNAGLVVASSADPRS
FT                   IGGPYKAIEPQAEQDMDTLRKGEEAVKLDTAKDAIKVFAPVALGRTGGAWSVIITVPRA
FT                   VVMADADKLGASLAERSRADTFWQMVAAAVVTAAALVAMALVARGISNPITRLTLALRR
FT                   LAAGEQVAEIAGANRKDEIGDISRAVDQIRIGVEEEAARKAKEAEANRVRQEEERRATM
FT                   QNLANGFEQAMGQVVENVGVASDKLGGAASTMTSATRKVAEESHTAAGASEEASNNVQT
FT                   VASAAEELASSIIEIKRQVDESARIANAAVAEAGNTAAQVQELSNSAEKIGKVVDLIRN
FT                   IAGQTNLLALNATIEAARAGDAGKGFAVVAAEVKQLADQTSKATAEIEAQIEEIQGSTR
FT                   ASSQAIVGITGVIEEINRIAGSIAAAVDQQGVATREIAHNVARASQGTQQVSVNISGIN
FT                   GAAADTSSAAAQVQDAAASLATQTQTLRRVMAEFLGTVRAA"
FT   CDS_pept        298002..299525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0255"
FT                   /product="sodium/sulphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86253"
FT                   /db_xref="GOA:A8IJ61"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ61"
FT                   /protein_id="BAF86253.1"
FT                   /translation="MCRGFEMIERVRGLFAYFARVVPFRIKPAIITTLVLFTLLLLPVP
FT                   AGLTPKAWALVAIFLTTIVAIILKVMPIGVMAMMAMTIVALSQVTATSSKAAIADALAS
FT                   LSNPLIWLIVVAIFISRGLKKTGLGSRIGLLFIALLGRRTIGIGYGLAVCELVLAPFTP
FT                   SNTARGGGIVHPIMKSIAGAFGSDPAKGTERKMGTYLALVNMHANPITSGMFITATAPN
FT                   PLVVDYVAKVTNQSFHLTWTSWALYMLLPGLVCLLLMPLAIALLSPPEVKATPDAVDYA
FT                   RGELKRMGALSGGEWVMIGTFLLLLVLWANVPAMIFGKAFELDPTAVAFLGLFALIITG
FT                   TIDWDDVLSEKSAWDTLIWFGALVMMAEQLNKTGVIAWFSNLLKSGILASGMGWQPAAA
FT                   LLVLCFVFSHYFFASTTAHISAMMLAFLTVGLQIVPPDFHIPFLLMMASGSAIMMTLTH
FT                   YATGTSPIIFGSGYVGLGLWWRVGFVMCVIELLIYAVVGNLWWKVLGLW"
FT   CDS_pept        complement(299583..300317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0256"
FT                   /product="protein of unknown function"
FT                   /note="DUF125, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86254"
FT                   /db_xref="GOA:A8IJ63"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ63"
FT                   /protein_id="BAF86254.1"
FT                   /translation="MPPARGSMPRTLSLRELHAETHLVSRIGWLRAAVLGANDGIVSTA
FT                   SLIVGVAAASAGRNEILLAGLAGLVAGAMSMAAGEYVSVSSQSDTEAAELARERRELAA
FT                   DFQGEVGELASIYEERGVEPALARQVAEQLMKKDALVAHARDELGISELTTARPIQAAV
FT                   ASAACFSIGAVLPLLLAMLAPASVRVALVSGGSLVFLAVLGVIAAKAGGAPVLKATLRV
FT                   TVWGALAMAATAGIGVLFGVAA"
FT   CDS_pept        complement(300461..302299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="AZC_0257"
FT                   /product="GTP-binding LepA protein"
FT                   /note="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86255"
FT                   /db_xref="GOA:A8IJ66"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ66"
FT                   /protein_id="BAF86255.1"
FT                   /translation="MAPDARCYAAPMTATAQKNIRNFSIVAHIDHGKSTLADRLIQLTG
FT                   GLSEREMSDQVLDNMDIERERGITIKAQTVRLSYKAQDGETYTLNLIDTPGHVDFAYEV
FT                   SRSLAAVEGSLLVVDASQGVEAQTLANVYQAIDNNHDIVPVLNKIDLPAAEPEKVKSQI
FT                   EDVIGLDASNAIGISAKTGLNIDQVLEAIVTRLPAPVGDREAPLKALLVDSWYDTYLGV
FT                   VVLVRIIDGVLKKGMRIKMMGADAVYDVDRVGVFTPKMVAMESLGPGEIGFLNGSIKEV
FT                   ADTRVGDTITDDKRPTSEALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASF
FT                   SFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFNLDLIATAPSVIYQMELTDGSTID
FT                   LHNPADMPDVVKIEEIREPWIRATIMTPDDYLGAVLKLCQDRRGNQIELTYVGARAMVT
FT                   YDLPLNEVVFDFYDKLKSISKGYASFDYNITDYRPGELVKMSILVNGEPVDALSMLVHR
FT                   TRAEFRGRAMCEKLKDLIPQHLFNIPIQAAIGAKVIARETIKALRKDVTAKCYGGDVSR
FT                   KRKLLDKQKEGKKKMRQFGKVEIPQEAFIAALKMDD"
FT   CDS_pept        complement(302394..303992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="AZC_0258"
FT                   /product="putative HemY protein"
FT                   /note="N-terminal precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86256"
FT                   /db_xref="GOA:A8IJ69"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ69"
FT                   /protein_id="BAF86256.1"
FT                   /translation="MIRLVLFLIVLAAIAFGASWLADRPGEMLVVWQGWRIETTVPVAL
FT                   AALAAFSVALLIVWHLGALLLRSPRMIATFSRRRRREKGWAAVSRGLVAIGSGDLDAAR
FT                   RARAEALRYLPKEPLTQLLAAQSAQATGHQDDALRTFRTMLDTPDTRLLGLRGLHMEAR
FT                   RSGDIAAARMLAEEAANQSPALTWAADAVIEARCGEGDYAGAREVLEKQMAHRGIDKLQ
FT                   YRRRRAVLLAAEALALEQTDPPVARERAVEAVRLAPTLVPAAAVAGRLLGANGELRKAT
FT                   KIVETAYASTPHPELAQVAAHLRPGDAALDRLKRIRTLAAKAPDHAESLIALAHATIDA
FT                   NEFAEARALLQRLSAEPTQRVCLLMAELEASEHEDVGKAREWAARALRAPRDPAWIADG
FT                   RVFDAWAPVSPVTGKLDAFVWAVPPGVSATPVLEHEAERVRLAIAAIREKEEARRELAR
FT                   AAELEKLAASEAVAEADAKRRMAETEAAAAELKTPEKPDAPPVIALPPLPDDPGPTGEP
FT                   DPVAAAPVRKRMFGL"
FT   CDS_pept        complement(303989..305386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86257"
FT                   /db_xref="GOA:A8IJ70"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ70"
FT                   /protein_id="BAF86257.1"
FT                   /translation="MPFAQRRRMKQGGERAPAAPKPPESERRISFPAVRTQLAARRPMA
FT                   SKNPTSKAAAEASSKADDAPKAPQPETSAPETAAAPVSAPEPVTLEETAAPDTPPKVEA
FT                   AASAEAASSASAPVSPAEAAARDMVVEPDAYEEADAAEPPIPVVRAPRPSPFVPILSGA
FT                   LAGAVVAVAAAWVFTHYVPPPAQGVSGGRLDALEIDVARDRAAATQRIEKIEAALRAQS
FT                   PAQDLQPIASGLAKATSDIAALRAEQQKLAAALQSGVDAAKAQAGDLRSAVDAAQKKLE
FT                   TLATTTQALDRASASVAVLAVLRDAIVSGRPFATELEAARAVAGPKAATLDPFASAAGR
FT                   GYGSTAALAKRLSDEGATALAGEASTGPTGSGVVNRLLSGAESLVRVTPPGGTSAAPSE
FT                   ETLQKAVATLQAGDADGALAALATLPEGARQKLQPVVSAIQGRRDAANAASALFQQALA
FT                   AISGKTP"
FT   CDS_pept        complement(305401..306096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0260"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86258"
FT                   /db_xref="GOA:A8IJ73"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ73"
FT                   /protein_id="BAF86258.1"
FT                   /translation="MRLLVTRPQPGAGDTARRLAALGHDAIVDPMLRVAQTHAPLPTGD
FT                   FTAIAFTSVNGVKALAAHAEKTRVRHLPAFAVGSRTAQAARAAGFADVTDCAGDVIALG
FT                   TALKALPPGSRVLHAAGAERAGDLEGDLAPAGISLALAVLYRTLPADQLAPETLAALKS
FT                   GAVAAALHYSARTVESLLEATARGDVTGPFLALRQLCLSHAVAAPLRALGATTEVSQTP
FT                   DEDALLTLL"
FT   CDS_pept        complement(306100..307041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0261"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86259"
FT                   /db_xref="GOA:A8IJ75"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ75"
FT                   /protein_id="BAF86259.1"
FT                   /translation="MPDPNAPFAPRLAIGTRGSPLALWQAHAVRDALAAALARPVESIS
FT                   ITVIRTSGDSIQDRALSEAGGKGLFTKEIEEQLLDGRIDLAVHSAKDMATALPDGLFLS
FT                   GFLPRADVRDALILREGKSLADLPAGARIGTASLRREAQLRRLRPDLDVSLLRGNVHTR
FT                   LAKVREGTFDGTLLALAGLTRLGLAHEASAVLDTDAFLPAVGQGAVAIESRVGDEATNG
FT                   AIAAIACRATGIALAAERALLTALDGSCRTPIGGLATVEGDMVRLRGLILSPDGRDAAE
FT                   ADETAPVSDAARLGADMGARLRATAPARALGL"
FT   CDS_pept        307484..308578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0262"
FT                   /product="glycoprotease"
FT                   /note="peptidase M22"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86260"
FT                   /db_xref="GOA:A8IJ77"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ77"
FT                   /protein_id="BAF86260.1"
FT                   /translation="MPIRTLRRRESVADLLVLGIETTCDETAASVVSRSPSGAGDILSN
FT                   VVRSQIEDHSPYGGVVPEIAARAHVEVLDHVIAQAMADAGVAFSDLSGIAAAAGPGLIG
FT                   GVIVGLTTAKSISLAARRPLVAVNHLEAHALTARLTDGVAFPYLLLLVSGGHTQLLAVE
FT                   DVGKYRRIGTTLDDAIGEAFDKVAKMLSLPYPGGPEVERQAALGDPQRFAFPRPMAGRR
FT                   EPDFSLSGLKTAVRLEADRLAPLSDQDVADLCASFQAAVVDVIMDRVKAGARFFRERLG
FT                   SGPTALVVAGGVAANGAIRNALNKTASDIGTRLAVPPPVLCTDNGAMIAWAGAERLSRG
FT                   LTDPLDLSPRARWPLDPAPITPRA"
FT   CDS_pept        308601..309587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0263"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86261"
FT                   /db_xref="GOA:A8IJ80"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IJ80"
FT                   /protein_id="BAF86261.1"
FT                   /translation="MSAFDRIGVVGAGAWGTALANVAARAGRAVKLWSRDPAQVAEMAA
FT                   RRENARGLPGIALEAGVTPTADLREAAACEAVLLVVPAQVCRAVSGELAPLLAAGTPLV
FT                   SCAKGIERGTAAFMTDVIRAAAPAARPMVLSGPSFADDVARGLPTAVTLAGEDGALAET
FT                   LAAALGSSTFRLYHSSDVRGVEIGGAAKNVLAIAAGIVAGRRLGASAGAALTARGFAEL
FT                   QRFGRAFGAQPDTLTGLSGLGDLILTAGGPQSRNFAFGLALGQTGEVPQGGKLAEGAFT
FT                   ASALVAMAAGRGVEMPICAAVDAVLSGRLSVDGAIEALMARPQRAEA"
FT   CDS_pept        complement(309646..309945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0264"
FT                   /product="antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86262"
FT                   /db_xref="GOA:A8IJ82"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ82"
FT                   /protein_id="BAF86262.1"
FT                   /translation="MVYELAVLRIHEGKQAEFEAAARQAIPLFQRAKGCSGMEIRHSVE
FT                   TPTEYHLIVKWATLENHTVDFRGSEDFQSWRALVGPFFAQPPEVQHLESTFVGF"
FT   CDS_pept        310145..310558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0265"
FT                   /product="protein of unknown function"
FT                   /note="DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86263"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ85"
FT                   /protein_id="BAF86263.1"
FT                   /translation="MAHWLYKSEPFKWSWDQQVKAGAKGTHWDGVRNHLAKQQLQAMKL
FT                   GDQGFFYHSNEGKEIVGIVEVIREFYPDPSDATGKFGMVDLKAVRALKKPVTLATIKAE
FT                   PRLENMALIKFSRLSVQPVTDEEWDIVLSLAEG"
FT   CDS_pept        complement(310618..311082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0266"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86264"
FT                   /db_xref="GOA:A8IJ87"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ87"
FT                   /protein_id="BAF86264.1"
FT                   /translation="MDETLDRIDLKILRLLQANGRMSNADLAEAVAVSPATCHRRTQRL
FT                   FEQGYLSGVRAQVNPHKVERGTLVMVGVVLDRSTPESFGEFERAVAKLKFVLDCHLVAG
FT                   DFDYFLKIRVGDMADFNRIHAQQLIALPSVRQTRTFFVMKEVVDNAPLEF"
FT   CDS_pept        311242..312258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0267"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86265"
FT                   /db_xref="GOA:A8IJ89"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ89"
FT                   /protein_id="BAF86265.1"
FT                   /translation="MNLKKFERYPLTFGPTHIEKLSRLTDHLGGKVELYAKREDCNSGL
FT                   AYGGNKLRKLEYIIPDAIASNADTLVSIGGVQSNHTRMIAAVAAKIGFKCRLVQEAWVP
FT                   HEDAVYDRVGNIMLSRIMGADVQMCDDGFDIGIRKSWEDAIADVKAKGGKPYPIPAGAS
FT                   VHKFGGLGYVGFAEEVRAQEAELGFKFDYIVVCTVTGSTHAGMLVGFAADGRARNVIGI
FT                   DGSFTPAQTKAQVLEIARRTADLVELGQDLTADDVVLVEDYAYPAYGVPSEETKEAIRL
FT                   AAKLEGMITDPVYEGKSMQGMIDLVKKGYFPEGSKVLYAHLGGAPALNGYAYAFRNG"
FT   CDS_pept        complement(312563..313036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0268"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86266"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ91"
FT                   /protein_id="BAF86266.1"
FT                   /translation="MPPVGAAPPGLPPRRAGSTGRPAERRQLRSSLQRGFPFEHPFRPP
FT                   APPPGPDHQEIIMRYVNTAALALLASLTFAGAASADEYLTRSVRENYAVSAQGFIPGVT
FT                   APAANTTRSAEALLPAAAQATSAPKAGFQILNIQGQFNSPSVDQDPHWGPAQA"
FT   CDS_pept        complement(313091..313372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0269"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86267"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ93"
FT                   /protein_id="BAF86267.1"
FT                   /translation="MRTISATALALVAGLAFAGAASADEYLTNANRENYAASAQGFIPS
FT                   LTAQRAANEALLPASAQGTVRVQAQAASVSQSQDPHWGPALEGTPSQL"
FT   CDS_pept        complement(313501..314118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0270"
FT                   /product="NADp oxidoreductase"
FT                   /note="coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86268"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ95"
FT                   /protein_id="BAF86268.1"
FT                   /translation="MDIAILGAGHLARLAGARWLRAGHTVRFGLANPASADVPAGETPA
FT                   LPFAAAAAGARVLLLALPWWDVEGALSACAPHGGRIIIDATHPLRIGAAGPELALDAAT
FT                   SGAEVVQALAPDAVVFKSLNALSGPALGRISHLRPVVPVAGPETPELETVRTLIMDLGG
FT                   DPRHAGDLSVAALLEAPMLVRLRLVLAGQPPEEAARTLATAA"
FT   CDS_pept        314202..315176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0271"
FT                   /product="putative transcriptional regulator"
FT                   /note="LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86269"
FT                   /db_xref="GOA:A8IJ97"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ97"
FT                   /protein_id="BAF86269.1"
FT                   /translation="MDIDLNHIRRFDGALLLVFRELMATGQTTAAARRLGLTQSTVSHA
FT                   LRRLRDLTGDPLFQRRPDGLTPTPRAHELLPIVVEMLRLSQALKGEPGEFDPAASTRHF
FT                   RIAGPDIVSTVLAGPLAHRFAQHAPNARLSFGFIVGAAALEALRRGEIDMAIGHFPSVP
FT                   RGFAASTLWEEEFVAIARKGHPRFPPLDLAGYLAADHVLVSFSGRFTGVVDRVLQPLGL
FT                   ARRVVASFPLFLSVFDAVAQSDAVAAVPYSLCERHAETFGLARLPMPIAVPGFPIVSVR
FT                   RAGVPDGGYEWLEALIRRMVAEYADEIEARGEWPPRQPVPAAV"
FT   CDS_pept        315204..316484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0272"
FT                   /product="lytic murein transglycosylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86270"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJ99"
FT                   /protein_id="BAF86270.1"
FT                   /translation="MLASGRRDREIRSVNGKLHLFLRGLLGTLALLVLAAPAPARADAA
FT                   FTQFIASLWPEAQAAGVSRETFERETRGLEPDYKLPDLALPGRPATGAGKQAEFVQVPA
FT                   DYVREATIERLAAEGRRLMQKYQPVLAQIERQFGVPGPVVLAIWGRETDFGRYTEPHDA
FT                   LRVMATQAYAGRRKAQYRTEFILALKILDEGVVPRKAFRASWAGATGLTQFLPSDYFAH
FT                   GVSLEGNAHPDIWRSVPDALASAAKQLADKGWQPGLRWAYEVRAPANADCTLGVPEVQR
FT                   PIGDWVRAGFQPIGVRLSAAELAQPASLLQPEGIYGPSFLTTKNYFVIKEYNFSDLYVL
FT                   FVGHLSDRMTNPQPFATPWAASTQLRTSSVEAMQKHLARLGLYGDKIDGKAGMLTRAAV
FT                   GAYQKSAGLKVDCWPSEGVLQSMGAAR"
FT   CDS_pept        316578..317483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="auxin efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86271"
FT                   /db_xref="GOA:A8IJA1"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJA1"
FT                   /protein_id="BAF86271.1"
FT                   /translation="MQQIVMIVLCLVIGVVLRWSGKLPDNAAKVLSGWVINVALPAAAL
FT                   ESMHGLETRPDWWFAAATPWIGVVVSVLVMVPLCRALGWSRGRAGALILVAGWGNTSFV
FT                   GLPMIAAFAGSQWLGLGIVIDLFGSYLALSTLGLAIAAVASEGRLDLKAVGKRIVTFPP
FT                   FIAILIAFATNHMARPEWLDQLITALAGTLTPLALAAVGYALRLDQVARRLAPLGVGLV
FT                   YRLGVAPLLLIGLYTLLGQTGDMVAKVAMLEMAMPPMLGASVIAMDNDLEPDLIASLIG
FT                   IGVPLSMLTAWGWWTVISAL"
FT   CDS_pept        complement(317675..319453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0274"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86272"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJA3"
FT                   /protein_id="BAF86272.1"
FT                   /translation="MKMTSTEEFTKLVEKAMNKKIFKQVYASKPSMQLIDQYGPLCDKI
FT                   TKKRSIESAIYLWNKYRKDPSFIESLNLITTRIDVLPVSVTTSTIISQSSLASLIQRFD
FT                   SIMNSVLGTVNGDRDRLAPIIAATMDLQVANALSSVPKIGPVAGMMVQGITIALTRFLS
FT                   SDQDIRDASVKGLPSLFLALADRNRKIKEEDIVAHAQVNSFGRLFQSSLQSINQEISSM
FT                   PQDTRYIRIKSQECLRIVNEYVNYSIDEKQTINSFKNKTSRMYKMCTVLFEDIIGSGIE
FT                   YAFSDATEKLFDLEKDNMLDVTRSQRIGLILMGYYYSKDWERVKLPKIERAMAIDSKNV
FT                   ELRKSILNNQAENPEETQKEIEENENISRALIYGHPYQKFWGHENIEKFPTAYKHYQVA
FT                   KILSTKKGFSNDEKTAPPFSAIATRGLEYLSILKGTLVSDITSSMVDFAKNVDDKELIR
FT                   MWKLYVGSNLIVNEAIRNSILGKNSRKGMEVNNEYVKMIEDAGFIHTHNKLTINNEEKI
FT                   KMAEVGKMRWRKSAFGSPSASERAMLIAFCAAITFSLDIGRLSLGLADWKDTEASIHKL
FT                   CRDISLLFADDQLALN"
FT   CDS_pept        complement(319793..320269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0275"
FT                   /product="protein of unknown function"
FT                   /note="DUF796"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86273"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJA5"
FT                   /protein_id="BAF86273.1"
FT                   /translation="MAIYVNYDGIQGEATQQDHKKWIDVLSLSWGVGRGISTVAGSGNN
FT                   REASEPSVSEVSIVKAFDAASPKLFTESCTGNVGKTVKIDLVSTGNPGVTYCTYTLTNA
FT                   LISSYSVSTGGDRPTESVSISFTKLEFKFTPYDDKNKAGTPVTVSYDLATTKSS"
FT   CDS_pept        complement(320931..321938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0276"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86274"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJA7"
FT                   /protein_id="BAF86274.1"
FT                   /translation="MVSSIGASYNVLSLFRSSTGPQSSASSEAVESILEKARQMRADVK
FT                   PSYMQGVSLGTAAWMSQAETAGNYIYVKDLDLTKLRPQFGSDDEFSRFTQRLAENTTGY
FT                   WPTYKDFNEAVAVFRADYKVLQEYQQKESSYTSRVEATGSETLKKMLELRSSEPLTMAS
FT                   AIRSYNAQHLIAQDGYKFVEEQQKRLETATQPDEIAKIKDGIMLANDYIERYEKVSEIF
FT                   DTYLAYFDMEWNSRAYEVVGELYHKNDDGTYAIGAFQIQTKDENLVYWSSDGSGIAKMY
FT                   YAMGGYDEVDLAFSYMPPNPIDTMAKRIDHLQSLPYRAVTADGQMVFSARPLPF"
FT   tRNA            complement(322581..322656)
FT                   /gene="trnE"
FT                   /locus_tag="AZC_trnE03"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:322620..322622,aa:Glu,seq:ctc)"
FT                   /note="codon recognized: GAG"
FT   CDS_pept        complement(322773..323489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="alanine racemase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86275"
FT                   /db_xref="GOA:A8IJB0"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJB0"
FT                   /protein_id="BAF86275.1"
FT                   /translation="MNRSGANAQSASITHSEAPARLAGIQSAIEQACRDANRAREAVTL
FT                   IAVSKTFGAAEIWPVIAAGQRVFGENRVQESQAKWPELRARQAGLELHLIGPLQSNKAA
FT                   DAVALFDVIHTVDRPKIAYALAEEMSRQGRRLPVFIQVNTGAEPQKAGILPEAADAFIA
FT                   ECRDKAGLDVRGLMCIPPAEDVPAPHFALLAEIARHNDLPGLSMGMSADFEVAIHQGAT
FT                   HVRVGSALFGSRPRPA"
FT   CDS_pept        323566..325272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0278"
FT                   /product="putative diguanylate cyclase"
FT                   /note="GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86276"
FT                   /db_xref="GOA:A8IJB1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJB1"
FT                   /protein_id="BAF86276.1"
FT                   /translation="MRWRGNDRPSGLADNTVDPPAKPARGGSIRLRIVLLILLITVPVS
FT                   VERVLSLMADRAERIMDTQTMLHDMAVRAALAQQEVLVSASAMLEVLSRQADWLLADPA
FT                   ACQRLMERLNSEVSGVQGLYLAAPDGRVVCASSRATVGRNVSERPYFQRALASRQPVLS
FT                   DLFRGSSLLASLVLSKAERDDNQRVIAVVAAGLDLQWLSRIAAETGASAGVTVDVIDSA
FT                   GTSLVRYPPSPDIVGRNFADAPLVRATVGRDEGHARVEGLDGVRRYVAFARFGGTDVRI
FT                   VLGMDEAAILAPIDREILSSVLLHFSVVLAVLVISWFAADRLVVLPIRRLAQQVSSLGA
FT                   GDGPEASLQPEALHDVGVQEFAPLVRAFGDLGRRLNERTEALRMLNGRLTALARTDGLT
FT                   GLANRRTFDVQLSEDWVRTRETGQPLGVLMIDVDHFKPYNDTLGHLAGDEALRAVARML
FT                   IAAVAGTPYLVARYGGEEFVVLMPGAGRDAAEAIAQDVRRLVETLEIVHPSAAYRRLTV
FT                   SVGVAVAMPLEGDSPDALLAAADQALYEAKAAGRNRVVMAASAVSEGARKR"
FT   CDS_pept        complement(325297..326151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0279"
FT                   /product="cell wall-associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86277"
FT                   /db_xref="GOA:A8IJB4"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJB4"
FT                   /protein_id="BAF86277.1"
FT                   /translation="MAELDRRLTPARPDLAASSLKGVVDASRFVEGEVRRVFADVAPLR
FT                   RAPRPDAMLDTEALYGETVTAFEDDMEGWSWVQLGRDGYVGYMPTIAIGPLGPAPTHRV
FT                   SAPRTFLFPGLDIKLPPVATLVTGALLHVRDVRGKFAVTDRGAVPARHILPLDAAEPDF
FT                   VTVAAGLLGTPYLWGGCSSLGIDCSGLVQTSLGIAGISAPRDSDMQEAALGASIDLSGP
FT                   FRRGDLLFWPGHVGIVEDAVTLLHANAFHMAVAREPLGPALLRIAEAAGPLRTVRRLEN
FT                   GVG"
FT   CDS_pept        complement(326144..327499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0280"
FT                   /product="leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86278"
FT                   /db_xref="GOA:A8IJB5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJB5"
FT                   /protein_id="BAF86278.1"
FT                   /translation="MSSCFAAADAPNLPIWCVTPDSFAAAAIPESARRFATGTGFTGEA
FT                   GKLVAVPGAEGALAGYLFGFGPDSDPFAAGSLPGQLAAGTYRFEGAVPALAPLAFGLGT
FT                   YRFERYRSRAARAVSLVPPAGADVAALTRTLEAVTLVRDLVNTPANDLGPAEIEDAARA
FT                   LAARFDAALNVVVGETLLEENFPMIHAVGRAATRAPRLIDLTWGPEDAPKVTLVGKGVA
FT                   FDTGGLDIKTSAGMLLMKKDMGGAASALGLAQMIMGRGLKVRLRVLIPAVENAIAGNAF
FT                   RPGDVLKSRKGLSVEIGNTDAEGRLVLADALTLADAEAPDLLIDFATLTGAARVALGPQ
FT                   LPPAYTDDEGLAADLARHAQAEHDPLWRMPLWAPYAAMLDSKIADINNAGSGGFAGSIT
FT                   AALFLKRFVGVAKSWLHLDIYAWNPSTRPGRPEGGEAQTIRALDALLTERYG"
FT   CDS_pept        complement(327645..328112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaA"
FT                   /locus_tag="AZC_0281"
FT                   /product="prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86279"
FT                   /db_xref="GOA:A8IJB8"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJB8"
FT                   /protein_id="BAF86279.1"
FT                   /translation="MSPVLLAEAFASILVPVALVAALASDLSRRTIPNIVVLALLLGFA
FT                   ALAFLGYVDDLPLRLVLAGAVLCVGFALFSEDVIGAGDAKLAAATALWLDPTQFPLYVL
FT                   LCGAMGALLVAAATVARQQGWGGRLARGLPYGVALATAGLALFPYSSLALA"
FT   CDS_pept        complement(328124..328288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86280"
FT                   /db_xref="GOA:A8IJC1"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJC1"
FT                   /protein_id="BAF86280.1"
FT                   /translation="MKVLLQRFVKEEHGSTALEYGLIAAGLSIAIVTVLTQVGLTLSRL
FT                   KAASASAGN"
FT   CDS_pept        complement(328489..329448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0283"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86281"
FT                   /db_xref="GOA:A8IJC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJC3"
FT                   /protein_id="BAF86281.1"
FT                   /translation="MARLDVNRTAEMEVFVRVVDAGGFSAAARALHLTPSAVSKLITRL
FT                   ELRLGARLINRNTRRLQLTAEGAAFYERAVTLLADLEEAERSVARSEVPSGRLRVNANV
FT                   PFGTLYLLPALPEFLARYPAVTLDVVLTDKVVDLMEERMDVAVRAGPLKSSQLVARKLG
FT                   DTRMVIVASPEYLARHGTPRGPADLDAHRCIGFCYLRQVEGWPLKAEEGREATVFRPQG
FT                   HVLASDGETLRHMVLAGTGIARLGTFHVAADLLAGRLVPLLEDFNPGDTDPMHAVYLGQ
FT                   GGHMPARVRAYLDFLVEVVAPRFRRAAALEPARLLQNA"
FT   CDS_pept        329515..330774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0284"
FT                   /product="transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86282"
FT                   /db_xref="GOA:A8IJC5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJC5"
FT                   /protein_id="BAF86282.1"
FT                   /translation="MLQRRMRCRVDAGFTRSPAFGRPLRMSAMPVALYALAAGAFGIGV
FT                   TEFVIMGLLLDVGADLGVSLSAAGLLISGYALGVVVGAPVLTILTARWPRKAVLLGLMA
FT                   VFTLGNLACALAPDYELLMAARVLTAFAHATFFGVGSVVATGLVPANKKASAIAIMFTG
FT                   LTVANILGVPFGTWLGQHYGWRSTFWAVTLVGVLAFAVIALLVPANAAKPEASNLKKDL
FT                   AVLTRAPLLLGLLTTVLSWVGVFAAFTYIAPMLTKITGFAESAVSPILLVFGAGLVVGN
FT                   LAGGRLADRWLVPTVYGSLVVLAAVLGALTFALHNAVAAVIFVGLLGAVAFATVAPLQM
FT                   WVLEKAQGAGQSLASSFNIAAFNLGNAIGAWLGGVVIDHGLGLGAVPWVAALVPLAAVP
FT                   VAWWAGRLEAGRALTPAAAE"
FT   CDS_pept        complement(330853..332352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0285"
FT                   /product="putative phosphoglucomutase/phosphomannomutase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86283"
FT                   /db_xref="GOA:A8IJC8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJC8"
FT                   /protein_id="BAF86283.1"
FT                   /translation="MFPTPKPALTPNTYAYESEPMVKPTGFREYDARWLFQKEINLMGV
FT                   QALGMGLGTLMHEMGIKPEIVTGHDFRGYSSSIKYAMVSGLMAAGVKVHDIGLAMSPMA
FT                   YFAQFALDVPAVAMVTASHNDNGWTGVKMGVNRPLTFGPDEMTRLKEIVLCAKFDLKGG
FT                   GAYQFVENFPEIYIKDLTDRPKLKHPIKAVVACGNGTAGAFAPRILEALGVEVVPLDTE
FT                   LDHSFPKYNPNPEDLEMLHAMRDAVLASGADVALGFDGDGDRCGVVDNEGEEIFADKMG
FT                   VMLARDLAKLYPNSTFVVDVKSTGLFATDPELIKLGVKADYWKTGHSYMKRRVNESGAL
FT                   VGFEKSGHYFFNKPIGRGYDDGLVSAIAVLDMLDRNPGKKLSELRLALPKTWSSPTMSP
FT                   HCADEAKYGIVEQVVKHYQKLQAEGAKVTGQAIRDLVTVNGVRVTTEDGSWGLVRASSN
FT                   KPELVVVVESPVSEARMREMFAEVDSVLRTHPEVGEYNQKI"
FT   CDS_pept        complement(332578..335136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="AZC_0286"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86284"
FT                   /db_xref="GOA:A8IJC9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJC9"
FT                   /protein_id="BAF86284.1"
FT                   /translation="MPQAGTPGWISGPPMAYVQASMTAQGSMFDTRLPIDDALPALTAT
FT                   LRDHVAAVLVAPPGAGKTTRVPLALLDEPWVKGGKILVLEPRRLAARAAAHRMAQTLKE
FT                   KVGETVGYRVRLRSEVSRRTRIEVITEGVFTRMVLDDPELSGIAAVLFDEYHERSLDAD
FT                   LGLALALETQRGLRDDLRLLAMSATLDGARVAALLGDGAPAPVVESEGRAYPVDTRYLG
FT                   RDPRAPIERQVVDAVLKALSAERGSVLAFLPGAAEIRRTQTHLLADVRDRDTDIVALFG
FT                   ALDAAEQDRAVLPAPPGKRKVVLATSIAETSLTIEGVRVVVDCGLARVPRFEPDVGLTR
FT                   LETVRVSRAAADQRRGRAGRTEPGVCYRLWGEGETQSLPAFATPEILAADLSGLVLDLA
FT                   SAGVRDPRALPFLDPPPLPAVTEAKNLLRVLDAIDADGAVTPLGARMARLPLPPRLAHM
FT                   VVRGSDLGAGESAADIAALLTERGLGGDSPDLAHRLEDFRRERSRRAEDARRLAGRWAE
FT                   LARESHPPKAGETPSPAALLALAYPDRVAKARGDGTRILLANGRGAVVDPASSLARAPY
FT                   LAVAEISGRADAARVQLAAAISGEEIERLFADAITAGLEVAFDPATASVRARETRRLGA
FT                   LTLADRPQPVPNTPETAAALAEGLADLGIERLPWTPALTQWRDRVRFLHQAEGAPWPDL
FT                   SDAQLAATAAEWLAPFLTGRTSLGQVSAGDLGNALHALLPYELTHRLETEAPSHFTAPT
FT                   GSNLPIDYAAEGGPLLPVRVQELFGLTRHPAIAGGKVPLTLALLSPAHRPIQVTKDLPQ
FT                   FWQGSWRDVRAEMRGRYPKHPWPEDPANAPPTNRAKPRGT"
FT   CDS_pept        335209..336204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0287"
FT                   /product="WD-40 repeat G-protein beta"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86285"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJD2"
FT                   /protein_id="BAF86285.1"
FT                   /translation="MSSVPSSLTDKAQSFSVEGAVVAVAFQKKAAILIGGMGEALRIEG
FT                   EAETRFTLHDGGVLDVRGDGKRLVSGGDDGRVVELSAEGEVQVRAEHKGRWIDRVALGP
FT                   DGAVAYSAGKTAYVLPAKGEARSLEVASTVGGLSFAPKGLRLAVAHYGGVTLWYPNLVD
FT                   AKPDLFGWKGSHLGVAFSPDGRFLVTTMQEAALHGWRVSDGGHMRMTGYPARVKSFNFS
FT                   ADGKWLATSGSSEVILWPFASKEGPMGKQPSMIAPSSTARVSSVACHPKDPVVAVGYED
FT                   GMVLMARISDGAEILLRAPDGSPVTATGWRADGGAVAFGTANGSAGIVTF"
FT   CDS_pept        336366..337112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0288"
FT                   /product="putative acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86286"
FT                   /db_xref="GOA:A8IJD5"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJD5"
FT                   /protein_id="BAF86286.1"
FT                   /translation="MKIEDVRRTAYSMPLTNPAYPPGPYRFFDREFMIITYRTDIEALR
FT                   RVVPEPLEVYEPLVKYEFIRMPDSTGFGDYTETGQVIPVKYEGVEGGYVHSMYLDDEAP
FT                   IAGGRELWGFPKKYAHPKMEVEKDVLTGRLHYGKTLCVDASMGYKHKAADKDAVLAALK
FT                   TPSFLIKIIPHVDATPRICELVRYYLEDIVLKECWTGPAALGLFPHAIADVAKLPVLEV
FT                   VSALHLRADLTLGMGEVVFDYLKDQK"
FT   CDS_pept        337296..338447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="patatin"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86287"
FT                   /db_xref="GOA:A8IJD6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJD6"
FT                   /protein_id="BAF86287.1"
FT                   /translation="MSTLRSEVPCDIKDVVSEYDRVALVFQGGGALGAYQAGVYEALDK
FT                   AGLEPNWVSGVSIGAINSAIIAGNLPENRVARLHEFWNTVSGRKIWAFTPEGDVYRTMR
FT                   NQLSAWTTMNMGQPGFFKPRFPNPWLLPTGASNATSLYDTSPLRETLLRLVDFDLINSG
FT                   SIRFSVGAANVRTGNFIYFDNTTHHIAPEHIMASGALPPAFPAIRIDGEYYWDGGVVSN
FT                   TPLQWLLDQPDHPSALVFQVDLFSARGELPRDMFGVIERQKDIGYSSRTRYTTDLFRRV
FT                   QLMRTAHAEAVMRIPEQLRTEDDLQVLSDYEKSGPVNICHLIYQEKSYERDFKDYEFSG
FT                   SSMRDHWQSGIEDTMKTLRHRQWLEKPDKSDGIVIHDVHRLAE"
FT   CDS_pept        complement(338578..339327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0290"
FT                   /product="protein of unknown function"
FT                   /note="DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86288"
FT                   /db_xref="GOA:A8IJD9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJD9"
FT                   /protein_id="BAF86288.1"
FT                   /translation="MTALTLTLIALILILAGLVKGVTAMGLPTLGMALLSLLMPPADAA
FT                   AILLAPTLLTNVLQFATGPRLLPVLIRFWPMGLATFGATLVSGFWLEGLDSHLAPAVLG
FT                   GTLLVYGLMGLGRFHFTTPAWIEPWLSPLMGFASGLLTGTTGVTVMPAAPYLQSLSLHR
FT                   EDLVQAMGLAFTSGSIGLAIALSAKGAPLASPHALLVTCAALIPAFAGMEIGRRIRLAI
FT                   SQQAFRACFFSGLALLGANTMFRALPL"
FT   CDS_pept        339413..340300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0291"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86289"
FT                   /db_xref="GOA:A8IJE1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJE1"
FT                   /protein_id="BAF86289.1"
FT                   /translation="MRFDSVDLKLFLAILETGSITAGAERANLALPSASARVRGMEEVA
FT                   GTPLLVRGRSGATPTPAGEALAHHARLILQQSERMRGELSRYGRGLKGHVRLWTSTAAL
FT                   SAQLPVDLARFLARHPDVDIDLEERPSRETAPALRAGLIHIGLLADAADVTGFETRPYC
FT                   EDVLMAVLPLAHPLAGRAGLTFAEVAAQPYVGLTPGNAIQHLIEHAAIGLGLPLKYRVR
FT                   VNRIDAVGELVQAGVGVSVLPTADARRVAERMAVSLFPLPDAWARRKVVVAVRNREALP
FT                   EFARQAFDMLAGAG"
FT   CDS_pept        complement(340303..341730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0292"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86290"
FT                   /db_xref="GOA:A8IJE3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJE3"
FT                   /protein_id="BAF86290.1"
FT                   /translation="MSRTVWTSGTTQLAEAETSSAPRTEAVMVEIRRRITGRALTGGEK
FT                   LPSIRRLAGDLKVSPSTVVEAYERLVAEGLVRARPGSGFYVAGSLPVVALREVAPKLDR
FT                   AIDPLWVSRQSLDAGADMLRPGCGWLPADWMPNAAIRRSLRALARAEDGILSDYGGTRG
FT                   SLALRGHLARQFAAEGIEAGADQILLTPSGSRAMDLLCRFLLKPGDTVLVDDPCYFNFQ
FT                   ALLRAHQIRIVSVPYTPTGPDIERFGQVLAAERPRLYITNAALHNPTGATLSPRTAHQV
FT                   LTLAAAHDLTIVEDEIFAEFEPEPSPRLAALDGLARVIRVGSFSKTLSASARCGYIVAR
FT                   PEWIEGLVDLQVATNFGGPSPIAAELVFGTLSDGSYRKHLADLRTRLARRRREMLAELG
FT                   KLGITPWTLPRGGFCLWCRLPDGRDAAAVAQAALRERVVLAPGNVFSVTQSAGDLMRFN
FT                   VAQMDGEVLRVLGNALR"
FT   CDS_pept        341803..342663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0293"
FT                   /product="protein of unknown function"
FT                   /note="DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86291"
FT                   /db_xref="GOA:A8IJE6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJE6"
FT                   /protein_id="BAF86291.1"
FT                   /translation="MDRGTEGWGSGLIGVIIFSGSLPATRVAVEDFSPLFLTCARAVIA
FT                   AGLGALLLMAFRQKRPAAADLGPLVLVALGVVVGFPLLTALALQHITSARSIVFIGLLP
FT                   LATALFAVLRGGERPKPAFWLFSLLGATLVAGFALAGSRAGDATGDLFMVAAIIVCGLG
FT                   YAEGARLSRRIGGWQVISWALVCALPVMAVIALATLPVHWTGIGVSAWAGLAYVSVFSM
FT                   MVGFIFWYRGLALGGIARVGQLQLLQPFFGLALAGLLLGEPVAWTMVAVTGLVVLCVAG
FT                   AKRYG"
FT   CDS_pept        complement(342706..343362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0294"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86292"
FT                   /db_xref="GOA:A8IJE7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJE7"
FT                   /protein_id="BAF86292.1"
FT                   /translation="MSKATLTISSKNYSSWSLRGWLICKLAGLDFEEERVPVDDPGARA
FT                   ELLLLSPSFLVPRLVHEGVTVWDTLAIASYLNEVFPEAGLLPPDRAARAHCLSVSGEMH
FT                   SGFANMRSALPMNIKGRYPGFKVWAGAQADIDRIVAIWRGCFAAHGGPYLMGPRPTLAD
FT                   AMYAPVCSRFTTYDVKLDVACDAYRERIMAHPVVKEWIAGAMAEPEELEELDAEF"
FT   CDS_pept        343621..344838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0295"
FT                   /product="polyhydroxyalkanoate depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86293"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJF0"
FT                   /protein_id="BAF86293.1"
FT                   /translation="MYLAYQAQSDLMEPVKFGAHFARRFLSGPFMAPFQTQATRQLAAA
FT                   CEMVERVGLTHGRPDFGIRTTEVGNREVPVVEEGVFRMPFGTLLHFKKKDVDVAQPRVL
FT                   VVAPLSGHFATLLVNTVRTLLPDHDVFITDWHNARDVPLEEGGFGFDGYVEHVTKFLEF
FT                   MGPGAHLVAVCQPCVQALVAAAVMAQEGNPAYPRSMTLMAGPIDCRINPTKVNELATSK
FT                   PIRWFENNLISTVPMGFPGSGRRVYPGFVQLSAFVSMNFGRHMKAHFDLYDALVEGDEE
FT                   KATTTKVFYDEYFAVLDLAAEFYLETVQYVFQEYRLPKGELTYKGNPIDFKAIRRTSLL
FT                   TVEGERDDICSLGQTVAAHDICTGLKPHRKRHHMQAGVGHYGVFSGRKWAGQVYPIVRN
FT                   HILASD"
FT   CDS_pept        345015..346445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0296"
FT                   /product="homospermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86294"
FT                   /db_xref="GOA:A8IJF3"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR023181"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJF3"
FT                   /protein_id="BAF86294.1"
FT                   /translation="MSAWPVHATIDGPIVMIGFGSIGRGTLPLIERHFSFDLDRMVVID
FT                   PVDDDRKLLDARGIRYIQSEVTAENYRELLTPLLTNGAGRGFCVNLSVDVSSVAVMELC
FT                   REIGALYVDTVIEPWKGFYFDPSLGTEARTNYALRESLLAARRRNPGGTTAVSTCGANP
FT                   GMVSWFVKQALLNIAADTGLSLPEPKTREEWARFAQALGVKGIHVAERDTQRARNPKPR
FT                   DVFVNTWSVEGFVSEGLQPAELGWGTHEKELPPDGRTHATGCGAAIYLTRPGADTRVRS
FT                   WTPTPGPQFGFLVTHNEAISISDYYTVRDGEKVVYRPTCHYAYHPAGDAVLSLHEMFGS
FT                   GGKMQSDWKILDEHEIVDGVDELGVLIYGHAKNAYWFGSQLSIEETRQLAPYQNATGLQ
FT                   VTSAVLAGMVWALENPQAGIVEADEMDFRRCLEVQMPYLGPVIGTYTDWTPLQSRNTLF
FT                   AGDFDEEDPWQFKNVIVR"
FT   CDS_pept        347206..347739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86295"
FT                   /db_xref="GOA:A8IJF5"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJF5"
FT                   /protein_id="BAF86295.1"
FT                   /translation="MPRLVTHLISATVLGAILASGPAAFAQPAAPQTPAAAPAPAPAII
FT                   VTEAYSEADARAVLNARLAALKAVIELTPEQEKLWPPLEAAIRDISKNAVARRKQMETA
FT                   QPPKDFLGVLDQIGTAEEIRGRELKRFVEAARPFVASLTEAQKRRIPPFLGLQDTGGAH
FT                   QPAGTLWLFEEEAG"
FT   CDS_pept        347848..348546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86296"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJF7"
FT                   /protein_id="BAF86296.1"
FT                   /translation="MSSSPSPISDPAAFVRAETRLRPVPLVPEISLHVADEAVPIWHRT
FT                   EEELGAMGLPPPFWAFAWAGGQALARYVLDHPQVVAGRRVLDFASGSGLVGLAARQAGA
FT                   ADVTCADIDVFAHAAIGVNFAANAGREMPADTTFRVTRENLIGCDEGWETVLAGDICYE
FT                   RDLAEAVFAWLKGLAARGATVLLGDPGRTYLPRAELEQLIEYNVPVTRELEDLEIKRTG
FT                   VWRPRLPAGV"
FT   CDS_pept        348613..349083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0299"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86297"
FT                   /db_xref="GOA:A8IJG0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJG0"
FT                   /protein_id="BAF86297.1"
FT                   /translation="MNVEDVWTAMEERHACMLVDRDGSRLRARPMAPVARRDDGVVWFV
FT                   TDAHSAKDEEVSAHPEVCLSFSDEGDRFYLSVSGRAEVVRDVAKLKDIWSAPMEAYFPG
FT                   GPEDPNAVLLRVVPEQAEIWQGDGLLTTGFKMASAILSDRRADLGENAKIEM"
FT   CDS_pept        complement(349119..349490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0300"
FT                   /product="putative uncharacterized small membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86298"
FT                   /db_xref="GOA:A8IJG1"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJG1"
FT                   /protein_id="BAF86298.1"
FT                   /translation="MTLWPRLLIVIAGLYGAGGVALAAVSAHLTGGASLAIAANFLLFH
FT                   AAALVALAAVAGQVAHMRAVLLVGASALALGALLFSGDLTLRALMEIKLLGGSAPFGGM
FT                   LMIAGWLVVGASALFGRRA"
FT   CDS_pept        349704..351710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0301"
FT                   /product="acetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86299"
FT                   /db_xref="GOA:A8IJG4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJG4"
FT                   /protein_id="BAF86299.1"
FT                   /translation="MRKQAGFSVREPGGKTVSEQNYFHVPAEWASRAFVDKAGYEAMYK
FT                   ASVENPEAFWAEQGKRIDWFEPYTKVKNTSFIPGAVSIKWFEDGVTNIAHNCVDRHLEK
FT                   RGDQVAIIWEGDSPTESRKITYRELASEVNKFANVLRNRDVQKGDRVTIYLPMIPEAAF
FT                   AMLACARLGAVHSIVFAGFSPDSLAGRISDCGSKVVITADEGLRGGRKVPLKANVDAAI
FT                   ERLPEPVDHVIVVRRTGATVAMEPGRDVWYHEAAEMVTDECPAEPMNAEDPLFILYTSG
FT                   STGKPKGVLHTTGGYLVYAAMTHQYVFDYHEGDIYWCTADVGWVTGHSYIVYGPLANGA
FT                   TTLMFEGVPNYPSNARFWEVIDKHQVNIFYTAPTAIRALMQAGEDPVKKTSRASLRLLG
FT                   SVGEPINPEAWHWYHRVVGEGRCPIVDTWWQTETGGILITPLPGATALKPGSATRPFFG
FT                   IVPQLVDAEGRVLDGAAEGNLVIADSWPGQMRTVYGDHERFEQTYFSTYPGKYFTGDGC
FT                   RRDEDGYYWITGRVDDVINVSGHRMGTAEVESALVAHPKVSEAAVVGFPHDIKGQGIYA
FT                   YVTLMAGENPSEELRKELVAWVRKEIGPIASPDLIQFAPGLPKTRSGKIMRRILRKIAE
FT                   DQFENLGDTSTLADPGVVEDLVSNRQNKREAAA"
FT   CDS_pept        351913..352953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0302"
FT                   /product="thiosulphate-binding protein"
FT                   /note="twin-arginine translocation pathway signal
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86300"
FT                   /db_xref="GOA:A8IJG7"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJG7"
FT                   /protein_id="BAF86300.1"
FT                   /translation="MLSRRSVLSLTLGGLVASAGMGSLSAALAQQIKYSGPNTLLNVSY
FT                   DIARELFTAENTEFVPFWKQQTGQDITVNQSHAGSSRQARAIIEGLEADVVTFNQVLDV
FT                   QALVKAGFVAKDWQAKFPNNASPYYSFPAFLVRAGNPKNIKDWNDLVRDDVKVIFPNPK
FT                   TSGNARYTYLAAYAYALEQNKGDTAKADAFVKKLLANVPVFDTGGRGATTTFVERETGD
FT                   VLVSFEAETRAIADVYKDKKLSTVVPSVSVLAEFPVAVVDKVVDKRGSRVAAQQYLEFL
FT                   YSPAGQTVAAKAYHRVVDKTVEEKFKDQFPPVRLVKVEDVFGGWDKANADHFVSGGKLD
FT                   QVFGAR"
FT   CDS_pept        353369..353722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0303"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86301"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJG9"
FT                   /protein_id="BAF86301.1"
FT                   /translation="MTETATLSLTDVPQVYKRHVFACFQQRPPTHPRGSCGAAGAQPLW
FT                   ERLGKQIEATGQRDIVMTATGCMGFCQAGPIMVVYPEGVWYQPRTPEDVDEIVTTHLVG
FT                   GTLVERLVIVPRI"
FT   CDS_pept        complement(353786..354898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0304"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86302"
FT                   /db_xref="GOA:A8IJH1"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJH1"
FT                   /protein_id="BAF86302.1"
FT                   /translation="MATHKLLLLAGDGIGPEVMAEVKHVIGFLDKQGIASFAIEEDLVG
FT                   GSAYDAHGVAISDAAMERAKAADAILLGAVGGPKWANVPYEARPEAGLLRLRKDLGLFA
FT                   NLRPALCYPALADASSLKREVVEGLDILIVRELTGGVYFGEPKTILDLGNGQRRAIDTQ
FT                   VYDTYEIDRIGRVAFELARTRRNKVTSSEKHNVMRSGVLWKETITALHAKDYKDVELEH
FT                   QLADSLAMQLVRWPKQFDVIVTDNLFGDILSDIASMLTGSLGMLPSASLGALDEATGKR
FT                   PAMYEPVHGSAPDIAGRGIANPIAMIGSLGMALRYSFGLGEVADKIEEAIAAVLASGKR
FT                   TGDIRTPGGPVIGTADMGAAIVEELGKLIA"
FT   CDS_pept        complement(355098..355820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0305"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86303"
FT                   /db_xref="GOA:A8IJH3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJH3"
FT                   /protein_id="BAF86303.1"
FT                   /translation="MSRVALVTGGTRGIGEAISIALKDKGYKVAANYAGNDAAAQAFHE
FT                   KTGIPVFKWDVSDFEACKAGIAKVEADVGPVEVLVNNAGITRDATLHRMTLEQWNAVIN
FT                   TNLNSAFNMCRNVIEGMRARKFGRIVCISSINGQKGQFGQTNYSAAKAGEIGFVKALAQ
FT                   ESAALGITVNAIAPGYIATEMVRAVPEDVLKKIISTIPVGRLGEPEDIARAVAFLVADD
FT                   AGFITGSTLTANGAQYIT"
FT   CDS_pept        complement(355974..357152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0306"
FT                   /product="thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86304"
FT                   /db_xref="GOA:A8IJH6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJH6"
FT                   /protein_id="BAF86304.1"
FT                   /translation="MTDDVVIVSAARTPVGSFNGALSTLPAHQLGAIAIKAALERAGVA
FT                   ASEVSEVILGQVLTAAQGQNPARQASIAAGVPIESPAWQVNQVCGSGLRSVALGYQAIK
FT                   NGDSSLVVAGGQESMSQSTHAAHLRNGTRMGSLDLVDTMIKDGLWDAFNGYHMGNTAEN
FT                   VATQFQITRAEQDEFAVASQHKAEAAQKAGRFKEEIVPVTISSRKGDVVVDTDEYPRHG
FT                   ATIEAMQKLKPAFVKDGTVTAANASGINDGGAAVVLMSAERAAKEGKTPLARIVSWAQA
FT                   GVDPAVMGTGPIPASKLALEKAGWTVDDLDLIEANEAFAAQAIAVNKGLGWDTAKVNVN
FT                   GGAIAIGHPIGASGTRILVTLLHEMQKRDAKKGLATLCIGGGMGIALCVERP"
FT   CDS_pept        357367..357969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaR"
FT                   /locus_tag="AZC_0307"
FT                   /product="polyhydroxyalkanoate synthesis repressor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86305"
FT                   /db_xref="GOA:A8IJH9"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJH9"
FT                   /protein_id="BAF86305.1"
FT                   /translation="MAKTQEPVTIKKYANRRLYNTGTSTYVTLEDLANMVKEGEDFVVY
FT                   DAKNGDDITHSVLTQIIFEQENKGQNLLPIAFLRQIIRFYGDSMQMMVPRFLEMSIESF
FT                   TKEQGRMRDQVSKTIVGTPFGGFEDQVRRNMEVFERAFNMFIPFKGDETPAETTTPAAQ
FT                   PAAAASSGDELEALKRQMADMQQKLEKLVSKPEGGSQ"
FT   CDS_pept        complement(358070..359770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0308"
FT                   /product="putative diguanylate cyclase"
FT                   /note="GGDEF, phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86306"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJI0"
FT                   /protein_id="BAF86306.1"
FT                   /translation="MAGRNPSSPVTPAPPAGEPKTVLDTPEQTLQALQTLQCLVYRWDL
FT                   TANTVHWSANSGEALGPALLEQLGRGTTFRAFLGCTDESTDYHRFARALPLASMPYEAL
FT                   VRPAIDGTPAAFRVHDQGRWRAGSDGQPEQAVGTLEILPLLAPVIPGGTADPLTGALTR
FT                   RHLTEALGTLPFGPQARWALLLVGLDDLGRINDRFGFETADRLLVALAGRLRQQLSSAD
FT                   LLLRFSGNKFAILLTETSVEALGAFGERLISEIREARLSAGEGQLPVSVTIGAILPPHQ
FT                   GEAPDAIIARLQEAHEMAKRRGRGRFFLDLQGTRNEGRRRANLQMADEIVQAIDRNDVT
FT                   VAYQPVVRATTRTLVFCEALARIAHDRYSRQYSGHRLVAAADSLGLMGHLDRSMLKQVA
FT                   ADMRRDPTLHVSINVSASSIMDEAWIALYRREVDTDIGRRLIVELTESVAVDHLSAARN
FT                   FIAQVRPSGARIAIDDFGAGATSFRNLRKLGVDLVKIDGGYIINMAKSPDDQAFVRALL
FT                   TLSRQLGIETVAEWVQNEIVAAQLLEWGCDYFQGSLSGLARPLATEHGT"
FT   CDS_pept        complement(359907..360569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86307"
FT                   /db_xref="GOA:A8IJI2"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJI2"
FT                   /protein_id="BAF86307.1"
FT                   /translation="MCWNAGIGSPRPAFAYAGRSFDNFLTRPCDPWRLLPHGRASGACL
FT                   AASMPRTGTRIARSGALRRDNVVMDHRHRTPCGAGRSQEPDMLTPIPLLIIPLAIYNII
FT                   AFITPGSDWRATVASFNLPSGASWQISLGDGFVAISLLILFVELIKATRVSSRSIVDHM
FT                   LSMLLLIASVVEFLMVPQAGTSTFALLICVMLLDVLTGFSVSIRVAQRDVSVAPPTT"
FT   CDS_pept        complement(360663..360851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0310"
FT                   /product="ribosomal protein S32"
FT                   /note="bacterial and organelle form"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86308"
FT                   /db_xref="GOA:A8IJI4"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IJI4"
FT                   /protein_id="BAF86308.1"
FT                   /translation="MAVPKRKTSPSRRGMRRSADALKQPTYVEDKDSGELRRPHHLDLK
FT                   TGMYRGRQILKPKTAEV"
FT   CDS_pept        361213..362157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0311"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86309"
FT                   /db_xref="GOA:A8IJI6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJI6"
FT                   /protein_id="BAF86309.1"
FT                   /translation="MDHMMRPAPTAALAVALTAFAFGGQAFAQTAAPGATPPAAAAPAR
FT                   PADSDPVVETVNGAPIRASELAIAEDDIGPGLPQVQGAARQEYILSFLTDMTLLAQAAQ
FT                   AQKLDQSPEFAAKMNYLRTKALMETLMAAEAKKAVTEDAKRKTYDEFVKQTKPETEVHA
FT                   RHILVDSEAKAKEIAAKAKAGADFAKLAKENSKDSAEDGGDLGYFTKDQMVPEFADAAF
FT                   KLDKGQVSDPVKTQFGWHVIKVEDKRQKPIPTYEQVSDQIDQYLIRKAQSDLVTKLRSD
FT                   AKVEKTSAAPSAAPAAPATPAAPAGAAPAAPKN"
FT   CDS_pept        complement(362237..362836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeS"
FT                   /locus_tag="AZC_0312"
FT                   /product="transcription regulator"
FT                   /note="TetR/AcrR family homolog; YdeS"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86310"
FT                   /db_xref="GOA:A8IJI8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJI8"
FT                   /protein_id="BAF86310.1"
FT                   /translation="MTDAAETAPTRRRTSIGGRRNPESAAAILDAAAAILAENGLGGFS
FT                   IEAVARRAGAGKPTIYRWWPNKAALLIDVYARQKETVLQADTGSLQGDLEDVLSRLFDF
FT                   WRHTPAGAAFRSIIAEAQSDPEALERLRAFLIERRAYVREIVERGIARGDLPADADGAA
FT                   IVEMLFGFAWMRLLTGDLGAAEDIPRRVHLILKGAA"
FT   CDS_pept        362919..363215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86311"
FT                   /db_xref="GOA:A8IJJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJJ0"
FT                   /protein_id="BAF86311.1"
FT                   /translation="MKRSVSFKYELPMTESVPPAQPSPPAPLCRYRLSVGASLGAYPLI
FT                   TGILYGLGPLTETWEVWQKTLAIVPVMVPCMVFGVIPGVQRIGGRWVRRASRN"
FT   CDS_pept        363284..364525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="AZC_0314"
FT                   /product="arginine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86312"
FT                   /db_xref="GOA:A8IJJ2"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJJ2"
FT                   /protein_id="BAF86312.1"
FT                   /translation="MSASISPLAPSALPEVPPVPGVRFATAEAGIRYQGRTDALLVAFD
FT                   KGTAVAGVTTRSLCPSAPVEWCREALKKGKARGLVVNSGNANAFTGLKGRESTALTARI
FT                   AADALGCKPTEIFLASTGVIGEPLDATKFQGVMGDMAGRLAAGPWEGPARAIMTTDTFP
FT                   KLATAQVPFGNTTVTIAGIAKGAGMIAPDMATMLSFVFTDAPIAAPVLQKLLSKLVVNS
FT                   FNAVTVDGDTSTSDTLLLFATGAAKEVGAPAVKDSADPVLRPFRKALKAVLNDLAEQVA
FT                   RDGEGARKLIRVHVSGAVSKSSARRIAFSIANSPLVKTAVAGEDANWGRVVMAVGKAGE
FT                   PADRDRLAISFGDIRVAAEGARDPSYDEQVVSDYMKGDVIDIRVDLGLGKGADRVLTCD
FT                   LTKEYVAINGDYRS"
FT   CDS_pept        364522..364926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0315"
FT                   /product="NTP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86313"
FT                   /db_xref="GOA:A8IJJ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJJ5"
FT                   /protein_id="BAF86313.1"
FT                   /translation="MKITLVAACALVDADNRVLVAQRPEGKALAGLWEFPGGKVEPGER
FT                   PEACLIRELHEELGITVKEACLAPLTFASHGYETFHLLMPLWICRRWEGQVIAREHKAL
FT                   KWLRAGKLRDIPMPPADEPLIPPLIDLLGP"
FT   CDS_pept        365262..365633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0316"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86314"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJJ6"
FT                   /protein_id="BAF86314.1"
FT                   /translation="MGRDLGRWMGTARVGWVVMLALLVAACSSGPGEADMKEAMDRLFR
FT                   QEVDTYNAKVKEENKRLGRAKFAEKSYPVIAQLKKIDCVRPDSKPGYICYFEMSLDGMQ
FT                   QKRPGRFYVEGGSWVYARP"
FT   CDS_pept        complement(365673..366152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0317"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86315"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJJ9"
FT                   /protein_id="BAF86315.1"
FT                   /translation="MMTKAEAAPRDAAPKGEREAPALRSSFPHFLPITTRWSDMDVYGH
FT                   VNNVVYYAYFDTVVAEYLMRTDGVNPHESAAIGLVVETRCSYFQSLTFPETVEAGLRVV
FT                   KLGNTSVRYEIGIFRQGEDTASAQGYFVHVYVDRDTRRPVPLPEHLKRALAPLVV"
FT   CDS_pept        complement(366220..367146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0318"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86316"
FT                   /db_xref="GOA:A8IJK1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJK1"
FT                   /protein_id="BAF86316.1"
FT                   /translation="MHRGREAPICTRMSHPLVFDRALLRARQARALALGPEPFLLERAT
FT                   EDLSERLLTVKRRFETAVDLGTPTDLLSRALAGHPGIGTLMRAAPLAAGLAASERTIVA
FT                   DEEALPFANGSLDLVVSALALQMVNDLPGAFAQVRRALKPDGLFLAALIGGGSLAELRE
FT                   AFAIAESETTGGVSPRVAPFADVRDMGGLLQRAGFALPVTDVDRVVVRYGSPFTLMNEL
FT                   RRMGAGNVLAERRRVPLRRATLLRAAEIYAERFSDADGRVRATFEIVWLSGWVPHESQQ
FT                   KPLRPGSAKMRLADALGTTEKPAGETP"
FT   CDS_pept        complement(367152..367526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86317"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJK4"
FT                   /protein_id="BAF86317.1"
FT                   /translation="MAAPLLICLSGAGATVRLGAAITLLWTHSVQKTEWAEDWRASAEG
FT                   LTLTEMRIEGSGAGMEPPPDAVLQGDRYVAHPKAAPLPSLALRRSGATADYRICVEGRC
FT                   TQMGDLLPAGADPVTLSVCP"
FT   CDS_pept        complement(367658..368683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0320"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86318"
FT                   /db_xref="GOA:A8IJK5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJK5"
FT                   /protein_id="BAF86318.1"
FT                   /translation="MTNMMKAAVVHQLGQPLVIEQVPVPEPGPEQILVRIAATGVCHTD
FT                   LHAVKGDWPVKPKPPFIPGHEGVGTVVGVGSRVKRVKEGDRVGIPWLHTACGYCPHCRT
FT                   GWETLCADQQNTGYSVNGSFAEYAVADPNYVGRLPDKLDWGPAAPVLCAGVTVYKGLKE
FT                   TEVKPGEWVAISGIGGLGHMAVQYAKAMGMHVVAIDVHPDKLELAKKLGAELVVNAREE
FT                   DPGAVVQKAIGGVHGVLVTAVSPKAFEQAFNVLRAHGTMALCGLPPGMFAMPIFDTVLK
FT                   RITVRGSIVGTRQDLEEALEFAGNGQVAAHFSWDKLENINEIFHRMEEGGIDGRIVLNM
FT                   N"
FT   CDS_pept        368942..370420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0321"
FT                   /product="putative succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86319"
FT                   /db_xref="GOA:A8IJK7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJK7"
FT                   /protein_id="BAF86319.1"
FT                   /translation="MPRAGGVPWGSSRMPADRRARSSHRMETAMAYASTNPFTAEVLQT
FT                   FPNATDAEVVAAIDAAHAAFLGWRETSFAYRARILQNAADLLRRDVDGYARLLTLEMGK
FT                   LFSEAKGEVELSARIFEYYVQNAERLLEPEPLPVADPAEGKAVLVCEPLGVLLAIEPWN
FT                   FPYYQIARIIAPQLSAGNTVLLKHASNVPQSAAAFERLMLEAGLPKGAFRNLYATRAQI
FT                   ELILNDPRVHGVALTGSEGAGAEVASVAGKALKKSTMELGGADAFVVLKDADLAKTVKW
FT                   AVFGRHWNGGQVCVSSKRMIIVDEVYDAFFEQYKAGVAGLKAGDPFDAQTTLAPLSSQG
FT                   AADEVKQKIQEAVAHGATAIEVGAPVPNQGAFVQPTILTNITEDNPARYWEFFGPVSML
FT                   FRAKDEDDAVRIANDSPFGLGGSVFTSDTKHGAEVAKRISTGMVFVNHPTMVKADLPFG
FT                   GIRRSGYGRELLGLGLKEFVNHKLIDVVDIDAPF"
FT   CDS_pept        complement(370464..372677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0322"
FT                   /product="TRAP transporter"
FT                   /note="4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86320"
FT                   /db_xref="GOA:A8IJL0"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJL0"
FT                   /protein_id="BAF86320.1"
FT                   /translation="MGAVGCPPARVFLLPHRVAASGGADPWSDAFMSTPSIPADSDITP
FT                   PQTFAPIDDMEHGLPPGFGTGFKGTLLFWIAIAFSAYQLFVSTYAILPSQVIRALHVGF
FT                   LCLISAALIANHRSTNKATLALGWGLGLIGFGTGLYQWIFYNDLILRAGEISQADFVMG
FT                   IALIVVVFVISWQMMGAALPLICGAFLLYGLFGQYLPAPLDHRGYSLEQIVEQMSFGTE
FT                   GIYGTPIAVSATYIFLFVLFGTFLERAGMIQLFNDIALGLFGRARGGPAKVAVFSSALM
FT                   GTISGSGVANVVTVGQFTIPLMKRFGYSASFAGGVEATASMGGQIMPPVMGAVAFIMAE
FT                   TIGVPYATIVKAAIIPAILYFASAFWMVHLEAGKHGLVGIPKDRVPRVIPALRRGWYLL
FT                   LPLAVLVYLLFAGYTPLFAGAVGLALTVVLILGQSLAGEAGKPALRLAFWILIGLVCAS
FT                   FFQFGVMVIVGLVLALIVVNGITRGGRATLALCRDGLAEGARQALPVGMACAIVGTVIG
FT                   VLTLTGTATIFGGWVVSIGKETLWLSLLLTIVTSIILGTGIPTIPTYIITASLAAPAML
FT                   SLGVPLIVSHMFVFYYGIIADLTPPVALAALAAAPIAKASPDAIGWQACRIALAGFLIP
FT                   VMAVYEPTLMLQQGGEIAAHYGYWVEVAYVFTKACIVIGLLGAIAIGWLFGPLGLIERI
FT                   VAGLAALLFVAAVPMSDISGFALLAVFLGWHLLQVRRAPPRPV"
FT   CDS_pept        complement(372721..373662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0323"
FT                   /product="TRAP transporter solute receptor"
FT                   /note="TAXI family precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86321"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJL1"
FT                   /protein_id="BAF86321.1"
FT                   /translation="MRKLALAALAAVFALSPLAARADFINILTGGTSGVYYPLGVAISK
FT                   IVSDKVPGARPSVQATKASVENLILIQQGKGEIGFTLADSLADGWAGKEDAGFKTPLKK
FT                   VRALAAIYPNYIQIVASKDSGIKSIADLKGKRLSVGAPKSGTELNARAILNAAGLKYED
FT                   LGKVEYLPFAESVELMKNRQLDATLQSAGLGVASIKDLATSVEINVVEIPASVVEKVGT
FT                   PYLKASIPAGTYTGQDKDVPTAAVPNFLVVREDMKEGDVYAITKAIFENLPELQAAHVA
FT                   AKSISLKDAMKGSPVPFHPGAEKYFKEQGVTP"
FT   CDS_pept        373684..375096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0324"
FT                   /product="hydroxypyruvate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86322"
FT                   /db_xref="GOA:A8IJL4"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJL4"
FT                   /protein_id="BAF86322.1"
FT                   /translation="MFCFGSEAIASPAKGQRLLRAFDEFPMVSAGGAAAALPSACARAR
FT                   TIGIKYTKGNAMPSDRDILLALFDAALNAAVPEGKFEGRLPEPPKGRTIVIGAGKASAR
FT                   MARAFEAAWGRPCEGLIVTRYGHGCETQHIEIVEAAHPVPDQAGLDAARRILELARSAG
FT                   PDDLVVCLMSGGASALLTLPAEGLTLADKQALNKQLLKSGAPIGIMNRVRKSVSAIKGG
FT                   RLAAAIAPARAVTYLISDVPGDDPAAIGSGPTIPEASDPEEVLRLMRAWGIEASPELEA
FT                   VIRANVVSGEALPGQEVHMIATPLMALQAAEAKARDFGLTPLILGDAIEGEAREAANVF
FT                   AGISRSAATHGLPVKAPCVLLSGGETTVTVRGKGRGGRNVEFLLALALALKGEAGLSAI
FT                   ACDTDGVDGTEDNAGAWFDAAILEEARAKGLSADAFLANNDGYSFFAALDRLVVTGPTL
FT                   TNVNDFRAILIR"
FT   CDS_pept        375196..375936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86323"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJL7"
FT                   /protein_id="BAF86323.1"
FT                   /translation="MLRSVPGRRGELLQCGRSVPLTFAAMHIVSQHKPMGEAGEDIRSF
FT                   TMSDERAPGIIRKLWPGEVQIFREHLLRLDTETRRSRFGSAVSDEFITHYSERVFRSGS
FT                   VVHGCFVDGVLRAAAELYPFSEILPTEGEAAFSVEAAFQNLGLGTLLMSRTVLCARNRG
FT                   IRTLHMSCLARNRRMQQIARKFDADFTFETDEVVAQLKAPFPTLASLTREATADAQGMA
FT                   GALFQAQWTAGQRMLSLVLSPTGA"
FT   CDS_pept        complement(375949..376278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0326"
FT                   /product="quaternary ammonium compound-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86324"
FT                   /db_xref="GOA:A8IJL9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJL9"
FT                   /protein_id="BAF86324.1"
FT                   /translation="MTYALLFVAIVAEVIATSALKAAEGFTRLVPSLIVIVGYGVAFVC
FT                   LSLTLKTIPVGIAYATWSGVGIVLVAGVGWALYGQSLDLAGAVGLGLIIAGVLIVNLVS
FT                   KTAVH"
FT   CDS_pept        complement(376702..379092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0327"
FT                   /product="pyruvate dehydrogenase"
FT                   /note="E1 component-like"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86325"
FT                   /db_xref="GOA:A8IJM1"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJM1"
FT                   /protein_id="BAF86325.1"
FT                   /translation="MTTAQELEILAELERKALWLASWTIHNANHLRPSTDGLKVGGHQA
FT                   SSASLATIMTALYFHTLRPQDRVAVKPHASPIFHAIQYLLGAQTREKLEAFRAYKGAQS
FT                   YPSRTKDTDDVDFSTGSVGLGVAQTLFASLAQDYVRAHGLTDRPEGRMIALVGDAELDE
FT                   GNVFEALLEGWKHDVRNTWWIVDYNRQSLDAVVREGLYERFIGIFEAMGWQVVVLKYGS
FT                   LQQAAFREPGGEKLRHWIDTCPNGEYSALTFQGGAAWRKRLMDDLGDQGDVTRLVEARS
FT                   DAELSALMTNLGGHDLPTILDAFDGIDHDRPVCFLCYTVKGFGLPLAGHKDNHAGLMTP
FT                   TQMDTLRAAMNIRAGHEWDRFEGLTLPPATLERFLKDVPFRREGTRRYSDAALAVPSIA
FT                   PPPNASLSTQAGFGLILQDLARGDSALASRIVTTSPDVTVSTNLGPWVNRRGLFAQREL
FT                   ADVFKRERIPSTFNWEFSPDGQHMELGIAEMNLFLMLSALGLSHSLFGARLIPVGTLYD
FT                   PFICRGLDALNYACYQDARFILVATPSGITLAPEGGAHQSIATPLIGMSQDGLAAFEPA
FT                   FVDELAVLVEFAFDYVQRDGGGPDEARNWLRDETGGSVYFRLSTRALEQPRRAFTQTQK
FT                   RHMVDGAYWLREPGPNAEVVIAVQGALAPEAIEAVGLIAEDRRDVGLLMVTSADRLNAG
FT                   WTAASRAREQGHYSAESHVERLLAPLPRHCGLVSVIDGHPATLGWLGSVMGHRQRALGV
FT                   EHFGQTGSLQDLYRHHGVDAAAIVSAAQAIAPGRPMRHLRALG"
FT   CDS_pept        379411..380208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0328"
FT                   /product="protein of unknown function"
FT                   /note="DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86326"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJM3"
FT                   /protein_id="BAF86326.1"
FT                   /translation="MTIRVGIGGWTFEPWRGTFFPPGLPHARELEYAAGQVTTIEVNGT
FT                   FYRTQTPKTFASWAAQVPDGFVFSLKAPRYATNRRVLAEGGESIARFVESGLAELGDKL
FT                   GPINWQFPPTKAFDPDDFGAFLNHLPETVDGVKLRHALEVRHASFCTAEFVALARKHKM
FT                   AVIFADDDDYPAIADVTADFVYARLQRAREEEPTGYSPDVLKGWLERARIWEAGGVPED
FT                   LPSYGDPAPKPKKAARRDVFVYMINGAKVRAPAAAQALLALVR"
FT   CDS_pept        complement(380188..380637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="K+ channel, pore region"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86327"
FT                   /db_xref="GOA:A8IJM6"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJM6"
FT                   /protein_id="BAF86327.1"
FT                   /translation="MPAELVYGILISLITVVIHSVASVFLVRALLVFTKRVRLRHAMRG
FT                   LLLGMMLTGAILTFAHLVEVAVWAVAYVAVDGVVQDKDSYYLAFVNFTTLGYGDLLPAK
FT                   PWRLLGPVTAANGMLLFGWSTALIFAVLTRLSEQLGVHHLSDKGE"
FT   CDS_pept        380669..381151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0330"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86328"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJM7"
FT                   /protein_id="BAF86328.1"
FT                   /translation="MAVEWGNNKASRASRRTCRAPRAPEPGEDGMCYDATHRDAVRKPR
FT                   RPRAGEPGGHSRKSSCSRRRGRKGTARDLSRQGGTLMTPNTAQDKPVKLQYWPSSHTVD
FT                   APDSWPEPYGFDTVEDAVVFAMTQSPANRELAWLRTDKGEVMKPDQIYRRWALRAI"
FT   CDS_pept        381331..383151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0331"
FT                   /product="small GTP-binding protein"
FT                   /note="GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86329"
FT                   /db_xref="GOA:A8IJN0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJN0"
FT                   /protein_id="BAF86329.1"
FT                   /translation="MQLRNIAIIAHVDHGKTTLVDKLLQQSGSFRENQRVAERVMDSND
FT                   LEKERGITILAKATSVVWNDIRINIVDTPGHADFGGEVERILSMVDGAIVLVDAAEGPM
FT                   PQTKFVVGKALKIGLKPIVAINKVDRPDGRPQEVINEVFDLFAALDANDEQLDFPILYG
FT                   SGRDGWMALTPEGPKDEGLGPLFELVVKHVPPAKTEDGAFRMLGTLLEANPFLGRIITG
FT                   RIASGTVKPNQSIKVIDREGKLVETGRVSKILAFRGIERSPIEVGEAGDIVSIAGLVKG
FT                   SVADTFCDPSVDTPIQAQPIDPPTVTMSFIVNDSPLAGTEGDKVTSRMIRDRLFKEAEG
FT                   NVTLKIEESADKDSFFVSGRGELQLAILIETMRREGFELAVSRPRVVFSQDEDGNTLEP
FT                   IEEVVIDVDEEYSGTVVQKMSERRAEMVEMRPSGGNRQRLLFHAPTRGLIGYQSELLTD
FT                   TRGTAIMNRLFHSYQPFKGDIPGRINGVLISNEQGEAVAYALWNLEDRGPMVIEPGWKV
FT                   YQGMIIGIHNRDNDLEVNVLKGKKLTNIRTTSKDEAVRLTPPIRMTLERSLAWIQDDEL
FT                   VEVTPKSIRLRKRYLDPNERKRMKGKVDVA"
FT   CDS_pept        complement(383246..383932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0332"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86330"
FT                   /db_xref="GOA:A8IJN2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJN2"
FT                   /protein_id="BAF86330.1"
FT                   /translation="MASPVLSRGAGPLFPPHPFHKPSGWRGLLRRMGILRPLKAAREMS
FT                   MIEIVAEKREEAAAREALLDLCLPERFEKASERIREDRLPAEGLALAAHGPDGRLAATV
FT                   RLWHVSAGPARPALLLGPLAVHPWFRDRGLGGQMMRAALERAEALGHDAVLLVGDAPYY
FT                   ARFGFSAQKTSGLWMPGPFDPARLLGLELKPGALDGARGLISPTGLPAEKPSLDALIAA
FT                   TAKRSA"
FT   CDS_pept        complement(384008..385138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0333"
FT                   /product="ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86331"
FT                   /db_xref="GOA:A8IJN5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJN5"
FT                   /protein_id="BAF86331.1"
FT                   /translation="MTDRIREFLRNRREDGPCVVVDLDVVRANYTAFARALPDTRVFYA
FT                   VKANPDAAILKALAELGSCFDCASVQEIEMALFAGATPDRISFGNTIKKERDIERAYKI
FT                   GVRLFAVDCYEEVEKIARVAPGARVFCRILCDGAGAEWPLSRKFGCVPEMAPDVLEHAF
FT                   RLGLSPYGVSFHVGSQQKNVHAWDQALGSAAYIFRECAVRGISLSMVNLGGGFPTKYLQ
FT                   DVPKAQAYGEAIFDSLRRHFGNAIPETIMEPGRGMVGNAGIIETEVVLISKKAESDTMR
FT                   WVYLDIGKFGGLAETMDEAIRYPLRTPRDGDDTAPCVLAGPTCDSADVLYEKTPVELPL
FT                   SLSIGDKVLIEACGAYTTTYSAVAFNGFPPLKSYVI"
FT   CDS_pept        386047..387324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0334"
FT                   /product="5-aminolevulinic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86332"
FT                   /db_xref="GOA:A8IJN7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJN7"
FT                   /protein_id="BAF86332.1"
FT                   /translation="MSYDHFFADAVDALRRERRYRTFADVERDATRFPRATWHSPGGPR
FT                   EIVVWCSNDYLGMGSHPAVVEAMRETALRRGAGAGGTRNISGNSHEIVLLERELADLHG
FT                   KEQGLVFTSGYVSNATGISTIAKLIPDCVVISDELNHNSMIEGVRQGGRQKFIFRHNDL
FT                   AHLEEILQAVADRPKLIVFESVYSMDGDIAPMAAICDLAERYGAMTYLDEVHAVGMYGP
FT                   RGGGVAERDGVMDRIDVIEGTLGKAFGVVGGYLTGKRVVMDAVRSYAPGFIFTTALPPA
FT                   VAAAATASIRHLKASNAERDGQRRQVAKVKAALAAAGLPQMETPTHIVPVMVGDAKACK
FT                   AASDVLLNEHNIYIQPINYPTVPRGTERLRITPTPFHNDKLIAHLADALNDVWNRLDLP
FT                   RVRDTGSERRLVAAGAASLAMPTAGG"
FT   CDS_pept        387551..388261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86333"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJN9"
FT                   /protein_id="BAF86333.1"
FT                   /translation="MCQRGAGMALLLLCAAAAGTIPARAASDGPSFDCRAARSKIEKAI
FT                   CADPALSALDRRIAAAYQKLLAALDAPGRTALRMDQRTFLEARDIQARRSDYDLKADLT
FT                   GRAAFLESIEPVPRAGFAGTWTNVYGDVSGSTAGSGFKVEISTVQPYPSYPTCTLSASG
FT                   AVSGNTLLVGGSEEERKDNDGWTVKLTREGATLSAELQRPREAEFGSPPFCGFRSTIDG
FT                   SFFATRQPSGNPAR"
FT   CDS_pept        388380..389318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86334"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJP1"
FT                   /protein_id="BAF86334.1"
FT                   /translation="MQPPLPIPWSRLRLRGREPGHPPGVLRSRLTAHPPWRARPPGGRC
FT                   VVRLPLTVRGREPGMRRFVRVVALAAPLIWGGPAGAQVVDGWGWSIIIPSITGTDVLGL
FT                   HLRDLRRQDEERARRAAQGQSAVPRSQPAVDTAVLRYTPSKARRAANLAGMVEKTRASD
FT                   PAGAADLQKLFAESDIIASIDARLRPQGLRVDDLGDAFAVWWTTVWAAARGSNDTPPPR
FT                   TVNAVRRQAAEALSGADGIRTATDAQKQELAEALLVQAVLIDGAVDQAKGNPAQMRQVS
FT                   AAARKIAGGMGLDVGAMQLTEKGFVLAVGSR"
FT   CDS_pept        complement(389370..391703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0337"
FT                   /product="penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86335"
FT                   /db_xref="GOA:A8IJP4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJP4"
FT                   /protein_id="BAF86335.1"
FT                   /translation="MTGLFMAGRGTGGQERREPSMRAASGSPEPSFDIRLDPEDRPGGG
FT                   RKPARKADAAGGGRPARDQRARVEPSLDGDAAESEDMAAAPRRSKTEGSSRTSKGSTSS
FT                   GGRGKAKSERRRKRGFFSLFGLIKWLFILGLWAAVGVGALVAYEASKLPPMQTLMVPKR
FT                   PPTVMIQSFDGKPLATRGDMGGAAVPIKELPAYLPKAFVAIEDRRFYDHFGLDIWGLAR
FT                   AMAANAVSRRVRQGGSTLTQQLAKNLFLTQERTFSRKIQELVLALWLEKKFTKTEILDL
FT                   YLNRVYFGNGAYGVEAAAQRYFNKSARNVTLSEAAMLAGLVNAPSRLAPTRNLKAAQDR
FT                   ANLVLAAMREQGFITEDMAKVALARPATLAKPSTPDSIGYVADWVMDQLDSYVGTLPGD
FT                   VIVRTTIDPVLQQTAQASLTDALNKQGQKYGVGQGAVVSLDTDGAVKALVGGRSYEDSQ
FT                   YNRAVTARRQPGSSFKPFIYLTALEKGLTPETVREDGPIQLKGWKPENASHQYLGPVQL
FT                   QQALAMSLNTVSVRLALEVGPKAVVATAHRLGITSTLDPNPSIALGTSEVSVLELASAY
FT                   VPFANGGIGVIPYVIESVKGPDGKMLYSRSTSGPGRVIDPAYVGMMNHMLEQTIAVGTG
FT                   RRAELPGWDAAGKTGTSQDYRDAWFVGYTARIVTAVWIGNDDSSPTKKASGANLPAEIW
FT                   SRYMKVAHKDLPPTELPGAGRSYVASGTFGFGQQGGMLPPGQVPDEAPPAIVGNLPPQQ
FT                   PRPQQDEPMTLDRWFVDTFLGGRR"
FT   CDS_pept        391739..394693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0338"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86336"
FT                   /db_xref="GOA:A8IJP6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJP6"
FT                   /protein_id="BAF86336.1"
FT                   /translation="MRPFKVRLPDHPRCRCNSRAGVACKPRAVTAPQDWAKPEREAPSG
FT                   SLKTSMTAPRPSRPSRTIGEPFEGTRLKAEVLALAKAHAGPKADLRPALVARLKQAMAE
FT                   GRAEAERLLNADGSGRMCAIRLSALQDAVIAAAHEVATTVMYPIDNPSRAERMAVVAVG
FT                   GYGRGMMAPGSDTDILFVLPYKQTAWGESVAEAMLYILWDLGLKVGHATRSVDECLRQA
FT                   RADVTIRTAILESRFLVGDKALFEDLEARFDKEVVEGTAAEFVAAKMAEREERLRRAGT
FT                   SRYLVEPNVKESKGGLRDLHTLFWMAKYVYRVHSTDELVAKGVFTKEEARLFTRCEDFL
FT                   WSVRCHLHFLTNRAEERLSFDVQREMAERLGYTSHPGQQDVERFMKHYFLVAKEVGDLT
FT                   AILSAALEARHDKSVPGLKGMVARLRGAPKRVKLKESADFWIDNERLNVIDDEVFRRDP
FT                   VNLIRLFAIADKRDVNFHPDALRLAARSLNLIDGKLRENPEANRLFLDVLCSKNAPEEV
FT                   LRRMNETGVLGRFVPEFGKVVAMMQFNMYHHYTVDEHLLRCIGILSEIERKTNPENGLA
FT                   NDLMATIKPRHLLYVALLLHDIAKGRPEDHSIAGARICRKLCPRFGLSAAETETVAWLV
FT                   EQHLVMSTVAQSRDLSDRKTIENFAAVVQNLDRMKMLTVLTTADIRAVGPGVWNGWKAQ
FT                   LLRTLYYETEPVLTGGFSEVDRGKRVQVAQAQLRHALADWTDEQFSTYAARHYPPYWLR
FT                   VDLETKVRHARFILATEEAGKALATCAEIVAERGITVLTVLAPDHPKLLSVIAGACAAA
FT                   GANIVDAQISTTTDGLALDTIAVRRAFDRDEDEERRAGRIRDAIEKALTGEVRLPEVMA
FT                   KKLPKARRTFSVEPEVTVNNTWSNRHTVVEVSGIDRPGLLFELTNTLSRLNLNIASAHV
FT                   ATFGERAVDVFYVTDLMGAKITGAARQSTIRRALIGVFEGSFDEEEPPRRVVRV"
FT   CDS_pept        complement(394718..395875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86337"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJP8"
FT                   /protein_id="BAF86337.1"
FT                   /translation="MFGSALYYPHIDIPDREWIRSAIIFWDRIKTIAPLSIENPYQNKD
FT                   THILYEEGIIEPLRCELYPQTLDSLATKIINLVEGSLTCKVGSEDPNAHTLLKAEMAGN
FT                   IVRDNVRSAHIHPKKFSHMLINFIEKMKYSPTNSSPNSDKPLKFAPELREIMHYYGRSG
FT                   NEDNWLIVDNFFAAFYMSALASLLAKDTGLSALTNEEMPLGFSLQSVLSDINKNLPEGK
FT                   DNSKGALVSFVMETIRIDPQTDIQKIINFRRSRETQIAELSAQFSEISAKLPLFETETD
FT                   LKENVKDTYSKKIRPKLESLKDELNDVGISSIWEGFQRAVTYTLPAGSAIGCLTGITGT
FT                   TLIAAGAAIAITDVAIKNHLASKKIRRASPYTYLLDVKRKFSTTS"
FT   CDS_pept        396160..396858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0340"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86338"
FT                   /db_xref="GOA:A8IJQ0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJQ0"
FT                   /protein_id="BAF86338.1"
FT                   /translation="MIRSAGPFSSAPHKGEAPRAGLSRRAFLAGSAVSLGALGLAGCAS
FT                   QDGMTLAEAQKLYGPVPDKKFAIPAADVSKVDPKYFRRTVPYETKEAVGTIIVDPANYY
FT                   VYRIEEDGKATRYGANVGRDGFRWNGEAYVGRKSEWATWTPPREMIKRQPEAAKWAGGM
FT                   PGGLDNPLGARTLHLYQNGSYTLYTIYATSDPETIGSGITSGCVGLLTQDMIDLYDKTP
FT                   VKTKVIVLPA"
FT   CDS_pept        397457..398626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0341"
FT                   /product="major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86339"
FT                   /db_xref="GOA:A8IJQ3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJQ3"
FT                   /protein_id="BAF86339.1"
FT                   /translation="MPLSLLSLAVAAFGIGTTEFVIMGLLPDVARDLGVSIPDAGLLVS
FT                   GYALGVVIGAPLLAILTARLPRKATLVGLMGLFIVGNVLCALSPTYGLLMGARIVTAFC
FT                   HAAFFGIGSVVAADLVPRNKRAQAIALMFAGLTLANVLGVPAGTAFGQWLGWRATFWAV
FT                   VGIGLAALVALVLLLPGRIPMKQSRILTEFRVLKDRQVFLAMVISVVCSASLFSVFTYI
FT                   SPLLRDVTHFSAEAVTGALLLFGVGLTAGNMLGGRLADWRLMPSLIGTLVVLIVVLAAF
FT                   TGTSASTVPALATLLVWGVLAFALVPLLQLRVVDTAHAAPNLASTLNQGAFNLGNAIGA
FT                   WIGAVAITHGIAYQHLPLVGVALSTTALGLSLLSARLDRPALEGVREGA"
FT   CDS_pept        complement(398633..399064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="TM2"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86340"
FT                   /db_xref="GOA:A8IJQ5"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJQ5"
FT                   /protein_id="BAF86340.1"
FT                   /translation="MRRFGPAAPPCQIPLRTREGDQVRDGSPRRSLPMTDATPNLSIDE
FT                   QILIETRLANEGPSLVVAYLLWIFLGIVSAHRFYLGRAGTAVIQILTFFIGIGFIWLLV
FT                   DGFLIPGLARQKRERMRQQMIVERVAQLATAPRAVLPQG"
FT   CDS_pept        399263..399859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0343"
FT                   /product="sigma 54 modulation protein"
FT                   /note="ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86341"
FT                   /db_xref="GOA:A8IJQ7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJQ7"
FT                   /protein_id="BAF86341.1"
FT                   /translation="MALRVSGKNMDVGEALRQRFSDRVSEVVGKYFDGGWSGHATVCRE
FT                   GSGYRSELLLHLDSGTNLQAHGNAQEPNACADAAMEKIEKRLRRYKQRLKGRHPQPVNG
FT                   VDSYLAQSYVLDISPLEEAEEEDIEGWSPTVVAEHPTRLKTLSVRDAVVELEVTGAPVV
FT                   VFRHAGHGRVSVVYRRADGHVGWIDPSAISPEESH"
FT   CDS_pept        400053..400517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="AZC_0344"
FT                   /product="PTS IIA-like nitrogen-regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86342"
FT                   /db_xref="GOA:A8IJQ9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJQ9"
FT                   /protein_id="BAF86342.1"
FT                   /translation="MPLADLVAREAVFPSLRASSKKQALQELAQHAATLLGRDAREIFE
FT                   TLLQRERLGSTGVGNGIAIPHGKLPKLDKLFGAFARLEKPIDFEALDGEPVDLVFLLLA
FT                   PEAAGADHLKSLARIARMLRDPATADKLRGTREAADIYALLTTTPASDAA"
FT   CDS_pept        400576..400836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0345"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86343"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJR1"
FT                   /protein_id="BAF86343.1"
FT                   /translation="MSSGSAEGAPEGLEFLLADRAVERVSPLAFGRHMEGSLGQPVAVG
FT                   PAGKRQPDTAIGADVDGAAAHIVGIALVIAERRQIAGVGRV"
FT   CDS_pept        complement(400997..401446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="Cupin, RmlC-type"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86344"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJR4"
FT                   /protein_id="BAF86344.1"
FT                   /translation="MADIACSDDSAAPAAPNRTAGMAFPIDPGTGKEHREFFEIDEVDG
FT                   WVEVAPGIEAKVLAGSIDEAARKGHLNRLVRWAPHARIDEVKVHDFYEEVFVARGSLIV
FT                   AAQTPPHTPETFNAPSFACRPPGALHGPFQAGPDGCLLFETQFYL"
FT   CDS_pept        complement(401483..401749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0347"
FT                   /product="protein of unknown function"
FT                   /note="DUF1150"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86345"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJR5"
FT                   /protein_id="BAF86345.1"
FT                   /translation="MNTEKINETNIPMTPEALAVLGGGEIAYLRTIKSEDAQRLFPQAP
FT                   EMQPGLTLFTLHAADGTPIMLTDSREAALANAFQNELTTVSVH"
FT   CDS_pept        complement(401793..402221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0348"
FT                   /product="putative small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86346"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJR8"
FT                   /protein_id="BAF86346.1"
FT                   /translation="MSRLSSLSSPFLLGFDEVERTLDRVAKSADGYPPYNVERIESGSG
FT                   SPLRLRITLAVAGFSQDELEVSIEEKELTIRGRQVEDGEERIFLHRGIAARQFQRTFVL
FT                   AEGMNVLGAELRNGLLSIDLVRPEPVRQAKRIDIVSRS"
FT   CDS_pept        complement(402408..404144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0349"
FT                   /product="glutamate synthase"
FT                   /note="putative large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86347"
FT                   /db_xref="GOA:A8IJS1"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJS1"
FT                   /protein_id="BAF86347.1"
FT                   /translation="MRRQTAPDGPSRRGPAGVLPLWRARRKTMSGGLQPGTVLWLRRYS
FT                   FFFAVVALATLALILSFASHAAWTWVFAAMMPFVAIGLFDAFQTRHSLLRNYPLIGSMR
FT                   WLFEALRPYLRQYIVEGDEEGRPYPRMDRSLVYARAKQEEDRQPFGTELNAYSSEYEWM
FT                   THSLAPMPVAEEPFRVTVGGPQCAKPYSASVLNISAMSFGSLGRNAIEALNLGAKTGGF
FT                   YHDTGEGGLSPYHRTYGGDIVWELGSGYFGCRNRDGSFSPERFAEKAADDQVKMVEIKL
FT                   SQGAKPGHGGVLPAAKVTPEIAEIRGIALGEDCISPSRHPAFNSPVQLMEFVAKLRELS
FT                   GGKPVGFKLCVGHPSETFAIVKAMLKTGIRPDFIVVDGSEGGTGAAPRELADHVGMPLR
FT                   EGLVLMRNALVGAGLRGEVKLAASGKVTSGFSMAANMAIGADWCNAARAFMFSLGCVQS
FT                   LRCHTGLCPTGVATNDPHLQRGLVVEDKAERVANFQRHTVHALAELVAAAGLSHPSELL
FT                   PHHLWHRVSPIEVRPLDKLYPFLAPFALVEAPEETPYGAEWRAADAESFTPRMDVGPLR
FT                   AA"
FT   CDS_pept        complement(404253..405335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86348"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJS3"
FT                   /protein_id="BAF86348.1"
FT                   /translation="MRSAFRPLRENVPIEPVFAPIGRTVSSKSQGPPHRSGPPGRIGAA
FT                   SRVKEPIMDALSPAPALLGIGYSIRATSPEFEDLPAKLDEAERLGVDFVELPTFAWTLV
FT                   VNGRILDDRLKRLVAATRDRPFGYTVHGPLAINLMDVPARLPRHEALLAASIEIAGALG
FT                   AENYVMHTGCVREQDDDIEVAYKRQRDALALAGDLAARHDLTVCVENVFRFEKMRETAL
FT                   PSRLAAELDALDHAHVRATLDVSHAYQRCTEAKVPLLPELAALAPFAKHVHVHDSFGRA
FT                   MESWSVDEAERLGLGEGDLHLPVGWGDLPWETIAAQCRLAPRAILNLELHRRYWSELPS
FT                   QIPVMRQLADAFATAAATAA"
FT   CDS_pept        complement(405416..405796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0351"
FT                   /product="response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86349"
FT                   /db_xref="GOA:A8IJS5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJS5"
FT                   /protein_id="BAF86349.1"
FT                   /translation="MALTILYVDDEADIREIASLSLGLDPGLTALTAASGPEAVARAKA
FT                   GGIDLILMDVMMPGVDGPTTLATLRADAATQAIPVAFVTARTQAHEVEHFRSLGAVGVI
FT                   AKPFDPMTLAATVRRLHATAME"
FT   CDS_pept        complement(405827..407587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0352"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86350"
FT                   /db_xref="GOA:A8IJS8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJS8"
FT                   /protein_id="BAF86350.1"
FT                   /translation="MLMQRRPKDRRRFRRGIRNVSIIAVLGACVSIAIVMAVGFASFRE
FT                   FAASQHAREDLIYSSSIRAELQSIYEQLLTVESATRGFIITGEAEFRPPLDEDRTRILA
FT                   RIAAVTKFAVERPEHTDDLARLKRLAEAELRLLGEMIDARMHSDATPAGSILQVRQSKG
FT                   LMDQIAETVESIAEAEIGAINARTQEVRVVGQRTKTTLLALLGAAIAVVFGSTAVMLTH
FT                   LVGRRRAERALGDALSRQRAILASAIDSIVTVNVEGRIESANPATTRLLGWQPEEIAGK
FT                   PLGTLFSLPEGTTPTDFMTELSSTAKDGGGVRELIGLRKDGGTVPVDVAIGRMRDSGGQ
FT                   NLVAVLHDITERKRAEVMKNEFVSTVSHELRTPLTSIAGSLGLLAGGATGSLPEGAQRL
FT                   VTIASQNCRRLVRLINDILDIEKMQSSGITFARDTVSLAEVAERSVEQNSGFALEHQVA
FT                   LTLEVEPGDLRVTGDADRLIQVLTNLLSNAVKFSPAGSTVEVSVARRGDHVRATVRDHG
FT                   MGIPESFRSAIFTRFAQADNSDTRQRGGTGLGLAIAREIADHHDGTLSFETEEGVGTAF
FT                   HLDLPALEAP"
FT   CDS_pept        complement(407691..408446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0353"
FT                   /product="putative GMP synthase-glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86351"
FT                   /db_xref="GOA:A8IJS9"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJS9"
FT                   /protein_id="BAF86351.1"
FT                   /translation="MDIRTDARAPWEARHKGRILTILHQATSTPGRIGRFLELRGYELD
FT                   IRRPALGEALPDTLEDHVGTVVFGGPMSANDPFPWIAEEMTLIGKALDADAPLLGVCLG
FT                   AQLMARTLGATVSRHEAGLSEIGYYPLRPTALGSELLPWPDHVYHWHSEGFELPAGADL
FT                   LAQGDVFPNQAFRYGQHAFAVQFHPEVTHEMMCRWTTKGAAKLSTPGAQPSDAHFDGWY
FT                   RHDPAVCHWLEHFLDAWLDLTVVEVEEEA"
FT   CDS_pept        complement(408430..408909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0354"
FT                   /product="protein of unknown function"
FT                   /note="DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86352"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJT2"
FT                   /protein_id="BAF86352.1"
FT                   /translation="MFRALSDFISDIAGERREASAFQDNDYRLAAAVLLVHVMAIDGAV
FT                   TDEERGVLRDILSSRFDLSAADTDSLVELAIARDAEAVDLYAFTSVLNRALDEEGRLRV
FT                   VEMMFEVAYADGSLTEFEDNLVWRAAELLNIGSRDRVRIRREVRREVEGDGGHSD"
FT   CDS_pept        complement(409060..409356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0355"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86353"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJT4"
FT                   /protein_id="BAF86353.1"
FT                   /translation="MTHTDHHRPSHRLGASALAVALACTLMGASVAQAQQTKPVIVSPT
FT                   YIAPIPGQNLSPPAPRQNMVPTPPPPTRPGEGDSARRIQGGSSQRQPLPNNNN"
FT   CDS_pept        410171..410566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0356"
FT                   /product="putative PAS protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86354"
FT                   /db_xref="GOA:A8IJT7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJT7"
FT                   /protein_id="BAF86354.1"
FT                   /translation="MSEQLEARGMALLVEDEPFVAMVARQILEDEGFHVSHANTGAGAL
FT                   SVLEAGPQELVLAVVDIGLPDMSGDALVQQITAFRPDLPVMIASGYGADELLQRFPSGG
FT                   RTALLPKPYDTAALRSALRTLGFSVEA"
FT   CDS_pept        complement(410609..410947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0357"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86355"
FT                   /db_xref="GOA:A8IJT9"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJT9"
FT                   /protein_id="BAF86355.1"
FT                   /translation="MAKRALLLFLAAGFAWITQVFLAISLYAAIEPHLKAPLAALITAA
FT                   ATLALTGLLAAIALWRRRQPAPVLGASALGFSTLSAVSRFAERHPMATVAVAAGAGLLQ
FT                   ALLATRRR"
FT   CDS_pept        complement(410956..411294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0358"
FT                   /product="protein of unknown function"
FT                   /note="DUF883, ElaB"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86356"
FT                   /db_xref="GOA:A8IJU1"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJU1"
FT                   /protein_id="BAF86356.1"
FT                   /translation="MPPERGTPSDPTEIPMSEKPDLSATQDNLADLRADLEQLRGDVAK
FT                   LVETLGKTAKQSVKSAAADAENAAGEMTDWAEDQAETLRSSIQAQPFTAVAIAAGVGAL
FT                   LGQLLMRR"
FT   CDS_pept        complement(411358..412155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0359"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86357"
FT                   /db_xref="GOA:A8IJU3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJU3"
FT                   /protein_id="BAF86357.1"
FT                   /translation="MPQQQLIKQLPLLRRYARALLGSQEAGDRLVRDTLQAVVDGQVSI
FT                   DPNVSPRVALYRALHQIWEPRSTPDVAVGSHADQRLQSLNASSRVALLLTAMEGFSYAE
FT                   ASAILRVGLEDVEQQVVAAQAEIDRQLATRVLIIEDEWVIALDLKTLVTDLGHEVVGVA
FT                   PTHTKALELAKDGDFGLVLADIQLADGSSGIDAVTDILGSFDVPVIFITAFPDRLLTGE
FT                   RPEPTYLITKPFLSETVKATIAQALFFHQTKSDAAQERAQRIA"
FT   CDS_pept        412302..414071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0360"
FT                   /product="putative signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86358"
FT                   /db_xref="GOA:A8IJU6"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJU6"
FT                   /protein_id="BAF86358.1"
FT                   /translation="MPGCGRVWTELCMSSRRRALVEAWGRERAAIFASAVGQPRSLLDS
FT                   VRRRLMLVILIAVLPLASACMLQGLLQLRRAGEDAQQSLVQSAAAAAASARNIFSSAEN
FT                   VLQALKNANDVRDANADCQATLAGANLSVLFSSNIAYIDKNGQVLCSALPQTQSSVGDR
FT                   KWWLAARNERGFTIGPRQISPVTRSDILVGILPLFGADGVFDGALAMAINAASLDNLLR
FT                   EAVPPSVGVVALINDKGVQVASNAADAASQLFDGRTIDNYMERLGEAKDAQGRAWSFAA
FT                   APLERHGLFVAIARPTADLFRWTTFHVLLGFVLPVVMVVFTLVAMWLATDRIVLQWLLY
FT                   IRRVTVVYAQGHYGFRPTRMHRAPSEFRVLGHAIEDMALAVRERDNRLREGLAEKTALV
FT                   REIHHRIKNSLQVVVSLLSLYGAGVAPADRPRFERLRVRMNSLAVVHRVFYEAAEGSEV
FT                   RVRELLRELAVLLEGASDRSAAVLVEAGDEITLPTDFAVPLALLVTEIVMALTRPDAAR
FT                   PVRITLKAALQGGTFELVAEASEPAEGRLDVGKADLAHGFAGQLGGSVLVEEAEDCARI
FT                   RTAFPARKRGMAG"
FT   CDS_pept        complement(414091..415068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0361"
FT                   /product="biotin synthase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86359"
FT                   /db_xref="GOA:A8IJU8"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IJU8"
FT                   /protein_id="BAF86359.1"
FT                   /translation="MSAAIAATARPAAEMRTRALYDLPLPELMFRAQAVHRAHFDACSV
FT                   ETAQLLSIKTGGCPEDCGYCSQSAHHDTGVAATRLMDVEAVLAEARKAKAAGAARFCMG
FT                   AAWRAPKDRDMDAVCAMISGVRALGLETCVTLGMLTPAQVDRLSAAGLDYYNHNVDTSP
FT                   AYYPRITSTRTLDDRLETLGHVRAGGIKVCCGGIVGMGETIEDRLAMLELLAGLDPHPE
FT                   SVPLNMWTPIDGTPVKAFEEKVDPIAFVRLVAVARLLMPRSVVRLSAGRHTLSDEAQAL
FT                   CFLAGANSIFVGDTLLTTPNMEESRDAVLLARLGLRPAPAQPSA"
FT   CDS_pept        complement(415065..415691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0362"
FT                   /product="bioY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86360"
FT                   /db_xref="GOA:A8IJV0"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJV0"
FT                   /protein_id="BAF86360.1"
FT                   /translation="MDSYRYWNQIIYNWSSPMLTSLLDGTRRSLLLRQAALILAGVALL
FT                   TLSAKVQIPFWPVPMTLQTAAVMAIALAVPPRMALAVFGAYLAAGALGLPVFAGTPERG
FT                   IGLAYMTGPTGGYLAGYWLAGGLVSALARSAPLAPLGVWGRTIAMLAGLAAVYALGLLW
FT                   LTAFVPARALLAQGFLPFILGDLLKIALVAAASAALPGRRAGDAQ"
FT   CDS_pept        complement(415716..416384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="AZC_0363"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86361"
FT                   /db_xref="GOA:A8IJV2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJV2"
FT                   /protein_id="BAF86361.1"
FT                   /translation="MTSRTEDTIAIRISRTLADRIISGEIEPGSRLRQDHVAAEFETSH
FT                   VPVREAFRRLEAQGLAVSEPRRGVRVAAFDLRDVREVAEMRAALEVLALRNAAPNITAT
FT                   ILQQAEEATRAGDISRDVRSWEEANRRFHRLIITPCAMPRLLATIDDLHAASARFLFAA
FT                   WRQDWEARTDHDHRAILDALRRGQVEAACTILANHVQWIGRRPVKSRSGPEREMFAIEG
FT                   "
FT   CDS_pept        complement(417458..417688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0364"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86362"
FT                   /db_xref="GOA:A8IJV5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJV5"
FT                   /protein_id="BAF86362.1"
FT                   /translation="MTPEQCRAARAWIDWSQDDLARAASVSLSTVRDFEKGRRVPIANN
FT                   LSAMRAALEKQGISFFDREGSSGIASQAQCN"
FT   CDS_pept        417797..418954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0365"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86363"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJV7"
FT                   /protein_id="BAF86363.1"
FT                   /translation="MAQHFLLSRAARTISLAKVARMSDEEAHDAFRNIRWAATDGKPVC
FT                   PRCACAETLTYKTRKLYKCKACAHQFSVTLGTIFASRKLPIRDYLLAIAIFVNGAKGHS
FT                   ALQLSRDLDVQYKTAFVMAHKIREALAAEMKDMTVSGTVEVDGAYFGGHIRRENRKEDR
FT                   KDRRLAQHQTGKRRVVVIMRERGGRTLPFVFKAEAHAIETIAQRVAPGSIIHADEAAHW
FT                   DKLHALYLTKRINHQESYSDGEACTNGAESFFSRIRRAEIGIHHHISGPYLAAYSAEMA
FT                   WREDHRRVSNGEPVPDDGRLRSGSPGEPSVEGLLAAVTLGRSRPWSVRPHNLGIANFFP
FT                   DPSGVDVNHYGFLTPLRTFNCLLVFGSDQWVFQDRSKPIFTINRL"
FT   CDS_pept        421223..422938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0366"
FT                   /product="putative histidine kinase"
FT                   /note="HAMP region, bacterial chemotaxis sensory transducer
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86364"
FT                   /db_xref="GOA:A8IJW0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJW0"
FT                   /protein_id="BAF86364.1"
FT                   /translation="MPPMPRLNLKVSHAVALMVFSCVAVTAALLIAVVAWMLDDDAAQN
FT                   AINRQNVAIRAAAIALAKAVPGSRIDWSGNTVSRIVLPRLPEPGDHGLIDDVSRISGGT
FT                   ATVFAYDAGKDDFVRLSTSVKKADGTRAVGTVLGRQSAAYPAMKAGTIYRGEATILDVP
FT                   YYTVYLPVFDPSGSVIGVVYGGVKQDEVDARLNSLLRTIIGLSIVLTLLLAGVAVLLAS
FT                   RLLRPIGQLAGVMERLAQDDLSVEIPHQDKKNEFGVMAHTIQVFRDHADERRVLQAEQE
FT                   RQTAQRLARQEEVDAIIAAFRTRMSRMVDAVRLNTGELLDVAGSLSQVAARTTARTVEA
FT                   DRASQEASNSVQGVAGATEELSASIGEITSQVSRASTVVADATRGAQSTGSKVRELSEG
FT                   AERIGKVVELIQAIAAQTNLLALNATIEAARAGEMGKGFAVVAQEVKELAAQTGKATEE
FT                   IGHQIQSIQGATADVVQAIEQIVVTIGDVDRYTSAIASAVTQQNAATGEITRNIVAASQ
FT                   GSATVASNITHVMQAVNETDTCASRVTDATRRLADDNSQLNAALEDFLARVVAA"
FT   CDS_pept        complement(423088..423630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0367"
FT                   /product="putative Fe2+/Zn2+ uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86365"
FT                   /db_xref="GOA:A8IJW1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJW1"
FT                   /protein_id="BAF86365.1"
FT                   /translation="MNEMTRIRTSLGSGAARVQVDPEEAVLPVAQLRDVNNARRTGCPF
FT                   HDVREMLREVGLRPTRQRLALGWLLFAKGDRHVTAEMLHEEAIRARFPVSLATVYNTLH
FT                   QFTEVSLLREVAVDGSKTYFDTNSSDHHHFYVEGHNELVDIPEASVTVDRLPEAPEGFE
FT                   VARVDVVVRLRKKSAKA"
FT   CDS_pept        423898..424428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="disulphide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86366"
FT                   /db_xref="GOA:A8IJW4"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJW4"
FT                   /protein_id="BAF86366.1"
FT                   /translation="MRPGRFMIHRRSRGVTHLFRSPVLVALFVALAAAATLAAAWFFQL
FT                   VVGLAPCPLCLDQRLPYYTAVPVGLLLAFVGRSRPDLARYGLWLLAALMAVDAGIAIYH
FT                   AGVEWQFWPGPTTCTGSTPPMVTDIMSALKTTRVPRCDEAAWRLFGISMAGWNAVIALG
FT                   LTGISLKGALARR"
FT   CDS_pept        complement(424440..424997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0369"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86367"
FT                   /db_xref="GOA:A8IJW6"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJW6"
FT                   /protein_id="BAF86367.1"
FT                   /translation="MTAALSPGAWPALVLNADYRPLSYYPLSVWSWQDTIKAVFLDRVN
FT                   IVEYYDKAVRSPGFELKLPSVVSLRTFVKPTRQPAFTRFNVFLRDRFTCQYCGTREDLT
FT                   FDHVIPRSRGGQTTWENVVAACSPCNLRKGGLMPDDAKMWPAQTPFQPSVHDLHQNGRH
FT                   FPPNYLHESWLDYLYWDTELDP"
FT   CDS_pept        complement(425226..425885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0370"
FT                   /product="phospholipase"
FT                   /note="carboxylesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86368"
FT                   /db_xref="GOA:A8IJW9"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJW9"
FT                   /protein_id="BAF86368.1"
FT                   /translation="MSLTEGPRLAPSAGGPADSLVVLVHGYGADGRDLIDLGAAWAEIL
FT                   PHTAFVAPHAPHPCDQMPVGRQWFPLSLADPHAIARDTLSALPAFARLLDEERTRLDLP
FT                   WSRVALFGFSQGAMMALSFAVTAPEPIAAVVGASGFLPPLLPPGLAPSRPPVLLMHGGR
FT                   DEVVPVYALTATAAALSAAGVRAETHLTQSLGHGIDEEGVERAGLFLAAHLAPPTG"
FT   CDS_pept        complement(425901..426554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0371"
FT                   /product="HhH-GPD protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86369"
FT                   /db_xref="GOA:A8IJX2"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJX2"
FT                   /protein_id="BAF86369.1"
FT                   /translation="MMGEVHLSDQATFEAALDRLLSLDDRLHALVAEAGRPPLRRRAPD
FT                   FAGLVNIIIAQQLSVAAARAISARTEQVLGGPPTVEALLNASPETLKAGGLSAPKIRTL
FT                   TRIARALADGVVDLAHVEAMEADAAADYLTRLPGIGRWTADIYLLFCLGRSDAFPEGDL
FT                   ALQVAAADAFGLPGRASALGLKAIAEDWRPYRGVAAHLLWAYYGARRARLGAPA"
FT   CDS_pept        426621..427529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0372"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86370"
FT                   /db_xref="GOA:A8IJX4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJX4"
FT                   /protein_id="BAF86370.1"
FT                   /translation="MTIVCRFAPSPNGFLHLGHAHSALVNHAAATRAAGRFLLRMEDID
FT                   TTRCRPEYEQGIIDDLDWLGILPPEPPRHQSRHFDDYAAALARLEEMGLLYASFETRAE
FT                   IARAVLAREAAGRSWPRDPDGVPLYPFSRESMTEAARARRKAEGEPYVLRLDMGQAYAL
FT                   AGAGLSWHEAPGDPLAEPLPVQADPAAWGDVVLARKDVPASYHLAVVMDDDLQGITHVI
FT                   RGRDLYAATAIHRLLQALLGLPAPIYHHHALVLDRDGRKLSKSTGAASLSSLRALGTTP
FT                   DEVRALIAHGLEPASQPTPST"
FT   CDS_pept        complement(427508..428446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0373"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86371"
FT                   /db_xref="GOA:A8IJX7"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJX7"
FT                   /protein_id="BAF86371.1"
FT                   /translation="MLGILADLALIVLPVFGIVGVGYGAAKTRLISDSASDGLAEYVFS
FT                   LAVPILIFKTLSESKLPDAQPWGYWIAYFTGAFAVFALAAVVAAKVFKRSHTEAVIHGF
FT                   SAGQANTVFVGVPLILKAYGEAGAVPLFLLIAVHLPVMLVAATIAVEGGSGFSRATVKR
FT                   LFRSLAFNPILLGIYAGGIGRLMGFEAHGVLKQVLDMMAASATPCALVSLGLALKRYGI
FT                   SGDLRPTVFISTLKLIVHPLLVLGLTRILPMPPVWAGVAVLFAAMPCGINAYLLAQRYG
FT                   VGVGTSSSSVSLSTALGLFTITFWLYVLGVG"
FT   CDS_pept        complement(428456..428743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86372"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJX9"
FT                   /protein_id="BAF86372.1"
FT                   /translation="MSDHAQVPAGAHYRLVVEAAADANVLLRLLEPFVIHDVLPHRIDV
FT                   AHANDALQVELEITAAPEIADRLESRLRAMVPVFDVAMACLRPAPVLTAA"
FT   CDS_pept        428915..429247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0375"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86373"
FT                   /db_xref="GOA:A8IJY2"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJY2"
FT                   /protein_id="BAF86373.1"
FT                   /translation="MRVAHGRSRQVAFGARRLPLDCRLMRVSRHHGQPRRIEMQVLPQP
FT                   AAPRGGAEANGGLAATDGEARLNRGALVGMGLVAVLLTGAAGFLWMRHGVAIFFDTVVA
FT                   GLATCF"
FT   CDS_pept        429293..429892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0376"
FT                   /product="putative inner mitochondrial membrane protein
FT                   Sco1p precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86374"
FT                   /db_xref="GOA:A8IJY4"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJY4"
FT                   /protein_id="BAF86374.1"
FT                   /translation="MAALSSRTKIIALFCAFAAGALVLVAGVTLLMPGRAGPALSSAVG
FT                   GPFKLVDDGAQPVTEAVLKGKPSLVFFGFTHCPDVCPTALFEMSEIFRALGPDADKAQA
FT                   FFITVDPERDTPEIMKSYVSSFVPQIHGLTGTPEQIEVVKKEYRVFSRKVPLKDGDYTM
FT                   DHTAVVYLMDKAGNFIAPFNTKRPPAEAAADLKRYL"
FT   CDS_pept        complement(429876..431813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0377"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86375"
FT                   /db_xref="GOA:A8IJY6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJY6"
FT                   /protein_id="BAF86375.1"
FT                   /translation="MVGEAASDRKRTFYAKADALSPPSRWPVELQALHGTLPDSLIDWA
FT                   AARARDLRVGGDEVLICAGLLTGPQASARLAAHLGLALQPPDVPLPVPPDLAPTVLRLQ
FT                   TFQTPPEDDLPGYVIAARGLYARRLASALREDPTLKRRARVIATEHLHGTLARQCADGI
FT                   GRAAAFDLRAHRPDVSAGTIRFTRRMLLPATMAGAAVATAGLSAPLETLLIVQSLLSSI
FT                   FLASATLRIATCLARPEEPPPLGLPDAALPLYSIIVPLYREERVLPRLVRALQAIDYPP
FT                   EKLDIKIVVEPDDAPVHAALARMALPPWFEIIVAPDVGPRTKPKALNCALPFTRGSFVV
FT                   VFDAEDVPDPDQLKRALAAFRQGGRNLACVQARLSVENADETWISRLFAAEYAGQFDVL
FT                   LPGLAQLRMPILLGGTSNHFRRSMLELIGAWDPYNVTEDADLGVRLARAGWTTAVIGSS
FT                   TAEEAPITRAAWMRQRTRWLKGWAQTLLVHGRQPLRLVRELGWGNLVPLLLLTAGPFAS
FT                   ALLHPLCVAWLIADVVRGVFLTTPGTTLGVVATALSLTNLAIGYGAAAWSCGLGLKRRG
FT                   QFALAPILILLPFYWLLLSVAAWRAVVQLIVRPYWWDKTEHGLGRLRPQAPLPAGAPAR
FT                   APAGILTDSA"
FT   CDS_pept        431865..432737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0378"
FT                   /product="extracellular solute-binding protein"
FT                   /note="family 3 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86376"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJY9"
FT                   /protein_id="BAF86376.1"
FT                   /translation="MPLGKKSRKSLIFQSLLAMIVAFAPVPLLAQPAPAGPVVPSFWSA
FT                   SRRLERPDTTRLPSTLRFLTSDDYPPFNFSGPDGALMGFNVDLARAVCAELALTCTLQA
FT                   VDFDTLLDALDQNKGDAVIAGLAATPANRAKVDFSERYLGTPARFVARTGLSLPGATPA
FT                   DVGARRVAVAAGTSHEAYLKAFFPQAKIQPYPDVAAARAALLAGEADLLFGDGIGLSLW
FT                   LNGTQANGCCRFVGGPFTESRYFGDGLSVAVKSGNDQLRRAIDYALQRVWEKGVYTDLY
FT                   LRWFPIGFY"
FT   CDS_pept        432823..433437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86377"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJZ2"
FT                   /protein_id="BAF86377.1"
FT                   /translation="MRASSLLSAALLSVLFASPVLAQQAASVRGTIVAAEGGNLKVHSR
FT                   EGQDVAVVLSEPIRVTGLERITLADIPANAYVGVASMPQAGAPAGAPEVAVSIHVFPEE
FT                   MRGAGEGSRGYDLAPNATMTNGAMAQKLVEKTGDRLTIAYAGGEKQVVVTPQTSLVRFV
FT                   PGTMAEVKPGAHVVIRGTKGSDGAIASQRVIVGRGDVVPAM"
FT   CDS_pept        433670..435325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0380"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86378"
FT                   /db_xref="GOA:A8IJZ4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJZ4"
FT                   /protein_id="BAF86378.1"
FT                   /translation="MTTAATTEDLATELRTFAETAGAWPFEEARKIVERLKRKPKDEVL
FT                   FETGYGPSGLPHIGTFGEVARTTMVRHAFRVLTEDKVKTRLLCFSDDMDGMRKIPDNVP
FT                   DRAALEPYLQMPLTSVPNPFGGDYPSFGDHNNAMLRRFLDTFGFDYEFASATDYYKTGK
FT                   LDAVLLRAAEKYDDIMAVMLPTLGEERQATYSPFLPISPTSGRVLYVPLKAVDAKAGTI
FT                   TFTDEDGVDKTLPVTGGKVKLQWKPDFGARWAALGVDFEMFGKDHQTNAPVYDRICEIL
FT                   GGVAPEHYVYELFLDENGQKISKSKGNGLTIDEWLTYASPESLALYMFQSPRSAKKLHF
FT                   DVIPKAVDEYFNFLARYPAQDWKLRLGNPVWHIHSGNPPAVDMPVSFSMLLNLASASNT
FT                   EDEGVLWGFLNRHVEGISPQTHPKLNELVGYAVKYFNDFVKPNKRFRAPDDVERDALAT
FT                   LDAALAALPEGASAEDIQTVLYDVARPIPRYQDLKAKGATPEKPGVSVEWFNTIYQVLI
FT                   GQERGPRFGSFVAIYGIPETRALIAKALDGTLAA"
FT   CDS_pept        435485..436579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86379"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IJZ7"
FT                   /protein_id="BAF86379.1"
FT                   /translation="MPSASGEARMTPILKTAVATAALSLALACTGSAFAQQATPPAQPP
FT                   ITLKAMGSFHIGGKTVDISGKPVKEVVFSPGGVPAKIDPNGTYIAGQMYVQYFIPQDQK
FT                   GTVPLLLWHGGGLTGVTYETTPDGREGWLNYFLRKGWAVYNSDAVERGRSGWAQSPDIF
FT                   PGEPVFLTVNGPFERFRIGDGAGSWSDDPAKRKVLPGNQFPVDSYIQFVKQNVPRWTTT
FT                   DDFILDAYSQEIEKVCPCVILVHSQSGKFGFEMAQKHPDKVKALIAVEPAVTGDPKLAS
FT                   KLAGVPILMVYGDYIATDSRWPTIRARAMDFVKLVRDAGGSVDVINLPEKGIKGNSHLI
FT                   MMDRNSDEVAGVIQNWLVEKKLTR"
FT   CDS_pept        complement(436592..437701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0382"
FT                   /product="putative acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86380"
FT                   /db_xref="GOA:A8IK01"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK01"
FT                   /protein_id="BAF86380.1"
FT                   /translation="MNIPALTGARFFAAAAIVLYHSQLPPFFPADAFWPLDPSGGVPFF
FT                   FVLSGFVLTLHAEKYRSHLQFMIARLARIWPAYLAAVAFWFALFWPYSRMLIESSGTQV
FT                   AILVANLAMVQAWVPDRIVYWSINAPSWSVSAEMFFYAVFPAVLWRMRRHGLVWLALLT
FT                   LAVIAAQMAVWTLFPGVDVLWLGRYNPVIYLPAFAAGVLAGHWFKATGRSPREGTRIQW
FT                   GALALMLAANMLFKVEWLGALPLPLAMAIAATGAAPAYAALILALGRYDGGPSRWLSRP
FT                   SIVFLGEISYGLYLFHQLIIRWHTDHLAAFSGVPVWGQYAGIWIAALLISAVCYLLIER
FT                   PGRRGIVALGASARAALAQKRSGPISDRP"
FT   CDS_pept        438015..438698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0383"
FT                   /product="AhpC/TSA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86381"
FT                   /db_xref="GOA:A8IK04"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK04"
FT                   /protein_id="BAF86381.1"
FT                   /translation="MIVTFSICSLEASMTLRLGDTVPDFTAQTTEGPISFHEWLGNSWG
FT                   ILFSHPKNFTPVCTTELGQVAHLKGEFDKRNVKVIGLSVDTIENHPAWVADIKDATGAN
FT                   LNFPLIADSDKKVSDLYDLIHPNASDTATVRSVFVIGPDKKLKLTLTYPASTGRNFQEI
FT                   LRVVDSLQLTAQHSVATPVDWKQGDDVIIVPSVSDEAAKEKFPEGWKTVKPYLRVVRQP
FT                   GTASA"
FT   CDS_pept        438814..439644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86382"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK07"
FT                   /protein_id="BAF86382.1"
FT                   /translation="MAPAARGAMIYICYGVTKSASTFLYQLTEEILVVSGRSCGRIRQP
FT                   GSAKLENYFDRISPTFLDRIAAAARGRDVVLKTHGPLDPGVGERIASGAVKASASIRDP
FT                   REMAMSMADNGARARKLGLLPFAEIHTPADAIHSLDVQMDYFTAWSSVPGVELFTYNEI
FT                   CFSTEAAIRRVAAHLGLTVNAAAVLAPFRDGSIIGQFNVGKPQRYREMDAPTQALFLER
FT                   YADLYARFNFDAEMPEAPPPVLKPRGALGHRIESTRRYLRRAFLTRSIGIVSPY"
FT   CDS_pept        439740..440015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86383"
FT                   /db_xref="GOA:A8IK10"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK10"
FT                   /protein_id="BAF86383.1"
FT                   /translation="MAEGNNQLSRFLGGSPVSVLLRLIILCIVVGVILAALGLDPAHLL
FT                   ESFRRLIETVFSLGFDTVERIWRYFLLGAVVVIPLWLISRLFRSGR"
FT   CDS_pept        440035..441369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matE"
FT                   /locus_tag="AZC_0386"
FT                   /product="multi antimicrobial extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86384"
FT                   /db_xref="GOA:A8IK13"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK13"
FT                   /protein_id="BAF86384.1"
FT                   /translation="MSGSASLPAGPVTHRSVLAIAAPMTLAHLTTPLLGLVATTVVGRL
FT                   GDAAALGGVALGAVVFDFLFWGFGFLRMGTVGLAAQALGRGDSLEQRAVLARALLLAFA
FT                   CGGAMVLLQWPIGRLARHLAGASPAADAALATYYGVRIWAAPVSLANYALLGWFTGLGR
FT                   TGHALALQAGINGINIALCVLFVLGLDRGVEGAAEAALWAEAAGTLAGLLLCARLLGFR
FT                   LEVPRAVVTDRARLMEMFALNRDIMIRTAALLAAFAFFAAQGARAGDVTLAANALLNTM
FT                   VLLSVYFLDGFATAAEQLCGAASGARDRTAFSTALRLVLGWGYGFAVPAVAFFLLAGPT
FT                   ILGLMSTNGEVVAEAVRYLPFAALLPLFGVAAYAYDGVYVGALWSRDMRNLMLAALAFY
FT                   LATWWALRPFGNAGLWSALLLFLAARGVLQAWRLPALVRRTFAEG"
FT   CDS_pept        complement(441376..441732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0387"
FT                   /product="protein of unknown function"
FT                   /note="DUF952"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86385"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK15"
FT                   /protein_id="BAF86385.1"
FT                   /translation="MGGMSHPCIIYKICPRTLWEAAEAAGRFEGAPVDLADGYIHFSAA
FT                   EQVRETAAKHFAGKDDLLLVAVDSARLAPHLKWEPSRGGALFPHLYAPLPVTSALWVKP
FT                   LPMGADGSHIFPQL"
FT   CDS_pept        441852..442520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0388"
FT                   /product="peptidase family S24 protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86386"
FT                   /db_xref="GOA:A8IK18"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK18"
FT                   /protein_id="BAF86386.1"
FT                   /translation="MLTHGQIWTAIDRLAEANGLSASGLAKRAGLDSTAFNRSKRITSD
FT                   GRPRWPSTESVSKILSATNTSMRAFLALLEGEDIGPSGFSEEPAPPFRPQRAIPHIGLA
FT                   QAGDGGFFDDAGFPVGSGWDEILFPEVEDEHAYALEISGDSMLPLYRPGDLVVVSPAAS
FT                   VRKGDRVVVKTRDGEVLAKELVRRTARTVELRSLNPEYEGRTLAATDVLWIARIIWASQ
FT                   "
FT   CDS_pept        complement(442524..443426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0389"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86387"
FT                   /db_xref="GOA:A8IK20"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK20"
FT                   /protein_id="BAF86387.1"
FT                   /translation="MPQPDGATAIFEAQRPRLLRLAYRMLGSLSEAEDVVQDAWLRWQR
FT                   ADHSAIAAPPAFLSRVVTRLCLDVMKSARRTRETYVGPWLPEPLVDGLSLPEPVPDADD
FT                   LTLTLMLALERLSPLERAAFLLHDVFGVPLNEVAATLEREPTAVRQLAARARGHVREAR
FT                   PRYKVEEEEGARIAQAFFTASRSGDVTALGSLLAETATLRSDGGGKVLAFRNPIIGSAR
FT                   ILRLYARLAVKDTDHGALLRPLVIDGLPGFLSRERGGLMQTTAFAIADGRITDIFITRN
FT                   PDKLARLLSALGEAPAAGA"
FT   CDS_pept        complement(443413..443946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86388"
FT                   /db_xref="GOA:A8IK22"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK22"
FT                   /protein_id="BAF86388.1"
FT                   /translation="MSHPVILPRLVLERAWSASRRRTMSERIKEPFRLAPEGIKAMMAL
FT                   EASIRHSTLETSVREFVKLRASQINGCAFCLAMHARDARAQGESEMRLHLLAGWREATC
FT                   YTPRERAALAWTEALTLLPQTRAPDADYAEIAAVFTEEERVQLTLLIGAINTWNRLQVG
FT                   FRVAPALETAHAAA"
FT   CDS_pept        complement(443987..446203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0391"
FT                   /product="putative glycosyltransferase"
FT                   /note="family 2"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86389"
FT                   /db_xref="GOA:A8IK24"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR018831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK24"
FT                   /protein_id="BAF86389.1"
FT                   /translation="MILTLTYAKVCTTSLHHLLTERFPGDVFRSHGLEPWILDPLERFA
FT                   AAVTADTSGLRGSFDNGPIRERLAHARATGETITIISGVRDPVSRSLSVAMQNLEAAFA
FT                   DCVSPSVQASAEAIATRVADLWLRETTNGDPVRTFLEKMIRAPFEWFEQELAGPFGFDL
FT                   REQAFDTVQGYSIQSRDNVRLLLFRHERAPAAIEKGLTELFPGMDFVLPHDNTGEDKPS
FT                   GGIYRALRQCFRLPRATLEAIYAHPDVRPYFGEDEITAAIERWAEPAPQSAWVMPPPPA
FT                   APRQTFAATVFIPLRNHAQWVGAQIDSLLAQWRPDVELVLVDDGSQDGSLAAALDRLGG
FT                   RPEVMATVMRNSTALGHGMLPAVLGLSRAPVIIQADSDDIALPGRLDTIIGHFAADPDC
FT                   RLVTSNAVLLSETGISIGVLDPHAADARLDDPVALPDLQHNSYWLGASSAFHRSVIEAF
FT                   PPLDPELCAYGLDLLTGFRAILLGSQHYLAQPLVGWRQHARNSHRVIGTFDATPASKEH
FT                   LAAIAFMTRAQRLRDLAWLQAQSQIAPERAARIDARWRADHSAQADEWIRLRNRLTGTH
FT                   AAPNPLDSRASEGAAHVPAVPPILTLTRGFEWSAAQLDPALSRWSGTYGGDSRMLWISR
FT                   QTAITLRIPEPDAEALVLTLAGIPYVDRQSVFLSLDFAPPMEITLVAGESRRVTVPIVQ
FT                   RRDPAGGLMTLMIRAPEAVRPCNLDPANPDQRMLGVALFAMQVI"
FT   CDS_pept        446413..447243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0392"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86390"
FT                   /db_xref="GOA:A8IK27"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK27"
FT                   /protein_id="BAF86390.1"
FT                   /translation="MELPAAARLPITWRGVRPVDGPPRLASQRIRALPATPCPMHPPCR
FT                   VPNAQMPMSLIAPLSPETPDGLLLIGGGRNARNLICIFETAGVAVRGIADDRPAGKVLG
FT                   HTVGFIDDLNGSDVAAFLTIADPDHAAQVRERPALRGCRWPRFVHPSSVVSSHADISEG
FT                   CYVGPFAILTDVVLGRHVHLFAHNVLGARVRVGDFTVILPHATLASDVRIGKRCMIGMG
FT                   ARIHAGVTIGDDCRIGVNAVVRRDMPDRAIAVSQQATRIKTRLSFATRRSVPVE"
FT   CDS_pept        complement(447259..448917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0393"
FT                   /product="putative ATP dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86391"
FT                   /db_xref="GOA:A8IK30"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK30"
FT                   /protein_id="BAF86391.1"
FT                   /translation="MNRFAELLDRLSYEPRRNAKIRLMSEYFRSTPDPERGVALAALTG
FT                   KLSFTNAKPGLIRALIAERTDPVLFELSYDYVGDLSETVALMWPAPKGLPEMGGNHAPF
FT                   LSEIVEGLETLPKRDLPRQLALWLDGLDETGRWALLKLITGALRVGASARLAKTAVAAL
FT                   GDLPPDEVELVWPGLSMPYRELFAWAEGKGERPQTTDPVPFRPVMLAHAIEETDFSALD
FT                   PASFAAEWKWDGIRVQAVCARSSDGTRAARLYSRTGEDISGAFPDLVEALDFDGALDGE
FT                   LLIVREKRVETFNVLQQRLNRKAVTTKMLAEFPAHIRAYDLLAVAGEDLRPLPFRDRRA
FT                   RLEALIARLETQGHTRLDLSPLVPFADWEGLAAARRDPASAGAGLDAEAVEGVMLKGWD
FT                   TAYLPGRPKGPWWKWKRDPHTVDAVLMYAQRGHGKRSSFYSDYTFGVWTQGEEGDVLVP
FT                   VGKAYFGFTDQELIEIDKFVRRATINRFGPVREVLHEPDEGLVLEVAFEGLARSTRHRS
FT                   GVAMRFPRIARLRWDKPPREADRLETLEALLRQEE"
FT   CDS_pept        complement(448914..449996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86392"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK32"
FT                   /protein_id="BAF86392.1"
FT                   /translation="MRPEDLLCPSTKGLYSPAGDFYVDPVRAVDRAVITHGHSDHARRG
FT                   HGKVLATRETLDIMALRYGPDFAGETQAIGYGESVEINGVRITAHPAGHVLGSAQMALD
FT                   WRGLTIVASGDYKDARDPTCAPFVPVKCHVFISEATFGLPVFRHPDAADETAKLLRSVA
FT                   LFPERAHILGAYSLGKAQRMMALIRQAGHTAPLYMHGALTEITAYYEAQGIALGPVAHV
FT                   TKMAKAKLAGAIVIAPPMAITDLWTRNFPDPVTAFASGWMRVRARARQRGIELPLVVSD
FT                   HADWDGLTASVTATGCEELWVTHGAEDALVHWAQTQGLKAKPLHMVGYAEEDEAAEGEA
FT                   VAMSGPEAPPQDGAPEETAP"
FT   CDS_pept        450042..450995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="SAM (and some other nucleotide) binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86393"
FT                   /db_xref="GOA:A8IK35"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK35"
FT                   /protein_id="BAF86393.1"
FT                   /translation="MAFQSSTQPLYASSGNPALDRRLDWARADLEAGDAAAAAELLADT
FT                   VAEAPHFVAAWFLLGEARAAAGDEAGAAEAFRAVLARDPADALGAGLRLARLGGVEAEG
FT                   AMSADYVRTLFDQYAPRFDDALRGKLAYRGPEVLAEAVSAVCAGRGRAERFARGLDLGC
FT                   GTGLAAGLFAGKVAALAGVDLSPAMVERAQALSLYTRLEVGEMGAALAAEAPQSLDLIL
FT                   AADALCYVGDLAPIFAAASRALAPRGLFAFTLETHEGEGLLLRDTLRYAHGRALVQQQA
FT                   AGAGLAIALLEDRSTRTEKGVPVPGLVAVLVRSVDL"
FT   CDS_pept        complement(450981..451487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="tyrosine specific protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86394"
FT                   /db_xref="GOA:A8IK37"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK37"
FT                   /protein_id="BAF86394.1"
FT                   /translation="MIYVCSLSRLHETVERTGARHVITLINGGTAVTRPSNVDPTHHLF
FT                   LGINDIVEEAEGLVAPGDTHLHDLLDFVHAWPREAPLVIHCYAGISRSTAAAYTTLCAL
FT                   LPEVDEMELALRLRQASPTATPNARIVALADRALKREGRMVKAIAAIGRGADAFEGEPF
FT                   ALQID"
FT   CDS_pept        complement(451484..452131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="metal-dependent phosphohydrolase, HD subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86395"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK40"
FT                   /protein_id="BAF86395.1"
FT                   /translation="MTDSPAQPSLPPTPPSPTAGKKPRAWQRMLSGRRLDLLDPSALDI
FT                   EIEDIAHGLARVARWNGQTSGDDIFSVAQHSLLVERLARAQTHDLDRSWRLAVLLHDAP
FT                   EYVIGDMISPFKAMIGGDYKAVEARLLAAISQRFGLPVRWPQALVKLTKAADRAAAFLE
FT                   ATRLAGFSEGEAVKVFGRPPRLDASLEAAYLSPWRAQEAKERFLARFEDIAR"
FT   CDS_pept        452233..452658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0398"
FT                   /product="putative ADP-ribose phosphohydrolase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86396"
FT                   /db_xref="GOA:A8IK43"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK43"
FT                   /protein_id="BAF86396.1"
FT                   /translation="MSDPVRPTLAASAAVFRDGRVLLARRGKAPGAGLWSLPGGRVEPG
FT                   ERLAEAAAREVMEEVAVEAEILAVAAARDIIVRDGERLLAHFVVVAHAARWRAGEPTIG
FT                   EEAIEVGWFAPDEVAALPGTDGLAEVVAAAARLMAAP"
FT   CDS_pept        452689..453096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="CHP02301"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86397"
FT                   /db_xref="InterPro:IPR012645"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK46"
FT                   /protein_id="BAF86397.1"
FT                   /translation="MRTFRSAALLLASAVWIAGLACGPAQAASSEGSTPPYEQDLLKIA
FT                   ELLGSLHYLRPLCGAPNEGQSWRTEMQTLIDAEQPSDPRKGKLIAAFNAGYNSYATVYR
FT                   TCTPAAVEAVQRQMDQGAKLAHEIVVRYGGN"
FT   CDS_pept        453240..453554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86398"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK48"
FT                   /protein_id="BAF86398.1"
FT                   /translation="MARRLIRGAARRSVLSSTSNFASHPLHVAEPASDERHVALSYLED
FT                   AWTEALRDGLDEDCLVQAALFSALRTLVAIYGEEPTADYVESLAQRVRGGEYTLIGQRQ
FT                   "
FT   CDS_pept        453713..454558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0401"
FT                   /product="glycine cleavage T protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86399"
FT                   /db_xref="GOA:A8IK51"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK51"
FT                   /protein_id="BAF86399.1"
FT                   /translation="MAHAFLPERAVLAVSGPDARAFLHNVVTCNINSLKPGGARYGALL
FT                   MPQGKIISDFLIYAPVATPETLLLDLPAARLEDLVKRFTMYRLRANVGFEPQADSAIVA
FT                   FWGDEAAPEGVEAFPDPRLDELGTRAVVLRATAEGLGGDAFAYAAHRIALGIPEGGADF
FT                   LYGDAFPHEADMDQLGGVDFKKGCYIGQEVVSRTQHRGIARTRTVAALLAGAPESGTEI
FT                   KAGEKTVGRIGSIAGGQGIALVRLDRAAEAKASGLPLLAGDVEVTLKAPDWASFDMEGV
FT                   "
FT   CDS_pept        454555..455142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0402"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86400"
FT                   /db_xref="GOA:A8IK53"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK53"
FT                   /protein_id="BAF86400.1"
FT                   /translation="MSADRILTPHSDGKCRCPWCGTDPLYVAYHDTEWGVPERDSRALF
FT                   EKLLLDGFQAGLAWITILRKRDNFRRAFDGFEPEVIAAYGPEKVAALMADAGIVRNRAK
FT                   IEGAVLSARAYLDLREKGIAFSDFMWEAVDGTVQVNRPRTLKDIPAETPASRALSKKLK
FT                   AAGFKFCGPTIVYAAMQACGLVDDHLAECWRA"
FT   CDS_pept        complement(455139..456347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0403"
FT                   /product="MFS permease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86401"
FT                   /db_xref="GOA:A8IK56"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK56"
FT                   /protein_id="BAF86401.1"
FT                   /translation="MDAVLLRVLCVTAVIQLIAWGTASLLAIVGIRMAADLGMDVPTVF
FT                   AGSTVFYCVMGVCSPVLGKGFVRHGARRMMMAGTLVAGPGFALIALSNGPLPYFAGWTL
FT                   LGISGSAMLSTAAAILIHETAGARAQRAMGALMLATGLSSSLFWPTTAVLADLWGWRVT
FT                   CWIYAGLHLAVCLPLLAFALPARTPAAAAAAPTEAVPAKPAPRLGRKRTFSLMMTAIAL
FT                   NGFVAFGFNAIFIELLKVEGVPPERAVAVGSLLGVLQVSARVIDFLGGGRWDGLTTGLW
FT                   AGSFILAAPLIALMADGSLLVIGLFVLVYGLGTGAFAVARSTIPLVFYDQAAYARALST
FT                   IALPLNIGCAISPPLFMGMLLETGAHSVLLLATACALVTLAALAALRQFRPQRAIPELT
FT                   PTG"
FT   CDS_pept        complement(456411..457151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="FMN-binding split barrel"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86402"
FT                   /db_xref="GOA:A8IK59"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK59"
FT                   /protein_id="BAF86402.1"
FT                   /translation="MSHETTETRLSETTFPVTDRNRVKRLHERGSYDRAVVYPILDAAF
FT                   LCHVAYAIDGQPFATPTIHWREGDTLYWHGSSASRMLRHLKGGTPACLTVAHLDGLVLA
FT                   RCGFNHSANYRSAMCFGTARIVEEPEEKARALSALVDRFYPGRDATLRASTTQEVKATM
FT                   VIAMPIEDASAKVRAKGVGDDEDDLGLPIWAGVIPVRTVLGAPETSPHVPAGVPVPDGL
FT                   GIYALGAPLDEALLAAQRMYEAAD"
FT   CDS_pept        457217..458653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0405"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86403"
FT                   /db_xref="GOA:A8IK62"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IK62"
FT                   /protein_id="BAF86403.1"
FT                   /translation="MRRSDETNLSEAAAPEVHAADWSALIPVLPKAGPRPVALYAELRR
FT                   LIEGGVLRPGTKLPPTRELAARLGLSRGAAVAAFELLLAEGFAEARVGAGTFVAAAVPQ
FT                   IAPAAPPPDPRPAVAPPLPGALGLAAPDARTFQILRGLITRHMAVPARHHFGYGDPRGS
FT                   RALREEVAAYLRTARGVRCHGDQVVLTSGSQQALDLIIRAALTPGDPVWIEDPCYPMAR
FT                   AAFEGAGMRLIGVPVDGEGLDPAAGEARAPHARAVYVTPSHQFPLGVTLTMARRLALID
FT                   WARRAGAWIIEDDYDSEYRYAGPPLTALQGIDGAGRVIYVGTFSKALFPGLRVGYAVVP
FT                   EALLDAVIAVRNRSDRFPPSLLEDALADFLREGHFSAHLRRARRRARDARDALVAVLNE
FT                   GGLSVAAPDQGLHLVARRPDWTEDATLLAAARAEGFGPRALSPLHVDRPPEAGLVIGFS
FT                   GFPPEELASAARRWLARIGG"
FT   CDS_pept        complement(458657..459097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0406"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86404"
FT                   /db_xref="GOA:A8ILR8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILR8"
FT                   /protein_id="BAF86404.1"
FT                   /translation="MSDAPPALAIGHAAPEETEALVALWQRCNLTRPWNDPHADIALAK
FT                   RGPHSTILVLRDGARLAASVMVGHDGHRGWMYYLGVDPDYEGTGLGRKLVAAAEDWLKA
FT                   RGVPKVMLLVRPDNEKVRGFYEALGYLDEPRVVFSKRLDETA"
FT   CDS_pept        complement(459122..460186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0407"
FT                   /product="Sua5 protein"
FT                   /note="SUA5 domain, /YciO/YrdC/YwlC"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86405"
FT                   /db_xref="GOA:A8ILS0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILS0"
FT                   /protein_id="BAF86405.1"
FT                   /translation="MARHGRSSGTGQMSASPAPPSASRSTQVLPATSPARAKAAAVVAG
FT                   RLIGEGKVVAFPTETVYGLGADAGNPRAVAEVYAAKGRPAFNPLISHVPDLAAAEQLGV
FT                   LNADAVKLARAFWPGPLTLVVPCRDTDAICDLARAGLSTTALRVPNHPAALAFLAAAGR
FT                   PVVGPSANRSGHVSPTTAAHVMADLDGRIDAVLDAGPTMVGVESTIVDCSGDEPRLLRP
FT                   GGLARADIEAVLGRPLPDAAGGDEAKPSAPGRLASHYAPNATVRLDVAEVRPGEALLTF
FT                   AGHRPTGSESAAFVYDLSPAGDLAEAASRLYGALRAIDARGAAGIAVVPLPREGLGEAI
FT                   ADRLGRAAAPRPHD"
FT   CDS_pept        complement(460275..461219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="cyclin-like"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86406"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILS3"
FT                   /protein_id="BAF86406.1"
FT                   /translation="MCGDFPRSGPLMGMAAMLGRWVRQLWPFQPRPASGPRHPVAPCHV
FT                   LGLAGLAALALLAMPFLLAAPAAAEPEKCPRMVAGPVLKPRVIPAAFRLAAAEGGQVRF
FT                   TFVGHATFLIESPHGVTIATDYNDYVRPNIVPQIVTMNRAHDTHYTNNPDPGIAHILRG
FT                   WNDDGTPPRIELTVDDVWIRNVSTNIRQGSATRYDGNSIFVFEVAGLCIAHLGHLHHIL
FT                   TPDHLEALGRIDVVLAPVDGSYTLDIEGMMENLKAINAPLVIPMHYFSSWGLDRFLSRL
FT                   GKEYQIQRSESPSVLLARETLPRKPTVLVLPGR"
FT   CDS_pept        461384..461524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86407"
FT                   /db_xref="GOA:A8ILS6"
FT                   /db_xref="InterPro:IPR021446"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILS6"
FT                   /protein_id="BAF86407.1"
FT                   /translation="MTFDLVIIQPIVALIAGILILLFPRLLNVLVAIYLIVVGILGLVP
FT                   H"
FT   CDS_pept        461648..464326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0410"
FT                   /product="pyruvate phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86408"
FT                   /db_xref="GOA:A8ILT0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILT0"
FT                   /protein_id="BAF86408.1"
FT                   /translation="MTKWVYSFGDGKAEGKSEMRNLLGGKGANLAEMANLGLPVPPGFT
FT                   ITTEVCTYYYAHGETYPAELKGDVEAALAKVGALTGKTFGDPANPLLVSVRSGARASMP
FT                   GMMDTVLNLGLNDETVEAVAKLANDRRFAYDSYRRFITMYSDVVLGVDHHHFEEILEGY
FT                   KSQHGHTLDTDLDADDWAKLVVEYKAKVEKELGKPFPQNPQDQLWGAIGAVFGSWMNQR
FT                   AITYRRLHSIPESWGTAVNVQAMVFGNMGETSATGVAFTRNPSTGENALYGEFLVNAQG
FT                   EDVVAGIRTPQDLTERARIAAGSDKPSMESALPDAFKEFERISHVLEKHYRDMQDLEFT
FT                   VEKGKLWMLQTRSGKRTAKASLRIAVELANEGLITQEEAVARVDPASLDQLLHPAIDPK
FT                   AERNVIATGLPASPGAAAGAIVFSADEAETMKHQGHKVILVRIETSPEDIHGMHAAEGI
FT                   LTSRGGMTSHAAVVARGMGKPCVSGAGSLRIDYAAQTLTVAGKTYKKGETLTIDGSTGQ
FT                   VLAGEVPMQQPELSGEFATLMGWADKVRRLKIRANAETPLDARMARSFGAEGIGLSRTE
FT                   HMFFDAGRILAVREMILADDEAGRRSALAKLLPMQREDFVELFEIMKGLPVTIRLLDPP
FT                   LHEFLPHTDAEVQEVAKSLGVEVERIERRQKELHEVNPMLGFRGCRIAIAFPEIAEMQA
FT                   RAIFEAAVIAAKKTGEAVVPEVMVPLIATKAEFDIVNARIQAVAKAVEEETGAKLTFQV
FT                   GTMIELPRAALRAKEIAETAEFFSFGTNDLTQTCYGVSRDDAGTFLGPYVQKGIIEVDP
FT                   FVSIDVEGVGELVKIGVERGRQSRPDIKLGICGEHGGDPASVAFCDEVGLDYVSCSPFR
FT                   VPIARLAAAQAALGRKAASQA"
FT   CDS_pept        464356..465501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0411"
FT                   /product="outer membrane protein"
FT                   /note="related peptidoglycan-associated (lipo)protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86409"
FT                   /db_xref="GOA:A8ILT2"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR032608"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILT2"
FT                   /protein_id="BAF86409.1"
FT                   /translation="MSGRPSGRPFALGKRGLGRSCVRAYDPLARLGRPRGRRRGFDVNC
FT                   LKVLLMSVLICAACRLFRRDGVVSPLALFLLLLAAAAVPARAADVPGSRDYPGISRYAG
FT                   SEIIRYEVKAFDDYVLVTEPMKGRARQGLELKGQVFRITYRNPPNRTSLEVLENYRTAL
FT                   QAAGASEIFTCAHRACGGRDFNIAQVDPQNYTRMGDNYDDQRYLAARLQAPGKDVYVAL
FT                   FITRSQSGAAADKDRIFTQLHVIEVKSMDANMVVVDASRMADSIGKTGSVALYGILFDF
FT                   NSAVIKPESKATLDEIASLLRKAPDLKLVVVGHTDNVGGMDSNMKLSQARAEAVRRALV
FT                   EQYAIAAARLQAWGAGFMAPVASNRTDEGRAKNRRVELVEQ"
FT   CDS_pept        465526..466446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86410"
FT                   /db_xref="GOA:A8ILT5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILT5"
FT                   /protein_id="BAF86410.1"
FT                   /translation="MADFSILTAIGLVLRTWPFLLLRVALSGAIVLGYAAWVGGGAGLG
FT                   AVSGAVLGAPGEGAAYGAAGGFVLASALLIWLRAYLLYLVKGGHIAVLVAAYDGQPLPG
FT                   GFGQIAYALDVLKARFAEVNVLFVLDGLIRGVLRTICGLITALAGLVGLRPVANVLNAV
FT                   LYVSTMFVDELILARNIRTGGDPFSGAQDALVLYAQNAVAILRNAVVLTLVMALLAAGL
FT                   FALVVGPFGALAALFPGPLAYAGVALAGIAALTLVYAVAEPFCIACLLQTFIAVTDGQQ
FT                   PDPEWRGRLEGASARFRDLGARAIR"
FT   CDS_pept        complement(466455..467483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0413"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86411"
FT                   /db_xref="GOA:A8ILT8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILT8"
FT                   /protein_id="BAF86411.1"
FT                   /translation="MSLLELGLDTFGDVTVAADGTPKPHAQVLRDVVAEAVLADEVSVD
FT                   FIGLGEHHRDDFAISAPDVVLAAIAARTQRIRLGSAVTVLSSDDPIRVFQRFSTLDALS
FT                   NGRAEVILGRGSFTESFPLFGFALQDYETLFTQKLDLFAALLTNAPVTWSGSIRPPLKD
FT                   QKVFPPIETGRLKTWIGVGGTPESVVRAAHYGLPLMLAIIGGAPSRFRAYAELYRRALE
FT                   EARQPALPLGVHSPGYIADTDEAAKEEMFGPYKTMRDRIGAERGWPPMGRDEFEREVSH
FT                   GSLYVGSPETVARKIATTAKALGLDRFDLKYSGGPIPHAGQMRCVELYGTKVIPMVRDM
FT                   LA"
FT   CDS_pept        467673..468602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0414"
FT                   /product="histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86412"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILU0"
FT                   /protein_id="BAF86412.1"
FT                   /translation="MTTLLITHPAGLAHATPTGHPERADRLRALDRIFEQERFANLLRD
FT                   QAPRGEREDIIRVHPADFVDALGEATPAEGIVRIDSDTILSPGSWEAVLRAVGGACFAV
FT                   DEVMEKRVDNAFVAMRPPGHHCETRRPMGFCLLNQAAIAARHAQAKYGLGRVAIIDFDV
FT                   HHGNGTQEIFWADDSVLYASTHEMPLYPGTGAVGEVGITGNIVNAPLRSGDAGDKFKEA
FT                   FESRILPRLETFRPELVIISAGFDAHKNDPLASLRLVDTDFGWVTKKLMDVADKHSDGR
FT                   LVSILEGGYDLEGLAQSAAAHVTALMHG"
FT   CDS_pept        complement(468985..469683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0415"
FT                   /product="protein of unknown function"
FT                   /note="DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86413"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILU3"
FT                   /protein_id="BAF86413.1"
FT                   /translation="MRHQITGTTLPVLQVTLAAGETLLAETDRLSWMTNNIALETTTSA
FT                   GTGGGGFFGAIGRAISGGGLFMTHFTAQGGEGLVAFAATVPGAIIEEQVSPGRGFMIHR
FT                   HGFLAGSAELTLAIGFQQNLGSGVFGGNGFVLQRLTGQGTAFIELGGEIVSYELQPGQQ
FT                   LLVHPGHVGMFEESVGFDITMMRGIRNVLFGGDGLFLAQLTGPGRVWLQTLTPSKLAHA
FT                   LEPYLPRDQK"
FT   CDS_pept        469786..472200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0416"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86414"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILU5"
FT                   /protein_id="BAF86414.1"
FT                   /translation="MTGVRASFRQGMTGRLAESARWRRLRFHAATVADEVDGRMASEKI
FT                   EASGEAARASGQDQPQPMVQQALPYPVPDNEEARLAVLASYHLMDTPPEADFDRLAALA
FT                   ARVFDVPIVLVSLLGRDRQFFKASVGFPVCETSREVSFCAHAIMQDEILVIPDATRDPR
FT                   FRANPLVLGPPFIRFYAGRPLIAPTGEKVGTVCLIDHEPRFRFTETDRHNLNDLAAMAV
FT                   DRMELRRLDHARNISQARFENIAATSPDAIICMNAQGEIGFWNSSAERLFGHGAQDIHG
FT                   RSCRILVPGHLRRAYDVLMERMRRGGGLGSALRTFEVTGRRRDGVEFPAECSLSIWRDG
FT                   PNLSVGAIVRDVSDRRQNEERLFRLASRDTLTDLPNRSAWRQCLSQTLASEPGATVLMI
FT                   DLDGFKEANDTLGHSAGDAVLKEVAGRLASSCHEALIVARLGGDEFVVLLAGNDEHRAR
FT                   VVAERVVAAVTDRYGVGERKVSIGASIGIAFYPAHGARGEDLISAADLALYRAKAGGKG
FT                   CYEVFTPMLREVAIARRAFEEELRRAFENGEFELYYQPQVLTSRGQLMGAEALLRWNHP
FT                   QRGLLTPVSFLDVLSHKPSAAEVGEWILNTALRQAAEWRVAVPGFRMGVNLFEAQFRSG
FT                   RLMSTVRRALAESGLPPDALELEIVETILLQTDPATIRLLHDLRALGVGLAFDDYGTGF
FT                   ASLSLLKRYPVSRLKIDRSFLRNVNDAPRDAAIVKAVLFLGRAFGMSVIAEGVEDERQM
FT                   AFLRENGCDEAQGYLFGRPMPAREFAARFILCDTPPGDCGPELRERARIGA"
FT   CDS_pept        472197..472652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0417"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86415"
FT                   /db_xref="GOA:A8ILU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILU6"
FT                   /protein_id="BAF86415.1"
FT                   /translation="MTLPIRPARPEDRAAIEALVHAAYSPYVARNGLLPGPMRDDYGQL
FT                   IGEGRVHVAEADGAIAGLLVLLPQDDALLLDNVAVDPARHGTGIGRALLLFAEESARAA
FT                   GYGAIRLYTQEIMVENVALYSRIGYRETHRAEEKGLKRIYMLKTLAA"
FT   CDS_pept        472766..473863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86416"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILU7"
FT                   /protein_id="BAF86416.1"
FT                   /translation="MNRLFRHGLCLALAVGLALPAGMAPAAAQMAGPDLSAATGAVFLP
FT                   FLNAPAPGEAIARTPKLEIRFPGGRKRRAVMDTGSTGVVVSANLIPNLSQLPQLGPGSL
FT                   TYSSSGQIEKGVWVQTPLTLRGADGTRVTTRPMPVLAVQEVACMPKARRCRPNPNPTHI
FT                   AMVGVGFARQHDHQAQSTPDHNPLLSIEGMGAPGQPGAMRRGYVVSRAGVLVGLDVPST
FT                   QGFTFLKLEKSPIYPDWQAVPGCLSVAGRTPPACGTMLMDTGVTTMYLKVPPEQLSGLT
FT                   APDAKDQPALVPGTSVSVSVTGAQGISYSFAAGDTANPVAPLNVVLVGRDTNPTPFVNT
FT                   SVRFLNGFDYLYDADGGYVGFRPLK"
FT   CDS_pept        complement(473913..476093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0419"
FT                   /product="twin-arginine translocation pathway signal
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86417"
FT                   /db_xref="GOA:A8ILU8"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILU8"
FT                   /protein_id="BAF86417.1"
FT                   /translation="MNAILKAAEAGLSRRAILRAMGGVGIGLVIGTDILPTGPAAAATD
FT                   AAAASINPFVRIAPDGTITVVVKHLDLGQGTTTGFATLVAEELDADLSKVKTEFAPLDP
FT                   KVYGNAAFGGAQGTGGSTSMAASFDVYRRAGAAARAMLLAAGAKALNVPADAITITSGT
FT                   LMAGPKTATFGELAASAAREPVPQDPPLKKAANYALVGKEGTHRVDNLLKTTGTATYTQ
FT                   DVKLPGMLVAVVAHPPRFGAKALKVDDAAARAVKGVEAVVVVPQGVAVLAKTTYAAMKG
FT                   RNALKVEWDEAKAEKRGTDALREEYRALLGKPGNVAETEGNVEDAFKAPGVKVVEADFE
FT                   FPFLAHAPMEPMNAVAQITGDQVTIWTASQFPSADAPGAAAAAGTSVDKVTINSLWAGG
FT                   SFGRRAVANADFVVEAVAIAKAHGKGVPVKLVWTREDDMKAGYYRPMYLHRVKAAVDAS
FT                   GKPVAWKHHVVGQSILSGTLFEKMMVVNNIDATSIEGAAGMGYAIPNLHVELTSPKVGV
FT                   PVLWWRSVGHTHTAYAVEVMIDQLAKAAGKDPVAFRMEILKDPRLKAVLALAAEKARWG
FT                   TTLEKGRFRGVAAHKSFNTYVAEVAEITLLEKGYRVDRVVAAVDCGFVVNPDVVRAQVE
FT                   GGVGFGLGHVMQDAITLTDGQVDQANFDTYEPLRMSQMPKVEVHIVPSTEKPTGIGEPG
FT                   VPPIGPAVANALFAATGKPMLNLPFNRQTIGS"
FT   CDS_pept        complement(476097..476558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0420"
FT                   /product="isoquinoline 1-oxidoreductase"
FT                   /note="alpha ubunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86418"
FT                   /db_xref="GOA:A8ILU9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILU9"
FT                   /protein_id="BAF86418.1"
FT                   /translation="MPITLSINGQTRTVEAEPDTPLLWVLRDELDLTGTKFGCGQALCG
FT                   ACTVHVDGAAVRSCQTAIGDVGDAKVTTIEGLKSREAEAVQAAWRQLDVVQCGYCQSGQ
FT                   IMSAVALLTDNKKPTDADIDAAMDGNVCRCATYQRVRAAIHDAARRLEA"
FT   CDS_pept        complement(476714..477142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0421"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86419"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILV1"
FT                   /protein_id="BAF86419.1"
FT                   /translation="MQTDLPPNTYAADCPTRQILDRIADKWAVLILQLLADEPQRFNAL
FT                   RRKIQGLSQKVLSQTLKTLERDGFVTRTAFPTVPVTVEYALTPLGASLAETLTPLSRWA
FT                   EAHIKDVEAARAAFDHRRATSGEGVPQGQTESHAPVAL"
FT   CDS_pept        477276..477887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86420"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILV2"
FT                   /protein_id="BAF86420.1"
FT                   /translation="MKIAVIGASGNAGAEITAELARRGHQVTAIARNADKIAKLPGVTA
FT                   VAGDAGDAAGIAKLIAGHDAVVSSIHFLASDADELISAVKQAGVPRYLVVGGAGSLEVA
FT                   PGVKLFDTPDFPAIYLGEAKAGGAFLDKLKAEPDLNWTFLSPAALFFHGPRTGTFRVGG
FT                   DGLLVAADGNSSISFADYAIALADEIETPRHPRARFTVGY"
FT   CDS_pept        477895..478512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0423"
FT                   /product="putative protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86421"
FT                   /db_xref="GOA:A8ILV3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILV3"
FT                   /protein_id="BAF86421.1"
FT                   /translation="MTIRLHYIHDPLCGWCYAAAPLAEAAAAVPGVEIVLHGGGLFPEP
FT                   AQLAPAMVSHIRAADARIAQMTGQAFGRPYLDELLPDPALRLHSLPPIAAVMAAEELAG
FT                   QGLGMHVAIQRAHYVDGKRVVEPETLADLAQGLGLDREGFVSALGRQPVADHLSQTRRL
FT                   MARFGLGGFPGFVRESDGRFDVLPHTQLYGQPGKFADLLKAG"
FT   CDS_pept        complement(478741..480384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0424"
FT                   /product="chaperonin"
FT                   /note="Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86422"
FT                   /db_xref="GOA:A8ILV4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ILV4"
FT                   /protein_id="BAF86422.1"
FT                   /translation="MAAKEVKFAGEAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFG
FT                   APRITKDGVSVAKEIELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVKEGA
FT                   KAVAAGMNPMDLKRGIDLATAAAVKDIQARAKKVSSSAEVAQVGTISANGDSSIGEMIA
FT                   GAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNAEKMIADLEDPFLLI
FT                   FEKKLSGLQPILPVLEAVVQSGKPLVIVAEDVEGEALATLVVNKLRGGLKVAAVKAPGF
FT                   GDRRKAMLEDIAILTGGQVISEDLGIKLENVTLAQLGRAKKVILEKEKTTIVDGVGEKA
FT                   EIEARVAQIKAQIEETSSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRVDDA
FT                   LNATRAAVEEGIVPGGGVALLRAKKAVEALSSENPDIAAGIKIVLRALEAPIRQIAENS
FT                   GVEGSIVVGKVLESEGNFGFNAQTEQYVDLVAEGVVDPAKVVRTALQDASSVASLLVTT
FT                   EALIAELPKKDAGMPAMPGGGMGGMGGMDF"
FT   CDS_pept        complement(480434..480721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0425"
FT                   /product="chaperonin"
FT                   /note="10 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86423"
FT                   /db_xref="GOA:A8ILV6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILV6"
FT                   /protein_id="BAF86423.1"
FT                   /translation="MSFRPLHDRVVVKRIEAEQKTAGGIIIPDTAKEKPQEGEVVAVGP
FT                   GARDENGKVVALDVKAGDRVLFGKWSGTEVKIDGQDLLIMKESDILGVIG"
FT   CDS_pept        481092..481610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILV7"
FT                   /protein_id="BAF86424.1"
FT                   /translation="MPQSSIRPVRADVASGKRRSLGAIAAVTCAGLLLAACATTEAPPP
FT                   PPPPGPPQYTSPIPASSLVGRYGLAAYHRPEDAGRTEAQARAQCSNPYIITAGPNGGVM
FT                   MYLADDPKLTEVVSKAAGGPTYIGPPEDAAGDVRDRQVLRWDGHVLVLKWVDPEVNKRY
FT                   GTMVYVRCN"
FT   CDS_pept        complement(481735..482169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0427"
FT                   /product="putative glyoxalase"
FT                   /note="bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86425"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILV8"
FT                   /protein_id="BAF86425.1"
FT                   /translation="MPPAFALHLVTLGVADLPRATAFYAAMGLERREHATTGVSFFQAG
FT                   GVALSLFPRAALAADAGLDAEADAGRAAATLAFNVPDEASVDAALAHAARLGAEIVKPA
FT                   QRAFWGGYSGYFADPDGHLWEVAHNPFWPLDADGRPTLPD"
FT   CDS_pept        complement(482177..483568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0428"
FT                   /product="elongator protein 3"
FT                   /note="MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86426"
FT                   /db_xref="GOA:A8ILV9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILV9"
FT                   /protein_id="BAF86426.1"
FT                   /translation="MFLFRSCLGRRIPSMELHRDSSPSSAPDFAALPDDRWSAARERLD
FT                   AARRHSAEALDKARRSRGEPAGEEPRTSRGARIMGRLAEERDRPMPTPRAAAQDAAAGE
FT                   GGTQVDETARRGRGALSNAAGRFEPAARVLFDDGWQSLDDLPPFRTQVTEERARTVITR
FT                   NQSPDIGFDRSINAYRGCEHGCIYCFARPTHAYQGLSAGLDFETKLFVKPDAPELLARE
FT                   LAQPRYQPRTIAMGTNTDPYQPIERQHEITRRILQVLSDFGHPVAIVTKSALVARDIDI
FT                   LAPMAEKGLAKVAISVTTLDPHLARLMEPRAAAPHRRLATIQRLSEAGIPTAVLSAPLI
FT                   PALNDSEIERILDAAKFAGATEAGYVTLRLPLEIADLFKEWLVTHFPDKARHVMALVRE
FT                   MHGGKDYDSTFGKRGRGDGPYAWTLGRRFEIAAKRLGLNARSHKLSTAHFRRPVQAGQQ
FT                   LSLFD"
FT   CDS_pept        483701..483853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="bacterial aa3 type cytochrome c oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86427"
FT                   /db_xref="GOA:A8ILW0"
FT                   /db_xref="InterPro:IPR012422"
FT                   /db_xref="InterPro:IPR036596"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILW0"
FT                   /protein_id="BAF86427.1"
FT                   /translation="MSEHGAIEYATADGNDYAEHKRTYELFTALTKWGTVAVAALMVIM
FT                   WFTLL"
FT   CDS_pept        483883..485034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0430"
FT                   /product="NAD(P)(+) transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86428"
FT                   /db_xref="GOA:A8ILW2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILW2"
FT                   /protein_id="BAF86428.1"
FT                   /translation="MKIAVPAEVDLGEPRVAATPDTVKRLIGLGAEVAVQSGAGLASGI
FT                   PDADYQAVGATIAATAGDAVSGADVVLKVRRPTVEEIAGYKSGALVIGIMDPYGNEAAL
FT                   AELAKAGLSTFAMELMPRITRAQVMDVLSSQANLAGYRAVIDASAEFGRALPMMMTAAG
FT                   TVPAAKVFVMGAGVAGLQAIATARRLGAVVTATDVRPAAKEQVESLGAKFVAVEDEEFK
FT                   QAETAAGYAKPMSAEYQAKQAALVAEHIKKQDIVITTALIPGRPAPRLVSAAMVASMKP
FT                   GSVIVDLAVERGGNVEGAVPGEVADVNGVKIVGHLNVPGRLAASSSQLYAKNLFAFLET
FT                   LVDKQAKALAVKWDDELVKATLLTRDGAVVHPNFAPKVEGAAQ"
FT   CDS_pept        485031..485486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0431"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha
FT                   PART 2 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86429"
FT                   /db_xref="GOA:A8ILW3"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILW3"
FT                   /protein_id="BAF86429.1"
FT                   /translation="MNPITAQAAADSAAQAKAAAEIARQAADAAQLYADQAAAAVGAVA
FT                   HAATGGAIDPFVFRLSIFVLAVFVGYYVVWSVTPALHTPLMSVTNAISSVIVVGALLAV
FT                   GVSTVGDPGHTWWARGFGFIALIFASVNIFGGFLVTSRMLAMYQKKK"
FT   CDS_pept        485497..486894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0432"
FT                   /product="NAD(P) transhydrogenase beta subunit precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86430"
FT                   /db_xref="GOA:A8ILW4"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILW4"
FT                   /protein_id="BAF86430.1"
FT                   /translation="MTANLAALLYLIAGILFILALRGLSHPTTSRQGNLFGMVGMGIAV
FT                   LTTLALSPPADAFGWVLVIAGIAIGAGVGAVVARRIAMTAMPQLVAAFHSLVGLAAVLV
FT                   AAAALYAPAAFGIGDYGHIHGASLVEMVLGVAIGAITFTGSVIAFAKLNGNMSGKPIML
FT                   PGRHYINGGLTLLLLVLIVAFVMTGSSVLFWLITILSLVLGGLLIIPIGGADMPVVVSM
FT                   LNSYSGWAAAGIGFTLGNTALIITGALVGSSGAILSYIMCKGMNRSFISVILGGFGGEV
FT                   AGAAGGAVEARPVKQGSADDAAYIMKNAQKVIIVPGYGMAVAQAQHALREMADKLKAEG
FT                   VEVKYAIHPVAGRMPGHMNVLLAEAQVPYDEVFELEDINSEFAQADVAFVIGANDVTNP
FT                   AAKTDPASPIFGMPILDVEKAKTVLFIKRGMGSGYAGVENELFFRDNTLMLFGDAKKVT
FT                   EEVVKNL"
FT   CDS_pept        complement(487121..488434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0433"
FT                   /product="putative transmembrane transport protein"
FT                   /note="MFS family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86431"
FT                   /db_xref="GOA:A8ILW5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILW5"
FT                   /protein_id="BAF86431.1"
FT                   /translation="MSSPAPALQPSPVPAAFARLGIHYGWVVAFVTFLTMLVTAGAVGT
FT                   PGILIGPLQQEFGWSTSAISSAFAIRLVLFGFMGPFAAAFMNRFGVRRVAVVALSLIFA
FT                   GVLGSFAMTQLWQLVLLWGFVVGFGTGLTAMVLGATVATRWFVARRGLVIGLLTASTAT
FT                   GQLVFLPLLAELTQTLGWRSALTVVLVLLGVAALIVLALMRDRPSDVGLAPFGAPAGTV
FT                   PAAPAGPASLSAMLASPLLALRDAARTRIFWMLFGTFFVCGASTNGLVQTHFVSLCGDF
FT                   GLAPVAAAGMLAVIGVFDFAGTVGSGWLSDRFDSRTLLFWYYGLRGLSLIYLPFTSFSF
FT                   YELSVFAVFYGLDWVATVPPTVKLTADRFGERANLVFGWVFAGHQMGAAFAAWGAGFTR
FT                   TAYDTYLPAFFFAGVLCVAAALAIIALREPRVPAPAAA"
FT   CDS_pept        complement(488480..488878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marR"
FT                   /locus_tag="AZC_0434"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86432"
FT                   /db_xref="GOA:A8ILW8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILW8"
FT                   /protein_id="BAF86432.1"
FT                   /translation="MSPPCHCTRLRIATRKMTALYDTALAPTGINVAQFSILRTIERRQ
FT                   PVSLTELGRLLALDRSTMGRNVRVLEKQGLVALGRGKDQREAAASLTETGTATLRAAEP
FT                   LWEDCQTDMGRRLGAERLALLDQLNQLL"
FT   CDS_pept        488934..489527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0435"
FT                   /product="putative acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86433"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILW9"
FT                   /protein_id="BAF86433.1"
FT                   /translation="MGLFGCLAGASPYSDGAITRGSSMGQHSRQPFTGRYRAALAALAF
FT                   LASALPAAAAEVVALGASQTYGKGVARGEDYPSRLQVLLREQGLKVSVRNAGVNGDTTA
FT                   GMRARLPSVVGADTRVVILQPGGNDKMKGQADQTSSNVSAMKAELEARHIKVVMLPNHA
FT                   FAGYPRQADGQHLLPDGYKAVAAQLAPQVAAALK"
FT   CDS_pept        complement(489574..489936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0436"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86434"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILX0"
FT                   /protein_id="BAF86434.1"
FT                   /translation="MVVISDKILRIVAPSGRPATTAALYKLNLQEKALERQISELKSSS
FT                   GTSGADVQEEIRKLETKLSEIQKKMEPLKAQLEELREQEDKEAEASAAAREAALRKGEN
FT                   PYAHPLKIDLTSIDRK"
FT   CDS_pept        complement(490332..492236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0437"
FT                   /product="peptidase M3B protein"
FT                   /note="oligoendopeptidase-related clade 3 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86435"
FT                   /db_xref="GOA:A8ILX1"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR034013"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILX1"
FT                   /protein_id="BAF86435.1"
FT                   /translation="MALKAGAVARYDRHSRFDASGGAMFGPVSFLTPDAATASAPATPL
FT                   PEWNLADLYAGMDDPRIATDLAEADALSKAFEADYKGKLADIAAAADAGAQLGAAVKRY
FT                   EAIDDLMGRVASFGSLVYAGDTADPARAKFFSDIQEKLTDSSTHLLFFTLEMNRLEDAQ
FT                   VEAALKDAAFGHYRPWVEDLRKDKPYQLEDRVEQLFHEKSSPARGAWGRLFDETMSSLR
FT                   FSVDGKELAIEPTLNLMQDPNEAVRKAAGQALAQTFSENLRLFSLITNTLAKDKEISDR
FT                   WRGFEDVADSRHLANRVEREVVDAMVASIREAFPRLSHRYYALKAKWFGKEKLEFWDRN
FT                   APLPKVDTRDIGWDEARDTVLGAYSTFSPRMADIARVFFDKNWIDAPVRPGKSPGAFAH
FT                   PTVPSAHPYVLLNYQGKPRDVMTLAHELGHGVHQVLAGRQGALMAPTPLTLAETASVFG
FT                   EMLTFRRLLAAAETPQARKIMLAQKVEDMINTVVRQTAFYTFERKVHTERRQGEITAER
FT                   IGELWMDVQTESLGPAINLSAGYETFWTYIPHFIHSPFYVYAYAFGDCLVNSLYAVYQK
FT                   ASDGFAERYLEMLAAGGTKHHSELLAPFGLDARDPAFWQTGLGLIESMITELEQMEGA"
FT   CDS_pept        492340..493035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0438"
FT                   /product="Fis-type protein"
FT                   /note="helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86436"
FT                   /db_xref="GOA:A8ILX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILX4"
FT                   /protein_id="BAF86436.1"
FT                   /translation="MVEDDFFECSRVESALLHQGHEVVCVGDGDAALARLDAEPFDLML
FT                   LDLVLPGLDGMGVLRTLEARGSSVPVIVSVTPAGIDGAASAIRAGARDFVVKPAGALRL
FT                   KVAITNALALAGAGAVSERPAAPVAGAPVRLRLAHDADWTAQDRSGQPAPKACGINESL
FT                   PFLDALGHTRTLEQLEADAIRAAVSLYGGRMSEVARRLGIGRSTLYRKLSALGLPVPEP
FT                   VSPLAVAAE"
FT   CDS_pept        493225..495174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86437"
FT                   /db_xref="GOA:A8ILX5"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILX5"
FT                   /protein_id="BAF86437.1"
FT                   /translation="MGQMKRPLLRPLPWPSAGRVFAGLMLGAVFAGAGLPVLMPADPAV
FT                   ASTDDTSPASRAAAASEANGIAWPPAHVEPGHVSTPAAKQATPAAPVTPAPAATQAATP
FT                   APSAPAAPANAAATPAAPAVATPSTTAEAPKLNPLAEQVRQILAVPALEGLGITKREQE
FT                   AIQSFYAARQDEPVFVTDKGLNAVGKGVEARFAAAAEDGLDPAAYPVPKLAAQPDLPAL
FT                   ARAEVRLAASALLYARHAQAGRFDPSRISPQLTPLRTFPDPVTVLSGLVDAKDASAVLA
FT                   AYNPTHAGYKALKAKLALADSHAGPAPVRVPGGPTLRPGDMDARVPALRARLGLKSATA
FT                   SDRLYDADLARAVAAFQGASGLNADGVVGPSTLEVLNRVENPAERRADIIANMERWRWL
FT                   PRDLGSVHVMVNIPEFVVRVVDDGKTIHQTRVVVGKPENQTPLLTHDMEYVVLNPYWNI
FT                   PPSIARKEMLPNLQRDPYFLARQGMEVVKNGRVVDPGTVNWAQGTGGYSFRQPPGERNA
FT                   LGRIKFMFPNDHSVYLHDTPSKALFANDRRAYSHGCIRVQDPLKFAEVIFNIGMPGQGW
FT                   TDEKIGKMLGGAERYLTLKQRIPVHLVYFTTFVDDSGRLVSREDVYGTNAKVKEALGLD
FT                   GEQKVAGRAVPVPR"
FT   CDS_pept        495545..497101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0440"
FT                   /product="protein of unknown function"
FT                   /note="DUF882, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86438"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILX6"
FT                   /protein_id="BAF86438.1"
FT                   /translation="MPNKNNTRLPLRIWTSDRSGIALSPSVRRTARSLAVAATLFLCGT
FT                   GTLQNAVANGDTRTLTFTNPHTGEAGSFTFKKDGRYDPEVLKQLNWLARDWRKDEPIEM
FT                   DPHLFDLLWEVYREVGATAPITLLCGYRSPSTNAMLRSRSKAVAETSQHMRGRAMDFYI
FT                   PGVRLAELRETGLRLQRGGVGFYPSQNFVHMDTGGVRMWPRMSREELARVFPDGKTVLI
FT                   PTDGKPMSGYQLALAELEARGSVASDAPQADGFKGIRNFFASLFGKPAPEESDAGEVEG
FT                   VQPERAPRATQVASAAPSRAATPAPAPAASAPLPPPQASRPVVTAVSTTPLPSARPAEI
FT                   AAAAMLTAHATNAPFAPLPIKRPQAPTQVASLEPAGAPVPLPAVIMRGTSERSEIMGPP
FT                   PSTALGYAAGGDIASALPPNPAIAAAPQPRLRGSSRTAADIPFGRVFRGPGLWGEAYLK
FT                   MPETRVFTAFLTAPQEVVAQGFGKDPMGGLSTSRFSGEAIAVLPTYVFQAPPVRLSQRG
FT                   L"
FT   CDS_pept        complement(497189..497482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="tRNA-binding arm"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86439"
FT                   /db_xref="GOA:A8ILX7"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILX7"
FT                   /protein_id="BAF86439.1"
FT                   /translation="MVHMARTAGRSERMTADVADTGVAADELRQFVERIERLEEEKKAI
FT                   ADDIKDVYAELKARGFDSKAVRKIVQIRRQDAQERQEQEAILELYMQALGLA"
FT   CDS_pept        complement(497688..497993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0442"
FT                   /product="protein of unknown function"
FT                   /note="DUF1244"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86440"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="InterPro:IPR036810"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILX9"
FT                   /protein_id="BAF86440.1"
FT                   /translation="MTDLSEDERTKLEAAAFRRLVAHLAARTDVQNIDLMNLAGFCRNC
FT                   LSNWYLDAAQEAGLPLSKDESRQAIYGMPYEDWKALHQREATDAQKAAFEQAKPSH"
FT   CDS_pept        498186..499085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0443"
FT                   /product="conserved hypothetical transmembrane protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86441"
FT                   /db_xref="GOA:A8ILY1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILY1"
FT                   /protein_id="BAF86441.1"
FT                   /translation="MTSQPAPSLRLAAGISALVLGALAMGASVLFVRLADVGPFASAFW
FT                   RTALALPFLLVWARIETGPRLPVPDRASVLAGLFFAGDLIFWHLAILGTTVANAAVLAT
FT                   TSPIWVALYAFFMLREPFTKPLVAGLLLCIAGTLALIGQSWQFAPEKLAGDAAGLITAM
FT                   FFASYFLSVRVARRRFGAGLVTFLSTAITSLALLVVALVMEPVLLPHTLQGALAVLALA
FT                   VVSQVGGQGLMAVGLSVVPPVFGALVFFLEVVSAAALGWLVLGEHLGLLQYCGAALIVL
FT                   GLVMARPRPGPVPEPGLP"
FT   CDS_pept        499223..499807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0444"
FT                   /product="protein of unknown function"
FT                   /note="DUF1036"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86442"
FT                   /db_xref="InterPro:IPR009380"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILY2"
FT                   /protein_id="BAF86442.1"
FT                   /translation="MVSDDPKHSAGMIRPFLHHLEYFRAIRMRMRARLPLLLALLGTVG
FT                   LFSVVLPDPAAADFRLCNRTQSRVGVAIGYKEGENWATEGWWNIAANSCETLLRGDLVA
FT                   RFYYLYAVDYDQGGEWSGKAFMCTRDKEFTIRGVEDCLARGFDRTGFLEVDTKEQKGWT
FT                   VQLTESNQTGTRPQGAASPAPMPPPAPPARR"
FT   CDS_pept        complement(499818..500612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0445"
FT                   /product="TPR repeat precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILY3"
FT                   /protein_id="BAF86443.1"
FT                   /translation="MRGLAGLGVDGRTLAPDTWLMKPPRILAPHPGRIPSKKLALRGSR
FT                   VTTRAALVTHFKSRRMALVLAVALAAASQAEAQTTGPVPSRPEATAPAETAPRPKPPRD
FT                   KRTQINALFEALRLAPDEATAEAVGERLEPLLGETQSTAGELLLARANAAAEAKQYDLA
FT                   LALLDQVVEIEPDSLAGFSRRATVYYLQDDYADALLDIREVLAREPRHYTMLLGLAMIL
FT                   REIGDEPRALEAARKALAVNPNLAPAKELVSQLATKVDGRGI"
FT   CDS_pept        complement(500648..500773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0446"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86444"
FT                   /db_xref="GOA:A8ILY5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ILY5"
FT                   /protein_id="BAF86444.1"
FT                   /translation="MKIRNSLKSLLGRHRDNRLVRRKGRIYIINKTQKRYKARQG"
FT   CDS_pept        complement(500915..502270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86445"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILY6"
FT                   /protein_id="BAF86445.1"
FT                   /translation="MTSQDDAERNRFSARAARYARVGVNVGGVAARIAGARLMGGAGAG
FT                   NAEALAAALGGLKGPLMKVAQLMATVPDVLPPEYASELQKLQSDAPPMGWSFVRRRMMA
FT                   ELGRDWESRFSSFEHKPAAAASLGQVHRAVALDGDQLACKLQYPDMQAAVEADLNQLDV
FT                   LFSIHRRMDPAIDTREIATEIGARIREELDYRREAKHAKLYARMLAGQPHVRVPHVRDD
FT                   LSTGRLLTLQWLEGTKILAFKDHSLEERNLLARAMFTAWWLPFSQYGVIHGDPHLGNYT
FT                   VFTDADGGPQGINLLDYGCIRIFPPRFVAGVVDLYRGLEAHDEARVVHAYETWGFNGLT
FT                   RELIDTLNIWARFIYGPLLDDRVRTIADGVEPGQYGRKEAFQVHTALKRLGPVTVPREF
FT                   VFMDRAAIGLGAVFLHLRAEQNFHALFEEAIVGFSHEAVAARQAEALAEAGL"
FT   CDS_pept        complement(502305..502760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86446"
FT                   /db_xref="GOA:A8ILY7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILY7"
FT                   /protein_id="BAF86446.1"
FT                   /translation="MLVLLCTGLSVRRTQTRTAGFVLERLIAYILLFPVGLVGLWAALG
FT                   HIVFAAQAAASIGWAPSPFQFEVGVANLGIGVAGLIGVWYRNWGYRLAVAVMTGGFLGG
FT                   AAVGHVVQIVSTGNLAAGNAGPILYTDVLTPLSLLVLLALTVRSARS"
FT   CDS_pept        502768..503289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0449"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86447"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILZ0"
FT                   /protein_id="BAF86447.1"
FT                   /translation="MIGTQKTIFPPRQMTQGNQFIPSTPGIGAPAAWLRLRRGRGSPRG
FT                   LVMSFWRAPRSGFGRWVFPLLLAYALLIQSVIGTLASTEHSVGVAAGFVCEGSAGTDHG
FT                   PSDGAGHDALCCVFGCTAAAAPALLDPPAPFLLTERDTAVIRLAPLPDGAPARARRQLS
FT                   FAARGPPARV"
FT   CDS_pept        503336..504313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0450"
FT                   /product="protein of unknown function"
FT                   /note="DUF461"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86448"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR021174"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILZ1"
FT                   /protein_id="BAF86448.1"
FT                   /translation="MTQTFVSRARPLAVAALVSLTAGSASAHVVLAQKEAQPGSYQGTL
FT                   KVGHGCDGSATTAIKVTIPEGVVGVKPQPKAGWTIAIETGPYAKAYPMMHGKPATEGVK
FT                   TITWSGGNLPDAYYDEFVFVSTLTPDVAGQTLYFPVLQTCEKGSTNWAETPVAGQPVPP
FT                   RPPAILKVAQAAASAPAASAQVKVGDLVLDAPWTRATPGGAKVAGGFLKITNTGSAPDK
FT                   LLSASFERAAKGEVHEMSMANGVMTMRELAGGLEIAPGKTVELAPGGYHLMFMDLKQPL
FT                   KEGEKVKGTLVFEKAGKVDVTFDVRGIGATAPAAGGMGNMGHQH"
FT   CDS_pept        complement(504347..505264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0451"
FT                   /product="transcriptional regulator"
FT                   /note="LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86449"
FT                   /db_xref="GOA:A8ILZ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILZ3"
FT                   /protein_id="BAF86449.1"
FT                   /translation="MIDLSPGFFNAHSMSIKNLDLDLLRSFAAVAELGSISAAAQRIGR
FT                   TQSAVSLQMDRLAEQLGFPVVERKGRGVALTPRGAAFLDDARRLLDLNDRVLGHHLRSG
FT                   FSEPLRLGFVQDVAESALQRILARLGSLFPGAPITVRVCSTNTMIEKLRIGELDLAAGY
FT                   RVETDVPTRLIMREQMCWIGARSLRLNPEEPVPLLMFESPCIFRSAAISALTAAGRSFR
FT                   IALTSPSLPGVMAAVGAGLGITLRSARSLRPDLMTIGDLGTQPLPHFEYALYSRAENRL
FT                   PALDQIEQVIEEELRRERPLFAVA"
FT   CDS_pept        505319..505723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0452"
FT                   /product="uncharacterized protein"
FT                   /note="4-oxalocrotonate tautomerase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86450"
FT                   /db_xref="GOA:A8ILZ4"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILZ4"
FT                   /protein_id="BAF86450.1"
FT                   /translation="MPILNVKLSAPAATSVAQVAQTLTRLTQEILRKDPNLTAVAIDVV
FT                   PAEQWFIAGQSLAQAGLASFWLDIVVVDGTNTKDEKAAYVAGVFAAMSALLGPLHPESY
FT                   VLVREVKADAYGHGGLTQEQRYVERKMKAA"
FT   CDS_pept        505815..507002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0453"
FT                   /product="putative adenine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86451"
FT                   /db_xref="GOA:A8ILZ6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILZ6"
FT                   /protein_id="BAF86451.1"
FT                   /translation="MRLMSVVRKGAPRRAPRLSGGVDFAEPSRAIPTDRILIGDCVEQL
FT                   ASLPPHSVDMVFADPPYNLQLQGELKRPDDSRVDAVDDAWDQFESFEAYDAFTRAWLLA
FT                   VKRVMKPNATIWVIGSYHNIFRVGALMQDLGFWILNDVVWRKSNPMPNFRGRRFTNAHE
FT                   TMIWAARDPGAKGYQFNYEALKGGNEDVQVRSDWLLPICTGGERLKDAQGRKLHPTQKP
FT                   EALLARVMLSASKPGDVVLDPFLGSGTSAAVAKRLRRHFVGVERDETYAAAAAARIDAI
FT                   EPLPEAALVAPPSAREAPRVAFSALVDSGLVTPGLELTDAKGHVRAVVRADGTIALVNA
FT                   ATLAVGSIHRMGALAQGAEACNGWTFWHVEQEGRRHPIDVLRARLRAEMGIRSEE"
FT   CDS_pept        complement(507113..507523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0454"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86452"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILZ8"
FT                   /protein_id="BAF86452.1"
FT                   /translation="MLPFRTHSSSKQGDYIPIGKSYLFPRHGAALTPPQHQTRNTPMRT
FT                   LSYAALALVAGLSLTSVAQADEYTTQEVRDQYAVAAESAAHNQPLLPFTAQATARTAAP
FT                   QAQAATQDAIVGPFSDKDAHSGPAHFGIPSRL"
FT   CDS_pept        complement(507598..507993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0455"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86453"
FT                   /db_xref="UniProtKB/TrEMBL:A8ILZ9"
FT                   /protein_id="BAF86453.1"
FT                   /translation="MSFANGRLSAGPKGLSLPSKRSGADAARHRTRKTPMRNLSYAALA
FT                   LVAGLSLTSVAQADEYTTQEVRDQYAVAAESAAHNQTLLPFTAQATARTAASKAQAPAA
FT                   TQDAIVGPFSDKDAHSGPAHFGIPSRL"
FT   CDS_pept        complement(508045..509166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="AZC_0456"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86454"
FT                   /db_xref="GOA:A8IM01"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM01"
FT                   /protein_id="BAF86454.1"
FT                   /translation="MTARATAAKPTAPTPAATKRQAPRSSTAPAPSALLAWYDRHRRRL
FT                   PWRAEAGRTADPYHVFLSEIMLQQTTVKAVGPYFTDFLRRWPTVRHLAEAPLEEVLSAW
FT                   AGLGYYARARNLHACAKAVVARHGGHFPADEAALLDLPGIGPYTAAAISAIAFDLKASP
FT                   VDGNIERVVSRLYAVDEPLPKSKPRIKALAAALTPERRPGDFAQAMMDLGATICTPRSP
FT                   ACPLCPWMEPCTARAEGDPARYPVKAPKGEKPKREGIAFLIVRADGAVLLRTRPDKGLL
FT                   AKMTEVPSTPWGARPETPATHAPLAARWRPLPGAVEHVFTHFALTLSVLRADVPARTPA
FT                   PDGHRWVHPSGFDREALPSVMRKVLAHGRIGEG"
FT   CDS_pept        509176..509721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0457"
FT                   /product="protein of unknown function"
FT                   /note="DUF1159"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86455"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM02"
FT                   /protein_id="BAF86455.1"
FT                   /translation="MPSAAGRGKALPVGGFGEQRFVMRKPKQAHLLADLVGPSIAEALG
FT                   RAGFSIVEIVTHWDEIVGPDLAPRTLPLKMQWPNRQGTEPATLIVRVEGAYAIELQYAA
FT                   PVVVERINAYFGWRCVGRLALRQGPVPRRSGPPPRVPEPAPSELEAARRLVPPGEDEAL
FT                   TSALTRLGALVRRERGGG"
FT   CDS_pept        509802..510533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0458"
FT                   /product="putative twin-arginine translocation pathway
FT                   signal protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86456"
FT                   /db_xref="GOA:A8IM04"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM04"
FT                   /protein_id="BAF86456.1"
FT                   /translation="MLARSCLRRMFPETFMLLHRRRFLEGVGLLALAGGVGLPLARLLG
FT                   VSVDLISPAAAQTVEDAKLTAPAASPLPVKALGNPKAPVTIIEYASMTCSHCAAFATQT
FT                   FPTLKTKYVDTGKVYYILREFPFDPVSTAAFMLARCVPDDKYFPMVETLFETQRSWAFG
FT                   NNPAAGLLTVAKQAGMSEADFEKCLTDKDLAEKVQASAQYGNKELGVDSTPTFFINGKK
FT                   IAGAISIADLDKELAPLLQGK"
FT   CDS_pept        complement(510608..511240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86457"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM05"
FT                   /protein_id="BAF86457.1"
FT                   /translation="MRAVWTPSGGKVMTPARIPGPRLVGAGLIAALVLVASTVPAANAA
FT                   ERGVTFAPSGGGGYGGYGGGWSGGGAQPGPPGPPGPPGPNTGIWLQPDISVPMPPDQNP
FT                   MPPGAPLIPPDQIQAIVSGAGYARVGTPQLSQGYYYMKASSAAGDVMLAVDARSGQVVS
FT                   SRPIPSTPRPPVVDSGSLIGNGSLIGTPPPTVPRGPLAPDPNNPDGE"
FT   CDS_pept        511539..516326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0460"
FT                   /product="large subunit glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86458"
FT                   /db_xref="GOA:A8IM07"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM07"
FT                   /protein_id="BAF86458.1"
FT                   /translation="MACVQVERARACARTMGCLDRRMPDSRRGPGTMTNVDRSIGTANV
FT                   ALGAANAKDPAIAGRPEAFGLFDPAHEKDSCGVGFIADIKGRKSHKIIQDGIQILLNLE
FT                   HRGAVGADPRAGDGAGMLVQIPHRFFAKEAEKLGFTLPEPGQYAVGHIFMPRDAEGREI
FT                   VRAAFERVVAEEGLVLLGWRTVPTDNSSLGESVLPTEPNHEQIFIGHGEAQMDEDAFER
FT                   RLFVMRKVISNVIYDAKDPRTAGYYPVSISCRTLVYKGMFLADQLGAYYPDLHDPDFES
FT                   ALALVHQRFSTNTFPAWPLAHPYRMVAHNGEINTLRGNVNWMAARQASVDSELFGADIS
FT                   KLWPISYEGQSDTACFDNALEFLTQGGYGLAHAAMMLVPEAWAGNPLMDEERRAFYEYH
FT                   AALMEPWDGPAAIVATDGRQIVATLDRNGLRPARYLVTSDDTIVLASESGVLTVPEEKI
FT                   VTKWRLQPGKMLLVDLKEGRLVPDEEIKTELARANPYKDWLKHTQLVLEDLRPVEAREV
FT                   RTDVSLLDRQQAFGYTQEDVKLLMAPMAITGQEAVGSMGTDTPIPVLSNNSKLLYNYFQ
FT                   QNFAQVTNPPIDPIREEMVMSLVSFIGPRPNIFDLEGTARRKRLEVRQPILTNEDLEKI
FT                   RSIGFMEERFDTRTLDITYPSDKGAAGLEGALERLCERAEAAVHGGYNIIILSDRMVGP
FT                   DRIPIPALLATAAVHHHLIRKGLRTSVGLVVETGEAREVHHFACLAGYGAEAINPYLAF
FT                   ETLLALEDIPDEVDDTEIVKRFIKSIDKGLLKVMSKMGISTYQSYCGAQIFDAVGLSSA
FT                   VIERYFFGTASTIEGVGLAEIAEETVRRHQIAFSDAPVYRLALDVGGEYAYRMRGEDHA
FT                   WSPDSVAALQHAVRGNAQDRYRDFADQVNEQDKRLLTIRSLFRLKEAHEFGRAPIDISE
FT                   VEPAADIVKRFSTGAMSFGSISREAHTTLAIAMNRIGGKSNTGEGGEEAERFKPLPNGD
FT                   SARSAIKQVASGRFGVTAEYLVNSDVMQIKVAQGAKPGEGGQLPGHKVDAVIAKVRHST
FT                   PGVGLISPPPHHDIYSIEDLAQLIYDLKNVNPDADVSVKLVSEVGVGTVAAGVAKARAD
FT                   HITISGFEGGTGASPLTSIKHAGSPWEMGLAETQQTLVANRLRGRVALQVDGGLRTGRD
FT                   VVIGALLGADEFGFSTAPLIAAGCIMMRKCHLNTCPVGVATQDPVLRKRFKGTPEHVIN
FT                   YFFFVAEDVREIMAQLGFRTVAEMVGRADVLDQKPAIDHWKAKGLDFSRIFAVPQVPPT
FT                   VSVRHTERQHHPIEHVLDRTLIAKAEPALERGEKVVIDHAIRSVDRSAGAMLSGAVAKR
FT                   YGHAGLPDGTIEVNLKGTAGQAFGAFLAAGITLNLEGEANDYVGKGLSGGRIIVKPAET
FT                   SAIVAENSIIVGNTVMYGATEGECYFRGVAGERFAVRNSGAIAVVEGTGDHGCEYMTGG
FT                   VVVVIGQTGRNFAAGMSGGVAYVLDEDKSFAKRCNLSMVDLEPVEEEEDLLERLHHHGG
FT                   DLEFKGRIDVQGDMSRHDEERLHQLIVKHLHYTGSQRAQTILDNWADYRSKFVKVMPVE
FT                   YRRALREMEKRLQAAE"
FT   CDS_pept        516489..517964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0461"
FT                   /product="small subunit 1 glutamate synthase"
FT                   /note="NADH/NADPH"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86459"
FT                   /db_xref="GOA:A8IM08"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM08"
FT                   /protein_id="BAF86459.1"
FT                   /translation="MGAAARCARRGSAEGCLMGKVTGFLEIDRHDQKYQPASDRIRHFR
FT                   EFTLPLPETEVSNQAARCMDCGIPFCHGDTGCPVHNQIPDWNDLVYNGEWEEAARNLHS
FT                   TNNFPEFTGRVCPAPCEEACTLNLEDMPVTIKTVEQSIADKAWKMGWIKPEPPAHRTGR
FT                   SVAVVGSGPAGLAAAQQLARAGHDVHVFEREPKAGGLLRYGIPDFKMEKHHIDRRVAQM
FT                   EAEGVTFHYGVNVGVTKPVQELLDSYDAVLLAGGAEAPRDPKLPGQELEGVHFAMPYLV
FT                   QQNRRVGHEDTGREHPLLASGRHVVVVGGGDTASDCVGTAFRQGALSVTQLDIRPVPPV
FT                   KENKLAVWPFWPTKFRTSSSQAEGAEREFACATLGIEGRNGRVTGVKCARVDHKRQPIP
FT                   GTEFVLRADLVFLAIGFASPIHEGLLEQSGADLDGRGNVKANVTDYQTSVPKLYAAGDM
FT                   RRGQSLVVWAIREGRQAAHAIDLALMGTTTLPR"
FT   CDS_pept        complement(518055..518684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="AZC_0462"
FT                   /product="DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86460"
FT                   /db_xref="GOA:A8IM10"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM10"
FT                   /protein_id="BAF86460.1"
FT                   /translation="MPAPAFAGLTSSPDVSMIRKLYDWVLAYSARPSAPWALAIVAFAE
FT                   SSIFPVPPDVLQVPMSLARPDKAWRYALIATIASVLGGLVGYAIGALLYDSLGLWLINL
FT                   YGYGQKVDAFRAAYAHYGHWVILLKGLTPIPYKLVTITSGFADYSLFWFVVLSVITRGA
FT                   RFFLLAALLHYFGPAARDFIERRLGLVTLGLLAIVVLGLVAAAYLV"
FT   CDS_pept        518917..519108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0463"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86461"
FT                   /db_xref="GOA:A8IM11"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM11"
FT                   /protein_id="BAF86461.1"
FT                   /translation="MPTLPWDGAPKRASCGPNPLSKRSPMLKRIAVFAVLVLGYVLTGV
FT                   ALSAGTNHGAPPIVSASE"
FT   CDS_pept        complement(519317..520378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0464"
FT                   /product="ketopantoate reductase"
FT                   /note="ApbA/PanE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86462"
FT                   /db_xref="GOA:A8IM13"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM13"
FT                   /protein_id="BAF86462.1"
FT                   /translation="MKVCIYGAGAIGGYLGVQLANAGAEVSLVARGAHLEAMRQNGVKL
FT                   LINGEERVARVNASDDPAELGPQDYVFISLKAHSVPGVVERMRPLLGNDTSVVTAVNGV
FT                   PYWYFYKHGGPLEGRTLESIDPGGKQWDVLRPERAIGCIVYPATEVVEPGVIQHIYGDK
FT                   FPIGEPSGERTERIQRLSDLMNSAGLRAPVVDHIRDEMWLKLWGNLCFNPISALTNATL
FT                   EVIAADPDTRSVAKAMMLEAQEIATRLGVSFRVDVERRINGAGAVGAHKTSMLQDLERG
FT                   RPMEIDPLVTVVQEMGRMVDVPTPTLDVVLALVRQRAATAGIGDHLSTPPLTAADLRAA
FT                   DLHASTGKMAARH"
FT   CDS_pept        520663..521514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iclR"
FT                   /locus_tag="AZC_0465"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86463"
FT                   /db_xref="GOA:A8IM14"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM14"
FT                   /protein_id="BAF86463.1"
FT                   /translation="MPDTDLAPRRRGRPASTSPDGGAEVQSLDRAIHLLRILAEADGMS
FT                   LTDVARRAELPASTTHRLLATLQKRQLVNHDAETGLWTVGLGLFRIGAAYLRIRKLPDI
FT                   GRPVIRRLLHDADETVNLSMFDGAELVVVGQAEGHASVRAFFRLGQRLPLHATAAGKSI
FT                   LAAAGPAFRGALLAQVRYEPLGVRTHRTERALMDDIAQIIERGYAVDNEEHTTGMRAVA
FT                   AAIYNEWREPIGAVSVSGPSGRMTDDRVARLGRLITAAADQMTRLYSGADETLPPDFAT
FT                   YR"
FT   CDS_pept        521601..522755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86464"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM16"
FT                   /protein_id="BAF86464.1"
FT                   /translation="MAVKGAPAGVASRGGERLGFRAAIGEVFRRPAIRPGQRVDVTGRK
FT                   SRMSRALMRRLHRWSLGALAALCLAPAAAQAWQPTKTVELVVPAGVGGGADQMARVIQG
FT                   IIQKHGLMAQPLVVVNRPGGAGAQGFLEMKGAAGDPHKILISLSNVFTTPLATGAPFRW
FT                   DELTPVAMLALDEFILWVNAKASYSDVAGFVAALKAAPPGAEFKMGGTGSKQEDQIITA
FT                   AIEQKTGGRFIYVPYKGGGDVATQLVKGQITASVNNPIEAVTQWRAGEVRPLCVFDDER
FT                   LPYKEPVVGQTSWADIATCKEAGLDIEYLMLRGIFGPPRLTADQVGYYVELFRRVRETP
FT                   EWKEFMQRGAFNTSALTGNDYKTWLSKAADSHRSLMETAGFIVR"
FT   CDS_pept        522936..523727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="AZC_0467"
FT                   /product="regulatory protein"
FT                   /note="GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86465"
FT                   /db_xref="GOA:A8IM17"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM17"
FT                   /protein_id="BAF86465.1"
FT                   /translation="MRALLAYSTQYFTDGIRPTEGAATGKGTGLVDQVADTPKLNVEPL
FT                   GASSSLRALAYDALKRAITEMDIYGSNTDIRLDERQLSEDLGVSRTPIREAMTVLEQEG
FT                   FVRSVPRRGIFVVRKTKRQLVEMITVWAALESMAARLAATRATAADLASLRRLFNDFEA
FT                   ERPAAHVPEYSKANIAFHQAIIRMGGSALIVDMTENLFLHMRAIRTVSIQQDNRSDVSM
FT                   QEHMAIIDALEARDPERAERLVREHTMALAALVEKHGQFPE"
FT   CDS_pept        523826..525565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0468"
FT                   /product="oxalyl-CoA decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86466"
FT                   /db_xref="GOA:A8IM19"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM19"
FT                   /protein_id="BAF86466.1"
FT                   /translation="MSAVAQRVETEADAQQELTDGFHLVIDALKLNGIETIYGVPGIPI
FT                   TDLGRMAQAEGIRVVSFRHEQNAGNAAAIAGFLTKKPGVCLTVSAPGFLNGLTALANAT
FT                   TNCFPMILISGSSEREIVDLQQGDYEEMDQLAIAKPLCKAAFRVLHAADIGIGVARAIR
FT                   AAVSGRPGGVYLDLPAKLFSQVMDAAAGEKSLVKVIDPAPAQIPGPAAVDRAINLLKGA
FT                   KRPLIILGKGAAYAQADEEIRAFVEKSGIPFLPMSMAKGLLPDTHPQSAGAARSTALKD
FT                   SDVVILLGARLNWLLSHGKGKTWGEPGSKQFIQVDIEPKEMDSNVEIAAPLVGDIGSVV
FT                   SALLDRIDGSWQAPPADWIESIRSKKEANIAKMAPKLLKNSSPMDFHGALGSLKKVIAE
FT                   RPDAILVNEGANTLDLARGIIDMYQPRKRLDVGTWGVMGIGMGFAIAAAVETGKPVLAV
FT                   EGDSAFGFSGMEVETICRYDLPVTIVIFNNNGIYRGTDTDPTGRDPGTTVFVKDSRYDK
FT                   MMEAFGGVGVNVTTPDELYRAVSAAMDSGKPTLINAVIDPAAGSESGNIGSLNPQSVVV
FT                   RKK"
FT   CDS_pept        525700..526980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0469"
FT                   /product="putative formyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86467"
FT                   /db_xref="GOA:A8IM21"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM21"
FT                   /protein_id="BAF86467.1"
FT                   /translation="MGKALDGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGEGDVT
FT                   RTQLRDVPNADSLYFTMLNSNKRSITLDTKNAEGKKVLEDLVKVCDVLVENFAPGALDR
FT                   MGFTWERLQEINPRIILASVKGFGPGPFEDCKVYENVAQCTGGAASTTGFRDGLPMVTG
FT                   AQIGDSGTGLHLALGIVTALYQREHTGRGQKVLAAMQDSVLNLCRVKVRDQQRLSRGPL
FT                   REYSQFGEGVPFGDAVPRAGNDSGGGQPGRILKCKGWEHDPNAYLYFITQAPVWEKICD
FT                   VIGEPTWKTDPNYATAAARLPHLNEIFTRIEAWTMAHTKFEAMEILNQYDIPCGPILSM
FT                   KEIIEDDSLYATGTLVEVEHPVRGAYVTVGNPIKLSDNDVPVERSPLLGEHTEEILATV
FT                   LGFDADRIAEVKHSGAVGLSPVRQAAE"
FT   CDS_pept        527380..528630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0470"
FT                   /product="putative acyl-CoA transferase"
FT                   /note="carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86468"
FT                   /db_xref="GOA:A8IM23"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM23"
FT                   /protein_id="BAF86468.1"
FT                   /translation="MSKPLEGIKIIDFTHVQAGPACTQLLAWFGADVIKVERPGAGDVT
FT                   RSQLRDISNADALYFTMLNSNKRSLTLDTKTPQGKEVLTKLIKESDVLVENFGPGALDR
FT                   MGFTWEHIKELNPGMIVASVKGFSDGHHYEDLKVYENVAQCAGGAASTTGFWDGPPTVS
FT                   AAALGDSNTGMHLAIGILTALHARNKTGKGQKVAVSMQDSVINLCRVKLRDQQRLDRVG
FT                   YLEEYPQYPHGTFSDVVPRGGNAGGGGQPGWVLKCKGWETDPNAYIYFTIQGHAWAPIC
FT                   RALGKEEWIDDPAYNTAEARQDKIFEIFAFIEAWLADKTKFEAVDILRKFDIPCAPVLT
FT                   MKEIANDPSLRESGTIVEVDHKQRGKYLTVGSPIKFSDMTVEITGSPLLGEHTDEVLAD
FT                   LGYTPEQIKALHEARAV"
FT   CDS_pept        528936..529184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86469"
FT                   /db_xref="GOA:A8IM24"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM24"
FT                   /protein_id="BAF86469.1"
FT                   /translation="MLRGPRARAAQEGRMIAIAVLLPWLALMLRGRIFQGILCLVLQIT
FT                   LIGWLPAAIWAVVVVNNDNEERRHRELMASLNGQRTR"
FT   CDS_pept        529223..529996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0472"
FT                   /product="putative 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomerase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86470"
FT                   /db_xref="GOA:A8IM26"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM26"
FT                   /protein_id="BAF86470.1"
FT                   /translation="MAKWVRFTDGAATGFGRVEGDQIAVHSGDMFGAAQPTGETRPLAG
FT                   AQLAAPCDPTKIIALWNNFHGLAAKLNVAEPAEPLYLLKSTTTVAAPDAEVRRPPAYSG
FT                   KTVYEGELGIVIGRTARNISEDEAAEHIFGYTIVNDLTAADILNKDPTFPQWARAKGFD
FT                   GYGPFGPWIVTDLDPATASVRTVLNGAERQNYPLSDMIFPPAKLVALLSQDMTLNPGDL
FT                   IACGTSIGVGSMKEPRNEVDVSIDGIGTLRTIFVQ"
FT   CDS_pept        complement(530064..531875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0473"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86471"
FT                   /db_xref="GOA:A8IM27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM27"
FT                   /protein_id="BAF86471.1"
FT                   /translation="MAPPLVLLQDIHLRFGATPLLDGAELSVAPGERLCLVGRNGSGKS
FT                   TLLKVAAGLLEPDDGTRFFQPGATVRYLPQEPDFTGFATTLAYVEAGLGPGDDHYRAQY
FT                   LLEQLGLTGQEDPAHLSGGEARRAALARVIAPEPDVLMLDEPTNHLDLPAIEWLESELK
FT                   SLRSALVLISHDRRFLENLSRATVWLDRGTTRRLDQGFGAFEAWRDQVLEQEETERHKL
FT                   DRKIVAELDWLRYGVTARRKRNVRRLGDLHAMRKDRREVRRAQGNVKITVTEAETSGKL
FT                   VIEARAIAKAFDGVSVVRDFSTRIARGDRIGIVGPNGAGKTTLLKMLIGTLKPDSGSVK
FT                   LGSNLEIASLDQKRAALRPETTLRDALTGGGSDTVMVGGQPKHVMGYLKDFLFTPEQAN
FT                   SPLSVLSGGERGRLMLARALALPSNLLVLDEPTNDLDLETLDLLQEMVADYPGTVILVS
FT                   HDRDFLDRTVTSVIAAEGDGVFSEYAGGYSDMVNQRGHGVEAKAKAKAEGKASPAAAPA
FT                   AGKPKETKRRLSFAEKHALETLPKTLDKLRVDAAVLEKKIADPNLYAKDPAAFEKASTA
FT                   LGKIHADIEAAEEEWLRLEILKEELGG"
FT   CDS_pept        532628..532834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86472"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM29"
FT                   /protein_id="BAF86472.1"
FT                   /translation="MTSEDERELTALLERLRQEHRDLDSAIEALTSVTGSDVLQIQRLK
FT                   KRKLQLKDRISHLEDQLFPDIIA"
FT   CDS_pept        complement(532866..533543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="AZC_0475"
FT                   /product="regulatory protein"
FT                   /note="GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86473"
FT                   /db_xref="GOA:A8IM31"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM31"
FT                   /protein_id="BAF86473.1"
FT                   /translation="MLERGASFRSLEAEAAPRSLREEAYDIIKQRIIRGLYRPGEALSE
FT                   AVVSSSLSLGRTPVRQAFDRLMRDGLVEVLPRKGIIVRPITADEIRDMVHVRLLNEGFC
FT                   ARLAAERADQAVLGVLNDTLDQSHKAARDSDIETLMVLDRRFHAALASAAGNAVLSDIL
FT                   SNLHDRSQRVWFLSLREHQHHARVVEEHAGIVAAISARDAEGAEAVMRAHILSFAENLS
FT                   RQL"
FT   CDS_pept        complement(533545..534279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86474"
FT                   /db_xref="GOA:A8IM32"
FT                   /db_xref="InterPro:IPR021269"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM32"
FT                   /protein_id="BAF86474.1"
FT                   /translation="MLPVPLLFPRTQEANMTGTALTFTIHADGRSFEETLLIRTAVIAG
FT                   WTGRDKVALEKHIHELEELGVPRPASTPIYYRVSAARLTTAGAIENTGPDSSGEIEFMI
FT                   VLADGKRYLGIGSDHTDRKVETYNITVSKQMCDKPVASELWSLDEVLPHWDSLILRSYA
FT                   VINGEKVLYQEGSVNAMLPPEEILGGFPAADLKGGSVMFCGTLAAIGGIRPAERFEFEI
FT                   EDPILKRTIRHGYDVAVLPVVG"
FT   CDS_pept        complement(534316..535491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0477"
FT                   /product="putative ABC-transport systems periplasmic
FT                   component precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86475"
FT                   /db_xref="GOA:A8IM34"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM34"
FT                   /protein_id="BAF86475.1"
FT                   /translation="MKKSLVFGATLLAAVSAAAMARAADDELVLGYMMAKSGPYVSLAN
FT                   TNEIAVDLAVEEINAKGGINGKKIKVVKFDTAGDPKQATTALRRFAEDDSALAVIGPFS
FT                   SSEVRTTFPVGERSGIAQMSMASSAPGLTKGFSYGFRNTTDEGIVLDQVMTSIKDKKLP
FT                   AASGAAAYATDDVVSKSIGTLVVPKLFEKYSVPMKGSVDFQLAAFDLSPQVSKLKEMAP
FT                   DIVGLGSPPEGAVNLAKELKRQGVSTRVIGGTTIADPELPKRMDGAGENLTIGTTFFPE
FT                   VNDKTKAFAAEFGKRTKAAGLPRTEPNQMDAAVYDIVYLYAEAMKRAAVTGDKAKLVAE
FT                   RTGVRDALAKMKDFEALEGKISFRDGDAVKPVYILEVKGGKWTLLDTRMPE"
FT   CDS_pept        complement(535530..536267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0478"
FT                   /product="ABC transporter"
FT                   /note="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86476"
FT                   /db_xref="GOA:A8IM36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM36"
FT                   /protein_id="BAF86476.1"
FT                   /translation="MALLEVSGLEVAYGRVNALRGVDLRVEEGQIVTVLGANGAGKSTL
FT                   LRAILGAVPPKAGGIAFAGRDVTREPPHARIGGGLVLVPEGRRILISLSVEENLLLGAH
FT                   MRADTQKVRTEMDAIYDRFPNLAERRHMLASCLSGGEQQMLAIGRAMLAKPRLMMLDEP
FT                   SLGLSPLFVSKLFDLIRELNRDGLSVLLVEQNTGKALACAHHATVLELGRVVMAGDPAT
FT                   LAADPRLQEAYLGEGSHAQAQHA"
FT   CDS_pept        complement(536273..537034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0479"
FT                   /product="ABC transporter"
FT                   /note="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86477"
FT                   /db_xref="GOA:A8IM37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM37"
FT                   /protein_id="BAF86477.1"
FT                   /translation="MSTPALVLSGLEKSFAGVRAIRNLSFTVPKGRATALIGPNGAGKT
FT                   TVFNLVSGVYGVDGGSIHVNGTDVTRLPSRRRIRAGVARSFQNIRLMPHLSVLENLLVG
FT                   QHVRASSLAALLTPYRIIPNHRWKREARAALEESGLGQYADETVGALPYGVRKRIDLVR
FT                   ATLAGADVLMLDEPAAGLNPSETNALRDHLNALAARGLTLLIVEHDMHFVDSICENVVV
FT                   LNFGEKIAEGRLSDVRKDPKVREAYIGTDEE"
FT   CDS_pept        complement(537031..537870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0480"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86478"
FT                   /db_xref="GOA:A8IM38"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM38"
FT                   /protein_id="BAF86478.1"
FT                   /translation="MSGYLTGVLVVLSFNIMAAYAVYLPLAAGQLNLGIAGFMAIGAYA
FT                   AAYLTNELGWSLWTAIPAGSAAAGLVGLIIGIPVLRTHGIYLALATFALGQVIAAIFLN
FT                   LDVVGAAAGYPVATYAAPPVVFAATAGVVLVMLLLSRTRYALYLTAVKSDPTVADLMGI
FT                   SVRGIQVSAFALGAAVAGFGGAFYAHHYSFIEAQHFNVLLSVFTVLYVLFGGVQTVWGP
FT                   LAGAIFFTLVPEVLRASDQWRYALFAFFIIIFMALRPQGLVTASLFRVFRRKPGAAA"
FT   CDS_pept        complement(537870..538775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0481"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86479"
FT                   /db_xref="GOA:A8IM41"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM41"
FT                   /protein_id="BAF86479.1"
FT                   /translation="MTAARRGAAPSMLTQQIINGLMLGAIYMLVAVAFTLAIGVLNFLN
FT                   FSLPGLFMLGGMAAFGFLKLGWPFLVAAGGALLIAAFVSLLVERLAYRRMQGGDPEVPL
FT                   VSSLGFLVLLENLVLIRYGSDQQAFPALFPDMNLRIGGLVVGIAQMVSLAISLALVAWL
FT                   SWFLRTTNTGRRIRTVAESRETALLMGINIQSLVPQLFVASALLAALGGLLFAVNYQQV
FT                   SPFMGEGIGFKGVAAMIIGGMGSIWGAVIGGLLIGLAEVLSISLIGADVVNITVYGLLL
FT                   AILILRPQGLFGRPPAREKL"
FT   CDS_pept        complement(539221..540696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0482"
FT                   /product="putative OtsA trehalose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86480"
FT                   /db_xref="GOA:A8IM42"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM42"
FT                   /protein_id="BAF86480.1"
FT                   /translation="MSRLIVVSNRVAVPEAGKVSAGGLAVAVNAALKERSGIWFGWSGK
FT                   ITEQPSDQPAISMRNGVKYAVVDLKEDDYQEYYNGFANRVLWPILHYRVDLAEFVRSDL
FT                   SGYIRVNKNFAEHVSKIIEEDDIIWVHDYHMMPLARYLRERGHKNRIGFFLHIPLPPPD
FT                   LIQALPRHGEIVGSLVHYDLVGFQTESDRDNFGRYLEGRGARPGNDGTSYEIAGRRVRI
FT                   GAFPVAIETESFARRARHAMRTNFMKDFRASLTGKKMVLGVDRLDYSKGIPNRLEAFET
FT                   LLRTAPEWHERVTFVQITPKSRTSVPEYAEMDRYVSTKAGQINGEFGDVSWTPLRYVNK
FT                   TYSRSALAGLYRAADVAMVTPLRDGMNLVAKEFVAAQDPEDPGVLLLSQFAGAAAEMGG
FT                   GALMVNPHEVEGVASALRRALEMPLAERRDRHARMMTVLNTNTIDHWAQNFLDALTDPP
FT                   ALDALLSARSNGLRPSAPACLMDWQGLHRAQDL"
FT   CDS_pept        complement(540700..541485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0483"
FT                   /product="putative trehalose-6-phosphate phophatase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86481"
FT                   /db_xref="GOA:A8IM43"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM43"
FT                   /protein_id="BAF86481.1"
FT                   /translation="MHVTSVPKEEGRPSRPDAVRLFDPRTCAFFLDVDGTLIDIAIHPD
FT                   AVTVPSGLLTTLGTLKTAADGALALVSGRTVAGLDALFSPLKLAAAGVHGGEIRLTPEA
FT                   PVAQQSATLPAETGTRISRLARDLDGVLMEDKGSSIAVHYRLAPQIGPDLQIALEQIVT
FT                   DYPGLSLLPGRLVFEVKRAGCDKGVAVRQFMAAPGFAGRTPVFIGDDVTDEAAFAAVSQ
FT                   MGGIAVSVGRNLPVADLVLPEAQDVRALLATLVAQQPEE"
FT   CDS_pept        541584..542096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0484"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86482"
FT                   /db_xref="GOA:A8IM44"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM44"
FT                   /protein_id="BAF86482.1"
FT                   /translation="MSSRVLRGESADAGAPVSSESFQAEPSREPPPCRRVFPARHKETS
FT                   AMFGHGSHANDISRQLDALKADVVRLGEALAEAAEDRSRGPRRQAARYAGRMFDAAEDQ
FT                   ASYLASNGLSMAREGGRAAAEHLARTAHRAERVVAENPGRAVVAAAAVGLTVGALLFAF
FT                   SGSDRRR"
FT   CDS_pept        542394..542663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86483"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM46"
FT                   /protein_id="BAF86483.1"
FT                   /translation="MKGAVIVVAAALALAGCSQYSESDRAVGGGLLGAGAGALIGGAAT
FT                   GNATGALVGGALGAATGAVVGAATTPNACWARDAYGNAYQVRCP"
FT   CDS_pept        complement(542735..543220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0486"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /note="thiol specific antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86484"
FT                   /db_xref="GOA:A8IM48"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM48"
FT                   /protein_id="BAF86484.1"
FT                   /translation="MPIQVGDSLPNVTFRVSTSDGPVPKTTDEVFKGKRVVLFAVPGAF
FT                   TPTCHKNHLPGYVSRAEEIKAKNIDTIAVVSVNDPFVMGAWEQASGADGKVLFLSDGNG
FT                   DFAKALDLFFDGSAVGLGLRSKRYSMLVEDGVVKVLNVEDVPSKADASSAQALLAQI"
FT   CDS_pept        complement(543362..544198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0487"
FT                   /product="uncharacterized protein"
FT                   /note="putative to be involved in C-type cytochrome
FT                   biogenesis, COG4233"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86485"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM49"
FT                   /protein_id="BAF86485.1"
FT                   /translation="MMISRRALLQSAALAAAVPLAQRAAAAPLSRPVQDPNAQTRLIAG
FT                   PAQDGVVQAGLEMVLAPGWKTYWRYPGDSGVPPRFDWSGSKNVADVTVLWPAPHVFPDG
FT                   SGGSSIGYKGRVLLPLVVRLKNPADPAELDLALDFAVCQSLCVPADARLSVPLPGTEAE
FT                   APALTEARAEVPVATPFGAGSGPAVLKVERDAGTTPPRLIITARASAEAVLLVEGPDDT
FT                   WALPIPERQPAAGETVRFTLPLLGVPSDARLPGNKLTLTLVDGAKAIETTTAIPGA"
FT   CDS_pept        544389..545006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0488"
FT                   /product="protein of unknown function"
FT                   /note="DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86486"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IM50"
FT                   /protein_id="BAF86486.1"
FT                   /translation="MMADRTISSPRGPGDFLDGQMLIAMPSMRDERFNRALVYICAHSA
FT                   EGAMGIVVNQPATHIDFGDLLVQLDVVPATKRIQLPPRAELVKVLRGGPVETGRGFVLH
FT                   SSDFFLENATLPIDNGICLTASLDILKAIAGGQGPESAVLALGYAGWAPGQLETEIQAN
FT                   GWLHCPADPELIFGESVDAKYDLALRKLGVHPGMLSTDAGHA"
FT   CDS_pept        complement(545031..547928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0489"
FT                   /product="diguanylate cyclase"
FT                   /note="phosphodiesterase precursor, GGDEF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86487"
FT                   /db_xref="GOA:A8IM51"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM51"
FT                   /protein_id="BAF86487.1"
FT                   /translation="MRSFLAFCLVLLGALSLAAPSAFAVDAVAVRLDAKVTDLLPAVER
FT                   LHTDNERVQISTAPGTDGIVRRIEVRSSDGQPNANWVAFALSNNTDEQVDRLIVAPFYR
FT                   MVGSGLFWPDLGNRRVLSLTPSQGFKPERQNAPDADVFLVTLDPGTTVTFVAELAGPKL
FT                   PQLYLWQPDAYKDKVNSFTLYHGIVIGIAGLLALFLTILFVVKGSVMFPAAAALAWAVL
FT                   GYIGLDFSFWSKVFGLSPIAEQFWRASGEAVLTATLLVFLFAYLNLNRWHVRYMHVAAG
FT                   WLVFLAALVAVALLDAPVAAGIARLSLAMVAVAGLLVVIWLSQHGYDRAVLIILTWMLL
FT                   VVWVVMAGMTVTGVVTNDLVAPALSGGLVLIVMLIGFTVMQHAFAGVGAVQGSASDLER
FT                   RALALAGSGYIVWDWDVDSDRIYVSPEAEEALGLKRHSLETEAAGWLEVLHPGDRDRFR
FT                   ATLDGIIEQRRGRIDQDFRLRAIDGHYLTFNLRARPVVGADGEVVRCIGVLSDVTGDRI
FT                   AAERLLHDAVRDNLTGLANRELFLDRLDQALAFAKTDESIRPTVMIIDIDRFKQVNVSV
FT                   GMAVGDSILLTVARRLMRLLKPQDTLARISGDQFGLILLSERDPERITTFADTLRRSLR
FT                   APISFAEREIFITASIGLVLSSADPGKREDVLKNAELAMFFAKRIGGDRIEVFRPAMRQ
FT                   QKIDRTSLESDLRRALERDEITVRYQPVVRLHDRAIGGFEAFMRWKHPSLGELAAADFL
FT                   HVAEESGVILELGLFVLERAARQLGQWQRILKVDPPLFMTVNVSSRQLLRHDLIQDLKS
FT                   VLARNVVEPGSLKLEVTEALAMENPEYSAVMLQRMRDLGAGLVMDDFGVGQSSLAYLPR
FT                   LPFDAIKIDNRFIRNTVKGSVRAARPIIVGSMIELAHQLGIEVMSEGLEREQEAAELGR
FT                   LGCEYGQGTLFGEPLTAEECRALLEPSPAEARRRA"
FT   CDS_pept        complement(548141..549289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0490"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86488"
FT                   /db_xref="GOA:A8IM54"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM54"
FT                   /protein_id="BAF86488.1"
FT                   /translation="MLRHFHPRPDGLPERRRPTSTGQPPRASAEGASGARHHPSPSPFR
FT                   GAAMTTPLPATMTAITIPTPGGPEALVPGERPVPQPVKGELLVKVKAAGVNRPDVMQRK
FT                   GLYPPPAGASDIPGLEIAGTVVATGPETQRFKVGDRVCALVTGGGYAEYCTTSALTALP
FT                   IPDGLSATEAAALPETFFTVWSNVFDRGRLQPGEVLLVHGGTSGIGTTAIQLAKAFGSK
FT                   VFVTVGSPEKCEAARKLGADLAIDYNTQDFVAEVKSATGGKGADVILDMVAGDYIARNY
FT                   EAAAVDGRIVQIAFQKGSKAQVDFMRVMLKRLTHTGSTLRSRPVADKALIAQALEEKVW
FT                   PLIAKGSVKPLIDATFPLKEAAAAHAHMEGSTHIGKIVLTIG"
FT   CDS_pept        549318..549503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0491"
FT                   /product="protein of unknown function"
FT                   /note="DUF1192"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86489"
FT                   /db_xref="InterPro:IPR009579"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM55"
FT                   /protein_id="BAF86489.1"
FT                   /translation="MDDDRPAPPPSPIAPGADVSRLSEHEIEARIELLKQEIVRLEAAL
FT                   VAKRASRSAADAVFKL"
FT   CDS_pept        549528..550370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0492"
FT                   /product="protein of unknown function"
FT                   /note="DUF1465"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86490"
FT                   /db_xref="InterPro:IPR010848"
FT                   /db_xref="InterPro:IPR038301"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM56"
FT                   /protein_id="BAF86490.1"
FT                   /translation="MACGLALGHAFLKARRRFGTATSGCARRGLARPAFRASCGGNGAR
FT                   LGVSCPIRAVLLWLDFSSRRASATPGCGHRPGTLALARFVRACGGPAESPCRWVRGKSV
FT                   AAAVVRRMGVCMTASAEPGSGPFAALYSDGLDLAARLSAYLSGPGRTYSEELPLASRLA
FT                   YHDEARELTTLLLQLAAWLLMERAVAEGEMTFDHAYHEAETLELRPRRSAVGSGLPDGL
FT                   KALRAEAELLRLRVVARAEHILERGERPPEHQSAVPAPRSGTPRLRIVSNSDDASPPA"
FT   CDS_pept        complement(550580..550804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0493"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86491"
FT                   /db_xref="GOA:A8IM57"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IM57"
FT                   /protein_id="BAF86491.1"
FT                   /translation="MKSDIHPDYHFIKVVMTDGTEYTTRSTFGKEGDTLALDIDPRTHP
FT                   AWTGGTQQLLDRGGRVSRFKNKFGALLKG"
FT   CDS_pept        550900..552705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0494"
FT                   /product="ABC transporter"
FT                   /note="ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86492"
FT                   /db_xref="GOA:A8IM59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011918"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM59"
FT                   /protein_id="BAF86492.1"
FT                   /translation="MRQVETSPSVEGKPESAPRARRSLRPLGRILPYVLRYRTRIALAL
FT                   VALILAAVATLAMPVAVRRMIDFGFAADHSGLIDRYFAMLVLVVGVLAGASAARYYLVT
FT                   TLGERVVADLRTAVFAHLTTLDGAFYDTSRAGEITSRLAADTTQIKSAVGASASQALRN
FT                   LVLFLGAVVMMVVTSPRLSALVLVAIPIIVLPLVASGRGVRKKSRAAQDALAEASAYAS
FT                   EATGAMRALQSSSAEPAARRRFDREVELAFEAAQGAVRARAILTGIGIFLVFASIVAIL
FT                   WTGAQSVMSGTMSSGQLGQFVLYAVLAASALGELSQVWGEVSAAAGAAERIGELLRIEP
FT                   AVKAPPQPRTLPARISGAIRFESVRFAYPARPDLPALNGISFTVAPGERVALVGPSGAG
FT                   KSTVFQLLERFYDPQGGHIALDDVDIAACDPVAVRRQMAFVPQEVAIFADTVRENIRLA
FT                   RPEASDAEVEAAGRAALVDEFVVRLPEGWDTKVGERGVTLSGGQRQRIVIARAILRAAP
FT                   ILLLDEATSALDAESETLVQTALERSMEGRTTLVIAHRLSTVLSADRILVMEDGRIVDQ
FT                   GTHAELVAKGGLYARLAALQFASAA"
FT   CDS_pept        complement(553025..553501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0495"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86493"
FT                   /db_xref="GOA:A8IM61"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM61"
FT                   /protein_id="BAF86493.1"
FT                   /translation="MSDHTPKPSFRIRPFAEGDMAALADLWVATWAATMPDIDFEARRP
FT                   WFLDHFAKLRADGAQVPVAETRDGTPVGFVIIHPTTRYLDQLAVAPAQRGTGAAEALMT
FT                   AARELSPGGIVLDVNQDNGRAVAFYEKQGLRITSASTNPMSGRAIWRMEWTPEV"
FT   CDS_pept        complement(553498..554517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0496"
FT                   /product="flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86494"
FT                   /db_xref="GOA:A8IM63"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM63"
FT                   /protein_id="BAF86494.1"
FT                   /translation="MALGRRGRDRQVDYWPGFVDALSTLLLVFVFLLSVFMVTQFFLSQ
FT                   DISGKENVLQRLQAQIRQLTELLSLERATGQSQDSELAALRASLQATEAERDRLKAAAG
FT                   PAPTGPDPSREAALAREVDMQKDVASRALAQIELLNQQIAALRRQMAALEEALNVSEKR
FT                   DQESQTKIADLGKRLNVALAQRVQELSRFRSEFFGRLRDILGNRPDIRIVGDRFVFQSE
FT                   VFFDRGSATPRPEALAELDKLASAILELERQIPPDINWALRIDGHTDSRPISTPQFPSN
FT                   WELSAARAIAVAQYLISKGVQPRHLIAAGFGEYQPIDTGTSDESMARNRRIELKLTER"
FT   CDS_pept        complement(554519..555601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86495"
FT                   /db_xref="GOA:A8IM65"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM65"
FT                   /protein_id="BAF86495.1"
FT                   /translation="MTRAVDPFLKVSSPRIFLVRIIVFLLLCAALAAVLYKQIAAAFMN
FT                   NPGLNGVIFGVLAIGIILAIRQVSRLFPEVEWVNSFRLADPGLAVSRAPTLLAPMAALL
FT                   GDRMGRMAISQSTMRSILDSIGTRLDEARDTARYLTGLLVFLGLLGTFWGLLETVSSIG
FT                   GVIGSLQGGGDSASMLEEMKSGLSAPLAGMGISFSSSLFGLAGSLVLGFLDLQAGQAQN
FT                   RFYTDLEDWLSTTVRDLDAEVPSRAPEVRPVPMDREAIDTRPVAQLLPPPAPIDLDPLV
FT                   EAMGRLERTMTEAGSQRVTTAVAHLAESLQGLVTHMRTEQAVLKQLVESQGAQQADIRR
FT                   VIERLERALNVPEDAGSGRG"
FT   CDS_pept        complement(555768..556556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0498"
FT                   /product="putative myo-inositol-1(Or 4)-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86496"
FT                   /db_xref="GOA:A8IM67"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM67"
FT                   /protein_id="BAF86496.1"
FT                   /translation="MIRSPLITVMVQAVRKAGRNLARDFGEVENLQVSLKGPANFVSSA
FT                   DRKAEETLYAELSRARPGYGFTMEERGKVEGQDEANEWVIDPLDGTTNFLHGIPLFAIS
FT                   VALVRNGVPFAGVIFNPVTDELYVAEKGQGAYLNDRRLRVAARRKLADCVVGCGIPHLG
FT                   RGDHNKFQRELALVQGQVAGVRRTGAAALDLAWVAAGRFDAFWERDLSSWDMAAGMILI
FT                   REAGGSVTDLDGHDKSLENGHIIAGNADMREDLFRLLKKA"
FT   CDS_pept        complement(556652..557665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0499"
FT                   /product="sel1-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86497"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM68"
FT                   /protein_id="BAF86497.1"
FT                   /translation="MMDRVLRLLRPLLGIAAASALSVALALPAAAQDPKPAQKPAAKPA
FT                   AKPAAPKAPVSSQPEDAAYGAYQRGLYLAAYKEASARAAAGPDAAAETLLGEIYAQGSG
FT                   VPRSPAKAVEWYQKAIDHGSEQAAFSLAMMNLMGDGIPRDLKKAAQLLEVAAKKGNASA
FT                   AYNLGLLYLQGEAMPQDFTLAAKWFRQAADAQVADAQYALSVLLRQGNGVPADKDAALK
FT                   MLAAAAAQDHVTAQVEYAIAIFNGDGVPKDEAKAAALFKKAALAGNAIAQNRYARVLSA
FT                   GRGAPQDKVRAAAWHMLSKAQGLGDPYLDDFVAKLTPEEQQKATALAHKWMGESRS"
FT   CDS_pept        complement(557677..558387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0500"
FT                   /product="putative thiamine-phosphate pyrophosphorylase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86498"
FT                   /db_xref="GOA:A8IM70"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM70"
FT                   /protein_id="BAF86498.1"
FT                   /translation="MPSGPASERAGCPSFACFLAEPVIMPTEPEIPRCRLMLVLPPTLS
FT                   AAEAIACMGAGDVAAVIVTTPAGDETAAKAQLSELCTATQAAGVAFLLADRVELASDIG
FT                   ADGVHLGSYAALKRALPAVKPGGIAGIGLEGRHEAMEAGEAGADYVLFGARDGSGPIEP
FT                   VVELVSWWAEVFEVPCVGVATTVEDARAIAVAGADFVALAAVPAGPDGPALVADVERAV
FT                   AAVDRTVADATPKA"
FT   CDS_pept        complement(558484..559509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0501"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86499"
FT                   /db_xref="GOA:A8IM72"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM72"
FT                   /protein_id="BAF86499.1"
FT                   /translation="MNAELETIAQKMVSDGKGILAADESTSTIKKRFDAIGVESTEENR
FT                   RDYRELLFRSDEAMKEYISGVILFDETLRQKAKDGTPLVSLIQQAGSIPGIKVDAGAKP
FT                   MALFPGETITEGLDGLAGRLKEYYDLGARFAKWRAVIDIGAGIPTPGAVAANAHALARY
FT                   AALCQEANIVPIVEPEVLMDGDHGIERCYEVTEYVLRVVFGELYQQRVALEGMVLKPNM
FT                   VVPGKKARTQASVAQVAEQTVRVLKATVPAAVPGIAFLSGGQSDEDATAHLDAMVKLGN
FT                   LPWKLTYSYGRALQAAPQKAWSGKAENVAAAQAAFTHRARMNSLAALGRWSAEQEAKKA
FT                   A"
FT   CDS_pept        complement(559584..560774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0502"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86500"
FT                   /db_xref="GOA:A8IM75"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IM75"
FT                   /protein_id="BAF86500.1"
FT                   /translation="MPTFRTLDEADLAGKRVLVRVDLNVPMDEGRVTDDTRIQAILPTI
FT                   RAITEKGGKAILLSHFGRPKGRDASQSLAPVAAAVGERLGAPVAFAGDCIGSDAEAAVS
FT                   TLAPGAVLVLENTRFHAGEEKNAADFVQQLAALGDIYVNDAFSAAHRAHASTEGLAHKL
FT                   PAFAGRSMQKELEALAKALEAPQRPVLAVVGGAKVSSKLELLGNLTAKVDILVIGGGMA
FT                   NTFLAAKGVKVGKSLCEHDLADTARQIIATAASHGCEIVLPVDAVVTKTFAAHADHRVV
FT                   PVDQVAEDEMILDAGPATVALVREKLKGAKTVVWNGPFGAFELPPFDAATVAVAKAVAE
FT                   ATKAGALLSVAGGGDTVAALNHAGAAGDFSYVSTAGGAFLEWLEGKQLPGVEALRR"
FT   CDS_pept        complement(560802..561809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0503"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86501"
FT                   /db_xref="GOA:A8IM77"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM77"
FT                   /protein_id="BAF86501.1"
FT                   /translation="MTVKVAINGFGRIGRNVLRAIIESGRTDIQVVAINDLAPVETNAH
FT                   LLRYDSVHGRFPAKVVVNGDTIDVGQGPIKVTAIKDPSTLPHKELGVDIAMECTGIFTA
FT                   RDKAAAHLTAGAKRVLVSAPADGADLTVVYGVNHQLLKPEHTVVSNASCTTNCLAPVAK
FT                   VLNDAVGIVHGFMTTVHSYTNDQPSLDQVHKDLYRARAAALSMIPTSTGAAKAVGLVLP
FT                   ELKGKLDGVSIRVPTPNVSVIDLKFVAKRATTVEEINAAIKAAADGPLKGVLGYTTEPN
FT                   VSIDFNHDPHSSTFHMDQTKVMDGTLVRVMSWYDNEWGFSNRMSDTAVALAKLG"
FT   CDS_pept        complement(561970..564054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0504"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86502"
FT                   /db_xref="GOA:A8IM78"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM78"
FT                   /protein_id="BAF86502.1"
FT                   /translation="MARWYQCRREVNPPPDRSLKWRAARRRPLFMSSRELHNRLANAIR
FT                   FLAIDAVEAANSGHPGLPMGAADMATVLFTEKLKFDATAPKWPDRDRFILSAGHGSMLL
FT                   YGLLHLLGYDAVSMDEIRRFRQLGSLTPGHPENFVTPGIETTTGPLGQGISTAVGFAMA
FT                   ERLMAARFGSEIVDHRTVVIASDGDLMEGISQEAIDIAGHLKLAKLTVLWDDNRISIDG
FT                   PTSISVSTDQQARFAASGWNTLAVDGHDPVALLAALNTAYASEKPTLIACRTTIGFGSP
FT                   AKAGSEKVHGSPLGAAEIEATRKALGWEAGPFEIPADALDAWRAAGRKGAEARAAWQAR
FT                   FDALPEATRAEFNRRMAGELPVAALKEAIAAVKAKAVADGGAVATRKSSEIVLDTLTKA
FT                   VPEMLGGSADLTGSNNTRAKGQKSVTPTDFSGDFVHWGVREHGMAAAMNGIALHGGFIP
FT                   YSGTFLAFADYSRPAIRLAALMGERVIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPNT
FT                   LVLRPADTVETAECWQIALEAKDRPSCLILSRQNLPLLRKDADGENKSAGGAYELLAAS
FT                   GEAQVSLFATGSELSLAVEARALLESEGVPTRVVSVPSFELFLARPLAERRAVIGKAPA
FT                   KVGIEAAIRMGWDSIIGSDAAFVGMTSFGASAPAKELYKHFGITPQAVVAAALEQLRQS
FT                   "
FT   CDS_pept        complement(564203..564787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86503"
FT                   /db_xref="InterPro:IPR024289"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM80"
FT                   /protein_id="BAF86503.1"
FT                   /translation="MAVRNRQGSRLRNRPTGEGLMRAAWFWTVVVAATLAGGLMGSAPR
FT                   AHAAPQAAKPAAAPSPETLIRDLYAHYLDTAPDTVVGFDFTDPTVANAYFDPALAKLVI
FT                   ADAKASDPKLNFDPFIEGQDFEIKAVTTSLKAQTSTSATVTAEFENFEEKKTVTFKLTK
FT                   VGGRWRIADIQWESNPQTLKALLVAKKIQSP"
FT   CDS_pept        564853..565194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86504"
FT                   /db_xref="InterPro:IPR025310"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM83"
FT                   /protein_id="BAF86504.1"
FT                   /translation="MALVAPTRLISRVMYALKHRPPELGPIEAATQRLHAALDRLSDSL
FT                   DRRRETERHQEALQAQLHALGNDRARLAAELDATRAEAAQVAEASREIGRRLDVAMTTI
FT                   RDVLATHGG"
FT   CDS_pept        565211..565594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0507"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /note="COG3027"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86505"
FT                   /db_xref="GOA:A8IM84"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM84"
FT                   /protein_id="BAF86505.1"
FT                   /translation="MAHVSVTIAGRYYRMACDEGQEEHLMRLGRDIDARINQLRGTFGE
FT                   IGDQRLTVMAAITISDELAEARARIRALESDLEGQRDARASALARLEAGEEAVARTIDE
FT                   VAERIEQLASDLAPREKSAVGMG"
FT   CDS_pept        565894..566517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0508"
FT                   /product="antifreeze protein"
FT                   /note="type I:5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86506"
FT                   /db_xref="GOA:A8IM87"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM87"
FT                   /protein_id="BAF86506.1"
FT                   /translation="MTLSSPTTFRSEKARLRAEALLRRADMGAERRAAASDAAARHALM
FT                   ALGSVAGRTVALFAPFRDEIDTGPLARKLRDAGARLALPVVIGRDRPLIFRLWDENDLL
FT                   EPAGAYGIPTPGAQAPQVTPDDLMVPLAVFDRAGARIGYGAGFYDRTLALLRREKPIRA
FT                   FGLAFACQETDHVPAEPHDEPLDGMVTEAGVLFLGGSDADSLSR"
FT   CDS_pept        566519..567319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0509"
FT                   /product="uncharacterized protein"
FT                   /note="conserved in bacteria, COG1692"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86507"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM88"
FT                   /protein_id="BAF86507.1"
FT                   /translation="MVGRTGRDVVTSRLPGLVQDWKLDLVVVNGENAAGGFGITEAIYN
FT                   EIRTAGADAVTLGNHAFDQREALVFIERADALVRPINYPPGTPGRGAAMIETRGGARVL
FT                   VANVMGRAFMDPLDDPFAAIDRALDGVDLGRVVDAIVVDFHAETTSEKQAFGHYCDGRV
FT                   SLVVGTHTHVPTADHRILPGGTAYLTDAGMCGSYDGVIGMDKDEPLRRFTRKIGAGRFE
FT                   PAAGPASLCGFAVETDPATGLAVKAAPVRLGGDLSEARPAFWEA"
FT   CDS_pept        567551..568297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0510"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86508"
FT                   /db_xref="GOA:A8IM90"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IM90"
FT                   /protein_id="BAF86508.1"
FT                   /translation="MAGHSQFKNIMHRKGRQDAVRSKLFSKLAREITVAAKMGLPDPNM
FT                   NARLRAAILAARAENMPKDNIERAIKKASGADMENYDEIRYEGYGPGGVAVIVEALTDN
FT                   RNRTASEVRSYFTKSGGNLAETGAVSFMFDRLGAIEFDAAKVNADDLLEAAIEAGADDV
FT                   NSSEETHEVVCAVESLAEVQKALEAKFGEPRKAGLVWRPQNTIAVDDETGEKLMRLVET
FT                   LEDNDDVQNVTANFELSEALMAKLSA"
FT   CDS_pept        complement(568385..568828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merR"
FT                   /locus_tag="AZC_0511"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86509"
FT                   /db_xref="GOA:A8IM92"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM92"
FT                   /protein_id="BAF86509.1"
FT                   /translation="MTQLTESAMDVSNFDARSQVSVPGRTYAAEDVYTIGDLAREFGIT
FT                   LRALRFYEDKGLLSPRREGLARLYSPADRERLTVILKGKRLGFTLAEIRALVAAHEGQS
FT                   GSDLALTRDRCLTQLGQLERQRTEIEAAIAELRETADRLAAAA"
FT   CDS_pept        569077..571335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0512"
FT                   /product="putative sel1-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86510"
FT                   /db_xref="GOA:A8IM94"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM94"
FT                   /protein_id="BAF86510.1"
FT                   /translation="MDRWHGTMGRSAAGSAAALAEPVYAPEPHDGWSDGGHLRAVATPG
FT                   AADHPLYAPADQPEDILDPAGTGFTRALAESVAILARKVDVLGAKAVDPVAIARLQRQT
FT                   GELKELVERVLVLHERSASDAAAASASDEFTRLAMDALARLETRVDGFMAEQARRTAPS
FT                   EELTVLRERLDAVAHDVKALGSAGDPRFAARLEDLLARFDRNETIEAAKLAPLVDVLER
FT                   HLSRLVERVDETQVHVARLDGIEAMLQGLTRELQRLQEPADDEVAAPQDDIAYGADEAL
FT                   VPHETAVLAPHLTLVEEDWRSPVETQAPAGTDPAGLREQDLPLRAAEIRPQVQEAAPPA
FT                   APAAAPSLEEWPQWPTDLRREPAPRAEPRPEIARDPAWQVTEAPWQGELRELLETHAER
FT                   RRSSAEVWREARADAAPKAADSEWTAKQVAALEAALEDAQAVATGRCRTDWVAAADRAE
FT                   HREKGAALARRRDSERRASLAIRVGAVALGALVLGIGTWFLLPRTAPDGASAGVAGPAT
FT                   ASGAPVDPALVTNLPPPVGSAALKNAALSGDASAAAEVGARYADGRGTDANQAAAMKWF
FT                   AYAASQGSAPAAYRLGSIYENSKRDLPAARKLYQWAAERGNLRSMHNLGVMYSDGIDGK
FT                   PDWQNAVNWFRKAADLGLRDSQFNLGVIYSRGLSGAVDRAEAWKWFSLAAAQGDTESAR
FT                   KREDVAAKAEPGVVDRARAAVTAFVPGKVVESANSTAVRPEWEVAGPADATPRKSASR"
FT   CDS_pept        571380..571889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="AZC_0513"
FT                   /product="crossover junction endodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86511"
FT                   /db_xref="GOA:A8IM96"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IM96"
FT                   /protein_id="BAF86511.1"
FT                   /translation="MTNGMIRIIGLDPGLRRTGWGVIEAQGTRLTYVACGTILPPENAP
FT                   MAERLAELHRGLAEVLARHAPDEAAVEETFVNMNPSSTLKLGQARGVVMLAPAQAGLSV
FT                   AEYAPLLVKKTVVGAGRAEKAQIRMMIGVLLPKATPQTEDAADALAVAVTHAHHRGPAA
FT                   LRRAAL"
FT   CDS_pept        571923..572354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0514"
FT                   /product="conserved hypothetical transmembrane protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86512"
FT                   /db_xref="GOA:A8IM98"
FT                   /db_xref="UniProtKB/TrEMBL:A8IM98"
FT                   /protein_id="BAF86512.1"
FT                   /translation="MLWGQLALVTAALFTGAAFYINAVEQPARLGLEARSMLAVWKPAY
FT                   RRGFAMQATLALIGFALGALAFWQTRDWHFLAGGVLMLANWPFTFIGIMPTNRRLLAIP
FT                   EGQAGPESVHLVAVWGQLHMVRTGLGLLATLIFLWGTLG"
FT   CDS_pept        572376..572996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="AZC_0515"
FT                   /product="DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86513"
FT                   /db_xref="GOA:A8IM99"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IM99"
FT                   /protein_id="BAF86513.1"
FT                   /translation="MIGKLKGTVDSFGEDHLILDVHGVGYLVHCSGRTLQALPRVGEAA
FT                   VLFIETHVREDQIRLFGFVTEAEREWFRLLQGIQGIGTKTALAILSTLKPSDLAQAVAL
FT                   GDKTALARANGVGPRVATRIVTELKDKVPAFTAADPGLARLAADVEATEAAGGALADAV
FT                   SALVNLGYGQAQAHTAIAAAGRKAGEDATTETLIRLGLKELAK"
FT   CDS_pept        complement(572999..573424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86514"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMA2"
FT                   /protein_id="BAF86514.1"
FT                   /translation="MSQAYLAPTEAAGRRFFSRDRQRPVMLNLLRFRTVADYSDAPDLA
FT                   PATPISGAEAYALYVAHTLPLLQASGGAILWRGRADAFLIGPEEEMWDEVLLVQQASAA
FT                   ALLAMANGPAYRKVMGHRTAALADSRLLPLTELPLPG"
FT   CDS_pept        complement(573421..574047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0517"
FT                   /product="uncharacterized conserved protein"
FT                   /note="in bacteria, COG3644"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86515"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMA3"
FT                   /protein_id="BAF86515.1"
FT                   /translation="MPSHIYPDINPQAEIRDRPMLTTFTAFCGPRRIAAGLLLDVARAV
FT                   RAAADTAPLLVFDDATGRVVDLDLRGTDAELAERYPAPAPEEEASPRGRGRPKLGVVAR
FT                   EVTLLPRHWDWLAAQPGGASVALRRLVEEARRADAPRQQARAAQEIAYRFMSAMAGDLP
FT                   GFEEASRALFAGDRPRMTTEMAPWPEDIRAYTLKLAFPPAAEDEA"
FT   CDS_pept        574075..574404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86516"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMA6"
FT                   /protein_id="BAF86516.1"
FT                   /translation="MEKAERRAASTAYKERKVAAGIYVVRCGGRVFVGQSPNLASVENR
FT                   LRFTLAHGSHPNRALQAAWVASGGAALEIEIVETLAEEADAYLRGRALSERQGHWLAAL
FT                   KAERL"
FT   CDS_pept        574449..575501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="AZC_0519"
FT                   /product="holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86517"
FT                   /db_xref="GOA:A8IMA7"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IMA7"
FT                   /protein_id="BAF86517.1"
FT                   /translation="MVAQGGMAPRLMTADSRPEDDADATLRPQRLADFVGQAQARANLE
FT                   VFIQAARARGEALDHVLFVGPPGLGKTTLAQIMAREMGVGFRSTSGPVIAKAGDLAAIL
FT                   TNLEERDVLFIDEIHRLAPQVEEILYPAMEDYELDLVIGEGPAARSVKISLPKFTLVGA
FT                   TTRSGLLTTPLRDRFGIPVRLVFYTLEELEYIVTRGARLLGIGIVPEGAREIARRARGT
FT                   PRIAGRLLRRVRDFAQFAGAEAIDRAIADRALMALDVDAMGLDTMDRRYLTVIAQHYGG
FT                   GPVGVETLAAALSEPRDAIEEIVEPYLVQQGFVQRTPRGRMLTSGAFRHLGLAEPQRPP
FT                   SALPLFDEGD"
FT   CDS_pept        575604..576272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0520"
FT                   /product="4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86518"
FT                   /db_xref="GOA:A8IMA9"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMA9"
FT                   /protein_id="BAF86518.1"
FT                   /translation="MRAGSHQERGKSPLPLGYGRGGRGPRPDACGRGAVGHPNGSKFED
FT                   DGMKLDLTGERAMTPGEREAYPHLAGRLIPGGHCLGLRVYYEDTDFSGIVYHANYLKFM
FT                   ERGRSDYMRLLGVVQGELFAEAAAEAPGFHFVVRSMQIDFKKPARIDDVLEVVTLSKDV
FT                   AGASITLAQSVRRGEEELVSALVRVAFVSQGRAKRIPDALRRATLEDATVVAGAVAPQR
FT                   "
FT   CDS_pept        576408..577253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="AZC_0521"
FT                   /product="TolQ protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86519"
FT                   /db_xref="GOA:A8IMB2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMB2"
FT                   /protein_id="BAF86519.1"
FT                   /translation="MPAALRGPGQPRIEDETCHPGVGASMKKWTPALATALVLAASAAW
FT                   AQADVGSAALAAPTANISLIGLFLQAHFVVKLVMLGLVAASIWVWAIIIDKTLLFTRTR
FT                   KEMDRFEQVFWSGQSLEELYRSLAGRPNQAMAAIFVAAMREWKRTYEGGAKSLTGLNQR
FT                   IEKVMDVTISREVEALESKLLVLATVGSAGPFIGLFGTVWGIMTSFQAIAASKNTNLAV
FT                   VAPGIAEALFATAMGLIAAIPATIFYNKFVHQASRQAQRLEGFADEFSAILSRQIDERG
FT                   "
FT   CDS_pept        577257..577709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="AZC_0522"
FT                   /product="biopolymer transport protein"
FT                   /note="ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86520"
FT                   /db_xref="GOA:A8IMB3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMB3"
FT                   /protein_id="BAF86520.1"
FT                   /translation="MGMGGGAGGAWQSRRSRRRRNGGMMAEINVTPMVDVMLVLLIVFM
FT                   VAAPMLTVGVPLDLPKTQAQAMNQDKDPLTISVNNKGQVFLQETEIKLDELVPKLQAIA
FT                   KNGYDERIFVRGDKTVNYGTVMQVMGRLSAAGFKRVALVTEGEQGS"
FT   CDS_pept        577721..578746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="AZC_0523"
FT                   /product="putative TolA protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86521"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMB6"
FT                   /protein_id="BAF86521.1"
FT                   /translation="MRVGLTASSIAHGAVLVLALVSFSAPSAFDTPQPDPINVDVISAS
FT                   DLSQMTKGNEKGKKTEVKKVVAEKVDAPKPVNDPNLKVSEKQEIEPTAPPPPPPPPPPP
FT                   TPAPPRPEEPKPPTPAPQPKPDEPKPAPPKADKPPPEQKADEGLKADPKKDEQKQEAKA
FT                   QTPPPLPQRKPPPPPTPQPTRANNDAKTQQEQKFDADRIAALLDKRTPQRNAAADQQVS
FT                   QTAALGSPNGAAQTLTQSEIDALRARIQSCWGPPAGASEASDLRATIVVSFKQDGSLAM
FT                   QPQLSGVTPASSPYGPAFADSALRAIIRCAPYTFLPANKYAVWKEIEMGFSLKDMLGRA
FT                   H"
FT   CDS_pept        578761..580113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0524"
FT                   /product="twin-arginine translocation pathway signal
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86522"
FT                   /db_xref="GOA:A8IMB7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMB7"
FT                   /protein_id="BAF86522.1"
FT                   /translation="MIHLPRLLTDRLDPRLSRRSVLVGGAAAAGASLLGAPAAQAALKL
FT                   EITSGTPQPIPIAVTDFIGEGDQGRAISGVITADLKRSGLFAPIDPKAFVEQISNPDLA
FT                   PRFQDWRVINAQGLVTGRVTRQGDGRLKAEFRLWDVFAGQQLMGQQYFTQPENWRRVAH
FT                   IIADAIYERLTGEKGYFDTRIVFVDESGAKDRRVKRLAIMDQDGANVTYLTRGDALVLT
FT                   PRFSPTSQEITYMSYAQGEPRVFLLNIETGQREIVGNFPGMSFAPRFSPDGQRVIMSLQ
FT                   QGGNANIFVMDLRSKATTRLTDTPAIDTAPCYSPDGRQICFESDRGGSSQIYVMNADGS
FT                   GQRRISFGNARYNTPVWSPRGDVIAFTRQAEGKFAIGVMRPDGQGERVLTEGYHNEGPT
FT                   FAPNGRVIMFFRDPPGGGGPNLFTIDVTGYNEQRVPTPSYGSDPAWSPLRS"
FT   CDS_pept        580582..581076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0525"
FT                   /product="OmpA/MotB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86523"
FT                   /db_xref="GOA:A8IMC0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMC0"
FT                   /protein_id="BAF86523.1"
FT                   /translation="MLHLGFARGFRFAAMIGVMLALAACANNPNANGGAGMNGAGGPPG
FT                   SPQEFVVSVGDRVFFDTDQTDLSPEARAILDRQAQWLQQYNRYTFTIEGHADERGTREY
FT                   NIALGAKRAQNVRDYLASRGIDPARMRTISYGKERPVAVCNDISCWSQNRRAVTVLNPT
FT                   S"
FT   CDS_pept        581273..582193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0526"
FT                   /product="TPR repeat precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86524"
FT                   /db_xref="GOA:A8IMC2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMC2"
FT                   /protein_id="BAF86524.1"
FT                   /translation="MFSAYGAMKHSALVKIALLAATAALLTGPALAQQSGNGLFGDIFK
FT                   PPANVQNDTVANQQSELLMRVERIENQLRVLTGQIEQLQYRNQQLEQQLGARGAGGVPP
FT                   AAATAPRPPVTPPVASGGRRSDAFEPSEDPAAPGVPQPLGSPTSASVAPPRPAGAPLDI
FT                   GSGAQRPPVAAGVAAASTPKDLYDLGYSYVQRQDYPQAEQTFKQFLQTYPTDRLTPDAT
FT                   FMLGETLYLRQTYKEAAEQFLQVSTKYPNFTRAPDALLRLGQSLAALNEREAACATFAE
FT                   VDRKFPRATSNVRQAVEREQKRAGC"
FT   CDS_pept        582279..583277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="AZC_0527"
FT                   /product="cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86525"
FT                   /db_xref="GOA:A8IMC4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMC4"
FT                   /protein_id="BAF86525.1"
FT                   /translation="MSGGPDSTAMLVLARIWRYGLLDGPSFFVATVDHGLRPEATDEAL
FT                   AVGALCEELGLPHVILPWRGPKPRSGIQEAARDERFALLRSFARQNGLDGLALAHTQDD
FT                   QAETVLFRLCRGSGIGGLAAMRPVSRRNGLAVLRPFLSIAKARLVATLAVSGTPFVRDP
FT                   SNEDTRYARPRLRAISPLLGAEGLDAARLAVLAQRAARADDALEAATDAAQKLLVHGGW
FT                   DDEAGTRLDAEGFFRLPQEIALRLLMRALTLRATEGPVELAKAERLLEALRAAVIQPGR
FT                   LRRTLAGALVTLKQGSLSIVQAPARQAGAAHLAANSGTSGALVLGKEGGDP"
FT   CDS_pept        583373..585295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="AZC_0528"
FT                   /product="FtsH peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86526"
FT                   /db_xref="GOA:A8IMC6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMC6"
FT                   /protein_id="BAF86526.1"
FT                   /translation="MNANLRNFALWVIIVLLLLALFSLFQSPGQRSSANDISFSQLLSD
FT                   VDQGRVRDVVIEGPNISGSFTDGRQFQTYAPSDPTLVQRLYGKGVSITARPPSDNVPWF
FT                   VSLLVSWLPFIALIGVWIFLSRQMQGAGGKAMGFGKSRAKLLTEAHGRVTFEDVAGIDE
FT                   AKSDLTEIVDFLRDPQKFQRLGGRIPRGVLLVGPPGTGKTLLARAIAGEANVPFFTISG
FT                   SDFVEMFVGVGASRVRDMFEQAKKNAPCIIFIDEIDAVGRHRGAGLGGGNDEREQTLNQ
FT                   LLVEMDGFEANEGIILIAATNRPDVLDPALLRPGRFDRQVVVPNPDVVGREQILKVHAR
FT                   KIPIAPDVNLKVIARGTPGFSGADLANLCNEAALMAARRNKRMVTMVEFEDAKDKVMMG
FT                   AERRSLVMTEEEKMLTAYHEGGHAIVALNVPATDPVHKATIIPRGRALGMVMQLPERDK
FT                   LSMSYEQMTSRLAIMMGGRVAEELIFGHDKVTSGAASDIEQATRLAKMMVTRWGFSDEL
FT                   GQVAYGENQDEVFLGMSMGRTQNVSEATAQTIDKEVRRLVDEGYVEAKRILSEKAVDLE
FT                   TLARGLLEYETLTGDEIVDLLNGKPPVRDTVIEPANPRGPTVPTAGAGKNRPRPGGNPE
FT                   PQPQA"
FT   CDS_pept        585990..587249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0529"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86527"
FT                   /db_xref="GOA:A8IMC8"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMC8"
FT                   /protein_id="BAF86527.1"
FT                   /translation="MEALLERVLKRVMTRGSLGVTTATGRTYVAGTGDPKVHIRFTTKS
FT                   AERAVLFDPELEIGEAITDGTLVIEKGSITDFLDLVMAQPGVTTPTIASRLMLLARMAG
FT                   RRIAQFNPRGRSQRNVAHHYDLDGRLYSLFLDSDRQYSCAYFEHPDQSLDDAQLAKKRH
FT                   LAAKLMLDRPGLKLLDIGCGWGGLGLYMSEVGGADVTGVTLSKEQLAVAQGRVKERGLD
FT                   RHVDFRLQDYRDVPETFDRIVSVGMFEHVGVAHYGTFFRKAHDLLKEDGVMMLHAIGRQ
FT                   EPPGVTNPWIAKYIFPGGYIPALSEVLPHIEKAGLIVTDIEILRLHYAETLKAWRERFM
FT                   AHREEAKRLTDERFCRLWEFYLAGSEMAFRHQNMMVFQIQLARRQEAVPITRDYLAAAE
FT                   ERLRAAEFAVHAPPLRLAGE"
FT   CDS_pept        587437..588915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0530"
FT                   /product="DnaB helicase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86528"
FT                   /db_xref="GOA:A8IMD0"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMD0"
FT                   /protein_id="BAF86528.1"
FT                   /translation="MLDLAASKEDLPAYRQPPHNVEAEQALLGAILVNNEAFYRVSDFL
FT                   KAEHFYEPLHGRIYDLTGSLIRAGKIATPITLKTFLPADLDVGGLNGPQYLARLAAEAT
FT                   TIINAEDYGRAIYDLSVRRELIRIGEEIVNDAYDAPIEAQPQDQIEEAEKRLYAIAESG
FT                   RYDGGFVRFGDALRESVDMASRAFQREGHLSGIASGLDDLDAQMGGLQPSDLIILAGRP
FT                   AMGKTSLATNIAYNIASAYRGEQKPDGSIEAVSGGVVGFFSLEMSSEQLATRILAEQAE
FT                   IASYKIRRGDISESEFSKLAAAAQSMQVVPLYIDDTGGISIAQLVARARRLKRQRGLDF
FT                   MVVDYLQLLSGSGKASSNRVQEITEITTGLKALAKELNVPIMALSQLSRQVESRDDKRP
FT                   QLSDLRESGSIEQDADVVMFVYREEYYLKSREPKPGTEEWFKWETDMKACEAMAEIIVG
FT                   KQRHGPTGTVKVHFEAQFTRFGNLAREDRFPDRH"
FT   CDS_pept        588951..589379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0531"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86529"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMD3"
FT                   /protein_id="BAF86529.1"
FT                   /translation="MNQMAVAVRQGSTAAARRSDDSPHPRADSRQDRLPMDLSPALSPE
FT                   DAFVADLVASGRYADAASVWREAIYLLAEREYERSVQETAQLSLLHDVLSREADGAPLV
FT                   PDADGAETDLAFADADAVLSEIELLLSAGAPMAFRKAG"
FT   CDS_pept        complement(589426..590484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0532"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /note="catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86530"
FT                   /db_xref="GOA:A8IMD5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMD5"
FT                   /protein_id="BAF86530.1"
FT                   /translation="MAAMSKGPFSFVHQRYSLPSFPSPFLKDCAMAPGSVELLVLIPFP
FT                   PHELARLEAVFKVTYAPTPEQRAAAIAAKGPDFRAVLTHGTAGMTAAEMDAMPKLEMIS
FT                   CFGVGYDRIDVQAAIARRIIVTHGPGTNTISVADHTLALMLAAIRRIASQDHAVRQGQW
FT                   HEARHSTPELTGMRLGLIGYGSIAREVARRCEAGFSMTVGYHSRRKATDTAHTYYETPL
FT                   ALAEASDVLVVAAPANPQTRHMVNEAVLTALGPNGYLINIARGSLVDTDALIAALNAGR
FT                   IAGAGLDVVDGEPVVPAALLQAPNLVITPHSAGRSPNAEDNMTTLALRNLNAHFAGRPV
FT                   ETPVPECAKAAA"
FT   CDS_pept        590635..592050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="AZC_0533"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86531"
FT                   /db_xref="GOA:A8IMD7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMD7"
FT                   /protein_id="BAF86531.1"
FT                   /translation="MAKRDLSYVCQSCGAVYNRWQGKCDACGGWNTISEETNLAATVPA
FT                   AQRAGRKGRAVPLETLHGEAKPAPRLVSGIGELDRVAGGGFVPGSIVLLGGDPGIGKST
FT                   LLVQASAALAKAGHRVIYVSGEEAVDQVRMRAGRLGLAQAPVALAAETNAENILATFSA
FT                   GAAVQFVVIDSIQTLWSDSVESAPGTVTQVRTSAQLLVRYAKQSGAAVILVGHVTKDGQ
FT                   IAGPRVVEHMVDAVFSFEGDGANQFRILRAQKNRFGPTDEIGVFEMTGTGLSQVPNPSE
FT                   LFLSHRDAGAPGTAVFAGMEGTRPLLMEIQALVAPSSLGTPRRAVVGWDSARLAMVLAV
FT                   LDARCGVRLGGHDVYLNVAGGLRISEPAADIAVAAALVSSLTGAPLPPDAVFFGEVSLT
FT                   GAVRQVSQAAARLKEAAKLGFNKVVMPQLADGSASGLEVDTISSLAGLVAGIAARAPRR
FT                   AAMPKPAMSDEEG"
FT   CDS_pept        592160..592858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0534"
FT                   /product="putative uncharacterized membrane protein"
FT                   /note="required for colicin V production"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86532"
FT                   /db_xref="GOA:A8IME0"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A8IME0"
FT                   /protein_id="BAF86532.1"
FT                   /translation="MPVTLLDLILIGVMLISGLLAMVRGLIREVLSIVSWVAAAGVTVY
FT                   FYPQLLPVTKQYIAQDMVATAVTVGGLFLGTLLIVTILSARLSDAVLDSRIGALDRTLG
FT                   FAFGLARGFLVMVIAFLFFNWLVPDKSQPPWVLNAKSRPVMQNAGNWIVSLLPDDPENT
FT                   ILKRLKKPPASDDGSTPPDSTNGPRTERGGRTTFAAGASTSIEVSQAGYRRDARQGFEQ
FT                   LLESTRASGQ"
FT   CDS_pept        592879..594441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0535"
FT                   /product="amidophosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86533"
FT                   /db_xref="GOA:A8IME1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A8IME1"
FT                   /protein_id="BAF86533.1"
FT                   /translation="MDLDTAAPGGKPLHLEDPHEVARHHATYEPAAAGSREDTIDLGLD
FT                   GDTLREECGVFGIFNHPDAAAITAIGLHALQHRGQEAAGIVTYDGRRFHSERRLGLVGD
FT                   TFSDSRVIERLPGHIAVGHTRYSTTGETLLRNVQPLFAELDAGGFAVGHNGNLTNGLTL
FT                   RKQLVRDGAITQSTTDTEVILHLVARSKKNRFIDRFIDALRALEGAYALVSVTNNKLIG
FT                   ARDPLGIRPLVLGSLDGAPILASETCALDIIGARYVRDVENGEVIVIDEEGVQSFKPFP
FT                   ETAARPCLFEYIYFARPDSVVSGRSVYQVRKAFGEVLAKEGPAEADVVVPVPDSGVPAA
FT                   IGFSRASGIPYELGIIRNHYVGRTFIQPTQTVRDQGVRMKHSANRSVVEGKRIVLVDDS
FT                   LVRGTTSVKIVQMMREAGAREVHFRIASPPITHPDFYGIDTPDRDKLLAATHDLESMRR
FT                   YIGADSLAFLTVEGVYRALGCERDPVRPQFADHYFTGDYPTPLTDKASAVASQQLSLLA
FT                   EAS"
FT   CDS_pept        594545..595288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0536"
FT                   /product="NAD/NADP dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86534"
FT                   /db_xref="GOA:A8IME3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IME3"
FT                   /protein_id="BAF86534.1"
FT                   /translation="MSERPFADKIAVVTGATRGIGAAVARALGAGGAHVVALGRTQGAL
FT                   EELDDAITAAGGTATLVPMDVTDYDAIDRLGGALYERYGRLDVFVGNAGFLGPLTPMRD
FT                   VELKDWDKAVNINLTANYRFIRSLDPLLRMAPAGRAVFISSGAAHKGRAYWGPYAITKA
FT                   GVEAMGRTWAAETVTTALKVNLFNPGPIRTLMRAKAFPGEDPMTLPTPEEAAEAIVAMC
FT                   RTDVAETGRLYDFPTRSWQDFRSPA"
FT   CDS_pept        595380..596897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0537"
FT                   /product="cytosol aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86535"
FT                   /db_xref="GOA:A8IME5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:A8IME5"
FT                   /protein_id="BAF86535.1"
FT                   /translation="MTCLECFMSEPVTIAFAKHGAAPSGVLLVLVDDALNFGREAQKLL
FT                   KPALGQIKRAFEADRFKGKLGGALELIAPEGLDVARLIVLGTGKAGELKPTDFLRLGGI
FT                   AAGKIPGGSTAATLLADLPGAKFAPEAAAEIALGARLRSYVFDRYKTRKKEGDTDPVTL
FT                   TLTLLVPDAAAAVRAWTPREAVGDGVLLARDLVNEPANVLDPPEFARRATELSAVGVDV
FT                   EVLDDAALSRIGMRALLGVGQGSIKESRVVVMRWNGGKPGEAPVAFIGKGVTFDTGGIS
FT                   IKPAAGMEDMKGDMGGAACVTGLMHALAARKAKVNAVGVIGIVENMPDGAAQRPGDIVT
FT                   SLSGQTIEIINTDAEGRLVLADVLWYTKDRFKPKFMVDLATLTGAIMVALGTENAGLFS
FT                   NDDTLSTQLAAAGAATGEKVWRMPLSPEYDKLIDSKFADMKNTGGRNGGSITAAQFLQR
FT                   FVDKTPWAHLDIAGTAMASPASDINKSWGAGWGVRLLDQLVRDNYEK"
FT   CDS_pept        596971..597243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0538"
FT                   /product="uncharacterized ACR protein"
FT                   /note="DUF172"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86536"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A8IME7"
FT                   /protein_id="BAF86536.1"
FT                   /translation="MIRPRAMDVLSYSDTRANLKEVMDRVVEDHAPVVITRQKAEAVVM
FT                   VSLSDWSAMEETLHLLSSPANAARLREGVAELEAGGGSERDLVVP"
FT   CDS_pept        597240..597506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0539"
FT                   /product="addiction module toxin"
FT                   /note="Txe/YoeB"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86537"
FT                   /db_xref="GOA:A8IME9"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A8IME9"
FT                   /protein_id="BAF86537.1"
FT                   /translation="MKLVFATRAWEDYLHWVDADRNVLERLNALIEECRRTPFSGTGRP
FT                   EPLKGDLSGWWSRRITLQDRLVYRVAGKPPHQSLEIAQCRYHY"
FT   CDS_pept        597538..597987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0540"
FT                   /product="DNA polymerase III chi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86538"
FT                   /db_xref="GOA:A8IMF0"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMF0"
FT                   /protein_id="BAF86538.1"
FT                   /translation="MTEVLFYHLERRPLEDALPVLLEKSLERGWRCVVQAGSPERRDAL
FT                   DAHLWTYNDASFLPHGTDAQPRPERQPVLLTLDEANPNDAQVRFLVDGARIADASPYVR
FT                   VVHMFDGRDETAVAAARERWREAKAAGHTLTYWQQDENGRWVRKA"
FT   CDS_pept        complement(598209..598673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86539"
FT                   /db_xref="GOA:A8IMF3"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMF3"
FT                   /protein_id="BAF86539.1"
FT                   /translation="MKLDAAARNLRVLLRADSIIAEVRMRTLATRLALYGLAALVAGFG
FT                   LLMLDASLYLALSESWGPVKAAAATGGLNLLLALVLVGLAALVKPGRDLDFAQEIHKTA
FT                   LDALMGELKTAEQDVSALAYAVRHPLDSALPAVALPLITGLIKALRKPKA"
FT   CDS_pept        complement(598725..599174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0542"
FT                   /product="putative uncharacterized protein conserved in
FT                   bacteria precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86540"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMF4"
FT                   /protein_id="BAF86540.1"
FT                   /translation="MRLRKALRRRMGKTGSPSPSRPNRERHMPARTRKELQDLKAELAA
FT                   TGAETAAAPKPRRHRAAAHPHAPEAPPPDVEAPSPEAPAAAAGEAAAEAEPETATFDQL
FT                   HALVRDLQEALHEATEKAEDAVTSHPAAALASAFLLGLLVGRAWR"
FT   CDS_pept        599431..600048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0543"
FT                   /product="2-hydroxychromene-2-carboxylate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86541"
FT                   /db_xref="GOA:A8IMF7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMF7"
FT                   /protein_id="BAF86541.1"
FT                   /translation="MSRRIGYFFSVVSPWSFLGNDRLLKIAARHGATVEFRPVELGPVF
FT                   AETGGLPLAKRAPQRQRQRLVELQRWRLKLGLDFHIQPAHWPFNPGLVDRTVIAALLAG
FT                   HPVEPLLARLFSGVWQRQENLADPAVIVALADEVGLPGAELVAAADGEAAQQAYLANRE
FT                   LALKSDVFGAPSYVLDGEVFWGQDRLDLLDDALTSGRPPFRA"
FT   CDS_pept        600085..600570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="quinonprotein alcohol dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86542"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMF8"
FT                   /protein_id="BAF86542.1"
FT                   /translation="MRHRWTLAVRPDATMECSMRRMILCLGLALMPAVALAQPAPAPDA
FT                   AMPAPTTADTANGRFTFTPVDGGVLKLDTRTGMASFCSKGTSGFACLAVPDSRDAYEAE
FT                   IARLQAQIDGKGGATSSGNKLEVPLPSQSDLDAAYAYAGKLYQRLRGFIDGVENGSR"
FT   CDS_pept        complement(600571..602040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0545"
FT                   /product="putative esterase"
FT                   /note="lipase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86543"
FT                   /db_xref="GOA:A8IMG0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMG0"
FT                   /protein_id="BAF86543.1"
FT                   /translation="MRAVAVLDQIDALPCAETRPPGEDRNGERAVREQRAHMGGHVVRP
FT                   LRRVHPAAIARGEVVQRGDEVRLHVRVRILLNGEGRRGVPAEDRKHALPGADLREEGRG
FT                   LPRDVDEAGTARRHLQLALGLEIHRPAHRRATPHLMSFPPHDQGAACQPGARCPPCGRM
FT                   FQPPGPRSPMTVLSIDPHLFTDAAVAPDTKMVNAAIVKALSRAPDLGLVPWAVVRQARL
FT                   SGKGTFPLPPESPRARNETIEGPRGPVPVRIYLPDGAPTGVYLHFHGGGWTIGSAREND
FT                   GLNDAVAAAGLVVVSVDYALAPETPYPAAPDDCEAAALWLLREGLSLFGTDRFLIGGES
FT                   AGAHLAVTTLLRLRDRHGISPFVAASLHAGCYDLRLTPSARNWGTEPLVLNTADIERFV
FT                   RNYLRLEGEAEHPDVSPLLADLKGLPKAQFLVGTRDPLLDDTLFMANRWLASGNPARLE
FT                   AFPGGCHVFMGFVGSLADKGRARIVDFLRDA"
FT   CDS_pept        complement(602095..605574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0546"
FT                   /product="outer membrane autotransporter barrel protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86544"
FT                   /db_xref="GOA:A8IMG2"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMG2"
FT                   /protein_id="BAF86544.1"
FT                   /translation="MSFASGGGKMAGRKDRASRARARIGRAVGTLAFLIAGTAIAGAQT
FT                   FEAAGAIFFATASRQTSAIPLDLSTIIGSSAGIVSGSISSTGASGVGTVITSQAPIATG
FT                   TMTPVTGFGTTIATAPTLIVAKPGSGSPQSPPAGWSLYSGYSTSYSIPYANTPVFGGPQ
FT                   AQLMVNVTVGGQTTQVQVDTGSQGIVIPQYLFGNQTFTGKQGTIVYSSSGNNATGIWTT
FT                   MTVSFPGAKDQNGNPTTASASVPVFIEQSANNGTKDCTVAGTGCYFMMGIGYGRPDNGW
FT                   TGYQPSLNTNPLLHLTGMDEGTVRSGYIVTATGIQAGLTAANAGQGYALIQLQPSTGQA
FT                   SANWTTPPGTLIVTPNGGSPATTALPVLVDTGISYLWGNLGTASTACTYHNQQFTCAPA
FT                   GTAVTVYLGPGSYVGYSYVVGGSDNNSAAPPASRDSVIGALNTGISPLAQFDLMFDAVG
FT                   GFAGYKATAPNTSGIYFSPYLSTAGALSVPDGFLTTLPVYVSSATTFSTTGTATLQGAV
FT                   TGVSGLTVAGPGNTSFFGTVTLPSVTISGGAASFLANVTAPQFQVLSGAAAANSATLTA
FT                   TVSNAGTLINAGTIVGGVSNSGTVFNWQTVTGAVQSSGTFANTGTVNGTVTNSGTLTND
FT                   GTINGIVISTGTMNGNGIVTGALAVSGTVAPGHSIGTMAVNGNVELRRGSVYEAELGPA
FT                   GTSDRILASGSATLDGTRIAVSPYAGYTPGLGSYQIITAGGGVSGTYSVSAPDFGALPA
FT                   AYPFLAANGRITGSGLTIDMVRSTVPFAAAGITANETATGRGLDTLAQQGTLFNALLGL
FT                   NAATAAGAYDQLSGEIYASTQSLLIDQSFYVRDGVLGRLRQESGAPGAAGAVQTATLVP
FT                   GLPLTLWGEGYGGWGQAGGNGNSAGDSRSIGGFLMGLDLPLGTNWRAGIAGGYSQSTFS
FT                   TDARGSSGTSDNYDVALYAGGALAAVGPGTLNLRAGAAYAWHDIAMSRSAAFSGFANAL
FT                   SAGYGADTAQVFAELGYGFTLEKTPLGRVGLEPFAGLAYVHLSTDGLTETFGAAALSVA
FT                   SSSFDTTLTQFGLRASAVLLPGPNLPAVDVHGLIGWQHAFGDTVPTVAASFASGSLPFT
FT                   VSGAPIATDSLLLGFGLDTAIGQNARLGVAYTGQLASNVQDSAVKGTFSLRF"
FT   CDS_pept        606080..606379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0547"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86545"
FT                   /db_xref="GOA:A8IMG3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IMG3"
FT                   /protein_id="BAF86545.1"
FT                   /translation="MSRRCDLTGKAVLTGHLVSHSNRKTKRRFLPNLCNVTLQSDVLQR
FT                   SIRVRISANALKSVDHRGGLDAFLLKARDEELAPRVLELKRQIVKAQAEAPAAA"
FT   CDS_pept        606388..606963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0548"
FT                   /product="uncharacterized conserved protein"
FT                   /note="COG1738"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86546"
FT                   /db_xref="GOA:A8IMG6"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMG6"
FT                   /protein_id="BAF86546.1"
FT                   /translation="MGLFAQAVKSEPRAFALAVFAMCAAVLTANVLVQFPFTPFGLEDY
FT                   LTYGAFTYPVTFLINDLTNRRLGVQRTRLVIYVGFALAVLLSILFATPRIALASGSAFL
FT                   VAQLMDATVFNRLRRRAWWMPPAMAGFVSSAIDTVVFFSLAFAGTGLPWTSWALCDYAV
FT                   KLAMILVFLGPYKALIARMPMWQQPATA"
FT   CDS_pept        complement(606988..608592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0549"
FT                   /product="putative fatty-acid-CoA ligase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86547"
FT                   /db_xref="GOA:A8IMG7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMG7"
FT                   /protein_id="BAF86547.1"
FT                   /translation="MLANLGDFDRLRAAFQWRIPARYNMATHACDGWAARDPSRPALYV
FT                   PQGADFVPVSYGHLAEASNRFANALAAKGITRGDRVAILLPQSIEVLVTHLAVYKLGAI
FT                   AVPLASAFGVEALTFRLNDSGARALVADAAGLAKLAERPEWLDLIVSRDGPAPGIEGFD
FT                   DLVSRASATAPGIITGPDDPALMIYTSGTTGAPKGALHGHRVLIGHVTGQHFTHDSMPA
FT                   PGDRMWTPSDWAWAGGLLNTVLSALAHGVPVVVQPPGRFDPESAFRLMKTAGVRNVFIP
FT                   PTALKMMRAVEKPKERFGFNLRTVGTAGEALGAETFEWGRAALGVAVNEFYGQTECNYV
FT                   IGSNARLGVARAGATGKAIPGHDVRIIRTDGSLCDIGEMGQIAIRAPDPVMFLRYWNQP
FT                   EATARKYLGDLFVTGDLARLDADGYIHFQGRDDDVITSSGYRIGPSEIEDCLLRHPAVQ
FT                   IAAVVGKPDPVRTEIVKAVLVLRPGYKPGPELVKEIQDFVRTRLAAYEYPREIVFMDEL
FT                   PLTTTGKVIRRLLRDQT"
FT   CDS_pept        complement(608722..609297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0550"
FT                   /product="SCP-like extracellular protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86548"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMG9"
FT                   /protein_id="BAF86548.1"
FT                   /translation="MSDLGLSPFAGARALTSSRWTRRALPFALLGALALAGCGTTEVEQ
FT                   PSQPAFYENLAKTGQPVNAEAAASIISDYRTGKGLNPVTIDPALNQVAQDQANAMARAD
FT                   TLSHEVGGRTFVQRMNASGYKPKVAVENVGAGYHTLAEAFSGWRDSPPHNKNMLAQGVT
FT                   RMGIATAFNPKSKYKVYWALVLATPDAR"
FT   CDS_pept        complement(609352..611868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0551"
FT                   /product="conserved hypothetical transmembrane protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86549"
FT                   /db_xref="GOA:A8IMH1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR022249"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMH1"
FT                   /protein_id="BAF86549.1"
FT                   /translation="MQRALVRIAVLLTLMLALVAGQSVWAAPPADPALATAREKLEANR
FT                   SVLDAVEASLGVDGLRAPDLDELRSRLDPVRREMQARSEMLGPRATDVKTRLDELGPVP
FT                   AAGAAPEDPNVTADRERLKVLSTDIDALVKQNRALAARADQLSDRISTRRRELFTGQLF
FT                   ERSISIVDPSLWGTGMAAVRSALRSMSLLVSDSYGYARQRQDTLTLIAIGAGMALIVGL
FT                   IVFLGRLLRRRLSSHAPADGERMPRLRASREAVKTAVFESLVGPLAALAAVNFASGFEV
FT                   VPARVEEILRGLMVAIFIYALGRAVARAVLAPSQPWRRLPPLSDTAAATIFRFFSWSVT
FT                   TLAIGSFVNALNRALFTPVALTVLVSGIIVIFISAFTALMLVRIGRIAEEEEARDTALA
FT                   ESGGTPSGNLDLNGAPWIRTLLWLIIAVLVASLVAGYVSFAVFVASRMLVAAVVLSALY
FT                   IIYALIDAFFGEGLSAETHRARVFSKTLGLRPKSLEVIATLVSGLLKLCLFIVALLLMA
FT                   GSWGTSSADIQETVERVTFGIHIGNTTITLWNVVYAVTLLIIGVLLARGLQKWMATKLL
FT                   PGTGIEASLQTSISTIIGYVGTIIAIMVAAGEIGLNLQNIALVAGALSVGIGFGLQSII
FT                   SNFVSGLILLTERPIRVGDTINVKGEEGYVRRISVRSTEIETFERATVIVPNSDLITGM
FT                   VKNWTHSNTTGRVIVAVNIAYDADVEEVRDILVACACDHPQVLQTPPPRVFITKFADTG
FT                   IVFELRCVVANVDYSLTVKSDLHFSILRRFRKHDIVMTSQPWAALSRAPADLVPPHVDA
FT                   DPEPPAVEAKPSTPVKGGGSISDSTG"
FT   CDS_pept        612090..613262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0552"
FT                   /product="proteobacterial succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86550"
FT                   /db_xref="GOA:A8IMH3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IMH3"
FT                   /protein_id="BAF86550.1"
FT                   /translation="MTDAAASTAVSDQALAFAKALIQAPSVTPDAGQALDVVADALKAA
FT                   GYHVERLVFSTAGVPVDNLYARIGTASPNLCFAGHVDVVPPGDAASWRHGPFSGAVEDG
FT                   VLYGRGAVDMKGAVAAFLAAALAYGAPAQGSLSFLITGDEEGPSIDGTAKVVDWLAAKG
FT                   EVIDHCIVGEPTNPNALGDMVKIGRRGSLSGLITVEGRQGHVAYPHLADNPVPRLVRLL
FT                   TALTAAPLDNGSAHFPPSNLEVISVDVGNTAYNVIPGAATAKFNVRYNDLYSLESLMAE
FT                   IARRLDTAGEPYVLTFRDGASESFLTAPGPFVETVLDAVADVTGQRPQMSTTGGTSDAR
FT                   FIKSLCPVVEFGLVGQTMHMVNEATPVADLTALTAIYERLIARYFATFAA"
FT   CDS_pept        613281..614051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="MhpC, putative hydrolases or acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86551"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMH5"
FT                   /protein_id="BAF86551.1"
FT                   /translation="MAEETSGHLSVDGIEIATRRVPGQGPGVIWLGGFRSDMTGTKAQA
FT                   LADWAGERGHEYLRFDYSGHGASGGAFEDGTISRWAKEARAVFDSTDGPQVLVGSSMGG
FT                   WIALLLARALAAEGVKRLAALVLIAPAPDFTEALMWATFPEAVKEEIMAKGRFERPTQY
FT                   DGGPYVITRALIEDGRHNLVLGAPFSVGCPVRILQGAQDADVPWRHAMHLVTCLAEDDV
FT                   VFSLIKDGDHRLSRPQDIDRLRRVLDMLMNELKG"
FT   CDS_pept        complement(614325..615329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0554"
FT                   /product="putative NADPH protein"
FT                   /note="quinone reductase and related Zn-dependent
FT                   oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86552"
FT                   /db_xref="GOA:A8IMH7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMH7"
FT                   /protein_id="BAF86552.1"
FT                   /translation="MRAEHAMSTDTFKAIVARKAEGGQSVALEQADESLLPAADVTVDV
FT                   AWSTLNYKDGLALKGLGRILRTFPMAPGIDFAGTVRTSDSPEFKPGDQVILTGWGVGET
FT                   WSGGFSARARARSEWLVKLPEGMSPRQAMAIGTAGFTAMLCVMALERHGIETGGEVLVT
FT                   GAAGGVGSIAVRLLSRLGYRVVALTGRPEEAGFLTGLGASEILDRAVLQAPGKPMQSER
FT                   WAGVVDTVGGTILANAIAATKAEGAVAACGLAGGTDLPTTVLPFILRGVCLLGVNSVDA
FT                   PMARRQDAWARLARELTPADLDGLTQEVALEDVLGLADDILAGKVRGRTVVRI"
FT   CDS_pept        complement(615326..616207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0555"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86553"
FT                   /db_xref="GOA:A8IMH8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMH8"
FT                   /protein_id="BAF86553.1"
FT                   /translation="MPLPLERRALKNGPPPSVRPAGHHWPVSGNKSGNAMPQEAMPRNA
FT                   FKRAIHAGRQQIGLWCSIPSPFTVEVLAGSGFDWLLLDTEHAPADIPEIFAQLQAAAGG
FT                   SASPVVRVPSNDPVAIKRALDAGAQSLLMPMVQTAEEAHAAVAATRYPPEGIRGFAGMS
FT                   RATRFGRVKDYFKQAHDETCVLVQVESAQALDNLEAICAVEGIDGVFIGPGDLSASLGF
FT                   LDGQGAPEMVKLIEETLRRIVAAGNRPGILTADRTLARRYMAAGSVFTAVDIDLALLVR
FT                   QTEALAAEFKAG"
FT   CDS_pept        complement(616246..617328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0556"
FT                   /product="uncharacterized protein"
FT                   /note="conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86554"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMI0"
FT                   /protein_id="BAF86554.1"
FT                   /translation="MFSFGRSVRERGKGTASARPKRNGCPMAGHLRRISACLLLGLLLW
FT                   AGLDVRLGETAVRAQDFPKRAITLVVPRPAGGMSERLAELLAPPLSRAFGVPVNIRLMP
FT                   GDMGGEGARYVVAAPADGYTLMVAPSTLLLFDPTTLPNLGFVPERDLDPVLLAIRMPTV
FT                   LVVQPAVEARSLSELEAEIRAKPDLVFGASAKGSINDLLAAEMFRRARMPRNITYLGGG
FT                   GAVEAALLKGQVQASFQEASISADDIDRALVRALAITGDERSPRLPGVPTFAELGAPEM
FT                   NVFTWQAVVAPAGLKEDVRAALENGLKTALLDRTVVTAMQAIGAEVVAAGSRQLSRVLT
FT                   EERVRWRELGTADPYSATTR"
FT   CDS_pept        complement(617458..618030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0557"
FT                   /product="proteinase I"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86555"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMI1"
FT                   /protein_id="BAF86555.1"
FT                   /translation="MANRLDGRKVAVLVADGFEQVELTEPVKALKEAGAQVKIVSPMKG
FT                   QVQGVNHDKKGDAIPVDQPLDGANAGDFDALLLPGGVMNPDTLRINDKAIAFTRAFFEA
FT                   GKPVAAICHGPQLLISAGLVKGRKMTGYSAIQVDLANAGAQVSDTEVIVDQGLVTSRNP
FT                   KDIPAFNAKMVEEFAEGRHRGQRVAAE"
FT   CDS_pept        618175..619359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0558"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86556"
FT                   /db_xref="GOA:A8IMI4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMI4"
FT                   /protein_id="BAF86556.1"
FT                   /translation="MLTTVAAFDRIGEENAFAVLARATTLAAQGRDIINLGIGQPDFRT
FT                   PEHIVEAAVKALKDGQHGYTPSVGIQPLREAVARDLHKRFDVEVDPGLVMIMPGGKVTM
FT                   YAAILLFGEPGAEILYPDPGFPIYRSMIEYTGATPIPVPIREENGFAFSAEETLALITP
FT                   KTRLLIINSPANPTGGVTPKAEIDKLVKGLADHPHVALMSDEIYDQFLFDGERHQTLLA
FT                   YPEIRDRLILLNGWSKTYAMTGWRLGYSIWPQALYDKVRKLSVNAWSCVNAATQYAGIA
FT                   ALEGPQEPVAAMLAEFDKRRRLVVEGLNALPGVTCAKPKGAFYAFPNVSRTGWTSAKAL
FT                   ASALLEDAGVATIGGPDFGVHGEGYIRLSYANSAENIARALERMGAFLSERKVA"
FT   CDS_pept        619360..619890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86557"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMI6"
FT                   /protein_id="BAF86557.1"
FT                   /translation="MARAGRTLARLGAGMLLLAAAPAGAQEKPWREPNPCAGRMPAPDY
FT                   SRCLSEAAALSEREVTAAFEAAMAVVEGRTDLAAVQRNRWKGQLDEAQSRFLLFRNLDC
FT                   QSVAPFEGPRGIGNFEQRALCLIENNARRARDLAARYPKPVVPPVLAAKMAALEGEGFH
FT                   PATWTDPTTPRLD"
FT   CDS_pept        619995..620888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0560"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86558"
FT                   /db_xref="GOA:A8IMI7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMI7"
FT                   /protein_id="BAF86558.1"
FT                   /translation="MVELARGNDGRYGQSFGGDTFNTAVYLARAGIETAYATALGDDVF
FT                   SAQIVDLARSENLSTGAIVEVKGRVPGLYLITTDDKGERTFHYWRDSAPARSLFELEGW
FT                   QDVAEHLVAAQAVYFSGITLSLYSNAGLGRFLATLELAGERGAWRVFDGNFRPRGWGGD
FT                   LARARMVFSEALKRASMALPTFEDEVMLWGDASPEATIARITTYGVKEVVVKNGPGGAY
FT                   VHAEGQTVFVPVEREVQPVDTTGAGDSFNAGYLAARLKGATPVDAARAGHALAGRVIMH
FT                   RGAIIPRNAHEGVASH"
FT   CDS_pept        complement(620932..621579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0561"
FT                   /product="4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="2-dehydro-3-deoxyphosphogluconate aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86559"
FT                   /db_xref="GOA:A8IMJ0"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMJ0"
FT                   /protein_id="BAF86559.1"
FT                   /translation="MSQSNPLPLIARAPVIPVVVIERLEDAVPLARALVEGGLPLIEVT
FT                   LRTPVALRAMSVIAAEVEGAIVGAGTVTDRSQIEAVVEAGATYIVTPGTTPALAQALAE
FT                   APVPVLPGCATASEAMALDALGFKVLKFFPAEPSGGAPFLKGLAGPLPALRFCPTGGIG
FT                   PSNAPDYLALPNVVAVGGSWVVPGDAIKAGNFDKVRELSAAAAKLPRAAKFD"
FT   CDS_pept        622061..622801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0562"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86560"
FT                   /db_xref="GOA:A8IMJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMJ1"
FT                   /protein_id="BAF86560.1"
FT                   /translation="MSVQLRFRDLTLGYERHPAVHHLDGVVEEGALLAVCGPNGAGKST
FT                   LMKAISGALRPLHGSIDRAGLDPRDIAYLPQSAEIDRSFPIHVYDMVAMGLWRRAGLFG
FT                   GIGRADRARIGEAIAAVGLEGFENRPIGTLSGGQMQRTLFARLLLQDARLILLDEPFTA
FT                   LDAKTMSDLLDLVRRWHGEKRTVLAVLHDFDLVRAHFPQTLLLARSAVAWGPTAEALAP
FT                   ENLLKARRMGEAWDETAQPCEAAA"
FT   CDS_pept        622798..623670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0563"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86561"
FT                   /db_xref="GOA:A8IMJ2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMJ2"
FT                   /protein_id="BAF86561.1"
FT                   /translation="MTPYDLLVSPFVEFEFMRRALVGIFALSLGAGPVGVFLMLRRMSL
FT                   TGDAMAHAILPGAAIGFLVSGLDLAAMTIGGLAAGLLVAVGAGVVARATEIKEDASMAA
FT                   FYLVSLALGVMIVSLKGSNVDLLHVLFGTVLGLDDPTLLLVAGIASLTLVTLAFIWRPL
FT                   VLECVDPTFLASVSRAGGVSHIIFLALVVMNLVGGFHALGTLLSVGLMMLPAATARFWV
FT                   RDLTALVVVATVIAFVAGVAGLLISYYVGAPSGPAIILVAGAAYAVSVVFGPAGGVLSR
FT                   LMPRRHLEA"
FT   CDS_pept        623683..624639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0564"
FT                   /product="ABC transporter periplasmic binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86562"
FT                   /db_xref="GOA:A8IMJ5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMJ5"
FT                   /protein_id="BAF86562.1"
FT                   /translation="MLSRRTLLAAALVLGATPALAQSPAPAAKLPVVASFSILGDFVKN
FT                   VGGDRIALSTIVGPNADTHVYQPTPNDAKKLAGAKVIFVNGLGFEGWMDRLVKASGTKA
FT                   TVVVATKGITPRERSKDEPQDDDDHGPKGKKADAGHDHGPIDPHAWQSVANAKVYVANV
FT                   RDGLIAADPAGKDTYTANAAAYLAKLDQLESEVKAAMASIPEANRRIITSHDAFGYFGD
FT                   AYGLKLLAPEGVSTESEASAKDVGKIIRQIKEQHIPAVFLENVTNPRLIERLGKESGAI
FT                   VGGTLYSDALSRDNGPASTYIDLVRYNIRQLSGALTK"
FT   CDS_pept        624684..625850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="AZC_0565"
FT                   /product="putative CobW protein"
FT                   /note="involved in cobalamin synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86563"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMJ6"
FT                   /protein_id="BAF86563.1"
FT                   /translation="MRRPYPEGVRSPLHARAAARTGDPMAETGSEKIPVTVLTGYLGAG
FT                   KTTLLNRILSEPHGKKYAVIVNEFGEIGIDNDLVVGADEEVFEMNNGCICCTVRGDLIR
FT                   IIDGLLRRKGQFDGIIVETTGLADPAPVAQTFFVDEEVGAKTKLDAVVTVADAKWLSDR
FT                   LKDAPEAKNQIAFADVILLNKTDLVSADELAEVEGRIRGINPYARLYRTQKSQIEIEKV
FT                   LNQGAFDLDRILALEPAFLEEGEDHDHDHTCGPDCGHDHHHHDHGHHHDHGHDHHHGHS
FT                   HGGLKHYHDEEMQSVSFSTDKLLDPDKFFPWVQNVVATDGANILRSKGILAFKDDPDRF
FT                   VFQGVHMILDGDHQRPWKPDEPQVSRIVFIGRHLPTEKLESGFLSCVA"
FT   CDS_pept        complement(625923..627482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaD"
FT                   /locus_tag="AZC_0566"
FT                   /product="putative Na+/H+ antiporter"
FT                   /note="related arsenite permeases"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86564"
FT                   /db_xref="GOA:A8IMJ8"
FT                   /db_xref="InterPro:IPR031566"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMJ8"
FT                   /protein_id="BAF86564.1"
FT                   /translation="MSPALLASPEGIVHQRYEPSIYTRDGTGRQRAAPLTGSHRTRCGM
FT                   AVIGRWTPLALIPALLVPMSAAHAAGDAGFSGVGLSPLWGVPFAGMLLSIALFPLLASH
FT                   FWHHHYGKVALFWGLAFVVPFTLVYGPNVTTHEVVHAALLEYIPFIVLLAALFTVSGGI
FT                   LVAGRIKGGPVTNTAILALGTVLASLIGTTGASMVLIRPLLRANEGRKHNVHTVVFFIF
FT                   LVSNIGGSLTPLGDPPLFLGFLKGVSFFWTTTHLFHDTAVVAGILLVVYFIMESLLHAR
FT                   EDKTAAPVEEGGGRIELRGLQNVPLLIAIIGAILLSALWKPGIVFDVYGTRVELQWIVR
FT                   DVLLVLVALVSLGITPKLVRERNGFDWEPILEVGKLFAAIFLTIIPVIAILKAGTNGAF
FT                   APLVDLVTTPDGKPVNVAYFWLTGILSSFLDNAPTYLVFFNLAGGDAHQLMGPMAVTLE
FT                   AISAGAVFMGAMTYIGNAPNFMVLSIARHRGVKMPSFFGYMAWSIIFLLPCFALLTWLY
FT                   FI"
FT   CDS_pept        627625..630249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0567"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="bacterial/mitochondrial, class Ia precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86565"
FT                   /db_xref="GOA:A8IMK0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IMK0"
FT                   /protein_id="BAF86565.1"
FT                   /translation="MSTDRYNARDAEPRWQAIWNERGIFRTRNDDPRPKFFVMEMFPYP
FT                   SGRIHIGHGRNYVMGDVLARYKRMQGFNVLHPMGWDSFGLPAENAAIERGIHPKSWTYE
FT                   NIASMKEQLQLLGLSLDWNREVATCDPSYYAEQQRLFLDLFENDLAYRKESEVNWDPVD
FT                   NTVLANEQVIDGRGWRSGAVVERRKLNQWFFRITAFAQELLDAIDTLDRWPDKVRLMQR
FT                   NWIGRSEGLEVLFELSKGSVAAAGTSAVKVYTTRPDTLFGASFLALSPDHPLTQHLAAT
FT                   RPDLAAFVADCKTGGTSAEAIETQEKKGFDTGLTVVHPLDAARTVPVYVANFVLMDYGT
FT                   GAIFGCPAHDQRDLDFARKYGLTVTPVVLPPGADPAVFAVGSEAYDGEGTLYNSQFLDG
FT                   LSIADAKEQVARRLERFRVGEQPQGTRKVNFRLRDWGISRQRYWGCPIPIIHCDSCGPV
FT                   AVPREQLPVELPDDVTFDRPGNPLDRAKAWRDVPCPKCGAPARRETDTMDTFVDSSWYF
FT                   LRYASDNPDKPLDKDAVRHWLPVDQYIGGIEHAILHLLYSRFFTRALKACGRVDVAEPF
FT                   AGLFTQGMIVHETYKDKDGRWLFPEEVKLLGDGKAEKLDDGSPVTVGPPEKMSKSKKNV
FT                   VPPEVVVDTYGVDAGRWFMLSDTPPERDSEWTQSGIEGAWRFVQRVWRQVQEAIELGAP
FT                   KGADKPASFDAAATALRRAAHGLAHQVADDVERLRFNVAVAHVHEFANAFGQAIASART
FT                   ASPVPADLAFALREAAEIVTRVVGPMVPHLAEECWAALGYDTLLAEAAWPKAEPELLVE
FT                   NTITLPIQINGKKRDDITVPRDATAAEVEAAVLEMESVRRALDGKAPKRIIVVPQRIVN
FT                   VVA"
FT   CDS_pept        630335..630838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86566"
FT                   /db_xref="GOA:A8IMK2"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMK2"
FT                   /protein_id="BAF86566.1"
FT                   /translation="MYAEKTVTPAGQPLVEMMRQVEIVKIEGKLGNDLRNDLIFELTGG
FT                   AGNPVGAPYKMFITVVTNSASSIVDTTSGLPQNRIIHVTANWRVVRAGEETKPPVLQGK
FT                   SSGSASIDVSEQRFANWRATRDAESRAARMVVEQIRAQLAAYFINPPAPPAAPAAPAAK
FT                   PPGT"
FT   CDS_pept        630843..631856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0569"
FT                   /product="DNA polymerase III"
FT                   /note="delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86567"
FT                   /db_xref="GOA:A8IMK3"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMK3"
FT                   /protein_id="BAF86567.1"
FT                   /translation="MVAVRAGDADTALARRDPRHAVVLIFGPDMGLVRERAAGLVKRVV
FT                   PDVADPFAVVRLEGDELSGDPQRLIDETQTVGLFGGERVVWVRAGSRNFVPALEPVLEV
FT                   GGSTLVVVEAGDLKKGAPLRTLCEASPKALAIPCYADGDRDLGKLVDTMLSEAGLAIDR
FT                   DAKELLVSLIGGDRLASRGEIAKLALYAQGQGRVTLEDVRVIVGDASALALDDVVDSTL
FT                   AGQAVEATAALAKAWGAATRPDAVLGALLRALSSLHQMALQVQAGTPADRVIDQARPMV
FT                   HFSRKPKLERALRSLNAERCLRAILLVDEAVLAARRNAGMAQAITERVVLQLSARR"
FT   CDS_pept        631892..632344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86568"
FT                   /db_xref="GOA:A8IMK6"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMK6"
FT                   /protein_id="BAF86568.1"
FT                   /translation="MMDWILPKRLDNSFPGHPAVVWIFVALTLVTLGRSLFHMFAPDGG
FT                   AQSVAHIPLSTYPAAASSTIIFVFALWGLSQLLMGLIYVVALIRYRGLIPLLLLLMAAE
FT                   YAGRMLIATYRVLETTATPPGAVADHLTLPLALILLAFCHPRFRKG"
FT   CDS_pept        complement(632348..633760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0571"
FT                   /product="major facilitator"
FT                   /note="superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86569"
FT                   /db_xref="GOA:A8IMK7"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMK7"
FT                   /protein_id="BAF86569.1"
FT                   /translation="MSSRPPPTEQDMSENTLEAPGAPASMLDAVKVYLRPSVLVVILLG
FT                   FSSGLPLALTGTTLAVWMTERKVDIATIGLFHLVGLPYTLKFLWAPLVDALDVPLLSRW
FT                   LGRRRGWLLATQLLLAAAILYLGFQDLGFAPSADGTRMAAPFGLIVGAVLVAFLSATQD
FT                   IVVDAYRVEKLDTSEQAAGMAGYVAAYRIGMLVSGAGIIALVAWFEFKGLPHAQVWAWG
FT                   YGVAAACMALGIFATLIAREPDGAPRVAHEGGALGALKRVFTTAFGAFSEFLTRSHAFA
FT                   ILAFVTLYKFSDALAGGLTASFVISIGFDKATYAAIVKGVGLLAALAGGFAGGMLARGR
FT                   SLVTCLWIGGVLQMASNLAFSVQAMIGPDVGFLTFAMIVENFTGAIGTVIFVAYLSSLC
FT                   GARAHTATQYALLTALTAVGRTVLASGGGYIYDVTGWAWFFVVTVIAGLPGLALLGWLQ
FT                   ARGHFRELGAKG"
FT   CDS_pept        complement(633885..634556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR"
FT                   /locus_tag="AZC_0572"
FT                   /product="regulatory protein"
FT                   /note="LuxR:response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86570"
FT                   /db_xref="GOA:A8IMK9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMK9"
FT                   /protein_id="BAF86570.1"
FT                   /translation="MGDADAGYRLVIADDHPLFRGALREAVAGEFPSAEIVEVGTFDDL
FT                   HALLEREDDFDLILLDLTMPGARGFSGLIYLRAQYAGVPVVVVSGNEEPAVIRRCIDLG
FT                   ASGFIPKTMGIAGMRQSVATVLAGGTSVPPDLGPPTAQDGEADAIISRLATLTPQQVRV
FT                   LMMLAEGRLNKQIAYELGVSEATVKAHVSAILQKLGVESRTQAVIAVSKVDAGLWSANQ
FT                   A"
FT   CDS_pept        635017..636510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0573"
FT                   /product="methyl-accepting chemotaxis receptor"
FT                   /note="sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86571"
FT                   /db_xref="GOA:A8IML1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8IML1"
FT                   /protein_id="BAF86571.1"
FT                   /translation="MRRSMFGVGSQSEALLKLSALDRAQAIIEFTPTGEILDANQNFLS
FT                   LVGYGLNEIKGKHHRMFVDPREAESAEYRAFWQALGKGQYQEAVYRRIGKGGAVVWIRA
FT                   IYNPLIDRSGKVLKVVKFATDITEQKMRFAEHESLLAAISKSQAVIQFDLKGNILEANQ
FT                   NFLDTMGYRLDEIVGRHHSMFVPEQMRQSPQYAAFWDNLRRGEYQAAEYKRIGKGGREV
FT                   WIQATYNPVLDADGAVSKIVKFATDVTKRVVVRERRAAAYREIDAGLSDISSELTDTNS
FT                   RVVSASEATQTAAHNMQSVATGAGQLAASVDDISRQVQQSSELSVAAVEQGNRTNEIVA
FT                   SLSGAAEKIGHVVELINSIAAQTNLLALNATIEAARAGEAGKGFSVVAQEVKSLAGQTS
FT                   KATSEIAAQVTEVQAATGQAVTALASVTEFITQLNAIAGSIADAVQRQASVTREVSSSM
FT                   QTVAHGIEVVKQDMGVIASATSHVEAAARKVREASAAIA"
FT   CDS_pept        complement(636520..637461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0574"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86572"
FT                   /db_xref="GOA:A8IML3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IML3"
FT                   /protein_id="BAF86572.1"
FT                   /translation="MRKSMNRRCSAVTGADFEWSDLRYLLTVARSGSLTAAARQMGVEH
FT                   STVSRRITALETALGAKLFDRRTGGLLLTPQGERLMAAAEGMEALALSAQGEIAGADLG
FT                   VSGTVRIGAPDGFGTVFLAPRLGAFSRQHPALEIQLLAMPRLISLSKREADIAISLSRP
FT                   KEGRLHARKLTDYRLGLYAAVAYLETHGPIESRAALGRHPFIGYIDDLIYAPELDYVPL
FT                   VARELKPRIKSSNLVAQMEATRAGAGVCVLPCFMGDAMPDLVPVLRGEVSLTRTFYLVT
FT                   HTDMRDLARVRAAADFIASEVGQARARFLGAP"
FT   CDS_pept        637555..639051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0575"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86573"
FT                   /db_xref="GOA:A8IML5"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A8IML5"
FT                   /protein_id="BAF86573.1"
FT                   /translation="MREMGHFIGGKHVPGTSGRHADVWQPMTGEVVGRVALASAAEMRA
FT                   AVENAKAAQPAWAATNPQRRARVLMKFLELVQRDYDALADLLAREHGKTVPDAKGDIQR
FT                   GLEVIEFAVGIPHLLKGEFTDGAGPGIDVYSMRQPLGVVAGITPFNFPAMIPMWKFGPA
FT                   IACGNAFILKPSERDPGVPLKLAELMLEAGLPPGILNVVNGDKEAVDAILDDPDIQAVG
FT                   FVGSSSIAQYIYARGAATGKRIQGFGGAKNHMIIMPDADMDQAVDALIGAGYGSAGERC
FT                   MAISVAVPVGEAAAEKLIEKLVPRVESLKIGPSTDVTADFGPLVTREALERVKSYVDIG
FT                   VNEGAKLLVDGRGFKLQGYENGFYLGGCLFDHVTPDMRIYKEEIFGPVLSVVRAKDYKE
FT                   ALRLPTEHEYGNGVAIFTRDGDAARDFASKVNVGMVGINVPIPVPIAYHTFGGWKRSGF
FT                   GDLNQHGPDGVRFYTKTKTVTSRWPSGVKDGAEFVIPTMN"
FT   CDS_pept        639143..640285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0576"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86574"
FT                   /db_xref="GOA:A8IML8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034178"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8IML8"
FT                   /protein_id="BAF86574.1"
FT                   /translation="MFELTEDQIAIRDMARAFAREEIAPHALEWDEAHHFPIPTLKAAA
FT                   ALGMAGIYVRDDVGGSALSRLDATLIFEALAEGCPATSAYLSIHNMVAWMIDRFGAPEQ
FT                   RTRWLPKLCAMDIVASYCLTEPGSGSDAAALKTRAARDGDHYVLHGEKQFISGAGASDL
FT                   YAVMARTGGEGPGGVSTILVEAGTPGLSFGANEKKMGWRVQPTRAVIFDGVRVPVENRI
FT                   GAEGDGFKFAMAGLDGGRLNIAACSLGGAQAALDKALAYTAERKAFGKAINQFQALQFR
FT                   LADMETELEVARTFLWRAASALDRSDPKATRLCAMAKRFVTDAGFEVANEALQLHGGYG
FT                   YLADYGVEKIVRDLRVHQILEGTNEIMRVIIARGLVARGN"
FT   CDS_pept        640336..641229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0577"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86575"
FT                   /db_xref="GOA:A8IML9"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8IML9"
FT                   /protein_id="BAF86575.1"
FT                   /translation="MAVIAFIGLGNMGGPMAANLVKAGHAVHGFDLSEAAKAAAAARGV
FT                   SLAVSAAEAVKAADVVVTMLPSGPHVLGAVTGADGLFAAARPGTLFIDSSTIDVESARA
FT                   FHAGAEAAGMASLDAPVSGGVGGAEAGTLTFMAGGSEAAFSAAKPHLERMGKKIVHCGG
FT                   AGAGQAAKICNNMILGISMIAVSEAFVLGEKLGLSHQALFDVASTSSGQCWSLTTYCPV
FT                   PGPVPTSPANREYQPGFAAALMLKDLKLSQQAADQAGAATRLGAEAAALYSAFEAEGNA
FT                   GRDFSGIIEWIRARTA"
FT   CDS_pept        complement(641242..642192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0578"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86576"
FT                   /db_xref="GOA:A8IMM1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMM1"
FT                   /protein_id="BAF86576.1"
FT                   /translation="MQHRPLGRSGLSIAPLVLGTNVFGWTADEATSFRLLDAFVDAGLN
FT                   ALDTADIYSRWVPGHSGGESETIIGKWLAANPAKRDKVLIFTKVGMDHGPDRNGLSPRW
FT                   IRQSVEESLKRLQVEQIDLHQSHTPDAATPDAETLGAYQELMRAGKIRAIGASNYSAEQ
FT                   LGAALAVAAELGLPRYETLQPLYNLYDRASYDGALRDLCMREDIGVIPFYGLAAGFLTG
FT                   KYRSEADFGKSARGGKMANYLNPRGLRILAALDEVAAAKGAAPGEVALAWLIARPGVTA
FT                   PIASATSLAQMDGLIRAVHLQLSAEEIAALDAASA"
FT   CDS_pept        complement(642425..643954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0579"
FT                   /product="AMP-binding enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86577"
FT                   /db_xref="GOA:A8IMM3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMM3"
FT                   /protein_id="BAF86577.1"
FT                   /translation="MHIGFLFRRARAWHGASVALVDRVGPWTFEALMARIARFGQALAG
FT                   LGLLRGERVALLLPDIREHLEADYGAMAAGFISVPLSAGMRRQDLVAHLRRTGARAVVA
FT                   EATLIPMLAELRSELPDLRHIIALGGTVSGAHDYEDLLARASDRFLPPGESEDIAQLAL
FT                   SAGRTGQPKIVKLSHGNISAVAGNLIAGLRIGSDSVFLNVRPLWAPLQFMVLAYLLGGS
FT                   RIVLGGAFDAERFPFQMARFSVTRSAMSPAQLAELLPHLAPEDVALNAMEMLHIGGAAL
FT                   PEAVCDEALNLVGPRISVHYGLAEAPFTCLLSAERLSVKRALRNELRTTVGRPFFGYET
FT                   RLEGVEDTFATEQEGEILIRGPHVMTGYWDDPEATARVLCDGWLRTGDIGMLSSGYDLK
FT                   VVGRTQDLIFSAGQTVSLREVEAAIARHPAIREVAVVGLPDGEAGEALTAFVVLKDESA
FT                   ASAEEILAFTHGALIGAKRPKAIHLRRELPRSDYGGIFLPGLLTDIVPLRG"
FT   CDS_pept        complement(644747..645766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0580"
FT                   /product="regulatory protein"
FT                   /note="LysR, substrate-binding precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86578"
FT                   /db_xref="GOA:A8IMM5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMM5"
FT                   /protein_id="BAF86578.1"
FT                   /translation="MPPASAWGAVGRSPCTECPMSRSKADARAASRAPEIPLRMSALHL
FT                   DVFNAVVVTGGVTAASRQLHLSQPAVSRRLADLERVLGFDLFLRDGKRLIITPEGKAFH
FT                   EELSISYLGLEHLTKVALDIRELRRGHLRFVCMPAMSFGPVPKGLAAFSARHPDIHITH
FT                   ETHSAARIEDALTSNLFDVGIGMAPRDMAGLVSEGRFAFSCVCVMRPDHPLATQETVTA
FT                   TDICREAVVGINPDTEIGSQLRRLFESLPHSVSLRIETQTSIAACGLVEAGAGVAVVDP
FT                   FTAAHLGRGGGLVSRRFSPIIPFDIHILRPERRVPSRAAQALIAELAAAMTSEEEASS"
FT   CDS_pept        645901..646473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0581"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86579"
FT                   /db_xref="GOA:A8IMM8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMM8"
FT                   /protein_id="BAF86579.1"
FT                   /translation="MTTLPPLIQDFVLHFGEMGSRWGMTRTVGQIYALLFVSSEPLCAE
FT                   DMVAALGISRSNVSMSLRELQSWNLLVMKPRPGDRRDFYTTPDDVWQILRILAEERKRR
FT                   EVAPTLAVLDRLLVREPTGESERHAQARMAQMNDLVVQLTSWYDDVKRLDDARLSSLLK
FT                   LGGKIVRLLGKLERPAASAHPGEDVAP"
FT   CDS_pept        646470..648236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="AZC_0582"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86580"
FT                   /db_xref="GOA:A8IMN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMN0"
FT                   /protein_id="BAF86580.1"
FT                   /translation="MSIQFPAPHSRFVDGSVAEGTSARPRMDTAGAHAAPARRRRPRPA
FT                   QNLESRGGALLQLVASLLFIGQAALIARAVGTMSSAITVPALLGPAAGILALGVVRAIL
FT                   EALGARLCHRQARAALGRLRSEVAAAVAARSPLDRNRPVAGAVASALAEQAEAVVPYLS
FT                   RFKPARLRASVVPFVMLAVVLPLSWAAALVMLVALPLIPVFMALIGWRAQAASEAHLKE
FT                   MGSMNGFLLDRLRGLATIRALGAVDTTALRLRASAETLKDRTMAVLRIAFLSSAVLELF
FT                   SALGVAMVAVYVGFHLLGTLEFGTWGVPLNLSDGLFILILAPAFFEPMRDLSAVWHDRA
FT                   AGEAAFAALKLLTANGLPLPGANMAHPVPAAAAPAPDVVFDTVSFTHAEGRAPFAAFSL
FT                   TVPAGGRVALLGPSGAGKSTLLALAAGLAPVHTGSVRIGGLPLTAETAAELRSGMAWIG
FT                   QRPHFFAGSLAANVQMGRPDIGPEAVEEALAFATLDRAVRGRSADDGLGEGGAGLSGGE
FT                   LVRLAIARAAVDPRVQLVLADEPTAHLDAATAAEVTEALLTLATGRTLIVATHDPVLAA
FT                   RLDTVVQLEPRP"
FT   CDS_pept        648233..649951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0583"
FT                   /product="ABC transporter ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86581"
FT                   /db_xref="GOA:A8IMN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMN2"
FT                   /protein_id="BAF86581.1"
FT                   /translation="MSARLFARARVPLRPLAAIVRLFWAERGPRLLAGALLAGVTVLAG
FT                   FALLSLSGWFLAATAIAGLSAGTALAFDVFTPAAAIRFLALARTGGRYGERLVTHDATL
FT                   GVLAGLRERLFRGWATPEAARALGLRPARLLFRLTEDIDAIGQLYLRVLVPAGAAVLLA
FT                   LVAGVGLGLVAGSGPGIALCAGLMVVGLGLPLAGARAAYRHSRRRAYATESLRARAIDL
FT                   VAGQTELVMAGRLPAQCEAVARADRTLAEADLALNRIETRVGAGFGIAASVLVAGALLL
FT                   AGVLARQGTIDGPVAAALVLGALAVLEPFAGLRRGALELGRILLAAGRLGPRLTDRRPL
FT                   RGPLRAEAGIAVRVSRVDLRQRAAHRTLLDDVSLTILPGERVALVGASGAGKSSLLGLI
FT                   AGERSPTDGTVESLCATLLTQRTELFQDTVRDNLRLAAPTASDEALWEALTAAGLAADI
FT                   AGLPAGLDTRLGEGGLGLSGGQGRRLALARLLLRDTPVWLLDEPTEGLDGETARAVLAR
FT                   LTACAEGRTLVVATHIRREAELCDRLLVMAQGRIIARLARGEPGFDAMLAGLRPD"
FT   CDS_pept        650026..651600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="AZC_0584"
FT                   /product="cytochrome d ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86582"
FT                   /db_xref="GOA:A8IMN4"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMN4"
FT                   /protein_id="BAF86582.1"
FT                   /translation="MEFDIVSLSRLQFAMTALYHFLFVPLTLGLSIIVAIMETVYVMTG
FT                   RTIWRQMTKFWGTLFGINFVLGVATGLVMEFQFGMNWSYYSHYVGDIFGAPLAIEGLMA
FT                   FFLEATFVGLFFFGWDRMSKVGHLVATWAVAFGSNFSALWILIANGWMQNPVGAVFNPQ
FT                   TMRMEVDDFYAVLFNPVAQAKFVHTVSAGYTTASVFVLGVSAWYLLKGRHIELAKRSMT
FT                   VAASFGLAAALSVVVLGDESGYLTTEHQKMKLAAMEAIWRTEPVPAPFTVVGFPDQKAR
FT                   ETHYAVEIPWVGGLIDTRSLNTPVEGIEELVERAKGNIAKGVLAYDALQKIRAAGSAAV
FT                   PVDVQKTFEANGNLLGYALLLKRYVDDPRQATPEQIAKAAWDTVPQVAPLFWTFRIMVG
FT                   VGFFMILLMATFFTLSARRQLDRFPLLLRIAVLAIPLPWLAAECGWFVAEFGRQPWIIE
FT                   GILPTASAVSSLGAMTVLLTIAGFVLIYTTLFIIEMGLMLRAIRKGPAPDNEPEAELIP
FT                   ATVVPAE"
FT   CDS_pept        651605..652759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0585"
FT                   /product="cytochrome d oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86583"
FT                   /db_xref="GOA:A8IMN7"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMN7"
FT                   /protein_id="BAF86583.1"
FT                   /translation="MILHDLINYEVLRLIWWLLLGVLLIGFAVTDGFDLGVATLLPFVG
FT                   RTDVERRVAINTIGPVWEGNQVWLILGGGAIFAAWPPLYAVSFSGFYLAMFAILAALIL
FT                   RPVGFKYRSKRDSEAWRKGWDWALFVGGFVPALIFGVAVGNTLQGVPFRLDDDLRIFYD
FT                   GSFFGLLNPFALLCGLLSVAMLVTHGATWLQLKADGPVADRARTYGSISALVAVVLFVL
FT                   AGVLLYSFVAGYKITSPINPLGPSNPLLKTAATAPGAWFANYATAPGLLAAPAIGIVGL
FT                   LAAGLALRLKWEGAGVLLSGLGIFGIISTVGVSMFPFILPSTVDPRFSLTVWDASSSHL
FT                   TLFIMLVSTVIFLPIILLYTTWVYRVMWGKVDAKAIREDRGHAY"
FT   CDS_pept        652778..652897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0586"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86584"
FT                   /db_xref="GOA:A8IMN9"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMN9"
FT                   /protein_id="BAF86584.1"
FT                   /translation="MWYFAWILGLPLAAAFAVLNAMWYELMDDEAKKRALTRK"
FT   CDS_pept        complement(653005..653229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0587"
FT                   /product="alkilphosphonate uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86585"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMP1"
FT                   /protein_id="BAF86585.1"
FT                   /translation="MSDDIIVKDSNGTRLADGDSVTLIKDLKVKGTSETLKRGTLVKNI
FT                   RLTDNPAEVECNTKQVKGLVLRTEFLKKA"
FT   CDS_pept        complement(653318..653590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0588"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86586"
FT                   /db_xref="GOA:A8IMP3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMP3"
FT                   /protein_id="BAF86586.1"
FT                   /translation="MRREGAMGIIGTIIIGFIVGLVAKWLHSGPNEPSGFILTTILGIV
FT                   GASVATYLGQAIGWYHAGEGAGFIGAIVGAVIVLMIWSALSRRIA"
FT   CDS_pept        complement(653725..654996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0589"
FT                   /product="putative ABC transport protein"
FT                   /note="substrate-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86587"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMP5"
FT                   /protein_id="BAF86587.1"
FT                   /translation="MNTTGFSGPPEPASHIGRTHMKRYVTGALAALTAFCLAGTAMADI
FT                   SDGKVKIGVLTDMSGVYSDITGKGSLLAAKMAIDDCLKAECKGMQIEMISSDHQNKADV
FT                   ASATARRWIDQEQVDVLADMSNASIQLAIAPLVKEKNRVALFPGGTARLTGDACQPDHV
FT                   VQWMWDTYVQVAGVANRLTKPGTSWYLVTADYALGHQLELDAKTAVTAKGGKFLGSTRH
FT                   PFPAVDLSSPLLAAQGSGADIIALANAGGDTVAGIKTAREFGITDSKQKLVAFFLTAND
FT                   VKSVGLPVAQGTLLTEGFYWNLDDGTRAFSERFKKEQGAMPSAIQAGVYSSILHYLKAV
FT                   AAAKSDDAKTVVAKMRELPIKDDVVRNAKLREDGRMVHDFYVFQVKSPGSSKGEWDLYD
FT                   LVGTIPGDEAFRSIADGKCPLLGK"
FT   CDS_pept        complement(655001..656023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0590"
FT                   /product="putative gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86588"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMP7"
FT                   /protein_id="BAF86588.1"
FT                   /translation="MAAPNPIDGFEIDPAALTFVGEGLQRPECILAEPDGSLWSADARG
FT                   GVVHIQPDGTQALISQHQADSFATATDEEQRFVSGTLPNGLAFARNGDILISNFGTDRL
FT                   EVMTRDGALRVLVEEIDGAPIGKVNFVLRDSRDRVWLTISTRIKNWMSAMSPNVRDGYV
FT                   ALYDQGRLRVVADGFGFTNEIRLDAREEWLYVVETCGRRITRLRVAEDGSLSRRETFGP
FT                   SDHGAFIDGIAFDSYGNLWGTHVMTDRLFAITPDGDLRILLDDDRNSAAGRALMEAFAQ
FT                   DKATPELMLACGGTIAPWFASLTFGGPDLRTGYIGSLRGTRIPTFRAPVAGLPMAHWTS
FT                   "
FT   CDS_pept        complement(656315..657241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0591"
FT                   /product="prokaryotic protein of unknown function"
FT                   /note="DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86589"
FT                   /db_xref="GOA:A8IMP9"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMP9"
FT                   /protein_id="BAF86589.1"
FT                   /translation="MSKVIITCAVTGGIHTPTMSDALPITPSEIAEQAIAAAEAGAAIL
FT                   HLHARDPKDGRPTPDPKVFMEFLPRIKQSTDAVINITTGGGLNMTVEERLAAPLQAAPE
FT                   MCSLNMGSMNFALHPLAKRYKDWKHDWEEPYLSGTKDFIFRNTFGDIERIYKLLGEGHG
FT                   TKFEHECYDVGHLYNLAHCLDQGWFRPPVFLQLIFGILGGIGPDLDNLMFMKRTADKLF
FT                   GKDYHWSVLAAGRHQMNFATQAAMMGGNVRVGLEDSLFIGKGQLAKNNAEQVAKIRRIL
FT                   EELGHEIATPDEARATLGLKGADLVKF"
FT   CDS_pept        complement(657309..658118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0592"
FT                   /product="putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86590"
FT                   /db_xref="GOA:A8IMQ1"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMQ1"
FT                   /protein_id="BAF86590.1"
FT                   /translation="MPNGTSLQGERPLPRFIDISIPLENDVPADPPFQKVQIAYHTHGD
FT                   TAAQLVGSFPGLTVDQLPDGQGWAVEIATISTHNGTHVDAPWHYHPTMDGGARAITIDE
FT                   IPLDWCFRPGVKLDFRHLPDGHVVTPDEIDAELARIGHTLAPLDIVVVNTAAGARYGHE
FT                   DYIHSGCGFGRDATLHLVNKGIRVVGTDGWSWDAPFSHTARRFAETGDASLIWEGHKAG
FT                   RDAGYCQIEKLHNLEALPATGFTVSCFPVKVKGGSAGWTRAVAILPD"
FT   CDS_pept        658318..659040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetR"
FT                   /locus_tag="AZC_0593"
FT                   /product="transcriptional regulator"
FT                   /note="TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86591"
FT                   /db_xref="GOA:A8IMQ4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMQ4"
FT                   /protein_id="BAF86591.1"
FT                   /translation="MVRRGMSEDKGKSDRRRAVPSGQAAGARRSALAPEAPGRPDRRAA
FT                   ILASAEALFAERGYADVSVRDIATRAGVPVALVGYYFGRKPELFTTIFERRQTYITERI
FT                   ARIEAVDARPDNPAAVEALVRAWAEPVITMRGTEAGDVFALLVARTAWDPGPEATAIIE
FT                   RFYDPLARAFFGAMQRALPACPPDRIVWAYEYAVGALLMYVGDKRIERLTEGRAATADP
FT                   ALCEDFIRFVSAGFETLR"
FT   CDS_pept        659137..660507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupT"
FT                   /locus_tag="AZC_0594"
FT                   /product="HupT protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86592"
FT                   /db_xref="GOA:A8IMQ7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMQ7"
FT                   /protein_id="BAF86592.1"
FT                   /translation="MSLPHDDGAPPVLPASGLGADGAVPGAEAEQAWISVIQKMDETYA
FT                   ELLAQQVELEAKNEALEEAHAFIAGVMASMTDVLIACDLAGRIEQVNVAAERLFGRPAS
FT                   VLQVQRLADLIAPESPASFSDVLTTVARRERIADRDFTFLTPEGPLPVSVNGAIRFDPR
FT                   GRAVGITLMGRPVGELRKAYSDLAAAHERLKETQQQLVQAEKMASLGRLVAGVAHELNN
FT                   PISFVYGNAHTMKRYAERLATYLDALHGAPSPAAVSGLRGELKIDRTLAELGPTLAGML
FT                   EGAERVRDIVADLRRFSSDRRQGDEAVDMAGLVRSALDWVAKAQQPDVAIFTDLPDGLD
FT                   VTGHPGQLHQVMMNLVQNALDALEGAPVRRLEITGRREGERVVVRVRDSGPGIAPDILS
FT                   RVFDPFFTTKPVGKGTGLGLSICYRIVQEHEGTLAAANAPEGGAVMTLSLPAAGSTP"
FT   CDS_pept        660504..661526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupU"
FT                   /locus_tag="AZC_0595"
FT                   /product="HupU protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86593"
FT                   /db_xref="GOA:A8IMQ9"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMQ9"
FT                   /protein_id="BAF86593.1"
FT                   /translation="MTVQSRAHGFNVLWLQSGGCGGCTMSLLCAEAPDLLTTLDFAGIR
FT                   LLWHPSLSEETGTEAVELLGAVARGDIRLDALCVEGALLRGPNGTGRFHVLAGTGRPTI
FT                   EWVRDLAAVAEHVVAVGTCAAYGGVTAAGANPADACGLQYDGRREGGALGAAFRSRSGL
FT                   PVINIAGCPTHPNWITETLMLLSAGLLGADDLDAYRRPRFYADHLVHHGCPRNEYYEYK
FT                   ASAEKLSDLGCMMEHLGCLGTQAHADCNTRPWNGEGSCTRGGYACINCTAPEFEEPGHP
FT                   YLATPKIAGIPVGLPTDMPKAWFIALSSLAKAATPERLRRNAVSDHVVMPPTVRDIKRR
FT                   "
FT   CDS_pept        661523..662995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupV"
FT                   /locus_tag="AZC_0596"
FT                   /product="HupV protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86594"
FT                   /db_xref="GOA:A8IMR1"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMR1"
FT                   /protein_id="BAF86594.1"
FT                   /translation="MRDASAKDGTARLIVGPFNRVEGDLEVRLEVADGAVRAAFVSSPL
FT                   FRGFERILEGRDPFDALVIAPRICGICSVSQSQAAALALAQWQGLAPTANGRIATNLLV
FT                   AAENVADHLTHFHLFFMPDFARAAYADRPWFAAAEARFKAGRGTSARRLIEARATLMHV
FT                   LGLLAGRWPHTLAIQPGGVTRRAEPRDQMRLLATLGAVRATLEQTLYGAPLERISALAD
FT                   PRELEAWRALGPDGDFRLFLEIAADLDLTHLGRAYDRFLSFGAYPGEEGPHYPAGTFAD
FT                   GVLGGVDEAAIAEDHTFARMEDRAAPHHPFAGSTIPDGFDETGYTWCKAPRLAGQPFET
FT                   GALARQFMDGQPLARALVAAGGGNVFSRVIGRLIETARTLIAMEGWVRALEPAEPWCAH
FT                   GTNPSEGRGAGLTEAARGALGHWMEVRNGRIARYQIIAPTTWNFSPRDAAGVPGPLEAA
FT                   LVGAPVQEGETTPLSVQHIVRSFDPCMVCTVH"
FT   CDS_pept        663003..665294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="AZC_0597"
FT                   /product="hydrogenase maturation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86595"
FT                   /db_xref="GOA:A8IMR4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMR4"
FT                   /protein_id="BAF86595.1"
FT                   /translation="MERTGEAEEITVRGIVQGVGFRPFVWRLARRFGLAGSVSNTGDAV
FT                   RIHIRGPVEARAAFVAALVAEAPPLARVEQVTRVPAAPVEGAEFHIAESGLGTVSVGIV
FT                   PDLATCPACRSEIADPKARRFRYAFTNCTDCGPRFSIVEGLPYDRPRTTMRAFALCPDC
FT                   RREYDDPADRRFHAQPIACPTCGPRLRFGAFEGDAALAAAASALKAGAILAVKGIGGFH
FT                   IACDATSEAVVAELRRRKQRPAKPLAVMVADLAAARALAEVSALEAEALSDPSAPIVLL
FT                   RRHLDGPLAPSVAPGQSHVGLMLTYTPLHHLLLASVGGPLVMTSANRANAPQVFRDEEA
FT                   EAALAGIVDGLLTHDRPIARRLEDGVVRIAAGGVRVMRRGRGQAPRALDWPADFEGAPP
FT                   ILALGSDLKSAACLSHGRKALLTHHLGDLDTPAVEDEFARALADMADVFAHHPEAVAVD
FT                   LHPGYRATQFGTALAVERGLPLLAIPHHHAHIAATLAENGWPRLGGPVVGLALDGLGLG
FT                   DDGTLWGAEVLVCDYRESRRIARLVPIPLAGGDVASREPWRVLLAHLDTAVGEDGFPAD
FT                   LLDGKPLATVRAMIAKGLNAPLASSAGRLFDAMAALLGLAPDRLSFEGEAAMALEACAG
FT                   DIMAAPYPMAVREADGLMELDPAPLWRTALADRAAGVPAPAMAARFHAGVAAAFADLAA
FT                   WVAEGHGLSTVALSGGVFQNARLLEDVAARLSAHGLAVLLPAEVPANDGGLAFGQAAIA
FT                   AARLMASEGR"
FT   CDS_pept        665510..666592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupS"
FT                   /locus_tag="AZC_0598"
FT                   /product="Ni-Fe hydrogenase small subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86596"
FT                   /db_xref="GOA:A8IMR5"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMR5"
FT                   /protein_id="BAF86596.1"
FT                   /translation="MAGLETFYDVMRRQGITRRSFLKYCSLTAAALGLGPEMVPEIAHA
FT                   METKPRLPVLWLHGLECTCCSESFIRSAHPLVKDVVLSMISLDYDDTLMASAGHQAEAI
FT                   LDEVMEKYKGNYILAVEGNPPLNEDGMYCIIGGKPFVDQLKKVAKDAKAIISWGSCASY
FT                   GCVQAARPNPTRATPVHEVIFDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGR
FT                   PKMFYSQRIHDKCYRRPHFDAGQYVEKFDDEGARKGYCLYKVGCKGPTTYNACSTVRWN
FT                   DGVSFPIQAGHGCIGCSEDGFWDKGSWYARLTDIKGEGFGIEANADKIGFAAAGVVGGA
FT                   VAVHAAVSALKRAQHKGDAQ"
FT   CDS_pept        666589..668403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupL"
FT                   /locus_tag="AZC_0599"
FT                   /product="hydrogenase large subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86597"
FT                   /db_xref="GOA:A8IMR8"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMR8"
FT                   /protein_id="BAF86597.1"
FT                   /translation="MTIQTPNGFSLDNAGRRIVVDPVTRIEGHMRCEVNVDANNVIRNA
FT                   VSTGTMWRGLEVILKGRDPRDAWAFVERICGVCTGCHALTSVRAVEDALQIKIPNNAFL
FT                   IREIMAKVLQWHDHVVHFYHLHALDWVNPVNALKADPKATSALQQSISNHSKSSPGYFR
FT                   DVQNRLKTFVESGQLGIFKNGYWDNPAYKLPPEADLLAVTHYLEALDFQREIVKVHTIF
FT                   GGKNPHPNYMVGGVPCAINMDGDMSAGAPLNMERLNFVKLKLQEALEFSANVYVPDVIA
FT                   IASFYKDWLYGGGLSALNVMDYGDYEAIQGQKSTDRLPGGVILGGKWDEIHPIDPRDPA
FT                   QVQEFVTHSWYTYGSGNNDKGLHPWDGVTEPKYELGPAAKGTKTNIEAVDEAAKYSWIK
FT                   APRWRGNAVEVGPLARYILAYSKGVDYVKGQVDEALGRFNTLAGTNFTPKQALPTTIGR
FT                   TLARALEAHYCAVMMMDDFNHLIANIKAGDTSTANVEKWDPSTWPKEAKGVGTVAAPRG
FT                   GLGHWIKIKDGRIENYQCVVPTTWNGGPRDPKGNIGAFEASLLNTPMQRPDEPVEILRT
FT                   LHSFDPCLACSTHVLAPGGEELARVTVR"
FT   CDS_pept        668416..669141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupC"
FT                   /locus_tag="AZC_0600"
FT                   /product="HupC protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86598"
FT                   /db_xref="GOA:A8IMS0"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMS0"
FT                   /protein_id="BAF86598.1"
FT                   /translation="MSDIPLSQPKAAEAPKERRLPTVYVYEAPVRLWHWVNALCIVVLC
FT                   ITGYLIASPLPTLSGEPSAHYQMGYIRFFHFAAAYIFAVGFVGRVLWAFVGNKYSRELF
FT                   TFPFWRASFWRGLIIEVKWYAFLKPRPLKFVGHNPLAQFFMFFVMVLGGLFMIGTGFAL
FT                   YSEGAGLGSWQDRMFGWIIPLLGGSMQVHTLHHIGMWVFILFVIIHVYSVIREDIMSRQ
FT                   TMISAMTNGTRSFRDDDPE"
FT   CDS_pept        669406..670032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupD"
FT                   /locus_tag="AZC_0601"
FT                   /product="hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86599"
FT                   /db_xref="GOA:A8IMS3"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMS3"
FT                   /protein_id="BAF86599.1"
FT                   /translation="MDGEHILVLGIGNILWADEGFGVRVVEALDRAFTFPDHVTLLDGG
FT                   TQGLYLLPALEEADVVVILDAVDYGLPPGTLHCLSDGDVPAVLGARKLSLHQTGFQEVL
FT                   ALLQLRGCLPRHLRLVGVQPHTLDDYGGGLTPPVAAQVAPAVTEVLRLLTEEFDVPVRP
FT                   RDSESSEGLVTAAVARAAYEAGRPSAQDACRIGDARVLARTFGEA"
FT   CDS_pept        670037..670366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupF"
FT                   /locus_tag="AZC_0602"
FT                   /product="hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86600"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMS5"
FT                   /protein_id="BAF86600.1"
FT                   /translation="MCVGLPMRIESRSGHLAECSGPEGFARVDLALVPEAQVGDYVLVF
FT                   LGAARRLIDALEARQIADALAALSAVMSGTSDAGALDRAFADLDREPQLPPHLAAALAA
FT                   GRTEA"
FT   CDS_pept        670366..670773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupG"
FT                   /locus_tag="AZC_0603"
FT                   /product="hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86601"
FT                   /db_xref="InterPro:IPR010893"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMS7"
FT                   /protein_id="BAF86601.1"
FT                   /translation="MSLSAATAPAPLPHPLVERLVITHGYSYADALSDLDGEPRDLLLF
FT                   LPSHGKPHLETPDIAAVLPELVKSLNGTADRLSAAIAGPALELELRQQLQLALPALVVV
FT                   RAGTPIGSVARMRDWDEYLARLSAVLGAATH"
FT   CDS_pept        670783..671622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupH"
FT                   /locus_tag="AZC_0604"
FT                   /product="hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86602"
FT                   /db_xref="InterPro:IPR006894"
FT                   /db_xref="InterPro:IPR038527"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMS9"
FT                   /protein_id="BAF86602.1"
FT                   /translation="MASPFAIQPPLGFGPGSQSGDEEGLAYLPMPSGMRVYEPHLLDAD
FT                   VAGPCAAALATLAAVRDALARWQPGGHESFSLAGLDARNRALIDEALGEGEVAVRVTGV
FT                   VPLEIQEATFAGVWRVRGAESVDRIEVGAFPRGALLRAFPAEWQMDLEDIARPRPGVVN
FT                   APPILAEIAHRTSARAPGTPAHVINFSLLPHTPEDLVLIDEVLGQGHLTILSRGYGNCR
FT                   IDAAARRDVWRVRYYNSTDMLILDTLEITSLPEVAQAAPEDIADSAARLAQVLDALA"
FT   CDS_pept        671633..672538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupJ"
FT                   /locus_tag="AZC_0605"
FT                   /product="rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86603"
FT                   /db_xref="GOA:A8IMT1"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR023994"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="InterPro:IPR038530"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMT1"
FT                   /protein_id="BAF86603.1"
FT                   /translation="MTASLRFEGSYRGQAATLDPATRLECKICWHVYDPAEGCEVWQVP
FT                   PGTPFTALPDHWRCPVCDGARDQFMVLDGGAPEARPASAAAEPDVDPRLLAIARDVPGK
FT                   LEAAFREIHAGQMRGVPMVNETLSVKAVGFRVHEGRVLGMLITPWFMNLILLPGPDEDW
FT                   SHLATGAKDLVEFPSGFYEFLAAQRPEVGAYKACSLFSPMFDFSSMLQAVETAQAALVA
FT                   LFDPAHREPGVPSAEIRRRREAELAAKEAAQPKLPDLAPEGEPEAEDGAEALPQTLVPP
FT                   PERSRREMIFGRSARPAGAP"
FT   CDS_pept        672535..673476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupK"
FT                   /locus_tag="AZC_0606"
FT                   /product="hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86604"
FT                   /db_xref="GOA:A8IMT4"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMT4"
FT                   /protein_id="BAF86604.1"
FT                   /translation="MSPLAASAVLAHRRGFSAPAFTDAGRWLAGRPVEEAARLIPRVFN
FT                   LCAAAHGAASAQALHLPATDAEASIRQETLRDHALALFHQAPEALDLPGERDALGLLAN
FT                   PDGGAELARRVSGDVDLAGLSLSDFDLWLARGETLPARLLRQVRQHIDPAWGRVGLPPL
FT                   TLSDLDAAVADAPRDLPARDATVLTRVRQAPLLVALLAAEGGSLLARLLARVLDLLAVL
FT                   KGGPASCGRTAAGHGFAAAARGLLAHGARVEAGRIAFYRIVPPSAWTLAPGGLLERMLA
FT                   ALPSRAETPMLGRLALLAVNPCVPVKLEGLGG"
FT   CDS_pept        673479..673820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA"
FT                   /locus_tag="AZC_0607"
FT                   /product="hydrogenase expression/synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86605"
FT                   /db_xref="GOA:A8IMT6"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IMT6"
FT                   /protein_id="BAF86605.1"
FT                   /translation="MHEMAICESLRVSMEEAARAQDFSRVTRVRLAIGAFAGVEVEALR
FT                   FGFDVVMQGSLAEGAELVVLEEEGTAWCFDCNRTVPLATRLDPCPCCGGERLVPNGGTG
FT                   MTIKDLEVV"
FT   CDS_pept        673820..674770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB"
FT                   /locus_tag="AZC_0608"
FT                   /product="hydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86606"
FT                   /db_xref="GOA:A8IMT9"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMT9"
FT                   /protein_id="BAF86606.1"
FT                   /translation="MCVTCGCGPDAVTISGPNGEAHHDPAHGHDHSHGHDHGHSHAHGD
FT                   HGHGHHHHDDHHHGHDEPQPVRSHAPGLEARRLVEIEQNILAKNDGFADTNRARLSTLG
FT                   VFALNLLAGPGAGKTTLLVETLKALKDKIPAAVIEGDQQTSNDAERIRAVGAPAVQINT
FT                   GKGCHLDAHMVGHALERLPLEAGGVLFIENVGNLVCPAAFDLGEDKRVTLLSVTEGEDK
FT                   PLKYPDIFEGAHLVLLTKADLVPHLEVDVDLIIANVRRINPHAKVLTLSSRSGDGMRAW
FT                   LSWLEDVRAEKLEALAEAAAARAAALRGAARRAAE"
FT   CDS_pept        674775..676241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxA"
FT                   /locus_tag="AZC_0609"
FT                   /product="HoxA protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86607"
FT                   /db_xref="GOA:A8IMU2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMU2"
FT                   /protein_id="BAF86607.1"
FT                   /translation="MTALASRPALLVVDDEPRSVEVMARVLGEEFDVFTAASAAEARAV
FT                   LEQEWVQAIFCDQRMPELSGVAFLTEVRERWPEIVRIIVTGYTEPEDMIGAINGAGIYQ
FT                   YVTKPWHPDQLLLVARNAAQLFALQRDHHRLSLELKLVAPVAQARVVSQREKVVRNFSF
FT                   DTLIRTPQSPLNETCQRAAQAAVFDIPVLIQGETGTGKELLARAIHYSSLRSDCAFHAV
FT                   NCGAIPDELLESELFGHKKGAFTGAHVTRVGLLDQADGGTILLDEIGDVSPAFQVKLLR
FT                   FLQEGEIRPVGSNDAKRVNVRVLAATHRDLVQAVSAGKFREDLYYRLSAMVLAMPALRE
FT                   RKQDLRVLAAAILDSLCNQHGKAVKGFTEEALACIEAYDWPGNVRELQNEVLRMLVLAP
FT                   GPELGADLLSPHVVRAAAADPMLAAITLPDSGPLKDRIERMEASILHETLVRCRWNKSR
FT                   AAEELGLSRVGLRAKLDRYGIARDRTFARH"
FT   CDS_pept        676251..676550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypC"
FT                   /locus_tag="AZC_0610"
FT                   /product="hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86608"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMU4"
FT                   /protein_id="BAF86608.1"
FT                   /translation="MCLGIPGRIVAIADEDAMLAVVDVSGVRRTVDVVCVAQEGEPLEA
FT                   LIGVWVLVHVGFAMSRIDEEEAAATLKVLAEIGEMEGELDAMRTGSVAPLAPAN"
FT   CDS_pept        676563..677684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD"
FT                   /locus_tag="AZC_0611"
FT                   /product="hydrogenase formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86609"
FT                   /db_xref="GOA:A8IMU6"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:A8IMU6"
FT                   /protein_id="BAF86609.1"
FT                   /translation="MRFVDEFRDPALAAALIREIGTICATLGRAKDDPVTVMEVCGGHT
FT                   HAIFRYGLEGLLPDLIEFVHGPGCPVCVLPMGRVDDCVAIAERPEVIFATFGDAMRVPG
FT                   SRKSLLQAKADGADVRMVYSPLDALELARRNPDREVVFFGLGFETTMPSTALTVQRAAR
FT                   ERITNFSLFCNHITIIPTLRALLEQPDFGIDGFIGPGHVSMVIGTAPYRFIAEEFRKPL
FT                   VVAGFEPIDLLQSLLMILRQMAAGEARIENQYARVVPERGNPSALRAVEEVYEPRPTFE
FT                   WRGLGSIERSGVRLREPYAAFDAERRFAVPDVKVADPAACRCGEVLTGAVKPWACPVFG
FT                   TTCTPEMPLGALMVSSEGACAAYYQYGGLRGAA"
FT   CDS_pept        677681..678748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="AZC_0612"
FT                   /product="hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86610"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPE7"
FT                   /protein_id="BAF86610.1"
FT                   /translation="MNGPFSLPRRAPRKVTQPKVTLAHGGGGTAMRDLIEDVFLETFSG
FT                   AGHAAPEDQARFDLSALAAQGDRLAFTTDAFVVDPLFFPGGDIGKLAVCGTINDLAVGG
FT                   ARPVALSCAVIIEEGLPLETLRAVVASMARTAAEAGVVIVTGDTKVVARGACDKLFLTT
FT                   TGIGVVRTGLDVGIAKGRPGDVVLVNGLLGDHGAAILNARGDLALETPIESDCAPLHDL
FT                   VATLIAAAPGIRMMRDATRGGVAAVLNELAEASGVGVRIRETDVPLRPEVNGFCEILGL
FT                   DPLYLANEGKLVAVVPPEEAEAALAAVRAHLLGREAAIIGRLAAERPGRVVMETRFGGE
FT                   RIVDMLVGDQLPRIC"
FT   CDS_pept        678814..679416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupE"
FT                   /locus_tag="AZC_0613"
FT                   /product="hydrogenase/urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86611"
FT                   /db_xref="GOA:A8IPE9"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPE9"
FT                   /protein_id="BAF86611.1"
FT                   /translation="MTRLPLRTLGLAGALMLAPSLAFAHTGVGDAHGFMHGFMHPIGGL
FT                   DHVLAMVAVGMLAWQIGGRAVYMLPLTFMVLMAGGGVAGMMGMTLPYVELGIALSVVVL
FT                   GAAVALGVKAPLAVSMVLVGLFAIFHGHAHGAEMPETASGFAYGAGFILATGLLHLAGI
FT                   GVGFGIGRLAERHGPALMRGAGAAVSVAGLGLVLGAL"
FT   rRNA            680516..681983
FT                   /locus_tag="AZC_16r01"
FT                   /product="16S rRNA"
FT   tRNA            682210..682286
FT                   /gene="trnI"
FT                   /locus_tag="AZC_trnI04"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:682244..682246,aa:Ile,seq:gat)"
FT                   /note="codon recognized: ATC"
FT   tRNA            682344..682419
FT                   /gene="trnA"
FT                   /locus_tag="AZC_trnA05"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:682377..682379,aa:Ala,seq:tgc)"
FT                   /note="codon recognized: GCA"
FT   rRNA            682826..685615
FT                   /locus_tag="AZC_23r01"
FT                   /product="23S rRNA"
FT   rRNA            685690..685809
FT                   /locus_tag="AZC_5r01"
FT                   /product="5S rRNA"
FT   CDS_pept        686185..686706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0614"
FT                   /product="uncharacterized protein"
FT                   /note="conserved in bacteria, COG3915"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86612"
FT                   /db_xref="GOA:A8IPF2"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPF2"
FT                   /protein_id="BAF86612.1"
FT                   /translation="MQAATIGFRWAVFALLLMVAAQAPALATGARLYLSVSFVTVSGLP
FT                   LSDHAFDLDQLDLLPQDRIITATPWTHGPQSFTGPPLATLAGLEANRGRRVRAVRVSSW
FT                   ADWTVTIPASDWERLNVILATRLNGQTMRVRDKGPYWIMYPIGDTRDVDTQMYQARMMW
FT                   QVKSLEFVVE"
FT   CDS_pept        686732..688432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0615"
FT                   /product="sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86613"
FT                   /db_xref="GOA:A8IPF4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPF4"
FT                   /protein_id="BAF86613.1"
FT                   /translation="MPAALIVTTLGLFLATGMLYVTQTQHRALLSATVRSSGWVAYQAQ
FT                   LEFVKTQGQFEIAMLRPSRRALDELQFRLELLRSRLPLLYDSDEGRLLQEVAAQKDVLQ
FT                   AFERTLDATIDSLPDTSPSAPETVARLRGAYYELEPLGRVLQKVLMQSIAYNEEIFRRE
FT                   REVAASPAIVPFALLFVSGTCLVAILFMDGRRDRQRLADVTAAKAEVTAVQDNLRAIIE
FT                   AMPIGTIIVDPDGDQVRFINPSAAALVDPSPDHPEWRRLIRAAFEAAIDENGRKTGTLS
FT                   MAFAKPLGDIVSLRGAVCGVIWEGRPQILILLTDTSRVRNAELQLMQAAKLATLGEMAT
FT                   AIAHELNQPLAVIKMAVANARRLVLSEADPEAITSKLDRIGAQVDRAKRITDQVRRYAR
FT                   MPGDQTASFVLRQAVELAAGFVAEQYRAAGIRMVLDLEVSPELLVSGDQTMFEQVIVNL
FT                   LINSRDAYDSQRQDTHQPQVVVRAVVRGGEVVIEVTDDAGGIRNDILGNIFDPFCTTKS
FT                   AEKGTGLGLSMARNVVRDMNGTIAAENVEGGARFTIVLPAARTQAQDVA"
FT   CDS_pept        688432..688803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0616"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86614"
FT                   /db_xref="GOA:A8IPF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPF7"
FT                   /protein_id="BAF86614.1"
FT                   /translation="MPGYSILICDDEQELAEELGEFFSSLGWNVRVCLTAPAARAALHD
FT                   GFVPNCLLTDLRIADHDGAELVSHVRGLPKELQPKVVAIITGHVVSETEAADFKADFLF
FT                   VKPVDPVVVMEGIERLLAG"
FT   CDS_pept        688834..690054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0617"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86615"
FT                   /db_xref="GOA:A8IPG0"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPG0"
FT                   /protein_id="BAF86615.1"
FT                   /translation="MPRAQAVLVLDDEPELREDLAELLVGAGFSAEGRGDARSLTDAEF
FT                   GAFDVVILDLAMPGTDGLSVLGRLAHVPQAPRIIFISGHGEDVLQTAAAVARREHLQVA
FT                   GVLRKPFTAEDVLRLLGQSWVPLDSGASIAWSDADIRSALAEAIDERALSVAFQPKVTA
FT                   KGLIFAGAEALLTGDLPRLGYVSPEIIVRAATREPELIGAMSLEVLRCSAAACRAWIDA
FT                   GWDVPVSVNLPFEVLCLPDISERLLSPIHEEGLMPRHVIFELTEDAIYDSSSDVLAILA
FT                   RLRLAGFGLSLDDVGRRQSGLLQLANLPITEVKIDLQLLAQARTWSKSRSVFVSVAELG
FT                   HRLGLTVVAEGVETRDDLVLVRSLPVDYVQGYLVSRKQHLPDLLAMLAASSSRGAPFAP
FT                   DHVVPIS"
FT   CDS_pept        690051..690839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marR"
FT                   /locus_tag="AZC_0618"
FT                   /product="regulatory protein"
FT                   /note="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86616"
FT                   /db_xref="GOA:A8IPG2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPG2"
FT                   /protein_id="BAF86616.1"
FT                   /translation="MSTENSVPRVLLVDDDPDVLAELSEGLDALGLPSLTAETAVEALD
FT                   IVQRHDDLQVIVTDLQMPRIDGIELLQKLAVRRRTKPMAAIVITGHASLDRAVGALRLH
FT                   AVDFLQKPLSAEEVAHAIHRAFSLVEDETAAANGNPTTLVQPTARPNYLKALVAARADR
FT                   DAIFQAGLFSDPAWDMLLDLAVAEATNRPISVTSLCIASGVPTTTALRRIDDLKDAGLL
FT                   DRIPDPGDRRRILVKLTAMGRERMEAFVQKQAGRLGLKLD"
FT   CDS_pept        complement(691070..691738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0619"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86617"
FT                   /db_xref="GOA:A8IPG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPG5"
FT                   /protein_id="BAF86617.1"
FT                   /translation="MYVVVDQRATVTDGYVSSFSREGFSSLGLGCNEFKEWLNTASDQD
FT                   IGAVQGFLLGEFDNRPAFPEMIRTHSRAPIIALEDVRSLQQTLELFTAGIDDVVRKPVH
FT                   VREIVARSDAVWRRVNSAAGPATNGRLRVFFDGRDPEVDGVPLPLPRRERHILEYLVKN
FT                   SRRRVTKTQIFNTIYGIFNDDVDESVIEGHMSKLRKKLRMKLGEDVIDAKRYIGYQFIG
FT                   "
FT   CDS_pept        complement(692651..693034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="AZC_0620"
FT                   /product="CheY-like response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86618"
FT                   /db_xref="GOA:A8IPG8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPG8"
FT                   /protein_id="BAF86618.1"
FT                   /translation="MAVDLTMPVLVVDDYKTMVRIIRNLLKQIGFEDVDEASDGTEALA
FT                   KLKERKYGLVISDWNMEPMTGYELLKRVRDDADLSDIPFIMVTAEAKSENVIAAKKAGV
FT                   SNYIVKPFNAQTLKGKIDTVFEA"
FT   CDS_pept        693226..693936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3143, CheZ, chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86619"
FT                   /db_xref="GOA:A8IPH1"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPH1"
FT                   /protein_id="BAF86619.1"
FT                   /translation="MSVSRRPFRIEASDRMTSIVEPAGSGPIANGLDGQLDRILNELEA
FT                   VRTEISKFKERDPSVDRERDRNALWAGIETIQDAIRSTKREIATLHSEGTRGENLFTAT
FT                   DELDHVVQDTEDATEVILSAAETIDNSIATLAARLSGEDLTMAEEMQAQIVRIFEACNF
FT                   QDITGQRIRKVVKLMVFIEERVTRMTDIWGGADMVAQNSGIAQREGDEKLLNGPALATD
FT                   ENVVSQDDIDSLFA"
FT   CDS_pept        complement(694129..694668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0622"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86620"
FT                   /db_xref="GOA:A8IPH4"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPH4"
FT                   /protein_id="BAF86620.1"
FT                   /translation="MQPDACEKELVRAAAKYKIPLPILYAVGLTETGVNGKMHPFTLYI
FT                   EGKDYQPKTLTEALARFKEANDRGVKLIDIGCMQANFYWHRAEFKSLEAMFDPRENVEQ
FT                   AARFLSELKQRHGSWTMAAARYNAGPNNNVAQHRYVCRVMKNLVAVGVGAWTPSAKAFC
FT                   DAPPPSPQQAQVQQPD"
FT   CDS_pept        complement(694697..696616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motD"
FT                   /locus_tag="AZC_0623"
FT                   /product="putative MotD chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86621"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPH7"
FT                   /protein_id="BAF86621.1"
FT                   /translation="MSALNISRALPSAVTSDVSAGKVQEMGGDEGGNGFADVFRDLGRA
FT                   SRDGGESLSGAKSDKAGEEQAGRNGKAADQNAKPDKAFSLADALATAASKRSAETAFSN
FT                   ASISSTPDGATTAQASTLLAMFDGATPGQDGADASSSDVATPKDDQGKGKSQTEMERAA
FT                   RGRRLANDGLNRLLFGSQDGINGLSPATKPAVLSDDEIRSANADQPLLISEADDTQGAT
FT                   DANASATPALSDPAAVVLQGLAQLTDMVPRTTEDGQTDGRDAAPTAVVAPNTGDQDGGT
FT                   GQGRTLSVSVLSRETHFAPIRTLAMNGGSAPTDAAATSAAAAPLGTDTTVAKPETRAAA
FT                   GLRGLRPERLAVQDTPGAAPLSGKTVIADAGEDATTTGSTQATVADAARTGTRQDSRSG
FT                   NSGKDDRNQPDTQRLTETTAEAARSDVKQGQTSNVSEAAHGTAETAPLTGTAGIAPTNA
FT                   IATPNLPALQQIGAAIAAEATSMDQGAGIASADSSTAQVLAGPVRILQIQLKPDELGTV
FT                   NVRMRLSGGTLEIQLRASNPETARMLERDRDALTDLLKASGISADTISIVGIDGGTSQI
FT                   TGRDAGRPFEGDGAQTQPEARDSRDGLDQDNRGSGNDDSQKGGRDDEARNRSRSADAGF
FT                   DFRV"
FT   CDS_pept        complement(696613..699231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motC"
FT                   /locus_tag="AZC_0624"
FT                   /product="hypothetical MotC chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86622"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPH9"
FT                   /protein_id="BAF86622.1"
FT                   /translation="MRLGSVSHLALGLALLLAAPQAHAEDFNLFKLLAPKPANTQAPGD
FT                   AAVDGTDGGASAEAPAPLPQRRPASAEAVPAADAAGKSIAALPAPQSTQAQPALAQLPV
FT                   PLPPRRPHIEEASALLLLQVAPKTAQVTHPAPAAPAMTQVAAPTAAPVRQTAPAAPQRV
FT                   ADTFIVPAAPAIAPVPGPRSEDGPVAGLDPRPVRVVAIKPEVKTAGAAPQKPAPKTNAK
FT                   TAAADKAKAAAPTAAHTAPQAPAPAPAVVAQAPKAAPEPELLADPMPEVVVGPRDIPVK
FT                   DAVQAVVLAQTPPESAVPRITPVAVAAAAPAARPRTEDGLPPQLPPDPSVVAEAMLQRI
FT                   PTVTSALAGIVSAVGPTPAQAAGQKEIPQPPADTSNSPPPPDQAIPVERSTGPLPYEQV
FT                   RRLQRLQDRIATGDTAALQAQRALIAEIEDAFHKADPKVWQDPRNARAAVVFFLSGGSP
FT                   KELRNLLSLKPAPAIDERLLQGALAYVEGRPEDAERYLANINPLQLPDALGGQIAMVQA
FT                   AVTVGKDPRKAMAQLDIARLVMPGTLVEEAALRREILVAAQLGELNKFEHLSKQYLYRF
FT                   RHSVYAGNFRQRFAAALTRMAFVNDRDQFQRLVSLLQPLDRDSRVDIYLMVARGALNQG
FT                   KFTAASLASERVLVDADPVSTDAERARVYKAAVNAASSKEVDAAVVELKSIIRSRLPPD
FT                   DVMLLNAALTTAELVRSAGETVKQAAVKPQVKVDPMQVTHTAGTALLPKWTANETVPVA
FT                   QPATAQRSDATSAQAQIAAQVQAAAQSRGVAPGQPPAGGPPPAAPGAVPPPPPPAGQAA
FT                   RPAPQAPAAQTAQAGQPAAAPAPEAKQPSLFDEGSPAGALVSRAQGTLDKVDAMLKESP
FT                   L"
FT   CDS_pept        complement(699231..700649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="AZC_0625"
FT                   /product="flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86623"
FT                   /db_xref="GOA:A8IPI2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPI2"
FT                   /protein_id="BAF86623.1"
FT                   /translation="MADKGEHHELIIIKRHEDEEHEHHSSAWKVAHADFMTAMMAFFLI
FT                   MWLINVTDKDVRKAIASYFNPVHLAESMTERKGLNEPEDIKPDGTSADGDQKSALKETA
FT                   GAGTGPGSDTQRGKQDRAAFQDPYAVLSKLAGEADPSEMSTPDAAVGETGQPGNSAGDA
FT                   VRDPFDPVYWQMNQARKMRTEKPGPQSLNAPTASRPDAAVSARGGGDFATDGDVFSPQP
FT                   QDAAEAQASAQQANAQATAVGGNGAPAAAPKADPSKLDATKAAPSAGKGDMAQGELAKG
FT                   DAANGAQAKGAAAKGDQAKGEQAKGDANAGAATFKIDQANADKLKTEAVAAVQSNLGSV
FT                   AAPKVDVRVTKEGIVLSLTDDINYSMFPVGSAVPDGRLVRAMAKIGEALGKRPGEVVIR
FT                   GYTDGRPYRSDTYDNWRLSTARAHMTYYMLVRGGLQEPRVAMIEGYADRNLKNKAEPYA
FT                   AENRRIEILLRVPN"
FT   CDS_pept        complement(700658..701374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86624"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPI6"
FT                   /protein_id="BAF86624.1"
FT                   /translation="MSAKVLRHHLPLFSGTDAPLPAELAEARKPGVPSRNIKPLFEAKP
FT                   VAATKAGPVPLTAKAAAPVQPKKEPAPDPAAILAAAVKAAREEARAEAQKEFEAERARE
FT                   AEAFEAHLQLVRQQWIIETGNTLAEGLKGAMAEMEERLATAVGRILVPFVQDGVRVQAL
FT                   ERLTAEVSRLLSTPGVPVIRVSGPQDMLDALKARCGEAGMEYEVKDEVDVRVTADDTII
FT                   ETQLRAWSAHLTEALA"
FT   CDS_pept        complement(701371..703050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="AZC_0627"
FT                   /product="flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86625"
FT                   /db_xref="GOA:A8IPI8"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPI8"
FT                   /protein_id="BAF86625.1"
FT                   /translation="MNAREQLERLLSNLRQLGARRLVALGLIAFTVMAVIGLGAMYLSQ
FT                   PERETLYANLSRDDVTRIGGALKDAGIPFDVSSDGATVLVAHSDTARARMLLAVKGLPQ
FT                   SSSSGYELFNDVRSFGLTSFMQEVTKVRALEGEIARTIQTMKGIKAARVHIVLPDRGSF
FT                   RRDQQLATASVVIRTENSADSSTAQAIRHLVAAAIPGMKLDNVTVLNTEGTILTSTEDG
FT                   VTAAATRKSALQQQVNRETEEKIRRTLTPFLGLGNFEVSVSSRLNTDRSTINETTYDPA
FT                   SKAERSTRVVKEQGQTQNRSQQPNTTVQQNIPPPPGTPGTGTENNENNQRREELTNFEI
FT                   STRQSQTVRDAYSVENLSIAVLVNKERLTGTKDGTPLETQTYEIEQLVSSAAGFDKERG
FT                   DKLKVVAVPFADGGNNMEPIPPLTWSELLFRQAGTIVNAVTILVVAILLIWFGLRPALR
FT                   AILARPEPDEAEAIEAAMLAAPTELPPDTVLPSTAQNPNTLDGVTTLAGFTGGDSGPVN
FT                   LIGDVTSKVNRSPQRRLEQMIEYDEEQAAAILRQWLHQEAKA"
FT   CDS_pept        complement(703520..704398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="AZC_0628"
FT                   /product="flagellar biosynthetic FliP protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86626"
FT                   /db_xref="GOA:A8IPJ1"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPJ1"
FT                   /protein_id="BAF86626.1"
FT                   /translation="MSRPAPKGHRNVWSLIRPCLLALLGLLFSAGLAYAQNRVQGDTQI
FT                   PSLDSLLGDNGGAVSGRIIQMVMVLTVLSIAPGLLIMVTSFTRFVIALSFLRSGLGLSS
FT                   TPANLVLISLSLFMTFYVMGPTFDKAWTEGVRPLTERKITEEEAFTKISEPFREFMLSQ
FT                   VRPKDLRLFADIAAATGRPSKNDPETAAQNNSAPATSPNRDQNAQPERQIELRILIPAF
FT                   MISELRRGFEIGFLIILPFLIIDMIVATLVMSMGMMMMSPAALALPFKILFFVLIDGWN
FT                   ILVSGLVRSFF"
FT   CDS_pept        complement(704395..704925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="AZC_0629"
FT                   /product="flagellar basal body-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86627"
FT                   /db_xref="GOA:A8IPJ2"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPJ2"
FT                   /protein_id="BAF86627.1"
FT                   /translation="MAASDDKAKSATVAAATGAGGKEQNGTKGLILAILILTVLGVATG
FT                   GGLGVQLATTVEKVVAAKAKEEPVKKEQQLFYAGNTMMQPMKPVIVNLASPPNTWVRIE
FT                   SSFVFKNGALANPALTESTLREDMMSYLRTLTLSQFEGPSALQQLREDLNERARVRSEG
FT                   RVDELIIETLVVQ"
FT   CDS_pept        complement(704944..705663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0630"
FT                   /product="flagellar L-ring protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86628"
FT                   /db_xref="GOA:A8IPJ4"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IPJ4"
FT                   /protein_id="BAF86628.1"
FT                   /translation="MKPVILATASALLLAACQTNSYDSLAYGPTLTPVGQGLEAGRMPV
FT                   PQPFQQAKERTFRSAYNLNSQSMYRALRAAAVGDVIRITIDIDDKAQLDNNTNRSRKSA
FT                   SDVGFASALNLSGFQSGSTSGSASGNLGLTGDTSTDGKGKIDRSEKLRLSLAAVVTEVM
FT                   PNGNLVINGSQEILVNYEVRVLTLGGIVNPLDVTSNNTVAYDKVAEARISYAGRGRLND
FT                   VQQPAWGQRLFDAVNPM"
FT   CDS_pept        complement(705663..706406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0631"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86629"
FT                   /db_xref="GOA:A8IPJ5"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPJ5"
FT                   /protein_id="BAF86629.1"
FT                   /translation="MRQCIFRVSPSQGGSVMFAQTTLWQLLIPYLLGVASGAIVIGAVG
FT                   ASRIARLSHENARLRAGLSHAVTQVVAAPVRAGRRWAALALAVVAALSIAPAVQAQQQT
FT                   AAAGDARDDNALAYCRNIANSASDARFARQAAALAAMEKEIDSRIAALEAKRAEYQDWL
FT                   QRREAFLKKADEALISVISQMRPDAAAAQISVMQDEAAAAILAKLNPRSASAILNEMEP
FT                   ARAATLTNTMVGISRRAQAQAEGRS"
FT   CDS_pept        complement(706706..707806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0632"
FT                   /product="flagellar P-ring protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86630"
FT                   /db_xref="GOA:A8IPJ6"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPJ6"
FT                   /protein_id="BAF86630.1"
FT                   /translation="MISRFLIAALVVLLAGPALALTRIKDISSVQGVRDNQLIGYGLVM
FT                   GLQGTGDTLRNSPFTEQALQAMLDRMGINVVGSPLRARNTAAVMVTANLPAFAAIGSRV
FT                   DVTVSSIGDATSLKGGTLLITQLNNTDGLTYAVAQGQLAVSGFSVQGQAETLTQGVPTS
FT                   GRIPNGALVERQIPGQLRDLNEYLIDLTNPDFKTASLMADAINAYTQARYGRPLARERD
FT                   LRTVVVQRPPQANPARFLAEIGELGIEVDTPAKVVVDQRTGTVVIGRNVQVSTVAVTQG
FT                   SVTVRVTETPVVSQPNPFASGSTVVVPRTDIQADEAGGHLAVVRGTDLQTLVRGLNRLG
FT                   LKPSDIIAILQAIKTSGALQAELVVQ"
FT   CDS_pept        complement(707803..708375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="AZC_0633"
FT                   /product="flagellar basal-body P-ring formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86631"
FT                   /db_xref="GOA:A8IPJ7"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPJ7"
FT                   /protein_id="BAF86631.1"
FT                   /translation="MRTILAALAVLAGLATMPAAAQSTSGLSISSRVAAAEAAEAAARS
FT                   KAPAPSAQAPAIPEPASIVLPVPAVAIYPGDTISDSMLVDRAYSVSPSDRVAVATSRQA
FT                   LIGKVARRGLQAGTPIPVNAYADPQVVSRGHLAPVVLQEGGLTISGFAMAMEDGSVGKI
FT                   VRLKNLDSGLIIAGTVQSDGSVRVSGQ"
FT   CDS_pept        complement(708417..709205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="AZC_0634"
FT                   /product="flagellar basal-body rod FlgG protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86632"
FT                   /db_xref="GOA:A8IPJ9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPJ9"
FT                   /protein_id="BAF86632.1"
FT                   /translation="MRALAIAATGMNAQQTNVEVIANNIANINTTGFKRARAEFSDLLY
FT                   QSERTQGIPNRDGGQAIPEGAMLGLGVRTVGIRNLHTQGPLTQTGNTLDLAVNGRGMFE
FT                   ITTPDGQTVYTRAGSFNRSATGQLVTSDGYVINPAIQFPNNATEIQVNESGQVYATIPN
FT                   QTNPQLLGQLTLVNFANESGMEPLGNNLYRETLASGQPIVGVAGDVGFGKIQQGYLEAS
FT                   NVDPVKEITELIAAQRSYEMNSKVIQAADEMSKTVSTGIR"
FT   CDS_pept        complement(709218..709547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE 2"
FT                   /locus_tag="AZC_0635"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86633"
FT                   /db_xref="GOA:A8IPK0"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPK0"
FT                   /protein_id="BAF86633.1"
FT                   /translation="MIETVSALSSSLRTPTSISSTKMETTETKLTALNGQQGADFGDVL
FT                   ASVTTDAMKTVRQGEAAGIAAIQGKASIQQVVEAVMSAEQTLQTAIAVRDKVVAAYQEV
FT                   SRMAI"
FT   CDS_pept        complement(709544..709966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="AZC_0636"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86634"
FT                   /db_xref="GOA:A8IPK1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPK1"
FT                   /protein_id="BAF86634.1"
FT                   /translation="MIDPLKVAGQIAGSGLQVQAQRMRVVSENLANMRSTGSTPGADPY
FT                   TRKTIQFQAELDRTLGASNVKVKSLGVDQAPFLTEYDPGNPAADESGMVKLPNVNMLTE
FT                   MADMREANRSYEANLQMIKQTRSMVAMTVDLLRTQS"
FT   CDS_pept        complement(709966..710475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="AZC_0637"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86635"
FT                   /db_xref="GOA:A8IPK3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPK3"
FT                   /protein_id="BAF86635.1"
FT                   /translation="MSRHERRPLGSFPPVGPVPDPSASPVQGFTPRVGPETIREDPLDP
FT                   LYLFDLASRQARWASVRQATITGNIANANTPGYQAREVEPFSAVMNKTRLSMATTEPGH
FT                   MGVPFAGAETSKTKESDSWEVTASGNSVNLDQEMLKAADVNRTYTLNTNIVRAFNRMIL
FT                   TSVRSS"
FT   CDS_pept        complement(710555..710986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0638"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86636"
FT                   /db_xref="GOA:A8IPK4"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPK4"
FT                   /protein_id="BAF86636.1"
FT                   /translation="MVNRATVGEQRLMVYERALAECLRHFLGELFYTNAGVIIGYIHGR
FT                   QDQNIDDIVASSAELSLRPGLLHYTHHANIVEEWGAPPVVTLEMELQHIDLTAYFRIEF
FT                   DGKGIGITIEGIVFTEPVASIEDSFLRFQHALDECRLPA"
FT   CDS_pept        complement(710991..712070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0639"
FT                   /product="flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86637"
FT                   /db_xref="GOA:A8IPK5"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPK5"
FT                   /protein_id="BAF86637.1"
FT                   /translation="MSDDTDKESKTEEATERKVSDALEKGNVPYSRETALFASLLGILG
FT                   VLTFFVVNPVRILTVELTHFLDNPAGFTLAGSDDAIALAWGVLLLMGQVLLPAVLLLAA
FT                   AGLAASLFQNTPRLVLNRIQPQFSRIDPMKGWTRIFSRDGGIEFGKSAFKLVVVAVICG
FT                   VLLMSERDKVMNAMYSDPLLMPSVILSLATRLISAVCVATIVLVALDLVWSRFHWRAEL
FT                   RMTKQEVKEEMKQQEGDPMVKARMRSLAQQRARQRMMSSVPKATLVVANPTHYAIALYY
FT                   DRQKGGAPQVVAKGTDLIALKIREIAERCSIPVIEDKPLARAMYDAVEVDQWIPPEFYK
FT                   PVAKILYFIYSRGTNAAKQ"
FT   CDS_pept        complement(712086..713111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="AZC_0640"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86638"
FT                   /db_xref="GOA:A8IPK6"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPK6"
FT                   /protein_id="BAF86638.1"
FT                   /translation="MAPQPLTGKSRPLHGTDKVAALLMTMGTPIANRILKHFEPDEIKL
FT                   VTRAIAELRPMPTAVVESLIEEFASSFVAGANLVGTAQDVERLLTGVLPPEQIAEIMNE
FT                   LLGAANHSIWDRISTVSENILATYIMKEHPQTAALILSKVRPSCAAKVMSHIPADKRNS
FT                   LMRRMLTFKPIVDATMQVIEKTIHEDFMMNFSRNAGADPHARMADIINKMEREDMEMVL
FT                   SSLAATRPKSAEILKGLLFTFEDIVKLTPKARTSLFDQVPNDKLILALKGTDVEFREII
FT                   LQSLGSRVRRMVEQELGNGEPSAQKEVAEARRTITDMALDMAGRGEIEINTGNDDEAYV
FT                   R"
FT   CDS_pept        complement(713122..713484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="AZC_0641"
FT                   /product="FliN protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86639"
FT                   /db_xref="GOA:A8IPK7"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPK7"
FT                   /protein_id="BAF86639.1"
FT                   /translation="MAPPDDFDKDTAQDEALFSKALKDNGKEETIGTGQGLESVMRIPV
FT                   LLQVVLGSASMPVANLMKLGRGAIVPLDHRVGEPVDVVVNGRIIARGEVMVVEEDNSRF
FT                   GVTLTEIVGPGGADHN"
FT   CDS_pept        complement(713597..713920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86640"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPK9"
FT                   /protein_id="BAF86640.1"
FT                   /translation="MVLLVALVMTTACVVLVYRKLKELEAHQAHYERVLAESSAALISA
FT                   HQAVCALNTDGRELLFSLGDKIEQAHEAIADLERNSLALRRARTEQAGMDKHANGQMLA
FT                   RGA"
FT   CDS_pept        complement(713922..714851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="AZC_0643"
FT                   /product="flagellar motor switch protein"
FT                   /note="surface presentation of antigens (SPOA) protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86641"
FT                   /db_xref="GOA:A8IPL0"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPL0"
FT                   /protein_id="BAF86641.1"
FT                   /translation="MNAAHSHQDIRDMLLDAAGLSIDRMPMLHVIFDRLGTLCAEGLRQ
FT                   LAASQAFYSLSSIETGRIGDVLEMYEGMAVAGVFHVPMWDSHIIVGFDRDFVFTMIEAL
FT                   FGADGSEPPVDDERSFSNIELRISQAIFEQMQKALHNAFTMVSDTQFKFERQETRMDFA
FT                   VIGRRNNLAVTAKFLLQALNRGGEMFVIIPQSALTPMRQALARTTPAETSGRDPIWTKQ
FT                   IRDEVNRTQVKVRAILEERHYPLGEIADFKVGQVLHLQATPRTLVKLESADQPLFWCHL
FT                   GQAEGAYVLRVEEQINLNQEFVDDILPR"
FT   CDS_pept        complement(714856..715746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="AZC_0644"
FT                   /product="flagellar motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86642"
FT                   /db_xref="GOA:A8IPL1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPL1"
FT                   /protein_id="BAF86642.1"
FT                   /translation="MMVLLGIVLGLGATFGGFMAMGGHLDVVWQPFEYVIIGGIAFSTF
FT                   LIANPMSVIKDTGSGIMHAMSGVAPKRKDFLALLGLLYALMREVRAKPRNEVEAHIDDP
FT                   ANSGLFAHFPTILKDKELTQYICDYARLIIIGNAKSHEIEGLMEQEISTIKKHKTKPAA
FT                   ALGTVAEALPALGICAAVLGIVKAMGAIDQSPEILGHYIGSALIGTFVGIYSSYAIISP
FT                   LAHKIKVTREKQCQPFIIVKQTLIAFMNGALPQIALEHGRKTIAEGERPTIDEVESEAI
FT                   SNVPSSNSPPQQQAA"
FT   CDS_pept        715982..716704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0645"
FT                   /product="flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86643"
FT                   /db_xref="GOA:A8IPL3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPL3"
FT                   /protein_id="BAF86643.1"
FT                   /translation="MSNGLYVALSGQMATEKRMATIANNVANMNTPGYRAEEIKFSSIM
FT                   AEQGAKDIKFASTGESYTSRRAGPITYTNSPYDVAVQGKGWFSVKTPDGVAYTRDGRFN
FT                   VTADGMLVSVNNYPVLDQGGTAVMIQPNQGELKITADGTIIQGTNPVGTLGLFEIPLDA
FT                   KLKRYDNSAVIPDKAATPVTDYNSNAIRQGYVEGSNVDPVMEMTRLIMVQRAFESAAQA
FT                   ISQQETSGTDSIRALGPQ"
FT   CDS_pept        716766..718088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="AZC_0646"
FT                   /product="flagellum-specific ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86644"
FT                   /db_xref="GOA:A8IPL4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPL4"
FT                   /protein_id="BAF86644.1"
FT                   /translation="MNALVRLQAAVESAMEDVPPLRVGGIVREVTPTYFRVSGISSYLR
FT                   LGDRVGIDQDGRTRIGEVVRVDEAGAAVKPFDERVPVGMGSVAFRAGSLSLSPDRSWKG
FT                   RVINALGVPLDGEGLLARGEHRMPMDAEPPPAMTRQRIQKGIRTGVRVIDLFTPLCEGQ
FT                   RMGIFAGSGVGKSTLLAMLARSAVFDTVVVGLVGERGREVREFLEGPLASNRHRSVVVV
FT                   STSDESPMMRRLAPQSALAVAEYFRDLGESVLLIIDSVTRYAHAARDVALAAGEPAVAR
FT                   GYAPSVFSTLPKLLERAGPGTEGAGCITAVFSVLVDGDDHNDPVADAIRGTLDGHIVLD
FT                   RAIADQGRFPAVNVLGSISRLADHVWTPEERDLVRRLKSMVARFEDTRDLRLMGGYHAG
FT                   SDPELDQAVALVPKIYEALRQYSDSPPSLDPFGELAQAIRG"
FT   CDS_pept        718197..719489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaE"
FT                   /locus_tag="AZC_0647"
FT                   /product="flagellar basal body FlaE protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86645"
FT                   /db_xref="GOA:A8IPL6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPL6"
FT                   /protein_id="BAF86645.1"
FT                   /translation="MSLYGTLRTSVSGMNAQSNKLGTISDNIANSNTTGYKKATTDFSS
FT                   LIVDSSTSEYNSGSVNTKISYDISKQGTTTSSTSATDMMVNGDGFFVVQDGGGSTYLTR
FT                   AGSFTVDATTGNLVNTAGYTLMGYDISKGNNVTPVVNSTAGMVPVNIGSIALAAVPTTS
FT                   GTMTANLQSTSAVVSGATPGGNTAAATYTYKSSVSVYDNLGNQVVLDVYFTKTAAANPA
FT                   ATPPTTGGWEMAIYNQADATTGGTTPFPYSSSALATQTLTFDSTGQLLTPATGKVSLTV
FT                   PNGQTMNFDISTMTQLSNDYSIKAPTNGSPATSASDIKVNSQGIVYAVDGNGNTTNLYR
FT                   IPVATVKSPDNLTPVSGNAYQVTQESGAMQIGLSGSAGVGTIKSNTLENSNVDVASELT
FT                   DMIVAQRDYTANSKVFQTGTDLLDVLMNLKR"
FT   CDS_pept        719526..720983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="AZC_0648"
FT                   /product="FlgK protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86646"
FT                   /db_xref="GOA:A8IPL7"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPL7"
FT                   /protein_id="BAF86646.1"
FT                   /translation="MSLTSAFSTARNSLLNTATQLSTSAKNIENASNTSYSRKNANLVS
FT                   GDAGNTSVVVARAGDAALFLKMLDATSNSSKYAALLTGLTTLQSTIGDTETDTSVAARL
FT                   STFQTALSSYANAPDNDTLGQAAITAAENLATALNSSTRTVQSVRAEADANIANSVSKV
FT                   NDLLSQFKIANDAVIAGTVKGDDISDALDARDAVLSKLSEEMGVTTVLGQNNDMKLYTD
FT                   GGATLFDQSPRSVTFVPSATFDGTTVGNAVYVDGVAVTGASSVMPLKSGAIAGYAEMRD
FT                   VTTVTYQDQLDEVARGLISAFQETDQSGGGGAAKSGLFTNGIDTTVAGGLTRNLAATIT
FT                   VNTAAVVSKGGSVSTLRDGGMNGAAYAYNTTNAASFGTRLAALQTAIKAQQTFSSTTQL
FT                   TSGVSLQTFASSSVSWLEGLRTSTTNKSETQKTLLSQASTAVSNASGVNTDQEYATQLQ
FT                   LEKSYQASSKILSAVQSMYDALFSAIR"
FT   CDS_pept        720993..722051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0649"
FT                   /product="putative flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86647"
FT                   /db_xref="GOA:A8IPL9"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPL9"
FT                   /protein_id="BAF86647.1"
FT                   /translation="MQSSYISTMSWTLSAMKSITSLQTQIEKKNTELATGRYADIGLEL
FT                   GVKTSLSVDLRHEYNQVQGLLDSNSLTDSIMTRSQTGLTNILNNASTYQKTLLSSQASA
FT                   ETVTQMQLEGQQGLASLLSSLNTTDGTRYVFGGINSGQTPMKDFATNAQVAIQTAFQTA
FT                   FGFPVSDPQAANITSGQMQTFLNNVFSEDNTNTSALFNDTNWAAQWSNASSTNLTRQIS
FT                   QTENVSVSTTANDTAMRKLAMAYSMMGYLGVGSLNMSALQTVMDTSRATLSAGMTGVTN
FT                   TAAAIGVSQTRVTTANSELNKTLDVVKSRINSLESVDPAEAKTQLDTLTNQLSMSYSTT
FT                   TKLLQLSIMNYA"
FT   CDS_pept        722072..722419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaF"
FT                   /locus_tag="AZC_0650"
FT                   /product="flagellar FlaF protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86648"
FT                   /db_xref="GOA:A8IPM0"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPM0"
FT                   /protein_id="BAF86648.1"
FT                   /translation="MYKFSYAEILEDSSTESRARERDAFDRALELLVSAESAGLDTPEC
FT                   RAAMLFLQRLWGLLIRDLTDANNELAPELRADLVSIGLWNIREADRVLEQSSSNFSGLI
FT                   NINRTIRDGLQ"
FT   CDS_pept        722416..722826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbT"
FT                   /locus_tag="AZC_0651"
FT                   /product="putative flagellum biosynthesis repressor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86649"
FT                   /db_xref="GOA:A8IPM3"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPM3"
FT                   /protein_id="BAF86649.1"
FT                   /translation="MSKAMQITLRPGEKIFINGAVLRVDRKVTLELMNDATFLLESHVL
FT                   QVEDTTTPLRQLYFVIQAILMDPRNAEAARHLFHTQWAALRQAFKNETVLEGLETIATQ
FT                   VIGGRTFDALRTLRGLFVIEDAILAHGGSKAA"
FT   CDS_pept        722895..723311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="AZC_0652"
FT                   /product="flagellar hook assembly scaffolding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86650"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPM4"
FT                   /protein_id="BAF86650.1"
FT                   /translation="MTTVASTTSSTSTNTAAAASTAASNASTVDYNQFLQLLVAQLKNQ
FT                   DPTQPMDSTAYLSQLASFSQVEQQTNTNKKLDTLLSASALQSADAAIGKTVTSADGTVS
FT                   GTVASVSLVSGGAPIATLKDGSKVTLDSSVSISG"
FT   CDS_pept        723308..723574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="AZC_0653"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86651"
FT                   /db_xref="GOA:A8IPM6"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPM6"
FT                   /protein_id="BAF86651.1"
FT                   /translation="MNEADALDVVRNAIWTILLAAGPAVAAAMLVGIFIALIQALTQIQ
FT                   EATLTFVPKIIAVLVVCALTGSFMGSQIMAFTEEIYGRIASGF"
FT   CDS_pept        723859..725940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="AZC_0654"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86652"
FT                   /db_xref="GOA:A8IPM7"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPM7"
FT                   /protein_id="BAF86652.1"
FT                   /translation="MADVSLTAGDQRSRRDIGFAVGIVAILAVLFLPIPPLLIDIGLAL
FT                   SIALSVLILMVSLWIQKPLEFSSFPTILLLATMLRLALGVATTRLILAHGADGVHAAGA
FT                   IIAGFSKLVMSGDFVIGIVVFAILVTVNFLVITKGATRIAEVGARFTLDAIPGKQMAID
FT                   ADLNAGLIDDKEAQRRRSELEEESSFFGSMDGASKFVRGEAVASLITIAINIFGGIIIG
FT                   VTRHGLPIGDAADIYTRLSVGDGLVSQIPALIVSLSAGLLVSKGGTKGSAEKAVLGQLG
FT                   AYPRALFVSAGLLFALALVPGLPLIPFAALGGLMAFVGYAVPKQLAKEKAEKEAKEKAV
FT                   KEQQALEVRESVKEQLKTAEIEVVFDKQLAGVMTRASTEFGQRIAKMRRKFAQRYGFVV
FT                   PDVKISESLNVPAKTYQIKIHGTVVTSQEMRIGELLVVTGDGAKPDVPGDEVREPAFGM
FT                   KAMWVAEAYQAEVRREGFTAVDNSTVILTHLSEVIANNLPQLLSYKDMRTLLDRLDPEY
FT                   KRLIEDICPSQISYSGLQAVLKLLLSERVSIRNLHLILEAIAEIVPHARRSEQVAEHVR
FT                   MRMAQQICGDLADGGVLRVLRLGSKWDLTFHQSLKRDAKGDVVEFDIDPRLVEQFGTDA
FT                   SVVVREQMKEGQPFVLVSAPDARPYVRMIIERMFPSLPVLSHVEIARGVEIKSLGTIS"
FT   CDS_pept        725937..726686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0655"
FT                   /product="type III secretion system inner membrane R
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86653"
FT                   /db_xref="GOA:A8IPM9"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPM9"
FT                   /protein_id="BAF86653.1"
FT                   /translation="MIPLDVSILSAFLVFCRIGSCIMMMPGLSGYRLPVRVRLLLAVAV
FT                   SLAILPLMYDDLVNFIRNANSAQLLLSIGTEMATGAIIGTLARIFYLMLQMMLVAIAQF
FT                   IGLSSPMGLPEDGEVLPSLATLMILAATTMMFLTDQHYEMLRGLIASYRQIPVGVGFGG
FT                   RGALIQASDQLSAALMIAMRLASPFLIYSLIINFAVGLINKLVPQIPVYFISAPFILLG
FT                   GLILLYGLSDQMLTAFSAAFNLFLRTG"
FT   CDS_pept        726690..727121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86654"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPN2"
FT                   /protein_id="BAF86654.1"
FT                   /translation="MKQRLRKAGRIVAVQEQMHRQAEWRMADISRAKADLERLRSELIE
FT                   TLNEDTFGPLLVEVVARRLKATAAEADRLTQEQMRQEAKVREEALRLKRAERMHENVSR
FT                   QYDRHQEHIMVAGILEGIAARLSHAKDDDPGAPGDASLT"
FT   CDS_pept        727175..727780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86655"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPN3"
FT                   /protein_id="BAF86655.1"
FT                   /translation="MAIQPPSDIVLDVMQAADPAKAQKVTANLQRLATSASSGVFDTMV
FT                   QGVAGGFSGGLSFASTSTTSLHNLTNLSKRPGAEPGEAASELMAKAGNDPLRKFEAMVL
FT                   STFVESMLPKSTAVYGAGNAGNVWRSMLAQKMGDQVAEAGGIGIAKTIAARHPEMRTVS
FT                   GAQVAGAPTAAAARLTTVQPSGGEADKDTTTTGTDISI"
FT   CDS_pept        727777..728262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86656"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPN4"
FT                   /protein_id="BAF86656.1"
FT                   /translation="MRMAAMSDKSVEGESLGFSLAAQLAWTDVDAPIAELNAPDQPALS
FT                   PEMATLVSSLDRLEIVIDQETAALEAHQPVDLAEMNRRKSRSLLELSRALRGLPDDVDS
FT                   SLGERLTGIKAKLTRNCEVLAMHLAAAREITTILNGALRAAESDGTYSTALLGGRTA"
FT   CDS_pept        728259..728774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86657"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPN6"
FT                   /protein_id="BAF86657.1"
FT                   /translation="MIKFVVIGVWVCAVTLASSYGAAYWAAGANLGKAEDPYLPGLEYK
FT                   RVPTITVPMIMDGQVKGYVIAKLVFTADAGTLKKLSVDPVVFVVNDAFSEIYNNGRVES
FT                   GKISKYNLKDMTDRVKEKVNARLNGPVIQEILIDGINYVDKNDIRTVANQQQQSSKGQD
FT                   KGDAKPSH"
FT   CDS_pept        728771..730483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0660"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86658"
FT                   /db_xref="GOA:A8IPN8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPN8"
FT                   /protein_id="BAF86658.1"
FT                   /translation="MIRSQGGTERKTKMKIAGKIYSIVGILGLTTLIVCVMGLSALNEL
FT                   NNTSDRLDATAQRAFVAEKLNGAITAVVMESRGIYAAPDIAAAKPFAAGLRKQLDNVDQ
FT                   LAAQLKRLSGNTDAQAVDAVLSDLAKFREFRVETARLGESVSPQAANVQGNNDANRANR
FT                   RALQASVDRLTDQIRNELEPLRARIDGLQNQTWWRLVILTGVGLLIGGSIAIWIGTRTM
FT                   SRPLRRASETLRRLASGELDVAVEAQRSKDEIGDLWQSTKQLLEELRQADRLRIEQREL
FT                   AVRAESDKRAAMHSLADEFDREVSGVVRTVAEAVSTLERNAATMSASADQTSRQSTVVA
FT                   AAAEEATSNVQTAASAAEELAASVREIGTQVSTAAKIAEEATGQAAKTADVARGLSASA
FT                   TRIGQVVQLITDIASQTNLLALNATIEAARAGDAGKGFAVVASEVKSLAEQTSKATDEI
FT                   SAQVSAVQGATDEVVRAIEGISDTIRKIDDISSAIANAIDQQGAATGEIAQNVSQAAQG
FT                   TQEVSSSITGVSAAAQATGRVSTDIVHAATDLSAQASRLRSQVDTFVARVRAA"
FT   CDS_pept        730690..733482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="AZC_0661"
FT                   /product="CheA signal transduction histidine kinases"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86659"
FT                   /db_xref="GOA:A8IPN9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPN9"
FT                   /protein_id="BAF86659.1"
FT                   /translation="MDDLLREFLTETNESLDVADVELVKFEQDPNNAQILNNIFRLVHT
FT                   IKGTCGFIGLSRLAALAHAAETLMDKFREGAPVTTDAVGLVLQTIDRIKELLAELEARG
FT                   GSEPEGSDQDLIGQLELMAENAHNAPVAVVEAPKPAAPAASSGFSGQLERDLLPGEIPL
FT                   DELERIFRETEVEKPAAKKKEVAVSEPAKAALPATAKSTAPATTAPAPAPAAAAPAPAP
FT                   STAVARKPAEDEHKAAPAARGDDHAGSVSSQSIRVNVSVLEHLMTMVSELVLTRNQLME
FT                   IARRQEDSEYKVPLQRLSNVTAELQEAVMRTRMQPIGNAWQKLPRIVRDLAQELGKQIE
FT                   LEQIGAETELDRQVLDQIKDPLTHMVRNSADHGLEMPEDRRKAGKPEKGTIRLSAYHEG
FT                   GHVIVEISDDGKGLDVARIKQKALDNGLATEAELAKMSDQQVFRYIFAAGFSTAAKVTS
FT                   VSGRGVGMDVVRSNIEMIGGTVEVRSKQGAGSTFVIKIPLTLAIVPALIVEASGERFAV
FT                   PQSAVIELVRVQPNSEHQVKRLKESPVLCLRDKLLPIVNLGKLLGMAPQGEDNLDDLLI
FT                   AVMQVGNQTFGVVVDAVSHTEEIVVKPMSSVLRQLPMVSGSTILGDGRVIMIVDPAGLA
FT                   QVAASPEEERSNLGADGAAHLRDQGATTSLLLLRAGNNDIKAVPLSLVTRLEELELEKV
FT                   ETVNGHPVIQYRGALIPLVHVNDKVKRATTGTQPMLIFSDEGKVMGLVVDEIVDIVEAR
FT                   LDMQLSSDAPDALGAAIIDGQATEILDVGHFLSIAFGDWFERHDSEKQTSFGKVLLVDD
FT                   SLFYRNLIEPVLKGTGYEVTACSSGREALEKIAAGARFDAVVSDLEMPDMDGCQLARAL
FT                   RADAATAHLPIIALSSDRSSESIERARVAGFTDYIAKFDRPGLIAALKEFAGTAHGEAA
FT                   "
FT   CDS_pept        733479..733961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="AZC_0662"
FT                   /product="CheW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86660"
FT                   /db_xref="GOA:A8IPP0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPP0"
FT                   /protein_id="BAF86660.1"
FT                   /translation="MTSTSLVLARQENTGAGAQYVTVRIGPQLFGLPIEMVHEVFVPDH
FT                   ITRVPLSNHEIEGVLNLRGRIVTMINMRSMLGLPALEDTRRMAVGIEHHGESFGLMIDE
FT                   VGEVLVLDPARKETNPTNLDPHWADIVTGVYRLKGQLMLVLDVDLALGRLNTARAA"
FT   CDS_pept        733990..734373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY2"
FT                   /locus_tag="AZC_0663"
FT                   /product="chemotaxis response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86661"
FT                   /db_xref="GOA:A8IPP2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPP2"
FT                   /protein_id="BAF86661.1"
FT                   /translation="MKTCLVVDDSGVVRKVARRILEDLSFNVREAADGQAALKACEEAM
FT                   PDGILLDWNMPVMEGIEFLELLRKTEGGDVPRVIFCTTNNDIEHITRAIEAGANEYIMK
FT                   PFDQDILREKLEEVGLLEKAPAT"
FT   CDS_pept        734370..735608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0664"
FT                   /product="chemotaxis response regulator"
FT                   /note="glutamate methylesterase of group 2 operon"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86662"
FT                   /db_xref="GOA:A8IPP4"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPP4"
FT                   /protein_id="BAF86662.1"
FT                   /translation="MSTSAPSADTGAVEDPIRVMIVDDSVFIRGILSNWLGESPDLRVV
FT                   ATHANGRRAVDDVQKSLPDVVILDLEMPEMDGLTALPLILEKKPNTVVLVASTLTRRGA
FT                   EVSLKAMSLGAADYVPKPDAGRGISAADEFRRDLTAKVRSLGQRVRRRGSLPRVMAAAA
FT                   ASAAAAPAAAPATAGAAAPAPARPAAPAAGAAPAAPVSAFAKPKVNDKRRPYSMSPVTV
FT                   LAVGSSTGGPQALTRLFTDIGPSIANVPVVIVQHMPATFTAILAEHVGRAAGRPAAEGI
FT                   DGEVVKPGHIYIAPGGKHMVLEKSGNDKVIRLHDGPPVNFCKPAVDPMFDTVSEIYGRN
FT                   ALAVVLTGMGSDGAKGAGRIADAGGSVIAQDEETSVVWGMPGATVQMGNASEVLSIADI
FT                   GRKVSRLLTGGRA"
FT   CDS_pept        735605..736456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0665"
FT                   /product="protein-glutamate O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86663"
FT                   /db_xref="GOA:A8IPP5"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPP5"
FT                   /protein_id="BAF86663.1"
FT                   /translation="MISAADYEFFKKYLKQHSGLILSDDKHYLLESRLVPLLRKFEIAD
FT                   FGRLAAVLRDNSSSAVAEAVIEAMTTNESLFFRDKTPFEVFTSIMLPKLHAARSPSAPL
FT                   RIWCAAASTGQEPYSLAMTLKENPHLVGSRRVEIFCTDLSNEVLERAASGRYNQFEVQR
FT                   GLPIQMLMKYFKKVDDMWEISPQLKTMMTFRKLNLLNPFVGLGTFDIVFCRNVLIYFDA
FT                   PTKTDILNRLAKVTAADGYLVLGGAETVMGLGDAYKPLPNQRGFYVPNVPAAAAPAAMA
FT                   SR"
FT   CDS_pept        736528..738042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0666"
FT                   /product="chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86664"
FT                   /db_xref="GOA:A8IPP6"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPP6"
FT                   /protein_id="BAF86664.1"
FT                   /translation="MRLILPVDDARDAIFAKAWPYSMGRPLRKRCGRIGRVASFARPDR
FT                   EELAAPPRAAKRDGPMTQESLSQRLNFIGMDKALQASLREARDLVVAAMPKILDGFYDH
FT                   LMTYPDMARMFPTAAVRAHAKAMQIKHWGVILDGRFDAAYVESVTRIGQTHARLGLEPR
FT                   WYIAGYALLLSGLVAAIETGFKAGRFDRTAPERKARLIEAVITAALLDMDFAISVYLDA
FT                   GIKAKRETLDRVGAAFRSIVTTVSDAAAHLETTAASLADTAQSTRALSSAVASSSEQAS
FT                   SNVQSVATASDELAASINEISRQVRESSRIAGEAVEQAQRTDERIRELSSASARIGDVL
FT                   KLITAIAEQTNLLALNATIEAARAGEAGRGFAVVAQEVKALASQTAKAIEEIGGQITSM
FT                   QSATQDSVSAVKEIGHTIERLAGISETIAHAVDSQTEATSMITANVARAAVGTEEVATA
FT                   IASVRTQAVNTGSASEEVLGSARMLSSESQRLNEEVETFLKTIDVV"
FT   CDS_pept        complement(738142..738573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86665"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPP7"
FT                   /protein_id="BAF86665.1"
FT                   /translation="MPSAKATPPTTPRIRTPEPPLPPEQNQAESAPPAPPPPQKPIDNW
FT                   KEFDAAFATCLDPVPGPEGAEMTLRFALDHRGNLKGKPVASYSKLPGTIAEQKEFVAAA
FT                   LTSLDKCLPLPVTSRFGPIISSRPLLIRFSGPKPRDRGI"
FT   CDS_pept        739492..740091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0668"
FT                   /product="glycosyltransferase"
FT                   /note="family 2"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86666"
FT                   /db_xref="GOA:A8IPP9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPP9"
FT                   /protein_id="BAF86666.1"
FT                   /translation="MISVIIPTKDSERELVPVLSALVAGVTAGILRDVILVDGGSVDET
FT                   AKIADAAGCLFIPSVNDPGLRMKQGAQHSRGRWLLFLGANAVLAEGWAREVGAFLETAE
FT                   RRGAADRMVATFRLSVDGFGLRPRFGEAVAAAKLAVFGRPKAGQGLLISRKHYERIGGH
FT                   AAGVATERRLFSRIRRRDMYVFQSRVMLAEADVSAP"
FT   tRNA            740234..740307
FT                   /gene="trnQ"
FT                   /locus_tag="AZC_trnQ06"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:740266..740268,aa:Gln,seq:ctg)"
FT                   /note="codon recognized: CAG"
FT   CDS_pept        complement(740956..741609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0669"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86667"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPQ1"
FT                   /protein_id="BAF86667.1"
FT                   /translation="MRLRPYPPDRPRANKTQGRSNAPARFLAFAQFKQAIAQKLEIDPR
FT                   SHPSYDPASANSQEELICLNPELAEISSLPPRGFGRNSKEIRPSRVPPDFKSVIGSHGT
FT                   HPQVSRFCRGSSATLAVHRGPSGDQAMNREANAPMQTSLHIWIDGRRHVLRTLNDAVVL
FT                   VRGIQHPLTEYCELLVDQIEAAASPDLQARAWRAITTWIEAVRATAPGVMLHAA"
FT   CDS_pept        complement(741624..741932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86668"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPQ2"
FT                   /protein_id="BAF86668.1"
FT                   /translation="MAGEHQRREAFMANNQQGGSGNFANDREKASEAGRKGGQSTQQHS
FT                   QSSGNMGQQGGSGNFAQNPERAAEAGRKGGQSVPDEKRSFSQDHDLASEAGRKGGQS"
FT   CDS_pept        742116..743228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0671"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86669"
FT                   /db_xref="GOA:A8IPQ4"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPQ4"
FT                   /protein_id="BAF86669.1"
FT                   /translation="MMIENDDAGGRKDHPMSLNSPIPAPAAAGPTSFLSRLQVTHLAPG
FT                   LALSAGLVAIAYLLRTVLNVPALSPLVVAIFLGMAFHNFIGTPKRAVPGVKFAMRRVLR
FT                   GAIVLLGLQLTFTQVRTVGLDGMAIVIITLVSTFFVTRWLGRRIGVEAGLSELIAAGTS
FT                   ICGASAVIATNTVTRASDEDVAYAVACVTVFGSLSMFLYPVLAPLTGFDAHAYGLWAGA
FT                   SIHEIAQVVAAAFQGGQSAGEFGTIAKLNRVILLAPLVLALGFAAARKARASGHGGKVE
FT                   APPVPWFILGFLAMIVVNSFGLVPASVTSTVAPITTMLLAVALAAMGLETDVRKLKARG
FT                   WRPLALGTASWLFISALSFGLIWLSPRLFG"
FT   CDS_pept        743248..744132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="AZC_0672"
FT                   /product="transcriptional regulator"
FT                   /note="LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86670"
FT                   /db_xref="GOA:A8IPQ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPQ5"
FT                   /protein_id="BAF86670.1"
FT                   /translation="MTLDQLKVFVAVADHLHMTRAAEALHMTQSAVSASIAALEQSCGQ
FT                   PLFDRVGRRIELTAAGRLFVGEAQAILKRVAQARDALSDLAGLARGTLTLHASQTIANY
FT                   WLAPRMNAFHAAHPGIRLELGIGNTTQVAAAVRDGLADLGFVEGEVEEPLIVRRRVPGD
FT                   ELVLVASADAPYADLDTLSAHDIAAMPFVLREPGSGTRQMFEAACRRLGVKPQAVTIVF
FT                   ELPSNEAVLSAVAAGAGATVISRLVAEAGLKAGTLKALPLALPPRNFYVLHHGERDRSR
FT                   AAEAFVGFIAPPK"
FT   CDS_pept        complement(744181..744870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0673"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86671"
FT                   /db_xref="GOA:A8IPQ7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPQ7"
FT                   /protein_id="BAF86671.1"
FT                   /translation="MASFVIPAPVVPTLPVKGTDALFPVHRIYCVGRNFADHAIEMGHD
FT                   PNREPPFFFQKNPDNLVPSGSTIPYPKLTKDVHYEIEMIVALKTGGDDIPVEKALDHVF
FT                   GYGVGIDLTRRDLQAEQKKLGRPWDIAKAYEQSAPASGLVPASEIGHPSTGRIWLSVNG
FT                   ETKQDGDLNQMIWKVPEMIATLSTFFTLQPGDLIFAGTPAGVGPVKAGDVLKGGVANVG
FT                   ELEVTFA"
FT   CDS_pept        complement(745013..745669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0674"
FT                   /product="methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86672"
FT                   /db_xref="GOA:A8IPQ8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IPQ8"
FT                   /protein_id="BAF86672.1"
FT                   /translation="MFWSKKPLDLPTPETALKGRPDAIPTARLHHVNQNPLKGPYPDGF
FT                   RTAIFALGCFWGAERAFWRTPGVWVTAVGYLAGLTPNPTYEEVCSGRTGHTEGVLVVYD
FT                   PAVISYADLVKLFFESHDPTQGMRQGNDVGTQYRSGIYTSDPQEKAVAEAVKASYEAAL
FT                   KAKGFGPITTEIIDGGPFYFAEDYHQQYLSKNPGGYCGLGGTGVSCPIGVGVAAQ"
FT   CDS_pept        complement(745734..746093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86673"
FT                   /db_xref="GOA:A8IPR0"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPR0"
FT                   /protein_id="BAF86673.1"
FT                   /translation="MGCRRQTAGTWTRGAMIRFLFRFLGFWLMAGAFVALVVDGTRSIA
FT                   ASDIVYTSAYRAWVSLSPGTYDAAQAKLTALSPFLWTHVGAPLLNLPLFFLLGLVGAVL
FT                   LSIGRVRERSPFEAA"
FT   CDS_pept        746262..746771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0676"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86674"
FT                   /db_xref="GOA:A8IPR1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPR1"
FT                   /protein_id="BAF86674.1"
FT                   /translation="MTTGLIEIRRARPQDAPSLAEVHDAAWRTAYRGLIPGLELERMIE
FT                   RRGPKWWQSAIRRGSRISVLLVGDEVAGYTNYGGNRAKNLPFGGEIYEIYLKPVYQGLG
FT                   FGQRLFSAARRDLSLAGLPGLVVWALSDNQGAIGFYEALGGQAVAASTERFGGKVLDKT
FT                   AFGWQR"
FT   CDS_pept        746928..747461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0677"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0677"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86675"
FT                   /db_xref="GOA:A8IPR3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPR3"
FT                   /protein_id="BAF86675.1"
FT                   /translation="MRIDAIPVGKNPPHEVNVVIEVPIGGEPIKYEMDKDAGALFVDRF
FT                   LYTAMRYPGNYGFIPHTLSGDGDPCDVLVANTRAIVPGAVMSVRPVGVLLMEDESGVDE
FT                   KIIAVPGPKLTKRYDKVLSYKDLADITLKQIEHFFEHYKDLEPNKWVKIIRWGDAEEAH
FT                   KLILEGIERAKSKA"
FT   CDS_pept        complement(747505..747777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86676"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPR4"
FT                   /protein_id="BAF86676.1"
FT                   /translation="MFQRALLAVVTASIVMMSGPVAAERGCGSRGGPGYRGPDGRCVGW
FT                   ANIGRVCGSPPTTRCTAEAPAADADQAAAFSSTHPRKPKTPPDPQ"
FT   CDS_pept        complement(747820..750519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0679"
FT                   /product="nitrate reductase large subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86677"
FT                   /db_xref="GOA:A8IPR5"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPR5"
FT                   /protein_id="BAF86677.1"
FT                   /translation="MNAPLSSPQATSTTCPYCGVGCGVKATPDGLGGALIEGDAAHPAN
FT                   LGRLCSKGAALGETIGLETRLLHPMMREGAGDLRRVTWDSALDRVAEGFRRVLAEHGPQ
FT                   AVAFYLSGQLLTEDYYAANKLAKGFLGTANVDTNSRLCMASSVAGHKRAFGSDTVPGSY
FT                   EDLEQADLIVLTGSNTAWCHPVLFRRMVAARQARGTKLVVIDPRRTATAEEADLFLPLA
FT                   HGTDAALFSGLLVHLTDTGALDETFIAQHTEGFAETLSAARAETPDLAATARITGLAEA
FT                   DVARFFALFRATDRVVTCYSQGVNQSRRGTDKVNAILNCHLATGRIGREGMGPFSLTGQ
FT                   PNAMGGREVGGLANQLAAHMGFSPAEVDRVRRFWGAPHMAQAEGLKAVDMFAAMERGEI
FT                   KALWVMGTNPAVSLPRADAARRAMAGLDLFVLSENVLGTDTAGCAPHVLLPAVAWGEKD
FT                   GTVTNSERRISRQRPFLAPAGEAKPDWWVLAQVARRLGHGEAFDWRGPADIFREHAALS
FT                   AFENNGTRDFDLSGLADLTDAAYETLAPVQWPVRTASDGPHGTERLFGTGGFFTASRRA
FT                   RFVTPAPVAPAPVAEDFPLLLNTGRIRDQWHTMTRTGLSPRLGSHISAPFVTVHPDDAR
FT                   AAGLTDGALAQVETAHGRAVLEVRLDDGQRPGTVFAPIHWSATNSSGGRVGALVHPLTD
FT                   PVSGQPDLKATPARLAPVDAPARGVLLARSRVSPPPGLGFARARLEGGHGWRLAGSVDV
FT                   AAWAAYAQALADDLGLADSFCDMADTAGGHYRAAAFTASGALAFALVLAPEAEVPAWDV
FT                   WVQRLARGTLTEDDRRLVLSGRASDGAAACGPLVCACFGVPRGAIAQAIREGAHDAAAI
FT                   GARLKAGTNCGSCLPELKALLVDMLAPA"
FT   CDS_pept        complement(750547..752160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0680"
FT                   /product="putative sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86678"
FT                   /db_xref="GOA:A8IPR7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPR7"
FT                   /protein_id="BAF86678.1"
FT                   /translation="MTLQTRTPLVPFLPESAPFSAEQRAWLNGFFAGIFSGEAPAGATV
FT                   LSPAEGAALMAPPASAEEDDGAPWHDASMPLDERMKLAEGKPLARRMMAAMAQQDCGQC
FT                   GYICDSYSKALASGAETKLNLCAPGGKETLRMLKQLATELDGAPAPAPTAPGAEAATAP
FT                   AAAAPRGTRDNPAEVTFLGRFRLNKDGSEKETWHVDFDLEGSGLDYKAGDSFGLFPVND
FT                   PGLVADVLAALHAPADFPIGEKTLEQVLTKEVCLKSPPDTLFTLISYITGGARKDNAKA
FT                   LAAGEDPDGDAATLDVLAALEKFPGIRPDPEAFVECLEPLQPRLYSISSSPAATPGRLS
FT                   LTVDAVRYDHQGRTRLGVCSTFLGGRVAPGTRMKAYVQKAHGFGLPTDAARPVVMVGPG
FT                   TGIAPFRAFLHERMATKAPGRNWLFFGHQRSATDFFYEDELAGMQAAGVLSRLDTAWSR
FT                   EGGEKVYVQDRIRAAGPELWAWFEEGAHFYVCGDAKRMAKDVEAAVADVAATHGGLGAE
FT                   GGARFVAELKKAGRYQADVY"
FT   CDS_pept        complement(752157..753926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0681"
FT                   /product="nitrite and sulfite reductase"
FT                   /note="iron-sulfur/siroheme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86679"
FT                   /db_xref="GOA:A8IPR8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPR8"
FT                   /protein_id="BAF86679.1"
FT                   /translation="MSGDFTVDQKRYLEGFMSGAQVARAGRAPGGGSPATAEPTGPDAP
FT                   SLKAMARTEAEGKKLCPEEKAKREEMGLDAWPRMEEAAREGVYPKGPDILRWKYHGLFY
FT                   VAPAQDSFMCRLRMPNGILTHWQFRGIADIAEIHGGGYADVTTRANLQIREIPATDGVI
FT                   LLEKLVDLGLTAKGSGGDNIRNVTGTPTAGIDPQELLDTRPYAKAWHHHILNTRTLYGL
FT                   PRKFNVAFDGAGQIGALEDTNDIGFQAVEVKEGFGVEPGVWFRLALGGITGHKDFARDT
FT                   GVILPPADATKVADAIIRVFIDTGDRTDRKKARLKYVLDALGFDGFLKKVEERLGAPFV
FT                   RVPADAVKPRPEADRMAHLGVRPQKQAGLNWIGIGVPVGRMTAAQMRGLADIAQNLGDG
FT                   DLRLTVWQNVLVSGVPDARVTVAKAAITALGLTADADALQAGIVACTGAAGCRFGNADT
FT                   KATARAIAAYCGPRVALDSPVNIHVTGCHNSCAQHYIGDIGLIGARVAINEDGDTVDGY
FT                   NLLVGGGFGTEAAIAQELFEQVKAEDAPALVERLLSGWTAQRLPGETFAAFTRRLGPAA
FT                   LKSLVETAMERAE"
FT   CDS_pept        complement(753940..755142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0682"
FT                   /product="putative nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86680"
FT                   /db_xref="GOA:A8IPS0"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPS0"
FT                   /protein_id="BAF86680.1"
FT                   /translation="MSEPLVIIGNGMAATKLCEELGACGLGRYSVAVVGAEPGLAYNRV
FT                   LLSDVLAGKLPATDLEMKPASWWAKQGVTLLYGTPAASIDRESRAVVLADGRRLPFSRL
FT                   VLATGSHPIRLPLPGADLPGVTTFRDLADVSALLAAAKPGVRAVVIGGGLLGLEAAIGL
FT                   AGAGVATTLVHLMDRLMERQLDATAADLLRQAVEARGVTVRLQAHSAAIEGESHVTGLR
FT                   LADGEVLPADLVVMACGVRPNADLARATGLTCNRGVVVDDHLATSDPAIFALGECAEHR
FT                   GMAYGLVAPAYEQAHVLARHLAGKPAAYPGSVVSTNLKVSGVPVFSAGDISGEGAQDIV
FT                   LRDRAHGIYRRLFIRDGVLAGAVLFGDTADGLYFLDLITNRTPIAPLRAALAFGRPALA
FT                   A"
FT   CDS_pept        complement(755179..755604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0683"
FT                   /product="putative hemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86681"
FT                   /db_xref="GOA:A8IPS1"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPS1"
FT                   /protein_id="BAF86681.1"
FT                   /translation="MTPSQVELVQSSFAKVAPIAETAAGLFYGRLFEIAPEVKPLFKGD
FT                   ISEQGKKLMATLSVVVNGLTKLDAIVPAAQALARRHVAYGVTREHYAPVGAALLWTLEQ
FT                   GLGPDFTPEVKAAWAEAYGLLSGVMIEAAEGAAVPAE"
FT   CDS_pept        complement(755674..756468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0684"
FT                   /product="nitrate transport ATP-binding subunits C and D
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86682"
FT                   /db_xref="GOA:A8IPS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPS2"
FT                   /protein_id="BAF86682.1"
FT                   /translation="MPAYLELSQIGKTFTRGAATTEVLREVSLDIAKGEYISIIGHSGC
FT                   GKSTLLNIVAGLTPATSGGVILDGREVNSPGPDRAVVFQNHSLLPWLTVYDNVRLAVDK
FT                   VFSGTRSRAERHDWTMHNLELVQMGHARDKRPSEVSGGMKQRVGIARALAMEPKVLLLD
FT                   EPFGALDALTRAHLQDSVMQIHATLGNTILMITHDVDEAVLLSDRIVMMTNGPSARIGE
FT                   VLEVGLPRPRKRLELVANPTYLKAREAVLKFLHERHRFVEAA"
FT   CDS_pept        complement(756480..757388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtB"
FT                   /locus_tag="AZC_0685"
FT                   /product="nitrate transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86683"
FT                   /db_xref="GOA:A8IPS4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPS4"
FT                   /protein_id="BAF86683.1"
FT                   /translation="MSVTALKEAEPQRRPEAATPASVAQVVRLKRSRPPVSARLMAAAR
FT                   WFAVSVLPPLIVTALLLLLWELLCRGAGATLPPPSRIWADSKDLIVDPFFVAGPQDIGL
FT                   GLRVLVSLQRVAVGFGLAAVVGVLTGALIGQSVWAMRGLDPIFQMLRTVPPLAWLPLAL
FT                   AAFRDSNPSAIFVIFITSIWPIIINTAVGIRNIPQDYRNVAQVLRLNPLEFFWKIMLPS
FT                   AAPYIFTGLRIGVGLSWLAIVAAEMLTGGVGIGFFIWDAWNSSRLPDIIVALVYIGVVG
FT                   FVLDRLVAGVAGIVTRGTAAS"
FT   CDS_pept        complement(757529..758929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtA"
FT                   /locus_tag="AZC_0686"
FT                   /product="nitrate transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86684"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPS5"
FT                   /protein_id="BAF86684.1"
FT                   /translation="MTDASEPKSVALSVVSPAAPSPAASSAGPEGTAHEGVSRRSLLKG
FT                   GVAAMGTAALFEAVRTVFPGGVPSAHAAAPETTKAVLGYIALMDASPLVIAKEKGLFAK
FT                   YGVPDVEVVKQASWGATRDNLVLGGGANGIDGAHILTPMPYLISTGKVTQNNAPTPMYI
FT                   LARLNLDAQAISVSNEYKDLKATANASALKAAFEKKKAEGKEVKVAMTFPGGTHDLWIR
FT                   YWLAAAGIDPDKDVSTIVVPPPQMVANMKVGNMDAFCVGEPWNEQLVNQGIGYTACTTG
FT                   EIWKNHPEKALGMRADFVDKNPNATKAILMAVLEAQQWCDKMENKKEMSEIVGKRQWFN
FT                   VPVADIYGRTIGDINYGNGRVVKGSDQYMKFWQANASYPFKSHDAWFITEDIRWGKFEP
FT                   TTDIKTLVDKVNREDLWRAAAKELNVPAAEIPTSTSRGVETFFDGKSFDPANPTAYLKS
FT                   LGIKRVEV"
FT   CDS_pept        complement(759244..760083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0687"
FT                   /product="putative carboxyvinyl-carboxyphosphonate
FT                   phosphorylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86685"
FT                   /db_xref="GOA:A8IPS7"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPS7"
FT                   /protein_id="BAF86685.1"
FT                   /translation="MSEQIAKFERFKALHQQAQAFVIPNPWDAGSARLLASLGFEALAT
FT                   TSAGYAFSKGKRDSAASLTRGEILENASEIVRATHLPVSADLEDGFGAAPDACAETIRL
FT                   ACAIGLVGGSIEDATGDPATPIYDLAHAIQRVEAAAEAARDLPFLLTARAENFLCGRPD
FT                   LDDTIRRLQAFSAAGAHVLYAPGLPNLEAIRTVCAAVDKPVNVVMGLRGPSYSVAELSA
FT                   AGVRRVSVGGSFARAALGALMRAAQEVRMFGTFSYAAEALPGKEIIALMSETRPERS"
FT   CDS_pept        complement(760130..761143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0688"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0412, dienelactone hydrolase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86686"
FT                   /db_xref="GOA:A8IPS9"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPS9"
FT                   /protein_id="BAF86686.1"
FT                   /translation="MKLLPAGLVVALLLSLPVAARAQGPGPAQSPATSDPASIPARVEL
FT                   HPFPSRTLPDSAFLKGEEVGQPVTLAAELRLSQASGKQPVVVLMHGSGGVGANIEPWVE
FT                   QFNAMGMATLVIDGFTGRGLTSVSSDQAKLGRLNFILDIYRALDILAKHPRIDTSRIAL
FT                   MGFSRGGQAALYASLDRFQKMWNRSGVTFAAYVPFYPDCAISFMGETDVAGVPIRIFHG
FT                   AADDYDPVSVCQPYVARLKAAGRDVVVKEYAGAEHGFDTPFPLGRVEAPTSQTVRACTI
FT                   RETEPGVLTNAATGQPFTYKDACVQLGPHVGGNAEAAAAAHTDVGAFLATQFKLKP"
FT   CDS_pept        complement(761261..762406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="AZC_0689"
FT                   /product="chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86687"
FT                   /db_xref="GOA:A8IPT0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IPT0"
FT                   /protein_id="BAF86687.1"
FT                   /translation="MAKRDYYEVLGCDRGADETVLKASFRKLAMKWHPDKNPGDPEAEI
FT                   RFKEISEAYEVLKDPQKRGAYDRYGHAAFENGGGPGGAGFNADFASTFADIFDDLFGGS
FT                   MGRSGARSAGGRARGADLRYNMDITLEEAFSGKTAQISIPTSISCEVCSGSGAKAGTQP
FT                   KTCRTCNGAGKIRHAQGFFTLERTCPSCQGRGTVIEDPCPNCGGAGRVTRERTLQVQIP
FT                   AGVEDGTRIRLGGEGEAGVRGGPPGDLYIFLSIEPHTFFQREGADLYCRAPISMVTAAL
FT                   GGTVEVPTIGGEKTKVKIPEGTQSGKRLRLPGAGMPVLRSRSFGDMYVQVVVETPQNLT
FT                   KRQKELLAEFEGLSSTDTHPESNGFFAKMKDFFQGASSDND"
FT   CDS_pept        complement(762823..764718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="AZC_0690"
FT                   /product="chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86688"
FT                   /db_xref="GOA:A8IPT1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IPT1"
FT                   /protein_id="BAF86688.1"
FT                   /translation="MSKIIGIDLGTTNSCVAVMEGASPKVIENAEGARTTPSIVAFTED
FT                   GERLVGQPAKRQGVTNPERTFFAVKRLIGRRYDDPTVEKDKKLVPYKVVRADNGDAWVE
FT                   SDGKKYSPSQISAFILQKMKETAESFLGEKVEKAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVLRIINEPTAAALAYGLDKKNSGTIAVYDLGGGTFDVSVLEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVNYLADEFKKEQGIDLRNDKLALQRLKEAAEKAKIELSSATQTEINLPFI
FT                   TADASGPKHLTMKLTRAKFEALVEDLIQRTMEPCRLALKDAGLSAGQIDEVVLVGGMTR
FT                   MPKVQEMVKQFFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRLIDRNTTIPTKKSQVFSTAEDGQTAVTIRVFQGEREMAADNKILGQFDLVGIP
FT                   PAPRGVPQIEVTFDIDANGIVQVSAKDKGTGKEQQIRIQASGGLNDADIEKMVKDAESH
FT                   AADDKKRRALAEAKNHGEALVHSTEKALSEHGDKVGAAEKGAIESALGELKTALTTEDA
FT                   EAIQAKTQALAQASLKLGEAMYSAQQGGEQPGAAKKDDVVDAEFTEVDDDKKKSA"
FT   CDS_pept        complement(764961..766097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0691"
FT                   /product="putative nitrate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86689"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPT4"
FT                   /protein_id="BAF86689.1"
FT                   /translation="MKRLSIGFIPLTDAAVLIAAAERGFAMAEGIEIELHKEVSWANIR
FT                   DKVNVGLLDGAHMLGPLAIASSLGLGHVRVPLVVPFALNLNGSAITIAKSVYAAMGETG
FT                   GDLTSALGAAQALGKVVIDRRERGEDPLTFAAVYTFSTHHYLIRHFLTAGGIDPDRDVR
FT                   LVVIPPPFMAESLRNGLIHGFSVGSPWNSVAVDADVGRIAVLGAEIFGWVPEKVLGVHA
FT                   RFANAEPEVLHRLVRALNAAAAWCEDPANHADLARLLSEPRHLSLPADILRRTLDGRLH
FT                   TAPGGVLRSHPDYLVLHREGANRPDPDHALWMYHQIVAAHQGDWAPDAAREAISVYRPD
FT                   IFDAAVGAAPPSPPREPDCVATQFGPVFDKERFLATGE"
FT   CDS_pept        complement(766094..766738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0692"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86690"
FT                   /db_xref="GOA:A8IPT7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPT7"
FT                   /protein_id="BAF86690.1"
FT                   /translation="MRAHWRRCVSCFVSPKSFMSSDLQLRIVIVDESPVRAAILSEGLH
FT                   EAGYVNVLRLEGRTNLLERIYAIDPDVILIDLEDPSRDVIEQMLHVSREVKRPVAMFVD
FT                   QSDGETIQQAIEAGVASYVVDGLRKERVRPIVETTISRFRAFARLKAELEEAKSQLEER
FT                   KTVDRAKGLLMKMKGISEEDAYSLLRRTAMNEKKRIADIAQSIITAAELLR"
FT   CDS_pept        complement(766805..770233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0693"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86691"
FT                   /db_xref="GOA:A8IPT8"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPT8"
FT                   /protein_id="BAF86691.1"
FT                   /translation="MAACGRGNMGKIRLWLSGFAWGAMLGVMASVVMGVAVFRPDIWEK
FT                   LSYERIERALTRKTQSTLDTSAPPPASAPAASGAVLFANTRTAPALEQNYAPPHAFGPD
FT                   DVLVIKGRNASNDFVEVDLRIDDSASKDWGSRFGGVKTVPPGPFEWVVPFKGLTDQNKR
FT                   AMDINAITRIILFSPENLPAAQIASVTLERRPQPAAAAGSAPGAAPARANAALFTDAST
FT                   SPALEQNYAPPRAFGPDDALVIKGSNPTGSAIEVDLRIDDSASKDWGSRFGMAKSVPPG
FT                   PFEWVVPFKGLADQNKREMDIKAITRIILFSPENQPAAQIASASIENRPGAGDTTGSTG
FT                   GAANEAKMGQSWLKGARTTAEQEFYPPMSFAQDQEVVVTGTNTDSKPITLYLRIDDVNS
FT                   KNWNSRVNATVTVPPGPFTFRSPVSSWVTPSKARLDRTRVARFVISLGDGEGPIRLGDV
FT                   HVAGGSPLPKDALGLRFGPADVSVPGFETVTRNDLRLSPAGRDLVRTQNDPLLSSGLNG
FT                   VRTITVPWTKSDTATISLWTEDQGEWEYFPHSLHRTFIINGQVALKEDYRPDEWVEKVF
FT                   HRGLWKEAMIDGDPWEVYASRRAGLVTATVPVIDGKITVQISSDQPPNDGYIAAMVIAP
FT                   GASTAAAEAVEAWRRGRYMERWPVVDKPVDPKLAQGTTLRVLPYGTPRSQHPFWDPNLP
FT                   TQTRLKALRGQMVSIDFLAFSDQSDANPDVALKLPEGITGEVRWGKWTYMRRGGGENSL
FT                   SITSDVLEGDLTRLRIAAGIPRRMNVTFTVPETASGTLPVVLAMNIGGASVEARADVEV
FT                   APVTLPATATPVGYYMAAPNPDFWFPPKPATADRLMACDLKALRRFGLTGLSPDLVTPT
FT                   ADQRARYLEQTRLAKDAGFSPPFFDYVSVKLLADKVGVQAMGENIGATEAALTAAGLPL
FT                   PLWSIADEPQNLQSPMMDLKRLRDAIRVYAPKAKIAGQLNDIKDKPFLPFFDTVLVNTG
FT                   FGVSARDFADLKAQGITPWLYNMPDIEAAAGFLLWRVGAEGYIQWHARAATADPSDPTD
FT                   GREPDFMFLPLTADRCQSVPTVDAMVVATGDGITDLRLLQWLDGRAASDPKAKALRDEI
FT                   FAAIPGDWVGFEKQKPNLPALRRKLIDYAGATAAP"
FT   CDS_pept        770405..771040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0694"
FT                   /product="conserved hypothetical protein"
FT                   /note="unknown function (DUF1007)"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86692"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPT9"
FT                   /protein_id="BAF86692.1"
FT                   /translation="MRQRFAFLLAAALSCLGAGVAEAHPHVWVTMRTTILFDPQGNFVG
FT                   LRNDWTFDEAFTAFALQGFPKDANGNYAKETLAPLAEVNVTSLKEYDYFAHGKTAKAKM
FT                   AFKDPVDYSLTFDKDLLTLHFTLPVAKPVPSKGSLTFELYDPTYFVSFDFEEKDPVRLE
FT                   GAPAGCTFSVVTPSQPQTMQVDESFFTNLTSSSTYGAQYADKILVKCP"
FT   CDS_pept        771040..772035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0695"
FT                   /product="ABC-type uncharacterized transport system
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86693"
FT                   /db_xref="GOA:A8IPU1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPU1"
FT                   /protein_id="BAF86693.1"
FT                   /translation="MTASRARFLRLLILACVGAGTALALAEPAVAQAFGQAGAKTTPFG
FT                   LGGGGPAPTGFTGYLIAKQSEFYRALIQAVRAAKADGHALYLLAGLSFGYGVFHAAGPG
FT                   HGKAVISSYLLADGGTLRRGALLALGSGMVQAIAAVLFVGVMALLLGSTAATMAQAMNW
FT                   VEIAAYGGIALFGALLALTKARALIGVLRGSPTHVHDAECGCGDSHAPDPRLLDGRGGW
FT                   KRAAVAVISAGARPCSGAILVLTFALSQGVFLTGVASAFAMGLGTALTVTAIAALAVYG
FT                   KRLAVRLAVLASGRGTALMLVVELGAAVLVCLFGLALLTGYAVSERLLPG"
FT   CDS_pept        772090..772935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0696"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86694"
FT                   /db_xref="GOA:A8IPU3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPU3"
FT                   /protein_id="BAF86694.1"
FT                   /translation="MADDIIRTLTPAEVDLAVDWAAREGWNPGLHDAPAFLAQDPEGFL
FT                   GLFRDGELVACISLVTYGAAYAFLGFYICRPDLRGQGLGWTLWQAGMARLGGRTVGLDG
FT                   VVAQQDNYKKSGFVLAHRNVRHGGVARRVAGDPEVRLRPVATDLMPALIAYDTACVPAA
FT                   RPDFLKHWLAPPDGLALMAGNGERVLGYGVIRHARTGWRIGPLFAQAPGVAGALLNALA
FT                   DHAGGADVFIDVPEPNGAALALVEAAGLVPVFETARMYKGDAPVLPLDAIYGITTLELG
FT                   "
FT   CDS_pept        complement(772946..773857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0697"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86695"
FT                   /db_xref="GOA:A8IPU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPU5"
FT                   /protein_id="BAF86695.1"
FT                   /translation="MLKLDGVAAFVAVADAGSISEAARRLGLAKSVVSERLAELERLLG
FT                   ARLMQRSTRRLALTEAGTAFLTRGRRLLREAEEAVAEIAEQKSLLAGPLRVSAPVSFGT
FT                   LHLGRALHPFLAAHPGIELTLELDDRFVDVVTDGFDLVIRHGQVHDTRLAARRLATSRR
FT                   FLVAAPAYLEAHEAPASLDALSAHRAILYANRETDWRFETPSGAVAVRPRPGLRVNNGV
FT                   MMRGAAVAGLGLALLPTFLCHEELAAGTLKVVDVGVPAEGAQLHAAYPLDRSASAKLRA
FT                   LIEHLRRAFGSPPFWEKGLRLP"
FT   CDS_pept        773917..774873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0698"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86696"
FT                   /db_xref="GOA:A8IPU7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPU7"
FT                   /protein_id="BAF86696.1"
FT                   /translation="MPFSCPETRSSRHAGSESSDGRPGQRMTTMTQTTNSLVFPDTFQI
FT                   RDIPTNGTTLHVRTGGKGPAVLLLHGYGETGDMWVPLAADLAADHFVIVPDLRGMGRSA
FT                   KPEGGYDKKTQGQDMAGLLDALGIAAVDLVTHDIGNMVGFAFAAQHRDRVHSFVLIDAP
FT                   LPGVGPWEEILKNPLLWHFRFGGPDMERLVAGRERIYLDRFWNEFSATPARFSEAAREH
FT                   YAALYAQPGAMHAGFSQFAAFDQDAIDNQAFLKAGKLTIPVLALGGEKSFGLGMGQVMA
FT                   FAAEDVTSGVVPDAGHWIMEENPAATVALVRDFLPKA"
FT   CDS_pept        complement(774932..778408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0699"
FT                   /product="pyruvate decarboxylase"
FT                   /note="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0699"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86697"
FT                   /db_xref="GOA:A8IPU9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPU9"
FT                   /protein_id="BAF86697.1"
FT                   /translation="MGLKQVSLADKYDLAQERVFVSGTQALVRLALMQKERDRQAGLNT
FT                   AGYVTGYRGSPLGGLDQQFGQAGKLLTANDIRFQPGLNEDLAATALWGSQQAELRGEGK
FT                   FDGVFGLWYGKGPGVDRSGDVFRHANNAGTSRHGGVLALMGDDHTCESSTTAHQSEFHF
FT                   VDVMIPVLNPAGAQEILDYGLYGWALSRFAGTWVGLKAVKDTIESTGIVDGRLDRVRIA
FT                   PVHDFRMPHGGLNIRLADTPPAQEERLQEYKRDAVLAFLRAQKLNRFVTSGGARPRIGI
FT                   ATVGKSYLDVRLALDELGIDEVRANDLGIRLWKVACPWPLETQALYEFARGLDLIMVVE
FT                   EKRSLIEVQVREELYGTANQPVCIGKKDEEGRWLFPVKGALDPNDIAIQLGRRLLRYGD
FT                   IPDIAARVAELEEAQRVLAATSDVTTRIPYFCSGCPHNTSTKVPEGMRGSAGIGCHYMV
FT                   QWMDRATVGFTQMGGEGANWIGEAPFSKRGHLFQNLGDGTYNHSGYLALRAAVAAKVNI
FT                   TYKILFNDAVAMTGGQRHEGDLTVPVIARQVAAEGVARVVLVTDEPDKYAAGINWPAGL
FT                   TIHHRDELDHIQRELATVPGVTVLIYDQTCASEKRRRRKRGAFPDPDKRVIINERVCEG
FT                   CGDCGVKSNCVSVQLLETEWGRKREIDQSSCNKDFSCVNGFCPSFVTVHGAKPRKAAGV
FT                   AGKMGELASLPEPAHPEIDGTYGIIVTGVGGTGIVTIGAILGMAAHLEDKACGMIDMAG
FT                   LAQKGGAVYSHVRLAKKPEDIAAIRVPARGADLILGGDLVVAGTKKVLAAVKPGKSLVV
FT                   VNTHEVLPGDFTRNADYSLPTERLKRTISGAVGAEQTHFIEASRLSTALFGNSLPQNIF
FT                   MVGYAYQFGGLPLSAEAILKAIELNGEAVEMNKAAFEWGRRAAHDPEAMAALLTAKEAA
FT                   TDARRLSESLDEIIARRVDALTAYQDAAYAARYKALVDKVAAAEATRAPGRSGLTEAVA
FT                   RNFHKLMAYKDEYEVARLFADGAFQRQVDAAFEGKLSYEFHLAPPLFARVDPHTGEPRK
FT                   MRLGPWMMKGFRLLAKLKGLRGTAFDLFGRTEERRTERALIADYERTVSELLGALTREN
FT                   HATAVAIASIPEKIRGFGHVKLRHLTAAKAEEAALLSTFRTPPVAPAQAAE"
FT   CDS_pept        complement(778658..779383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0700"
FT                   /product="pyrimidine 5-nucleotidase"
FT                   /note="HAD-superfamily hydrolase subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86698"
FT                   /db_xref="GOA:A8IPV2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPV2"
FT                   /protein_id="BAF86698.1"
FT                   /translation="MTAQDLPLPHSSAPGARGFDQVETWVFDLDNTLYPAQHDLWGQID
FT                   ARMRDYIAGLLNISREEAFARQKDYYRRYGTSLRGLMIEHGIDAHAFLDHVHEVDLSTL
FT                   EPSPRLAAALEGLPGTKLVYTNGSERHALNVLGKLGLDTHFSAIHDIVAAEFHPKPTEE
FT                   AYLRFLRAHGVEPTRAAMFEDLARNLEVPHRLGMTTILVVPPTEQIESRESWEFEGREA
FT                   AFVDHVTEDLAGFLETLGG"
FT   CDS_pept        complement(779434..780522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0701"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0701"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86699"
FT                   /db_xref="GOA:A8IPV3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IPV3"
FT                   /protein_id="BAF86699.1"
FT                   /translation="MRAAGSGRNGCPGFGITPPADFPMPRGAGTKICNTQELSRRSAGQ
FT                   PATACFQDRPPRSGPSMSASIADNVAEAQLQAEVLTKALPHMQRYDDAIVVVKYGGHAM
FT                   GNDELARHFAQDIVLLEQSGVNPVVVHGGGPQIGAMLEKLGIKSEFAAGLRITDKATIE
FT                   IVEMVLAGSINKQIVGFINEAGGKAIGLCGKDGNMVRARKATRTIVDPQSHIEEVVDLG
FT                   FVGEPDTVDTMVLDQILGRELIPVLAPVASAVDGGTYNVNADTFAGAIAGALGAKRLLL
FT                   LTDVPGVLDKNKQLIPRLTIDECRALIADGTVSGGMIPKVETCIYALEKGVEGVVIMDG
FT                   KLPHSVLLELLTDHGIGTLITR"
FT   CDS_pept        780724..782289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86700"
FT                   /db_xref="GOA:A8IPV5"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPV5"
FT                   /protein_id="BAF86700.1"
FT                   /translation="MSPKAPLPPRRALDLSPRLILLLSLVCFVLVAIPIVTHPLPPLSD
FT                   YVNHLARMKVIATPKDSDLARFYFLEWSVLPNLMMDMVVPLLDRFADIYVAGEMYTLMC
FT                   FALIIFGTMYLHRALFGSWSAIPLVAFPLLYNNIFLIGVMNYIFGIGLCLCGLASWVML
FT                   RDKPWPWRYAVSCLFVLALFFCHLFATGVYGVGILSYELMRLFDRKGGALKGRLVAFVT
FT                   AGFPFALTVPLLLMSPTWGLKGENYWEPRGKIDGLEFVINVYYDFVAFALTAVIVLAAA
FT                   WAVRHRLLRTHTFLFFLLVIAGAVYLALPRTVFATYMADQRMPVAIAFMVIASIQIDLR
FT                   HRLAQRGFAVMLVLLVAVRVTEVQMVWNNLTQWTVAFHDSIAKIKRGSKVLVAYADPWG
FT                   GSAATDLGLVHAACLAIIERSSLVTTAFTVPGKQILRVHKPYTDWVDTEDGTPPSVEQL
FT                   LVTEEDGTPGGPRYWDYWPQHFDYVYLLFTEPGDPNPDPDRLELVYAGDRFQLYKVIPP
FT                   APLH"
FT   CDS_pept        782483..783613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0703"
FT                   /product="metal-dependent hydrolase"
FT                   /note="involved in phosphonate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86701"
FT                   /db_xref="GOA:A8IPV7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPV7"
FT                   /protein_id="BAF86701.1"
FT                   /translation="METVFTNARLVLEDQVIDGTLVVRDGRIAAVEEGRSALSGAVDCA
FT                   GDYLAPGLIDLHTDALENHFVPRPKVIWPDARAAALAHDGQTVAAGITTVFDAICAGGF
FT                   DQTKSARKELFTIMLDAVEEGAPYFRADHHIHLRCELTDPGLLELAEPELNRGRLGLAS
FT                   LMDHTPGARQWRNVDQLRTYLLGIGKTTEDVERELAERTARGQAAVAANFDRLAALLRD
FT                   AGVALASHDDTTPEHVADAKAAGCTISEFPTTQEAAHAAHAEGLTTIGGAPNVVRGGSH
FT                   SGGVAMKDLVAAGLLDALASDYVPASMLQAAVKLSQDGVSLPQALALVTARPADLAGLS
FT                   DRGRLAPGLRADLLRFRIVGPTPVVREVQVEGARVF"
FT   CDS_pept        783685..784380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0704"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86702"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPV9"
FT                   /protein_id="BAF86702.1"
FT                   /translation="MSVRYAIYLAPPPDSALWRFGSSVVGYDAETGEDIAPAALAGFTP
FT                   EEWFEQTHEPRRYGFHGTLKAPFRLAEGADETDLFAALARFAAGHHPFELPPLEVRQIG
FT                   TFIALVPPAPVPALEDLAADAVEELDALRAPLSEAEIARRKPERLSARQLAYLHRYGYP
FT                   YVREEFRFHMTLSSALAEPALGRATQALCDAYAASGAHLPVKVEDAALYVQEAPGMRFR
FT                   ILHRAPLGA"
FT   CDS_pept        784491..785126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0705"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0705"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86703"
FT                   /db_xref="GOA:A8IPW1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPW1"
FT                   /protein_id="BAF86703.1"
FT                   /translation="MKKLGLAPLIDPTASVKDSSLGRYTEVGARVKLLEVAMGDYSYIE
FT                   HDSDMAYTQVGRFCSIAALTRINPGNHPMWRASQSHFTYRASTYFDDAQDEPDFFQWRR
FT                   DHGVTLGHDIWVGHGAVILPGRTIGTGAVVAAGAVVTKDVPPYAIVAGVPARIVKWRFP
FT                   ETIAERLQALAWWDWDHGSLRAALEDFRALPVEGFLEKYERRAVSAAE"
FT   CDS_pept        785160..786224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0706"
FT                   /product="sugar isomerase"
FT                   /note="KpsF/GutQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86704"
FT                   /db_xref="GOA:A8IPW3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPW3"
FT                   /protein_id="BAF86704.1"
FT                   /translation="MSGRKLPLAGEQCYGLAMTAAPSTKVDTSVTETRSPAIASALSTL
FT                   ETEAAGLAALIAAVGNGLGEAFEAAVATILGAKGRVIVTGMGKSGHVARKIAATLASTG
FT                   TPAHYVHPAEASHGDLGMVAPEDVIIGLSWSGETAELRDIVDYALRFDVPLIAITSNRE
FT                   SALARAARVVLALPLSPEACPLGLAPTTSTLMQLAMGDALAVALLESRGFTAKDFRTFH
FT                   PGGKLGANLKFVRDVMRAGEALPLARSGALMGEVLVEMSAKGLGCVAVLDGDGRLAGIV
FT                   TDGDLRRHMANDLPSRPVDAIMSRSPKTIRPDQMVSEALRLLNTAKITALMVVEDGRPV
FT                   GAIHIHDLLHVGVA"
FT   CDS_pept        786507..786980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0707"
FT                   /product="deoxy UTP pyrophosphatase subfamily 1"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86705"
FT                   /db_xref="GOA:A8IPW5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8IPW5"
FT                   /protein_id="BAF86705.1"
FT                   /translation="MSATRLDVPVVRLPHGMDLPLPEYATAASAGMDLVAAVPAEVPLV
FT                   IAPGAWALVPTGLALELPEGMEAQVRPRSGLALKFGVTVLNAPGTIDADYRGEVGVILI
FT                   NHGREPFTVSRGMRIAQMVIAGVQQITLVETGNLGETARGVGGFGSTGLDRTP"
FT   CDS_pept        787000..787440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0708"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86706"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPW7"
FT                   /protein_id="BAF86706.1"
FT                   /translation="MPRLSDKSLLAIAAVVDVAVHARGTPVAAKSLAARHGLPPRRLEP
FT                   VLQALVHAGVLKGVRGPRGGYELARERRRVSVAEIVRVVEGAEEEKEIILPPLVTEVVQ
FT                   PAVAAAEQTFDTALDTVTLEDLCRAADQKGHGIENDRIDFII"
FT   CDS_pept        787502..788485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0709"
FT                   /product="cysteine synthase K/M"
FT                   /note="cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86707"
FT                   /db_xref="GOA:A8IPW9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8IPW9"
FT                   /protein_id="BAF86707.1"
FT                   /translation="MATSAAKAASAAPRPGRGRVYDSITETVGNTPLVRLHRLPELRGV
FT                   KANILAKLEFFNPIASVKDRIGVAMVDAIAEAGQLDPDTVLVEPTSGNTGIALAFVAAA
FT                   RGLRLILVMPESMSVERRKMLALLGAELVLTPANLGMRGAVTRAEELLKEIPKSVMPQQ
FT                   FKNKANPAVHRATTAEEIWNDTDGAVDLVVSGVGTGGTITGIGQVLKPRKASLRMVAVE
FT                   PEDSPVLSGGQPGPHKIQGIGAGFVPDVLDRSIIDEVVTVGNQTAFDTARALARYEGIP
FT                   GGISSGAAVAAALEIGARKENEGKNIVVIVPSFAERYLSTALFEGL"
FT   CDS_pept        788780..791374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AZC_0710"
FT                   /product="ATP-binding ATPase"
FT                   /note="ATPase-like:histidine kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:AZC_0710"
FT                   /db_xref="EnsemblGenomes-Tr:BAF86708"
FT                   /db_xref="GOA:A8IPX1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_