(data stored in ACNUC1104 zone)

EMBL: AP009385

ID   AP009385; SV 1; circular; genomic DNA; STD; PRO; 3448421 BP.
XX
AC   AP009385;
XX
PR   Project:PRJDA19401;
XX
DT   04-JUN-2008 (Rel. 96, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 4)
XX
DE   Burkholderia multivorans ATCC 17616 DNA, complete genome, chromosome 1.
XX
KW   .
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-3448421
RA   Ohtsubo Y., Yuji N., Tsuda M.;
RT   ;
RL   Submitted (17-APR-2007) to the INSDC.
RL   Contact:Yoshiyuki Ohtsubo Tohoku University, Department of Environmental
RL   Life Sciences, Graduate School of Life Sciences; Katahira 2-1-1, Sendai,
RL   Miyagi 980-8577, Japan
XX
RN   [2]
RA   Ohtsubo Y., Yamashita A., Kurokawa K., Takami H., Yuhara S., Nishiyama E.,
RA   Endo R., Miyazaki R., Ono A., Yano K., Ito M., Sota M., Yuji N.,
RA   Hattori M., Tsuda M.;
RT   "Complete genome sequence of Burkholderia multivorans ATCC 17616";
RL   Unpublished.
XX
DR   MD5; fc02bb93bb290cf07f0d3c6f6464d269.
DR   BioSample; SAMD00060926.
DR   EnsemblGenomes-Gn; BMULJ_00051.
DR   EnsemblGenomes-Gn; BMULJ_00052.
DR   EnsemblGenomes-Gn; BMULJ_00054.
DR   EnsemblGenomes-Gn; BMULJ_00056.
DR   EnsemblGenomes-Gn; BMULJ_00057.
DR   EnsemblGenomes-Gn; BMULJ_00098.
DR   EnsemblGenomes-Gn; BMULJ_00114.
DR   EnsemblGenomes-Gn; BMULJ_00147.
DR   EnsemblGenomes-Gn; BMULJ_00186.
DR   EnsemblGenomes-Gn; BMULJ_00188.
DR   EnsemblGenomes-Gn; BMULJ_00326.
DR   EnsemblGenomes-Gn; BMULJ_00327.
DR   EnsemblGenomes-Gn; BMULJ_00384.
DR   EnsemblGenomes-Gn; BMULJ_00385.
DR   EnsemblGenomes-Gn; BMULJ_00386.
DR   EnsemblGenomes-Gn; BMULJ_00387.
DR   EnsemblGenomes-Gn; BMULJ_00388.
DR   EnsemblGenomes-Gn; BMULJ_00433.
DR   EnsemblGenomes-Gn; BMULJ_00511.
DR   EnsemblGenomes-Gn; BMULJ_00512.
DR   EnsemblGenomes-Gn; BMULJ_00513.
DR   EnsemblGenomes-Gn; BMULJ_00648.
DR   EnsemblGenomes-Gn; BMULJ_00726.
DR   EnsemblGenomes-Gn; BMULJ_00728.
DR   EnsemblGenomes-Gn; BMULJ_00766.
DR   EnsemblGenomes-Gn; BMULJ_00815.
DR   EnsemblGenomes-Gn; BMULJ_00830.
DR   EnsemblGenomes-Gn; BMULJ_00840.
DR   EnsemblGenomes-Gn; BMULJ_00841.
DR   EnsemblGenomes-Gn; BMULJ_00842.
DR   EnsemblGenomes-Gn; BMULJ_00856.
DR   EnsemblGenomes-Gn; BMULJ_00859.
DR   EnsemblGenomes-Gn; BMULJ_00941.
DR   EnsemblGenomes-Gn; BMULJ_00943.
DR   EnsemblGenomes-Gn; BMULJ_00945.
DR   EnsemblGenomes-Gn; BMULJ_00948.
DR   EnsemblGenomes-Gn; BMULJ_00957.
DR   EnsemblGenomes-Gn; BMULJ_00962.
DR   EnsemblGenomes-Gn; BMULJ_00963.
DR   EnsemblGenomes-Gn; BMULJ_01035.
DR   EnsemblGenomes-Gn; BMULJ_01036.
DR   EnsemblGenomes-Gn; BMULJ_01082.
DR   EnsemblGenomes-Gn; BMULJ_01083.
DR   EnsemblGenomes-Gn; BMULJ_01084.
DR   EnsemblGenomes-Gn; BMULJ_01085.
DR   EnsemblGenomes-Gn; BMULJ_01243.
DR   EnsemblGenomes-Gn; BMULJ_01254.
DR   EnsemblGenomes-Gn; BMULJ_01256.
DR   EnsemblGenomes-Gn; BMULJ_01259.
DR   EnsemblGenomes-Gn; BMULJ_01406.
DR   EnsemblGenomes-Gn; BMULJ_01438.
DR   EnsemblGenomes-Gn; BMULJ_01452.
DR   EnsemblGenomes-Gn; BMULJ_01453.
DR   EnsemblGenomes-Gn; BMULJ_01460.
DR   EnsemblGenomes-Gn; BMULJ_01470.
DR   EnsemblGenomes-Gn; BMULJ_01478.
DR   EnsemblGenomes-Gn; BMULJ_01531.
DR   EnsemblGenomes-Gn; BMULJ_01533.
DR   EnsemblGenomes-Gn; BMULJ_01556.
DR   EnsemblGenomes-Gn; BMULJ_01569.
DR   EnsemblGenomes-Gn; BMULJ_01581.
DR   EnsemblGenomes-Gn; BMULJ_01583.
DR   EnsemblGenomes-Gn; BMULJ_01616.
DR   EnsemblGenomes-Gn; BMULJ_01617.
DR   EnsemblGenomes-Gn; BMULJ_01702.
DR   EnsemblGenomes-Gn; BMULJ_01892.
DR   EnsemblGenomes-Gn; BMULJ_01893.
DR   EnsemblGenomes-Gn; BMULJ_01908.
DR   EnsemblGenomes-Gn; BMULJ_02027.
DR   EnsemblGenomes-Gn; BMULJ_02028.
DR   EnsemblGenomes-Gn; BMULJ_02029.
DR   EnsemblGenomes-Gn; BMULJ_02030.
DR   EnsemblGenomes-Gn; BMULJ_02031.
DR   EnsemblGenomes-Gn; BMULJ_02032.
DR   EnsemblGenomes-Gn; BMULJ_02033.
DR   EnsemblGenomes-Gn; BMULJ_02047.
DR   EnsemblGenomes-Gn; BMULJ_02087.
DR   EnsemblGenomes-Gn; BMULJ_02089.
DR   EnsemblGenomes-Gn; BMULJ_02128.
DR   EnsemblGenomes-Gn; BMULJ_02146.
DR   EnsemblGenomes-Gn; BMULJ_02147.
DR   EnsemblGenomes-Gn; BMULJ_02159.
DR   EnsemblGenomes-Gn; BMULJ_02160.
DR   EnsemblGenomes-Gn; BMULJ_02170.
DR   EnsemblGenomes-Gn; BMULJ_02199.
DR   EnsemblGenomes-Gn; BMULJ_02200.
DR   EnsemblGenomes-Gn; BMULJ_02201.
DR   EnsemblGenomes-Gn; BMULJ_02202.
DR   EnsemblGenomes-Gn; BMULJ_02203.
DR   EnsemblGenomes-Gn; BMULJ_02236.
DR   EnsemblGenomes-Gn; BMULJ_02349.
DR   EnsemblGenomes-Gn; BMULJ_02442.
DR   EnsemblGenomes-Gn; BMULJ_02443.
DR   EnsemblGenomes-Gn; BMULJ_02444.
DR   EnsemblGenomes-Gn; BMULJ_02613.
DR   EnsemblGenomes-Gn; BMULJ_02720.
DR   EnsemblGenomes-Gn; BMULJ_02746.
DR   EnsemblGenomes-Gn; BMULJ_02891.
DR   EnsemblGenomes-Gn; BMULJ_02898.
DR   EnsemblGenomes-Gn; BMULJ_02905.
DR   EnsemblGenomes-Gn; BMULJ_03020.
DR   EnsemblGenomes-Gn; BMULJ_03022.
DR   EnsemblGenomes-Gn; BMULJ_03023.
DR   EnsemblGenomes-Gn; BMULJ_03024.
DR   EnsemblGenomes-Gn; BMULJ_03025.
DR   EnsemblGenomes-Gn; BMULJ_03026.
DR   EnsemblGenomes-Gn; BMULJ_03027.
DR   EnsemblGenomes-Gn; BMULJ_03028.
DR   EnsemblGenomes-Gn; BMULJ_03029.
DR   EnsemblGenomes-Gn; BMULJ_03063.
DR   EnsemblGenomes-Gn; BMULJ_03117.
DR   EnsemblGenomes-Gn; EBG00001436888.
DR   EnsemblGenomes-Gn; EBG00001436889.
DR   EnsemblGenomes-Gn; EBG00001436890.
DR   EnsemblGenomes-Gn; EBG00001436891.
DR   EnsemblGenomes-Gn; EBG00001436892.
DR   EnsemblGenomes-Gn; EBG00001436893.
DR   EnsemblGenomes-Gn; EBG00001436894.
DR   EnsemblGenomes-Gn; EBG00001436895.
DR   EnsemblGenomes-Gn; EBG00001436896.
DR   EnsemblGenomes-Gn; EBG00001436897.
DR   EnsemblGenomes-Gn; EBG00001436898.
DR   EnsemblGenomes-Gn; EBG00001436899.
DR   EnsemblGenomes-Gn; EBG00001436900.
DR   EnsemblGenomes-Gn; EBG00001436901.
DR   EnsemblGenomes-Gn; EBG00001436902.
DR   EnsemblGenomes-Gn; EBG00001436903.
DR   EnsemblGenomes-Gn; EBG00001436904.
DR   EnsemblGenomes-Gn; EBG00001436905.
DR   EnsemblGenomes-Gn; EBG00001436906.
DR   EnsemblGenomes-Gn; EBG00001436907.
DR   EnsemblGenomes-Gn; EBG00001436908.
DR   EnsemblGenomes-Gn; EBG00001436909.
DR   EnsemblGenomes-Gn; EBG00001436910.
DR   EnsemblGenomes-Gn; EBG00001436911.
DR   EnsemblGenomes-Gn; EBG00001436912.
DR   EnsemblGenomes-Gn; EBG00001436913.
DR   EnsemblGenomes-Gn; EBG00001436914.
DR   EnsemblGenomes-Gn; EBG00001436915.
DR   EnsemblGenomes-Gn; EBG00001436916.
DR   EnsemblGenomes-Gn; EBG00001436917.
DR   EnsemblGenomes-Gn; EBG00001436918.
DR   EnsemblGenomes-Gn; EBG00001436919.
DR   EnsemblGenomes-Gn; EBG00001436920.
DR   EnsemblGenomes-Gn; EBG00001436921.
DR   EnsemblGenomes-Gn; EBG00001436922.
DR   EnsemblGenomes-Gn; EBG00001436923.
DR   EnsemblGenomes-Gn; EBG00001436924.
DR   EnsemblGenomes-Gn; EBG00001436925.
DR   EnsemblGenomes-Gn; EBG00001436926.
DR   EnsemblGenomes-Gn; EBG00001436927.
DR   EnsemblGenomes-Gn; EBG00001436928.
DR   EnsemblGenomes-Gn; EBG00001436929.
DR   EnsemblGenomes-Gn; EBG00001436930.
DR   EnsemblGenomes-Gn; EBG00001436931.
DR   EnsemblGenomes-Gn; EBG00001436932.
DR   EnsemblGenomes-Gn; EBG00001436933.
DR   EnsemblGenomes-Gn; EBG00001436934.
DR   EnsemblGenomes-Gn; EBG00001436935.
DR   EnsemblGenomes-Gn; EBG00001436936.
DR   EnsemblGenomes-Gn; EBG00001436937.
DR   EnsemblGenomes-Gn; EBG00001436938.
DR   EnsemblGenomes-Gn; EBG00001436939.
DR   EnsemblGenomes-Gn; EBG00001436940.
DR   EnsemblGenomes-Gn; EBG00001436941.
DR   EnsemblGenomes-Gn; EBG00001436942.
DR   EnsemblGenomes-Gn; EBG00001436943.
DR   EnsemblGenomes-Gn; EBG00001436944.
DR   EnsemblGenomes-Gn; EBG00001436945.
DR   EnsemblGenomes-Gn; EBG00001436946.
DR   EnsemblGenomes-Gn; EBG00001436947.
DR   EnsemblGenomes-Gn; EBG00001436948.
DR   EnsemblGenomes-Gn; EBG00001436949.
DR   EnsemblGenomes-Gn; EBG00001436950.
DR   EnsemblGenomes-Gn; EBG00001436951.
DR   EnsemblGenomes-Gn; EBG00001436952.
DR   EnsemblGenomes-Gn; EBG00001436953.
DR   EnsemblGenomes-Gn; EBG00001436954.
DR   EnsemblGenomes-Gn; EBG00001436955.
DR   EnsemblGenomes-Gn; EBG00001436956.
DR   EnsemblGenomes-Gn; EBG00001436957.
DR   EnsemblGenomes-Gn; EBG00001436958.
DR   EnsemblGenomes-Gn; EBG00001436959.
DR   EnsemblGenomes-Gn; EBG00001436960.
DR   EnsemblGenomes-Gn; EBG00001436961.
DR   EnsemblGenomes-Gn; EBG00001436962.
DR   EnsemblGenomes-Gn; EBG00001436963.
DR   EnsemblGenomes-Gn; EBG00001436964.
DR   EnsemblGenomes-Gn; EBG00001436965.
DR   EnsemblGenomes-Gn; EBG00001436966.
DR   EnsemblGenomes-Gn; EBG00001436967.
DR   EnsemblGenomes-Gn; EBG00001436968.
DR   EnsemblGenomes-Gn; EBG00001436969.
DR   EnsemblGenomes-Gn; EBG00001436970.
DR   EnsemblGenomes-Gn; EBG00001436971.
DR   EnsemblGenomes-Gn; EBG00001436972.
DR   EnsemblGenomes-Gn; EBG00001436973.
DR   EnsemblGenomes-Gn; EBG00001436974.
DR   EnsemblGenomes-Gn; EBG00001436975.
DR   EnsemblGenomes-Gn; EBG00001436976.
DR   EnsemblGenomes-Gn; EBG00001436977.
DR   EnsemblGenomes-Tr; BMULJ_00051-1.
DR   EnsemblGenomes-Tr; BMULJ_00052.
DR   EnsemblGenomes-Tr; BMULJ_00054.
DR   EnsemblGenomes-Tr; BMULJ_00056.
DR   EnsemblGenomes-Tr; BMULJ_00057.
DR   EnsemblGenomes-Tr; BMULJ_00098-1.
DR   EnsemblGenomes-Tr; BMULJ_00114-1.
DR   EnsemblGenomes-Tr; BMULJ_00147.
DR   EnsemblGenomes-Tr; BMULJ_00186.
DR   EnsemblGenomes-Tr; BMULJ_00188.
DR   EnsemblGenomes-Tr; BMULJ_00326.
DR   EnsemblGenomes-Tr; BMULJ_00327.
DR   EnsemblGenomes-Tr; BMULJ_00384-1.
DR   EnsemblGenomes-Tr; BMULJ_00385-1.
DR   EnsemblGenomes-Tr; BMULJ_00386-1.
DR   EnsemblGenomes-Tr; BMULJ_00387-1.
DR   EnsemblGenomes-Tr; BMULJ_00388-1.
DR   EnsemblGenomes-Tr; BMULJ_00433-1.
DR   EnsemblGenomes-Tr; BMULJ_00511.
DR   EnsemblGenomes-Tr; BMULJ_00512.
DR   EnsemblGenomes-Tr; BMULJ_00513.
DR   EnsemblGenomes-Tr; BMULJ_00648-1.
DR   EnsemblGenomes-Tr; BMULJ_00726.
DR   EnsemblGenomes-Tr; BMULJ_00728.
DR   EnsemblGenomes-Tr; BMULJ_00766-1.
DR   EnsemblGenomes-Tr; BMULJ_00815-1.
DR   EnsemblGenomes-Tr; BMULJ_00830-1.
DR   EnsemblGenomes-Tr; BMULJ_00840-1.
DR   EnsemblGenomes-Tr; BMULJ_00841-1.
DR   EnsemblGenomes-Tr; BMULJ_00842-1.
DR   EnsemblGenomes-Tr; BMULJ_00856.
DR   EnsemblGenomes-Tr; BMULJ_00859-1.
DR   EnsemblGenomes-Tr; BMULJ_00941.
DR   EnsemblGenomes-Tr; BMULJ_00943.
DR   EnsemblGenomes-Tr; BMULJ_00945.
DR   EnsemblGenomes-Tr; BMULJ_00948.
DR   EnsemblGenomes-Tr; BMULJ_00957.
DR   EnsemblGenomes-Tr; BMULJ_00962.
DR   EnsemblGenomes-Tr; BMULJ_00963.
DR   EnsemblGenomes-Tr; BMULJ_01035-1.
DR   EnsemblGenomes-Tr; BMULJ_01036-1.
DR   EnsemblGenomes-Tr; BMULJ_01082-1.
DR   EnsemblGenomes-Tr; BMULJ_01083-1.
DR   EnsemblGenomes-Tr; BMULJ_01084-1.
DR   EnsemblGenomes-Tr; BMULJ_01085-1.
DR   EnsemblGenomes-Tr; BMULJ_01243-1.
DR   EnsemblGenomes-Tr; BMULJ_01254-1.
DR   EnsemblGenomes-Tr; BMULJ_01256.
DR   EnsemblGenomes-Tr; BMULJ_01259.
DR   EnsemblGenomes-Tr; BMULJ_01406.
DR   EnsemblGenomes-Tr; BMULJ_01438.
DR   EnsemblGenomes-Tr; BMULJ_01452.
DR   EnsemblGenomes-Tr; BMULJ_01453.
DR   EnsemblGenomes-Tr; BMULJ_01460-1.
DR   EnsemblGenomes-Tr; BMULJ_01470-1.
DR   EnsemblGenomes-Tr; BMULJ_01478.
DR   EnsemblGenomes-Tr; BMULJ_01531-1.
DR   EnsemblGenomes-Tr; BMULJ_01533-1.
DR   EnsemblGenomes-Tr; BMULJ_01556-1.
DR   EnsemblGenomes-Tr; BMULJ_01569-1.
DR   EnsemblGenomes-Tr; BMULJ_01581-1.
DR   EnsemblGenomes-Tr; BMULJ_01583.
DR   EnsemblGenomes-Tr; BMULJ_01616.
DR   EnsemblGenomes-Tr; BMULJ_01617.
DR   EnsemblGenomes-Tr; BMULJ_01702.
DR   EnsemblGenomes-Tr; BMULJ_01892-1.
DR   EnsemblGenomes-Tr; BMULJ_01893-1.
DR   EnsemblGenomes-Tr; BMULJ_01908-1.
DR   EnsemblGenomes-Tr; BMULJ_02027-1.
DR   EnsemblGenomes-Tr; BMULJ_02028-1.
DR   EnsemblGenomes-Tr; BMULJ_02029-1.
DR   EnsemblGenomes-Tr; BMULJ_02030-1.
DR   EnsemblGenomes-Tr; BMULJ_02031-1.
DR   EnsemblGenomes-Tr; BMULJ_02032-1.
DR   EnsemblGenomes-Tr; BMULJ_02033-1.
DR   EnsemblGenomes-Tr; BMULJ_02047-1.
DR   EnsemblGenomes-Tr; BMULJ_02087.
DR   EnsemblGenomes-Tr; BMULJ_02089.
DR   EnsemblGenomes-Tr; BMULJ_02128-1.
DR   EnsemblGenomes-Tr; BMULJ_02146-1.
DR   EnsemblGenomes-Tr; BMULJ_02147.
DR   EnsemblGenomes-Tr; BMULJ_02159.
DR   EnsemblGenomes-Tr; BMULJ_02160.
DR   EnsemblGenomes-Tr; BMULJ_02170-1.
DR   EnsemblGenomes-Tr; BMULJ_02199-1.
DR   EnsemblGenomes-Tr; BMULJ_02200-1.
DR   EnsemblGenomes-Tr; BMULJ_02201-1.
DR   EnsemblGenomes-Tr; BMULJ_02202-1.
DR   EnsemblGenomes-Tr; BMULJ_02203-1.
DR   EnsemblGenomes-Tr; BMULJ_02236-1.
DR   EnsemblGenomes-Tr; BMULJ_02349-1.
DR   EnsemblGenomes-Tr; BMULJ_02442-1.
DR   EnsemblGenomes-Tr; BMULJ_02443.
DR   EnsemblGenomes-Tr; BMULJ_02444.
DR   EnsemblGenomes-Tr; BMULJ_02613-1.
DR   EnsemblGenomes-Tr; BMULJ_02720.
DR   EnsemblGenomes-Tr; BMULJ_02746-1.
DR   EnsemblGenomes-Tr; BMULJ_02891.
DR   EnsemblGenomes-Tr; BMULJ_02898.
DR   EnsemblGenomes-Tr; BMULJ_02905-1.
DR   EnsemblGenomes-Tr; BMULJ_03020-1.
DR   EnsemblGenomes-Tr; BMULJ_03022-1.
DR   EnsemblGenomes-Tr; BMULJ_03023-1.
DR   EnsemblGenomes-Tr; BMULJ_03024-1.
DR   EnsemblGenomes-Tr; BMULJ_03025-1.
DR   EnsemblGenomes-Tr; BMULJ_03026-1.
DR   EnsemblGenomes-Tr; BMULJ_03027-1.
DR   EnsemblGenomes-Tr; BMULJ_03028-1.
DR   EnsemblGenomes-Tr; BMULJ_03029-1.
DR   EnsemblGenomes-Tr; BMULJ_03063-1.
DR   EnsemblGenomes-Tr; BMULJ_03117-1.
DR   EnsemblGenomes-Tr; EBT00001814539.
DR   EnsemblGenomes-Tr; EBT00001814540.
DR   EnsemblGenomes-Tr; EBT00001814541.
DR   EnsemblGenomes-Tr; EBT00001814542.
DR   EnsemblGenomes-Tr; EBT00001814543.
DR   EnsemblGenomes-Tr; EBT00001814544.
DR   EnsemblGenomes-Tr; EBT00001814545.
DR   EnsemblGenomes-Tr; EBT00001814546.
DR   EnsemblGenomes-Tr; EBT00001814547.
DR   EnsemblGenomes-Tr; EBT00001814548.
DR   EnsemblGenomes-Tr; EBT00001814549.
DR   EnsemblGenomes-Tr; EBT00001814550.
DR   EnsemblGenomes-Tr; EBT00001814551.
DR   EnsemblGenomes-Tr; EBT00001814552.
DR   EnsemblGenomes-Tr; EBT00001814553.
DR   EnsemblGenomes-Tr; EBT00001814554.
DR   EnsemblGenomes-Tr; EBT00001814555.
DR   EnsemblGenomes-Tr; EBT00001814556.
DR   EnsemblGenomes-Tr; EBT00001814557.
DR   EnsemblGenomes-Tr; EBT00001814558.
DR   EnsemblGenomes-Tr; EBT00001814559.
DR   EnsemblGenomes-Tr; EBT00001814560.
DR   EnsemblGenomes-Tr; EBT00001814561.
DR   EnsemblGenomes-Tr; EBT00001814562.
DR   EnsemblGenomes-Tr; EBT00001814563.
DR   EnsemblGenomes-Tr; EBT00001814564.
DR   EnsemblGenomes-Tr; EBT00001814565.
DR   EnsemblGenomes-Tr; EBT00001814566.
DR   EnsemblGenomes-Tr; EBT00001814567.
DR   EnsemblGenomes-Tr; EBT00001814568.
DR   EnsemblGenomes-Tr; EBT00001814569.
DR   EnsemblGenomes-Tr; EBT00001814570.
DR   EnsemblGenomes-Tr; EBT00001814571.
DR   EnsemblGenomes-Tr; EBT00001814572.
DR   EnsemblGenomes-Tr; EBT00001814573.
DR   EnsemblGenomes-Tr; EBT00001814574.
DR   EnsemblGenomes-Tr; EBT00001814575.
DR   EnsemblGenomes-Tr; EBT00001814576.
DR   EnsemblGenomes-Tr; EBT00001814577.
DR   EnsemblGenomes-Tr; EBT00001814578.
DR   EnsemblGenomes-Tr; EBT00001814579.
DR   EnsemblGenomes-Tr; EBT00001814580.
DR   EnsemblGenomes-Tr; EBT00001814581.
DR   EnsemblGenomes-Tr; EBT00001814582.
DR   EnsemblGenomes-Tr; EBT00001814583.
DR   EnsemblGenomes-Tr; EBT00001814584.
DR   EnsemblGenomes-Tr; EBT00001814585.
DR   EnsemblGenomes-Tr; EBT00001814586.
DR   EnsemblGenomes-Tr; EBT00001814587.
DR   EnsemblGenomes-Tr; EBT00001814588.
DR   EnsemblGenomes-Tr; EBT00001814589.
DR   EnsemblGenomes-Tr; EBT00001814590.
DR   EnsemblGenomes-Tr; EBT00001814591.
DR   EnsemblGenomes-Tr; EBT00001814592.
DR   EnsemblGenomes-Tr; EBT00001814593.
DR   EnsemblGenomes-Tr; EBT00001814594.
DR   EnsemblGenomes-Tr; EBT00001814595.
DR   EnsemblGenomes-Tr; EBT00001814596.
DR   EnsemblGenomes-Tr; EBT00001814597.
DR   EnsemblGenomes-Tr; EBT00001814598.
DR   EnsemblGenomes-Tr; EBT00001814599.
DR   EnsemblGenomes-Tr; EBT00001814600.
DR   EnsemblGenomes-Tr; EBT00001814601.
DR   EnsemblGenomes-Tr; EBT00001814602.
DR   EnsemblGenomes-Tr; EBT00001814603.
DR   EnsemblGenomes-Tr; EBT00001814604.
DR   EnsemblGenomes-Tr; EBT00001814605.
DR   EnsemblGenomes-Tr; EBT00001814606.
DR   EnsemblGenomes-Tr; EBT00001814607.
DR   EnsemblGenomes-Tr; EBT00001814608.
DR   EnsemblGenomes-Tr; EBT00001814609.
DR   EnsemblGenomes-Tr; EBT00001814610.
DR   EnsemblGenomes-Tr; EBT00001814611.
DR   EnsemblGenomes-Tr; EBT00001814612.
DR   EnsemblGenomes-Tr; EBT00001814613.
DR   EnsemblGenomes-Tr; EBT00001814614.
DR   EnsemblGenomes-Tr; EBT00001814615.
DR   EnsemblGenomes-Tr; EBT00001814616.
DR   EnsemblGenomes-Tr; EBT00001814617.
DR   EnsemblGenomes-Tr; EBT00001814618.
DR   EnsemblGenomes-Tr; EBT00001814619.
DR   EnsemblGenomes-Tr; EBT00001814620.
DR   EnsemblGenomes-Tr; EBT00001814621.
DR   EnsemblGenomes-Tr; EBT00001814622.
DR   EnsemblGenomes-Tr; EBT00001814623.
DR   EnsemblGenomes-Tr; EBT00001814624.
DR   EnsemblGenomes-Tr; EBT00001814625.
DR   EnsemblGenomes-Tr; EBT00001814626.
DR   EnsemblGenomes-Tr; EBT00001814627.
DR   EnsemblGenomes-Tr; EBT00001814628.
DR   EuropePMC; PMC2553346; 18793444.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; AP009385.
DR   SILVA-SSU; AP009385.
DR   StrainInfo; 39670; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3448421
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /chromosome="1"
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395019"
FT   CDS_pept        complement(493..1608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00001"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2170: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00001"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41986"
FT                   /db_xref="GOA:A9AJC7"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJC7"
FT                   /protein_id="BAG41986.1"
FT                   /translation="MALETFVNSEPFTFGVELEIQVVNTHNYDLTKAASDLMRLIQGET
FT                   FPGNITPEITESMIELSTGICHTHEQALGELHAIRDVLVKAADQLNVGLAGGGTHAFQQ
FT                   WSDRQIYDAPRFQYLSELYGYLAKQFTVFGQHVHIGCPDPDSALFLLHSMSRFIPHFIA
FT                   LSASSPFVQNVDTGFHSARLNSVFAFPLSGRAPFALTWHDFEEYFTKMVNTGVVNSMKD
FT                   FYWDIRPKPGYGTIEVRVMDTPLSVDRAAAIACYIQTLARYLLIDRPLTLTEDDYLVYT
FT                   FNRFEACRFGLEGTCVNPQTGERRTIAEDILDTLDRIAPHAAELGSRAALDEIGALAKA
FT                   RVNDASWLRTVFKQEKSLNETVRQQCLRWRE"
FT   CDS_pept        complement(1626..2840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00002"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00002"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41987"
FT                   /db_xref="GOA:A0A0H3KAU6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAU6"
FT                   /protein_id="BAG41987.1"
FT                   /translation="MKSAFSFLPNWPLTPDAVFWAGLALFAAGLCGELCYRAWRLPRIT
FT                   GYAVIGLIAGSFGFGVIDSSTDETSRLLINVALGLLLFELGSRLDLRWIRRNPWLIASS
FT                   LAEATLTFVLVLFVMLALGVSGMVALVLSAIAIATSPSMVIQLKTELRAEGQVSQRLIT
FT                   LTALNSVYAIVLTKLVTSWLHQEAYGNVFATILQPVYLLVGSFIVAYLVARSCNYLFRH
FT                   MTSTMRDEHSFVALFGLVMLAIAVAQALKLSTLLTLLLAGIIVKNLEARPQLWPEHFGT
FT                   AGWLLTVVLFVLTLTSFTWSDIAIGGLFAIVLIVTRLVAKLGGVVAFAKPSGIGMKQGV
FT                   ALGIALTPMSALSYLLVDDTYQLYPNFDPHLRAIVMCTIVILQLVSPFVVYRCLSAVGE
FT                   RSDGN"
FT   CDS_pept        complement(3515..5488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00003"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4121: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00003"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41988"
FT                   /db_xref="GOA:A9AJC5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJC5"
FT                   /protein_id="BAG41988.1"
FT                   /translation="MPDRLVPATLAFRDDGTLVSPAYGDIYHSAAGAIAQANHVFVAGN
FT                   GLPARWQQRRTFTIVETGFGTGCNFLATWAAWRDDPARCERLHFVSVEKHPFSREDLRR
FT                   AAAHIVANTTISASVDALADAWPPLVPGLHRLEFDAGRVVLTLVFGDALERLPTLVARA
FT                   DAFYLDGFAPSKNADLWSIDVFRALARMADEHATFATYSSSGVVKRALDEAGFAYRKVD
FT                   GFAGKRAMLVGEYAPRWRMRRHEPPRAWPNAAARRALVIGAGVAGCAVVERLAARGWNV
FT                   TLIERHERIASEASGNPAGVFHPLMTRDDNVASRLTRAGFLYALARWRALEAGGHAFAR
FT                   STHGMVHLAESADDFARMRDAFDALGAPSDYARLLDTDAARAYLNLPVAHGGLLFPHGG
FT                   AVWPAALADAQCAAAGDRVQRLTRTEVARLERNGDEWHALDAHGRTLAQAPVVVLANAG
FT                   DAVRLAGLRHVALQPVRGQLTLLPAASASPPPCPAIGDGYAVPLDDGTLLIGATFEPDD
FT                   VDPAIRVAGHAENLERVRRLLPGLIGDVPALDTLRGRVAFRWVAGDRLPLIGPLADEAQ
FT                   AVANARALSGAKARDLPRMPGLYGAFGYGSRGLVWAALGAELIASQLDGEPWPIERELA
FT                   EAVDPARFLIRALRARQVSAAD"
FT   CDS_pept        5878..6156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="BMULJ_00004"
FT                   /product="DNA-binding protein HU-beta"
FT                   /note="COG0776: Bacterial nucleoid DNA-binding protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03530"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00004"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41989"
FT                   /db_xref="GOA:A0A0H3KFG7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFG7"
FT                   /protein_id="BAG41989.1"
FT                   /translation="MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLI
FT                   GFGSFGSGKRAARTGRNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR"
FT   CDS_pept        complement(6272..7573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00005"
FT                   /product="cobalamin biosynthesis protein"
FT                   /note="COG0523: Putative GTPases (G3E family), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00005"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41990"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB05"
FT                   /protein_id="BAG41990.1"
FT                   /translation="MKQPLPVTVLSGFLGAGKTTLLNHILANRAGLKVAVIVNDLAAVN
FT                   IDASIVRDAQALSHVEERLVEMSNGCICCTLRDDLLVEIRQLAAEGRFDAIVIESTGIA
FT                   EPMPIAETFTFVDDDGTSLGDTARLDTLVTVVDAFNFLRDYGSDDALATRGIAASEDDD
FT                   RTLVELLIEQIEFCDVLVINKADLVSADELARLQHILARLNPRAHQVVSTFGNVPLDAV
FT                   LNTGRFDFDEAANAPGWLASLDRDHAYCDDPDCDAHHHAHVHGEADEFGIANFVYRARR
FT                   PFHPARLWALLHQQWPGVLRSKGFFWLATRNDIAGSLSQAGGVCRHGPAGLWWAAQDRA
FT                   EWPDDDELLAEIRTEWEGDFDDRSIGDRRQELVLIGIALDADAWRAKLDACLLTDAEFA
FT                   LGAAGWAAFDDPFPAWDVDAHDDEDPGDAQIVRP"
FT   CDS_pept        complement(7737..8159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00006"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0741: Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains), Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00006"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41991"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJD3"
FT                   /protein_id="BAG41991.1"
FT                   /translation="MWIAAGAWFASANAHADCFDEAARYQKVNPLILRAIAWQESRNRP
FT                   SALNKNTNGSVDYGLMQINSVHLSTLSRYGIDRDTLMEPCKNVYIAAWHLRQKMNRYGN
FT                   TWQAVGAYHSETPALRDKYARQIAAILAQWKLLPPQ"
FT   CDS_pept        8567..10873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="BMULJ_00007"
FT                   /product="general secretion pathway protein D"
FT                   /note="COG1450: Type II secretory pathway, component PulD,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K02453"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00007"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41992"
FT                   /db_xref="GOA:A0A0H3KB12"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB12"
FT                   /protein_id="BAG41992.1"
FT                   /translation="MRRVATTLIIAGIIGSQAAYAQVTLNFVNADIDQVAKAIGAATGK
FT                   TIIVDPRVKGQLNLVAERSVPEDQALKTLQSALRMQGFALVQDHGVLKVVPEADAKLQG
FT                   VPTYVGNVPRARGDQVITQVFELHNESANNLLPVLRPLISPNNTVTAYPANNSIVVTDY
FT                   ADNVRRIAQIIAGVDSAAGAQVQVVPLRNANAIDLASQLQKMLDPGAIGNSDATLKVSV
FT                   TADPRTNSLLLRASNASRLAAAKRLVQQLDAPSAVPGNMHVVPLRNADAVKLAKTLRGM
FT                   LGKGGNDTGSSASSNDANSFNQNGSSSSGNFSTGTAGTPPLPSGGLGGTSSSSSYGGTS
FT                   SSGGLGNAGLLGGDKDKNDDNQPGGMIQADAATNSLIITASDPVYRNLRAVIDQLDKRR
FT                   AQVYIEALIVELNSTTAGQLGIQWQVASGALLAGTNLAATAGSVAGNSIINLTTGSVNS
FT                   STGTATGVGLPANLANLNQGLNIGWLHNMFGVQGLGALLQYFAGVSDANVLSTPNLITL
FT                   DNEEAKIVVGENVPIPTGSYSNLTSGTTSNAFNTYDRRDVGLTLHVKPQITDGGILKLQ
FT                   LYTEDSAVDTATTNSQTGPSFTKRSIQSTILADNGEVIVLGGLMQDAYNVSNSKVPLLG
FT                   DIPWIGQLFRSESKQRKKTNLMVFLRPVIIADRDTAQAVTSNRYDYIQGVTGAYKSDNN
FT                   VIRDKDDPVVPPMPLGPSQGGTAAGNLFDLDKMRRQQMQRQIAPPAAEQAPAQSQGVPA
FT                   QTVPQQPLTAPGASQ"
FT   CDS_pept        10870..12366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="BMULJ_00008"
FT                   /product="general secretion pathway protein E"
FT                   /note="COG2804: Type II secretory pathway, ATPase PulE/Tfp
FT                   pilus assembly pathway, ATPase PilB, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02454"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00008"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41993"
FT                   /db_xref="GOA:A0A0H3KAV2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAV2"
FT                   /protein_id="BAG41993.1"
FT                   /translation="MSDLLSSAHDGAPGERQPPSPLAARLLPYGFAKNGQVLIAHQLDD
FT                   TLEVWISDRTNDAALAEIARNFGSIVVQRVPADELAQAINHAYARQDGSAAQIVGEVEG
FT                   EVDLSRLMQDIPEVEDLLESEDDAPIIRMINALLTQAAREQASDIHIEPFENASVVRFR
FT                   VDGTLRDVVRPKKALHGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLP
FT                   TGHGERAVLRLLEKDAQRLNLEALGMGRDTLVQFDKLISRPHGIVLVTGPTGSGKTTTL
FT                   YASMSRLETATTNIMTVEDPIEYDLSGIGQTQVNERIGMTFARALRSILRQDPDVIMIG
FT                   EIRDLETAQIAVQASLTGHLVLATLHTNDAASAVTRLTDMGVEPYLLASSLLGVLAQRL
FT                   VRQLCPVCKEERHEDGRSVWHPVGCDKCGHSGYTGRRGVYELLIVDDAIRTLIHRNAAD
FT                   AEILAAGRAQGMRTLRDDAERWLAAGATSLEEVLRVTGGA"
FT   CDS_pept        12371..13588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="BMULJ_00009"
FT                   /product="general secretion pathway protein F"
FT                   /note="COG1459: Type II secretory pathway, component PulF,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K02455"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00009"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41994"
FT                   /db_xref="GOA:A0A0H3KFH1"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFH1"
FT                   /protein_id="BAG41994.1"
FT                   /translation="MPAFRFEAIDAAGRTQKGVVDADSARAARGQLRTQGLTPLVVEPA
FT                   GSATRGARSQRLALGRKLSQREQAILTRQLASLLIAGLPLDEALGVLTEQSERDYIREL
FT                   MAAIRAEVLGGHSLANALSQHPRDFPEIYRALVSAGEHTGKLGIVLSRLADYIEQRNAL
FT                   KQKILLAFTYPAIVTVIAFGIVTFLLSYVVPQVVNVFASTKQQLPLLTIVMMALSGFVR
FT                   HWWWAILIAVALVVWFVKATLSRAGPRLAFDRWLLTAPLAGKLVRGYNTVRFASTLGIL
FT                   TAAGVPILRALQAAGETLSNRAMRANIDDAIVRVREGSALSRALNNVKTFPPVLVHLIR
FT                   SGEATGDVTTMLDRAADGEARELERRTMFLTSLLEPLLILAMGGIVLVIVLAVMLPIIE
FT                   LNNMVQ"
FT   CDS_pept        complement(13619..14029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="BMULJ_00010"
FT                   /product="general secretion pathway protein C"
FT                   /note="KEGG, K02452"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB11"
FT                   /protein_id="BAG41995.1"
FT                   /translation="MNALSIRILSLALFAALCATATYWVVTLSAREAPLPAAAARPPIR
FT                   TEDAAALFGGQLERNPVQDIHLFGILALQHGGAAIVGVGGEPPRAVSLGAELTPGAKLA
FT                   EVRNRSIVVERNGARAEIQLPANTPSPAIYMR"
FT   CDS_pept        14207..14659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="BMULJ_00011"
FT                   /product="general secretion pathway protein G"
FT                   /note="COG2165: Type II secretory pathway, pseudopilin
FT                   PulG, Ralstonia solanacearum"
FT                   /note="KEGG, K02456"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00011"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41996"
FT                   /db_xref="GOA:A0A0H3KJD8"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJD8"
FT                   /protein_id="BAG41996.1"
FT                   /translation="MQTWITRRNGAVRRQRGFTLIEIMVVVAILGILAALIVPKIMSRP
FT                   DEARRIAAKQDIGTIMQALKLYRLDNGRYPTQEQGLNALIQKPSTDPIPNNWKDGGYLE
FT                   RLPNDPWGNPYKYLNPGVHGEIDVFSYGADGKEGGDGNDTDIGSWQ"
FT   CDS_pept        14699..15331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="BMULJ_00012"
FT                   /product="general secretion pathway protein H"
FT                   /note="COG2165: Type II secretory pathway, pseudopilin
FT                   PulG, Ralstonia solanacearum"
FT                   /note="KEGG, K02457"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00012"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41997"
FT                   /db_xref="GOA:A0A0H3KB18"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB18"
FT                   /protein_id="BAG41997.1"
FT                   /translation="MLALRTTYRSGCHGGLRRAAASTVRACAAAEPGSRRRLAKSAGPC
FT                   AASPAFGGQRTQHRRRAARGFTLLEMLVVLVIAGLLVSLASLSLTRNPRTDLREEAQRL
FT                   ALLFETAGDEAQVRARPIAWQPTAHGFRFDVSSSDGWRTLHDDLLRPRDWDGGVTGADI
FT                   DYPGSDTRASRVVFGTESIDTPVRVTLHSAVGSATIVGTGNGRYEVQ"
FT   CDS_pept        15346..15771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="BMULJ_00013"
FT                   /product="general secretion pathway protein I"
FT                   /note="COG2165: Type II secretory pathway, pseudopilin
FT                   PulG, Ralstonia solanacearum"
FT                   /note="KEGG, K02458"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00013"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41998"
FT                   /db_xref="GOA:A0A0H3KAV6"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAV6"
FT                   /protein_id="BAG41998.1"
FT                   /translation="MRRPARSPRIAGALRMRGAARGFTMIEVLVALAIIAVALAASIRA
FT                   VGTMATGASELHRRLLAGWSADNALAQLRLAHAWPQIGEQNFDCSQGNVPLVCTQRVSA
FT                   TPNPVFRRVEVSVSMPGRSGVLAQMVTVVANETSRSL"
FT   CDS_pept        15749..16444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="BMULJ_00014"
FT                   /product="general secretion pathway protein J"
FT                   /note="KEGG, K02459"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00014"
FT                   /db_xref="EnsemblGenomes-Tr:BAG41999"
FT                   /db_xref="GOA:A0A0H3KFH5"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFH5"
FT                   /protein_id="BAG41999.1"
FT                   /translation="MKPAVRSDAPMPRPFARASRARGFTLIELMIAIAILAVVAVLAWR
FT                   GLDQIMRGRDKVASAMEDERVFAQMFDQMRIDARLAATDDEAGQPAIGVAGNTLQIIRA
FT                   LDVPGAAPRLQVVRYRIAGGRVVRYASPPLDDANRLHALLKDSSVDGWSAVALMGGVGA
FT                   IDAKLYVPRVGWTTSVQAANDALAQNNDALKVPQIGNAPPPRAVTGLQVSIGATSLRVP
FT                   ITRVFLVGE"
FT   CDS_pept        16451..17575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="BMULJ_00015"
FT                   /product="general secretion pathway protein K"
FT                   /note="COG3156: Type II secretory pathway, component PulK,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K02460"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00015"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42000"
FT                   /db_xref="GOA:A0A0H3KB15"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB15"
FT                   /protein_id="BAG42000.1"
FT                   /translation="MRTRPHLSMPERRACRRAHGLPRGERGAAIITALLVVALAAILVS
FT                   GMLWRQQVQVRRIENQRMLAQAQWVARGALDWTRMILRSEGDTAPGITYLGGIWAVPIA
FT                   KTKLSDFLGRIGAPNQGGDDTYISGSIEDAQAKFNLRNLIASPAPGVLQLNVAQLAAFQ
FT                   RLLTTLGYDGAFAKRIALQVRAGLMHSATRFQLPTLPGGGMAPTAPVTGGDTQAGGFTD
FT                   DPGLADSERGPAPLTMTSVDSLLDVDGVTPEMVARLRPFVTVLPTTTPVNMNTAPAEVI
FT                   AALVPGMSVSSAQALVSRRETVFFRNVGDVQLALRGAGAPGVQLDASLIDVNSSYFVVH
FT                   GRIQHDRAEVDRTSLVYRDPTTHSTRVVRIRDQL"
FT   CDS_pept        17600..19006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="BMULJ_00016"
FT                   /product="general secretion pathway protein L"
FT                   /note="KEGG, K02461"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00016"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42001"
FT                   /db_xref="GOA:A0A0H3KJE5"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJE5"
FT                   /protein_id="BAG42001.1"
FT                   /translation="MSTLIVSLPPREPAVPLQEWQWPELPFMLVDKAGHVQRAGRAALS
FT                   LLPRASATVLIVAARDVLLLAASVPPLKGPKLRQALPNIVEDQLIQDPLGCHIALDPVA
FT                   LPDGRRVLGVVDRAWFRAICDAFTAAGHRQLRAVPATRCLPAPLAAAPAPSAVPSDDDA
FT                   PDIAAAADGLPLGSSTGTPSAEPLVRPAAVAAVLGVATSVEPALVEAGAQPLAASAPRL
FT                   ELAIARGALGEGFAAPAARAPGTLAALAGGGAVELYELGEPGAEPRVASAGRAGGAPLL
FT                   PGAMPLSFDAFARRALAERFDLCQFEFESQPWRFDRATLKRLRLPIALAAATLGIAVIG
FT                   MNLHWWKLSRERDALSAQITETLLSAFPKTTTVLDPPAQMQRQLDQLRLAAGELSPNDF
FT                   LALSSGLARSMGALPLNGIASLDYHDRRLDVGFKPEVKVDPDFPQRLARNGLAGEVDSN
FT                   TGKWTIRSRS"
FT   CDS_pept        19003..19509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="BMULJ_00017"
FT                   /product="general secretion pathway protein M"
FT                   /note="COG3149: Type II secretory pathway, component PulM,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K02462"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00017"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42002"
FT                   /db_xref="GOA:A0A0H3KB24"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB24"
FT                   /protein_id="BAG42002.1"
FT                   /translation="MNTERLTQALTQFWGERTPREKTLLGWGGAVLAVAIAYSVLWSPA
FT                   QEGRARIERELPTMRRELAQMTAQANEAKSLTAAAQGVAPTGLALKDALAASLSDHGLP
FT                   GAQVQIVGNGVQIQMKNVSFPAWTQWLDDVRRQLKAQVGEAHVSALKEDGQVDLTAVMQ
FT                   PSMPK"
FT   CDS_pept        19541..20329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="BMULJ_00018"
FT                   /product="general secretion pathway protein N"
FT                   /note="KEGG, K02463"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00018"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42003"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAV9"
FT                   /protein_id="BAG42003.1"
FT                   /translation="MNRWTMRLVAALPWVAVGALATAITLIALAPAAWIAPQFARATGG
FT                   HVNLVDPAGSLWHGSATLMLAPGADQSASTLLPGRVEWTTRFWPLLTGRVQMRLRQTDA
FT                   MPQPVTLDATWRGAVLSAGAMAVPASLLAGLGTPFNTLDLQGDVRLGWTDWRLIGRNAF
FT                   GQLTVTIDGMSSRVSRVKPLGSYRAVLQAKGTGADLDLTTTQGPLFLDGHGTFGPGSGA
FT                   FRGTAHAAPEQQANLAGLLNLLGRPIGNGQVSLIYGGAMR"
FT   CDS_pept        complement(20375..21958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00019"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00019"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42004"
FT                   /db_xref="GOA:A0A0H3KFH9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFH9"
FT                   /protein_id="BAG42004.1"
FT                   /translation="MPYAPLPRALRPLSAAVAVATAVLLAGCAVGPDYHRPDTSIPAAF
FT                   KEAPAGWKVAQPADRADRGPWWTVYDDPQLNALIDKLNASNQTIAQSAAAYRQARALVS
FT                   EARAAYFPTVGLSASGSRARTPRSSFSSGTSSSFGSSTSGSINNSYSVGLDASWEPDLW
FT                   GKVSRTVSAQRAGEAAAAADLANARLSQQALLAQTYFQLRTSDALQKLLDETVQSYRQS
FT                   LQLTQNQYAQGVAARADVIQAQTQLQSAQAAAIDNGVARAQYEHAIATLIGEPASTFSL
FT                   PPMPLTAEPPITPVDVPSTLLERRPDIAAAERRAAAANEQIGVAISAFFPTLTLSASGG
FT                   FESSVWSQLFTLPARFWTVGPQLAATLFDAGLRAAQTQAARATYDQDVAAYRLAVLSAF
FT                   QDVEDNLASQRILAQEIDVQRQAVESAEHALAIVTNQYKAGTVAYLNVLTAQTTAFTAR
FT                   QKLATITGQRMVSSVGLVKALGGGWNVSDIARETGDMAAPAAVPASGAAAASAVSAVSA
FT                   APAPGTLARQ"
FT   CDS_pept        complement(22154..22438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00020"
FT                   /product="putative ABC-type multidrug/protein/lipid
FT                   transport system ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42005"
FT                   /db_xref="GOA:A0A0H3KB21"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB21"
FT                   /protein_id="BAG42005.1"
FT                   /translation="MFAMLFLKNAAGALRRTLTDTAHHVFSGPHRGWKIALYVAMLVLP
FT                   GGSLAALGFAWFDHRRQRNAKGASRRTPERAATEPPSWRLAAQPLPVRR"
FT   CDS_pept        22603..23091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00021"
FT                   /product="MarR family transcriptional regulator"
FT                   /note="COG1846: Transcriptional regulators, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03712"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00021"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42006"
FT                   /db_xref="GOA:A0A0H3KJF0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJF0"
FT                   /protein_id="BAG42006.1"
FT                   /translation="MAGGLYDPDSIELETSLGYYLTKARQVLFERMDRALEPFDLTAQQ
FT                   IGVILLLSRGYARTPFELSRKMAYDSGSMTRMLDRLERKGLIARSRSEQDRRMIELALT
FT                   ERGADAARALPSLIATALNAQLAGFSTDELATLTALLQRFIENGPGPAGCPKPDDGHD"
FT   CDS_pept        23252..24814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrB"
FT                   /locus_tag="BMULJ_00022"
FT                   /product="multidrug resistance protein B"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Escherichia coli O157:H7"
FT                   /note="KEGG, K03446"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00022"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42007"
FT                   /db_xref="GOA:A0A0H3KB29"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB29"
FT                   /protein_id="BAG42007.1"
FT                   /translation="MSATTASAASPAAEPAPLSGGALALLTVGLALGTFMEVLDTSIAN
FT                   VAVPTISGSLGVATSEGTWVISSYSVASAIAVPLTGWLARRVGEVRLFTLSVLAFTIAS
FT                   ALCGLASNFETLIAFRLLQGLVSGPMVPLSQTILMRSYPPAKRGLALGLWAMTVIVAPI
FT                   FGPLLGGWISDNYTWPWIFYINLPIGIFSATCAFFLLRGRETKTTKQRIDAVGLALLVI
FT                   GVSCLQMMLDLGKDRDWFNSSFIVALALIAVVSLAFMLVWEATEKEPVVDLTLFKDRNF
FT                   ALGALIISFGFMAFFGSVVVFPLWLQTVMGYTAGKAGLATAPVGLLALVLSPLIGRNMH
FT                   RLDLRMVASFAFIVFAIVSVWNSTFTLDVPFNHVILPRLVQGIGVACFFVPMTTITLSS
FT                   IPDERLASASGLSNFLRTLSGAIGTAVSSTFWENDAIYHHARLAESVSVYAQNTTDYQG
FT                   ALAQLGVVGQTANAQLNQIVTQQGFMMATNDFFHLSAIVFVALAALVWITKPKKGAGPA
FT                   MGH"
FT   CDS_pept        complement(24903..25829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00023"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Salmonella
FT                   typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00023"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42008"
FT                   /db_xref="GOA:A0A0H3KAW3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAW3"
FT                   /protein_id="BAG42008.1"
FT                   /translation="MELRALRYFIEVVRQQSFTAAADKLFVTQPTISKMVKALEDEIGS
FT                   PLLLRDGRQMVLTDAGRIVFQRGQDVLAAQAQLQSELNDLGTLGRGELTIGIPPLGGSL
FT                   FTPIIAAYKQRYPNIELKLFEQGARMIEAALMSGELELGGLLEPVDPATFERLPMVRAP
FT                   LWLVAPRESRWEDHAAVPLADLARESFVFYAESLALHDAVLDACRQAGFTPSIVSRSGH
FT                   WDFMAALVHAGVGIALLPEPYCRRLDAGQFTCRPIVEPEIMWAIALGWVKKGYLSHAAR
FT                   AWLEVARATLPIAPGDDLAFGGLRARE"
FT   CDS_pept        25969..26415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cidA"
FT                   /locus_tag="BMULJ_00024"
FT                   /product="holin-like protein"
FT                   /note="COG1380: Putative effector of murein hydrolase LrgA,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K06518"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00024"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42009"
FT                   /db_xref="GOA:A0A0H3KFI3"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFI3"
FT                   /protein_id="BAG42009.1"
FT                   /translation="MNRPTAVPARPAGAAHAGRIALQAAALGVLWLAVDWAVRAVGLPV
FT                   PSGVIGLAVLLVLLFSGRVAPTWVKDGANWLLSDMLLFFVPAAVAAVQYGGLFREDGWR
FT                   LALVVVAGTAFVMVAVAVAVDLAARLERRFVVQRVYAERRRARA"
FT   CDS_pept        26441..27163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00025"
FT                   /product="LrgB-like protein"
FT                   /note="COG1346: Putative effector of murein hydrolase,
FT                   Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00025"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42010"
FT                   /db_xref="GOA:A0A0H3KB25"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB25"
FT                   /protein_id="BAG42010.1"
FT                   /translation="MFAALSNLPADRVNAAISFGCFVLTVALYFASKRLYAYKKTLLFS
FT                   PLVFVPGVLVLLVLLTGIPYSVYFRDTRWLMWLLGPATIAFAVPIYDYRDLIRRHWLSL
FT                   SVGVAVGIGAGVCGSLLLAKLLHLSPELQRSLMTRSVSTPFALAVSDKIHAPKDLTALF
FT                   VIATGICGMLLGEIVLALVPMRTRLARGALFGAAAHGVGTAKAREIGSEEGVVSSLTMM
FT                   IAGVAMVLIAPLLSRLPI"
FT   CDS_pept        27242..27775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="BMULJ_00026"
FT                   /product="flagellar FliL protein"
FT                   /note="COG1580: Flagellar basal body-associated protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K02415"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00026"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42011"
FT                   /db_xref="GOA:A0A0H3KJF5"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJF5"
FT                   /protein_id="BAG42011.1"
FT                   /translation="MHATSHHARIHMASTTANPPADKPASSGKFKRIALIAVIALGAAA
FT                   AAAAGMYVFMGRQGATHASAAEPAPLAAPVFFPLDPLTVNLQSDDGVQHYLRVGLSLKL
FT                   TDPKAQEQLTARMPEIRSRVLLALSNKHPEDIATPDGKQALAQQLRNLIEEPTQPGNQR
FT                   TKVDDVLFTEFVVQ"
FT   CDS_pept        27798..28796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="BMULJ_00027"
FT                   /product="flagellar motor switch protein"
FT                   /note="COG1868: Flagellar motor switch protein, Ralstonia
FT                   solanacearum"
FT                   /note="FliM protein"
FT                   /note="KEGG, K02416"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00027"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42012"
FT                   /db_xref="GOA:A0A0H3KB33"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB33"
FT                   /protein_id="BAG42012.1"
FT                   /translation="MGHEEFMSQEEVDALLKGVTGESDTVDEERDTAGVRPYNIATQER
FT                   IVRGRMPGLEIINDRFARLLRIGIFNFMRRTAEISVSQVKVQKYSEFTRNLPIPTNLNL
FT                   VHVKPLRGTSLFVFDPNLVFFVVDNLFGGDGRFHTRVEGRDFTATEQRIIGKLLNLVFE
FT                   HYTVAWKSVRPLQFEFVRSEMHTQFANVATPNEIVIVTQFSIEFGPTGGTLHICMPYSM
FT                   IEPIRDVLSSPIQGEALEVDRRWVRVLSQQVQAAEVELTADLAEIPTTFEKILNLRAGD
FT                   VLPLDIADTITAKVDGVPVMECGYGIFNGQYALRVQKMISASDTMKEGGYD"
FT   CDS_pept        28789..29268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="BMULJ_00028"
FT                   /product="flagellar motor switch protein"
FT                   /note="COG1886: Flagellar motor switch/type III secretory
FT                   pathway protein, Ralstonia solanacearum"
FT                   /note="FliN protein"
FT                   /note="KEGG, K02417"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00028"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42013"
FT                   /db_xref="GOA:A0A0H3KAW7"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAW7"
FT                   /protein_id="BAG42013.1"
FT                   /translation="MTELNPTPELDPQALADAALADSAGAQQAADADPAMDDWAAALAE
FT                   QNHQPVQAGATGAGVFQPLSKAAASSTHNDIEMILDIPVKMTVELGRTKIAIRNLLQLA
FT                   QGSVVELDGLAGEPMDVLVNGCLIAQGEVVVVNDKFGIRLTDIITPSERIRKLNR"
FT   CDS_pept        29265..29840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /locus_tag="BMULJ_00029"
FT                   /product="flagellar protein"
FT                   /note="FliO protein"
FT                   /note="KEGG, K02418"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00029"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42014"
FT                   /db_xref="GOA:A0A0H3KFI7"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFI7"
FT                   /protein_id="BAG42014.1"
FT                   /translation="MSVAPSGRRAAFAAAAACAASAVGMPACAADLNAVNHAGTIASSV
FT                   VVGSAAPSLGVGAVLQTLVGLAVVIGLVFGCAWLARRFGFQPARRGGPLKVVSSVAVGA
FT                   KESATIVEIGDTWLVLGVAPGNVRLLHTLPAGSAAVASTDAAAGVAPSGRAAPGTGGLS
FT                   VNGASFGARFRDALAGEAAKRLGRGKER"
FT   CDS_pept        29882..30643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="BMULJ_00030"
FT                   /product="flagellar biosynthetic protein"
FT                   /note="COG1338: Flagellar biosynthesis pathway, component
FT                   FliP, Escherichia coli O157:H7"
FT                   /note="FliP protein"
FT                   /note="KEGG, K02419"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42015"
FT                   /db_xref="GOA:A0A0H3KB30"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB30"
FT                   /protein_id="BAG42015.1"
FT                   /translation="MNHVFLRRAARIVPALLLGLAPALACAQAAGLPAFNASPGPNGGT
FT                   TYSLSVQTMLLLTMLSFLPAMVLMMTSFTRIIIVLSLLRQALGTATTPPNQVLVGLALF
FT                   LTFFVMSPVLDRAYTDGYKPFSDGTLPMEQAVQRGVAPFKGFMLKQTRETDLALFAKIS
FT                   KAAPMQGPEDVPLSLLVPAFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSMGMMMVS
FT                   PSTVSLPFKLMLFVLVDGWQLLIGSLAQSFT"
FT   CDS_pept        30660..30932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="BMULJ_00031"
FT                   /product="flagellar biosynthetic protein"
FT                   /note="COG1987: Flagellar biosynthesis pathway, component
FT                   FliQ, Ralstonia solanacearum"
FT                   /note="FliQ protein"
FT                   /note="KEGG, K02420"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00031"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42016"
FT                   /db_xref="GOA:A0A0H3KJG0"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJG0"
FT                   /protein_id="BAG42016.1"
FT                   /translation="MTPEQVMTLAHQAMMVGLLLAAPLLLVALAVGLVVSLFQAATQIN
FT                   EATLSFIPKLLAVAATLVIAGPWMLTTMLDYLRQTLLHVATLGAG"
FT   CDS_pept        30956..31738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="BMULJ_00032"
FT                   /product="flagellar biosynthetic protein"
FT                   /note="COG1684: Flagellar biosynthesis pathway, component
FT                   FliR, Yersinia pestis"
FT                   /note="FliR protein"
FT                   /note="KEGG, K02421"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00032"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42017"
FT                   /db_xref="GOA:A0A0H3KB38"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB38"
FT                   /protein_id="BAG42017.1"
FT                   /translation="MFSVTYAQLNGWLTAFLWPFVRMLALVATAPVVGHASVPARVKIG
FT                   VAAFMALIVAPTLGPMPAVTVFSAEGIWIVVTQFLIGTAMGFTMQIVFAAVEAAGDFIG
FT                   LSMGLGFATFFDPHSSGATPVMGRFLNAVAMLAFLAVDGHLQVLAALTASFQSLPVSAD
FT                   LLHAPGWRTLATFGATVFGMGLLLALPVVAALLIANLALGILNRAAPQIGVFQVGFPVT
FT                   MLVGLLLVQLMVPNLVPFVSRLFDMGLDAIGRVVLGWR"
FT   CDS_pept        complement(31837..32322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00033"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42018"
FT                   /db_xref="GOA:A0A0H3KAX1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAX1"
FT                   /protein_id="BAG42018.1"
FT                   /translation="MAAIFPVAAVARLIAHGPLVASALLTWMLTYLVGILIWFAQYFFD
FT                   FSPEVFVGPRIIRDDLATRLLLGSLIAPIVETFLFQWLPIRTLRRVFKARTWLAVSVST
FT                   LAFAAAHGYSLLYVVVALWGGLVFAAVFVLRDYPGGHPFWAVAIAHAARNTLASSIL"
FT   CDS_pept        32886..33890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuA"
FT                   /locus_tag="BMULJ_00034"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   substrate-binding protein"
FT                   /note="COG0715: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems, periplasmic components, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02051"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00034"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42019"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFJ1"
FT                   /protein_id="BAG42019.1"
FT                   /translation="MRPILRTLAVAASLSCALAAHPALADDGGKITIMVGGIAKLIYLP
FT                   ARLTQELGYFKAEGLDVELLSQPAGVDAENELLAGAVQAVVGFYDHTIDLQSKGKDVKA
FT                   IAVFGQVPGEVEMVSTKAAPTFKSMADAKGKTLGVTGLGSSTSFLTQYLALQHGVPSTQ
FT                   YTMLPVGADASFIAAIKQGRIDAGMTTEPTVSALEKMGDAKVLVDMRTVDGTRAALGGT
FT                   YPAASLYVQSAWADSHKAQATKLAHAFAKTMQFIHTHSAEEIAAKMPADYQKDKALYVA
FT                   ALKASLPMYTADGKMPADGPATVLKVLSAFNPSVKGKHIDLARTYTNEFVAAK"
FT   CDS_pept        33998..34795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="BMULJ_00035"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   ATP-binding protein"
FT                   /note="COG1116: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, ATPase component, Mesorhizobium loti"
FT                   /note="KEGG, K02049"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00035"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42020"
FT                   /db_xref="GOA:A0A0H3KB36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB36"
FT                   /protein_id="BAG42020.1"
FT                   /translation="MNQAVSASTPAIEFRNVSCRFISPEGKATVALREFSMSVARGEFI
FT                   AIVGPTGCGKSTTLNLITGLLKPASGEVRVMGRPVDGIDPRIGFVFQADAVFPWRNVID
FT                   NVAAGPLFRGRSKDVAYAQAEEWIRKVGLDKFTKHYPHQLSGGMRKRVALAQTFINQPE
FT                   ILLMDEPFSALDMQTRTLMQDELLQLWSANKGSVVFVTHDLEEAIALADRVFVLTARPA
FT                   TLKRVYSIDLPRPRVMSEVRYDARFIEISKDIWHDLREEVQIG"
FT   CDS_pept        34812..35669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="BMULJ_00036"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   permease protein"
FT                   /note="COG0600: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, permease component, Mesorhizobium loti"
FT                   /note="KEGG, K02050"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00036"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42021"
FT                   /db_xref="GOA:A0A0H3KJG6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJG6"
FT                   /protein_id="BAG42021.1"
FT                   /translation="MTDMTLPPTALPATPLEDDERAAQRRLRRRRTLIVTLRIAVLVVV
FT                   LGGWELAARLKWIDPFFFSMPSLIFDQIRDWFVNGTSQGPLLTQVWVTLEETAIGFLIG
FT                   SVAGVICGIVLGRNKLMADVFGLYIQIANSIPRVVLGSVFVIALGLGMASKIALAVVMV
FT                   FFVVFGNAFQGVREADRYLIANAQILGASRRQITTAVVIPSALSWILASLHVSFGFALV
FT                   GAVVGEFLGSKQGIGLLISTAQGAFNASGVFAAMIVLAVVALAADYLLTWVEKRLLKWR
FT                   PAAF"
FT   CDS_pept        35755..37122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00037"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00037"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42022"
FT                   /db_xref="GOA:A0A0H3KB43"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB43"
FT                   /protein_id="BAG42022.1"
FT                   /translation="MAHSLRGRLLWWLLLPLAVFVLIAAAMAYDAARRTADLVQDSTLV
FT                   ASARTIGEDIEWRNGLPVADVPPAALEIFESPSRDSVFYKVIDGDGRLLAGNPALDVVA
FT                   RHGAEPVSYDTTLDGMRLRAVAYDRQLYDEGQVDTVTVVVAKTTRSRNAMVATIWRPQL
FT                   VRLALMLVLAVALVYLGLTFELRPLMKLKDDVADRGPMELEPIRPERLQHELRPIVDAI
FT                   NQCIARLNTHTATQRRFIADAAHQLRTPIAVLDTQIQYAQQRGNDDRELASVLDSMQRS
FT                   SRKMADVTDKLLLLAHAEATPSTLLTQRVDLAALVSSVLEETIVLAQRRDIDLGAELGE
FT                   RLDVAGSGSLLSALVTNLVDNAVRYTQPGGCVTVAARRDGDTVVLDVIDDGPGIPAEAR
FT                   PHVFKRFYRVSSDTEGSGLGLAIVSEIAQAHGGSATLAPGPGNRGVVVTVRLPAYD"
FT   CDS_pept        37136..37813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00038"
FT                   /product="signal transduction response regulator"
FT                   /note="COG0745: Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00038"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42023"
FT                   /db_xref="GOA:A0A0H3KAX5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAX5"
FT                   /protein_id="BAG42023.1"
FT                   /translation="MKLLLVEDNAELAHWIVNLLRGEDFAVDCVGDGERADTVLKTERY
FT                   DAVLLDMRLPGISGKEVLARLRRRNDNVPVLMLTAHGSVDDKVDCFGAGADDYVVKPFE
FT                   SRELVARIRALIRRQAGVGSTQLVCGDLVYAFGTREFRCGDAPLVLRRREHAILETLML
FT                   QQNKTVSKARLMDSVFALDDEPSADAIDIYIHRLRKHLAASSAEIITLRGLGYILRAKA
FT                   GTA"
FT   CDS_pept        38089..39222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00039"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00039"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42024"
FT                   /db_xref="GOA:A0A0H3KFJ7"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFJ7"
FT                   /protein_id="BAG42024.1"
FT                   /translation="MLKRKTLTLSVAAAGLCAATGAYAQSSVQLYGLMDLSFPTYRTHA
FT                   DANGKHVIGMGNDGEPWFSGSRWGLKGAEDIGGGTKIIFRLESEYVVANGQMEDEGQIF
FT                   DRDAWVGVEDERFGKLTAGFQNTIARDAAAIYGDAYGAAKLSTEEGGWTNSNNFKQMIF
FT                   YAAGPTGTRYNNGIAWKKLFSNGIFASAGYQFSNSTAFATGSAYQAALGYNGGPFNVSG
FT                   FYSHVNHGGFRNQTFSVGGNYTFSIVRVNAGYFRYNGDQGSLGQRHDNAWTVSLKVAPQ
FT                   GPLDYELGYQQMRIKNAAYNADGFTPNANLGAFSLTNGVGNGFKETLYASVFYHLSKRT
FT                   ELYLAGDYMKLHGGYKVASTFGSNNQLELTTGIRTRF"
FT   CDS_pept        complement(39270..39911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00040"
FT                   /product="signal transduction response regulator"
FT                   /note="COG2197: Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42025"
FT                   /db_xref="GOA:A0A0H3KB42"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB42"
FT                   /protein_id="BAG42025.1"
FT                   /translation="MAITVAIADDHPVVVSLLVQLFQADPSFHVEHCCNEGSALIESLA
FT                   RVPTDIVIVDYSMSRGDRPVDGFALLRKLREVAPKAGRVLFTMQRNPTVFAAAMRLGVA
FT                   AIVSKEDEVAELLRACRYIQDGGACYLSPTVRTIVDQAGTVLRDNAPPLTQKEIDVVRL
FT                   FVSGHSLADIAKQLGRSVSTVSTQKYTAMRKLRADTNVHLIRYAYENGLI"
FT   CDS_pept        40376..42382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mod"
FT                   /locus_tag="BMULJ_00041"
FT                   /product="adenine-specific DNA methyltransferase"
FT                   /note="COG2189: Adenine specific DNA methylase Mod,
FT                   Listeria innocua"
FT                   /note="KEGG, K07316"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00041"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42026"
FT                   /db_xref="GOA:A0A0H3KJH1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJH1"
FT                   /protein_id="BAG42026.1"
FT                   /translation="MQKLDAANPLAMSTDFTADNVARLKALFPELVTEGPKGVSVNVDV
FT                   LKTLVGDRTVSDADERYGFHWHGKRDARQAALTPSTGTLRPCPDDSVAWDDTRHLMIEG
FT                   DNLDVMKLLHKSYAGKVKLVYIDPPYNTGNDFVYADDFSDSIRHYLAMTGQTEGGVKRS
FT                   TNTEANGRFHTDWLNMMYPRLKLAHALLSEEGLIVVHIDEHEVHALVLMLREIFGEENE
FT                   LGVAVWDKRNPKGDARGIAYQHESLVLFARNAETLLERAPLKRPKRNAQRMLDAAHDAM
FT                   YRSGTPKDAAKAYRAWVKAQTNLSGGEAMYDRLSEDGRVYRLVSMAWPNKKKAPDEYFT
FT                   PLLHPVTGKPCAMPARGWRNPPATMQALLERGQIEFGPDETTQPQRIYYLDENMYENVP
FT                   SVLPFGGSDDALLKALGIPFEQPKPVDFAAAVIGWCTRRDDIVLDCFAGSGSTGHAVMQ
FT                   VNATDGGARRYILVQLPEPLDRRDKTQQAAADFCAKLKKPATLAEVTKERLRRAAQQVA
FT                   RDYPESYGDLGFRVYRLDTTNVIEWDPRRDDFDHALFASVEHVKTGRTDDDLLAELTLK
FT                   LGLDLCTPVEHHTIAGKTVHLIGREIVACFDARVSRDDAEPLADGIVALLDASGATRDV
FT                   TCLFRDSGFVDDVAKLNLAALLEQHGVKRVRSL"
FT   CDS_pept        42382..45408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="res"
FT                   /locus_tag="BMULJ_00042"
FT                   /product="type III restriction enzyme"
FT                   /EC_number="3.1.21.5"
FT                   /note="COG3587: Restriction endonuclease, Fusobacterium
FT                   nucleatum"
FT                   /note="KEGG, K01156"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00042"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42027"
FT                   /db_xref="GOA:A0A0H3KB48"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB48"
FT                   /protein_id="BAG42027.1"
FT                   /translation="MRLHFEADLDYQRDAIDAVCDLFRGQESYRGDFSVLASAAPGTTA
FT                   AAQGSLGFAMSERGVGNRLSLTDDALARNLADVQLRGGLPPSGSPGSRDFTVEMETGTG
FT                   KTYVYLRTIFELNRRYGFTKFVIVVPSIAIKEGVHKTLSITEDHFRALYAGVPYDYFLY
FT                   DSAKLGQVRHFAASATIQIMVMTVAAINKKEVNNLYKDSEKTGGEKPIDLIRATRPIVI
FT                   VDEPQSVDGGLEGRGREALAAMDPLCTLRYSATHVDRHHMVYRLDAVDAYERKLVKQIE
FT                   IASAIVEDAHNKPYVRLVGVSNRRGAISARLELDVATANGVKRQLVSATDGDDLERLTK
FT                   RALYAGLRIGEVHAVKGAEYVELRHPEGETFLSLGEAFGDIDTLAVQREMIRRTIREHL
FT                   DKELRLAERGVKVLSLFFVDSVERYRRYDENGMPVKGEYALIFEEEYARAARVPAYRAL
FT                   FDGVDIAREVERAHNGYFSIDRKGGWTDTSESSAVARENAERAYGLIMREKEALLSFDT
FT                   PLKFIFSHSALKEGWDNPNVFQICTLRDIQTERERRQTLGRGLRLAVDQDGERVRDPGV
FT                   NTLTVIATERYESFAENLQKEIEADTGIRFGIVEQHQFAALPVQEGDGPAHALGIELSR
FT                   VLWTHLHEQGYVDAQGKVLDRLKDALRQSALVLPDAFESLRAPIVATLRKLSGRFAVRN
FT                   ADERRAIALRRDASGKAVVFGDDFRALWDRIRHRTVYRVDFDNAKLVRDCAAALRDAPD
FT                   IARARLQWRKAEIDIGKSGVEAIEVGGAGTVLIDEGELPLPDLLTELQDRTQLTRRSLA
FT                   TILADSGRLDDFRVNPQQFIAIAADAINRCKRLALVAGIAYRKLGDRHVHALESFESEA
FT                   LTGYLRNLRLEARKSIHEAVVCETDAERAFADALEAHDGVKLYAKLPAWFRVATPLGSY
FT                   HPDWAVLAEQDDGERLYFVVDTPNADGDTPTEHERAKLACGEAHFRALADGDDAARFVR
FT                   VRHVDALFDAAAAPARTAR"
FT   CDS_pept        complement(45627..45992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00043"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAX7"
FT                   /protein_id="BAG42028.1"
FT                   /translation="MKKQRYLSVLAAALLALGTVCAHAAAGGNGGGNGGGHGAGGSGGN
FT                   AGGMSGGHMSGEALSNSNGFHAGDRDKGLARAADRSDTIADRAGTQPGRGHTHGHVAHT
FT                   TSHGKHTKRNAFGKTTL"
FT   CDS_pept        complement(46199..46453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00044"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42029"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFK3"
FT                   /protein_id="BAG42029.1"
FT                   /translation="MMSIRSFRTCAAAAIVALATIDSAHAAGCMKGAVVGGVAGHYAGH
FT                   HAVAGAVGGCVVGHHMAKKHAQEQAEQRNERAQSAPPKQ"
FT   CDS_pept        complement(46509..46799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00045"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42030"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB47"
FT                   /protein_id="BAG42030.1"
FT                   /translation="MSKKLLLGAVIGVAALAASGVASAHVDLSVGIGVPGVYTAPAPVY
FT                   VAPPPVAYAPVGYRYDDWRAREWREREWRRHEWREHEWRERDRGWRGGRWD"
FT   CDS_pept        complement(47044..48000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00046"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4301: Uncharacterized conserved protein, Nostoc
FT                   sp. PCC 7120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00046"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42031"
FT                   /db_xref="GOA:A0A0H3KJH6"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJH6"
FT                   /protein_id="BAG42031.1"
FT                   /translation="MRPSAFERDLIDGLSRTPRSIPPKYFYDATGSALFDRICELPEYY
FT                   PTRTELGILRARAAEIVQRVGPHADIVEFGAGSLEKIRILLDAFAAHGANAPLRYVPID
FT                   ISADYLHGAAARLRAEYPWLDVAPIAADYTKAEQLAELTATPRRRIGFFPGSTIGNFSP
FT                   EEADAFLRDAAQLLRGGGLLVGADLVKDERVLHDAYNDAQGVTARFNLNLLARANAELG
FT                   ADFDLDAFSHCAFYDPQRQRVEMHLVSDVAQTVHVRGHVFHFDAGERIHTENSYKFTID
FT                   GFRAIARRAGFVPDTVWTDADRLFSVHWLRSVDDIRA"
FT   CDS_pept        complement(48041..49255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00047"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1262: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00047"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42032"
FT                   /db_xref="GOA:A0A0H3KB54"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB54"
FT                   /protein_id="BAG42032.1"
FT                   /translation="MSLLASQLQRRYQDVRAHSVALTATLSAEDQAVQSMPDASPTKWH
FT                   LAHTTWFFETVVLMRRVHGYTPFNDAFQFLFNSYYEALGPRHPRPQRGLLTRPSLDEVH
FT                   AYRQYVDEAMLNALASADPSLLDTIAPEIELGLHHEQQHQELIVTDMLHAFSCNPLKPA
FT                   YRPRSDADTQALAAGDAGPLRWLHRPGGLVDIGHGGETFSFDNERPRHTALVRPYEIAN
FT                   RLITNAEFAAFVADGGYARPEYWLSDGWATVQREGWQAPAYWIADDAAAHGWRTFGLHG
FT                   VEALAPDAPVCHVSFYEAAAYAEWAGARLPTEFEWEAAFGADGIRQMLGHVWQWTRSSY
FT                   EPYPGFRPLAGVAAEYNGKFMVGQQVLRGSSIATPPGHERPTYRNFFPPAARWQFTGVR
FT                   LARDV"
FT   CDS_pept        complement(49260..49496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00048"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAY2"
FT                   /protein_id="BAG42033.1"
FT                   /translation="MLSNVFRFRFPRNPIRDLHISGPYCSARADGLTPLLRPGARAGCP
FT                   MDAAPKVARQPRALEREAFLFPATQRSELRRGR"
FT   CDS_pept        49882..50355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00049"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2128: Uncharacterized conserved protein,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00049"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42034"
FT                   /db_xref="GOA:A0A0H3KFK8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFK8"
FT                   /protein_id="BAG42034.1"
FT                   /translation="MTAKLNPFAVAPALMKDWMAVSVAAAGSLEPTLIELVKIRASQIN
FT                   ACANCLNMHTVEARAQGETEQRINLLAAWREAPCYTDRERAALGWTDALTRLSEGHAHD
FT                   AAYAELNAHFTQEEQVKLTLMINVINGWNRLAVGFGLWVDPAEAKAAAAKMVA"
FT   CDS_pept        50355..51224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00050"
FT                   /product="ECF subfamily RNA polymerase sigma-70 factor"
FT                   /note="COG1595: DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog, Sinorhizobium meliloti"
FT                   /note="KEGG, K03088"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42035"
FT                   /db_xref="GOA:A0A0H3KB51"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB51"
FT                   /protein_id="BAG42035.1"
FT                   /translation="MTNVDPADTMADAAASFDPLRRMLIRVAYRMLGSVADAEDVVQDA
FT                   FIRWMDVDRTGIRVPEAFLRRMVMRLCLDHLKSARHRRETYVGPWLPEPVVDEDEQEDV
FT                   TLPLMLALERLSPLERAAFLLHDVFGLEFDEVAATIQREPAACRQLAARARTHVREARP
FT                   RFRVDKQRGIELAEAFFAASRSGDMRTLGAMLAEDVSLHSDGGGKRTAAAKPVFGFERV
FT                   MKVHTHLAELFATQASMLVRAGFINGLPGFVTREADGELQTTALEIEDGKIVAIYVVRN
FT                   PDKLKHLH"
FT   tRNA            complement(51372..51448)
FT                   /locus_tag="BMULJ_00051"
FT                   /product="tRNA-Val"
FT                   /note="anticodon GAC"
FT   CDS_pept        52175..54367
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00052"
FT                   /note="COG3501: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /note="inactivated Rhs element Vgr protein"
FT   repeat_region   54320..54324
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  54325..58790
FT                   /mobile_element_type="insertion sequence: ISBmu1c"
FT                   /note="ISBmu1 carrying ISBmu4. Because this IS unit exists
FT                   three copies, this IS unit seems transpositionally active,
FT                   although orfB of this insertion sequence is interrupted by
FT                   ISBmu4."
FT   repeat_region   order(54325..56403,58261..58790)
FT                   /note="IS21 family, this copy of ISBmu1 has experienced
FT                   insertion of ISBmu4."
FT   repeat_region   54325..54375
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu1c, terminal inverted repeat"
FT   CDS_pept        54523..56055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00053"
FT                   /product="ISBmu1c transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00053"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42036"
FT                   /db_xref="GOA:A0A0H3KVF0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVF0"
FT                   /protein_id="BAG42036.1"
FT                   /translation="MANRRFELFEYRQVLVRMRQGDSDRDIARGGLMGRKKLTTVRREA
FT                   EARSWLDPVQPLPDDATIAGVFGRTPHLPHTCVSTVEPYREQVREWLAAGVQGTTIHAA
FT                   LQRNHGYAGSYCAVKRMLRHLAAERSVATTTILDFAPADAAQVDFGAGPVLTVEGIAVR
FT                   TWIFVMTLCWSRHQYAEIVLDQTVETWLASHRRAFEWFGGCPDRVIIDNAKCAIIRACR
FT                   YEPAVQRSYAALAEGYGFRIDACPPHDPQKKGVVESGVKYVKKSFVPLREFRDLADANR
FT                   QLREWVMQQAGTRIHGTVHERPLTRFGVERPLLAALPDVPPVLSVWKEVAVHRDGHVVY
FT                   KHALYSAPFTLVGKSLWLKATDTVIQLFHRHELVATHPRQRAGGRHTVRDHQPPEAQAW
FT                   LEHDPQWCLARAKEIGPSCHGVILALFNDKVLVNLRGAQGIIRLRQKVGDQRLEAACER
FT                   ALAFSSAKYSTIKGILDKGLDSEPVPRPASAPTGAYQNGGRFGRDLQSLLIH"
FT   CDS_pept        56060..56428
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00054"
FT                   /note="inactivated ISbmu1c transposase OrfB"
FT                   /note="inactivated by ISBmu4 insertion, N-terminal portion"
FT   misc_feature    56060..56403
FT                   /note="Remnant of ISBmu1 transposase, OrfB. Interrupted by
FT                   ISBmu4."
FT   mobile_element  56404..58260
FT                   /mobile_element_type="insertion sequence: ISBmu4"
FT                   /note="IS110 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        56850..58211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00055"
FT                   /product="ISBmu4 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00055"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42037"
FT                   /db_xref="GOA:A0A0H3KHX3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KHX3"
FT                   /protein_id="BAG42037.1"
FT                   /translation="MASISNAPVRHRTVGIDLAISAVQVAQIFDDGRAIGKPIRFRLTS
FT                   TDLRRFVSAIKSGVGADTPITAVMEPTGMAWFPVANWLQRAGIKVIRVKGQRVKALRKY
FT                   LSEHAKTDAADAHVLGAIPGFGGRGLDPVHVPGPEQHSLQRLTKQRHRYQELVCSARRR
FT                   VLDLIRWACPALEPVLPDTVTQLTLAILGELLDPRKVVAMRRDVLARFLSQHASGNHPK
FT                   SGPFIDSLVEKLKAAAEETIELHGDSVDFTALQFEVAQEVEHLRLWDRHVRAIEREVEQ
FT                   IYQRVHPSDALRSIPGIGATLAPLLIGVLGYAKRFRNEDHIRGFCGMFPTRSSSGGIEK
FT                   PGQRLTKSGSDRVKRALYIAADVARKIDPDLAAVYWRLMVNKGHHHKQAICAVATRLIN
FT                   RIYRVLKTGEPYVLRDQEGNSISVQEGKRIVAAQFKVPLEVRQSRRNQPMPEPA"
FT   misc_feature    58261..58705
FT                   /note="Remnant of ISBmu1 transposase, OrfB. Interrupted by
FT                   ISBmu4."
FT   CDS_pept        58307..58705
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00056"
FT                   /note="inactivated ISbmu1c transposase OrfB"
FT                   /note="inactivated by ISBmu4 insertion, C-terminal portion"
FT   repeat_region   58741..58790
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu1c, terminal inverted repeat"
FT   repeat_region   58791..58795
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        58854..59414
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00057"
FT                   /note="inactivated Rhs element Vgr protein"
FT   CDS_pept        59417..60997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00058"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42038"
FT                   /db_xref="GOA:A0A0H3KAY5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAY5"
FT                   /protein_id="BAG42038.1"
FT                   /translation="MSWTIEDFRATSLEVGQWCWGTLEGAFNEKQTISQIIVDAVIGMI
FT                   PLVGDATAVRDLLAVSIGMSQDPVKRNDTTQRVLLVVLIFALIPVVGGVIKGVGRLLLK
FT                   VTGDVAKDAELLKAVVQFLNRMGHGDAPKWLKALDLAKYQAQVVTRLKDFCATVRVAIQ
FT                   RSLAARVGRMLPDKWRAALERVSSGFHAIQDMADQIVPEAIKELNAKLKVLQNMVYRGE
FT                   VHEIATGGAPKLQREAEAYLEERRLARDIRRGRYSSTQCAADGQEIERWIRAKYQPKID
FT                   AGWPDILDKQGKMPMFGDDDVFLDVASFSGEIKALTARELAGKKVYRVFGNPSELARSE
FT                   KGSSAGGRSPAFWGVGEPPKTAEEWRRLAAVLDTWNGNGFIVIMQLPHDFGERMPTANA
FT                   WFGKIAEQYGSAVPVQYLEGGGDQLIVDFGKLADYVTEEGNLIKQKYRNFVGHANVHVQ
FT                   REFDGVKIDFYKTNWEDVEKVHGYSRYEDDIGYSTKTRRLASDEVQTKMTNSKVTAATR
FT                   SAANLEGHR"
FT   CDS_pept        61426..62067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00059"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42039"
FT                   /db_xref="InterPro:IPR028966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFL3"
FT                   /protein_id="BAG42039.1"
FT                   /translation="MENAPFEPARSNNDLAQLRAPSLLLDPGRYNHGFYTLGYPVFPSY
FT                   LPEVPNGAGPVISSGDKVPCDGIWEPVAIEQSKLLGIVPVGDRSSRNNGCFNYFIRDIR
FT                   APNLRDATGAVTGTRWRLLWEDRRYADGTVPDESQYFLEPPSSPQPTRDTSAPVRTGDI
FT                   CPVSGEWRTDEYGGKTVRVEAGAAMPDMLVRDNLGELKVHWVTWHLVTRS"
FT   CDS_pept        62695..63282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42040"
FT                   /db_xref="InterPro:IPR028966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB55"
FT                   /protein_id="BAG42040.1"
FT                   /translation="MNNDLAQLRSVGRLLSPSAYEYTFYTLPYPVFPDDLPEVPEAVGP
FT                   VIKSGDKVPCDGIWEPVAIEQSKLLGVVPVGNRSLRNNGCFNYFVQDIHAPNVRDDDTG
FT                   AIVKTHWRLLWEDKRYADGIIPDESQYFLEPPSSPQPSRDTAAPVRTGDICPVSGVWRT
FT                   QEYGGKTVRVEAGAAMPDMLVRDNLVNSRCTG"
FT   CDS_pept        63970..64431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00061"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42041"
FT                   /db_xref="InterPro:IPR028966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJI5"
FT                   /protein_id="BAG42041.1"
FT                   /translation="MQSDENVAHLEWPGALLDLTQYDHGFYELGYPVFPAALPDIPDPA
FT                   GLVIRSGQSVPCDGIWEPVAIEPSRISGTIPVDAKRFRNNGCFNYFVADVIAPGFADVD
FT                   VDTFDVTLRCTYWRLLWEDTRYTNGVVPDESQYILKAGEGPRRLMSILR"
FT   CDS_pept        64455..65393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00062"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42042"
FT                   /db_xref="InterPro:IPR028950"
FT                   /db_xref="InterPro:IPR028966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB63"
FT                   /protein_id="BAG42042.1"
FT                   /translation="MTDDMTRRRVFWLLQRLTSFSLWKRKRDAFARFANEYENAVKTWP
FT                   EDDPEALPPQNLPIISEILAAYDRGLSALARGNRFVWQRGEPLQYAIDRYNHLNAYFFP
FT                   HPDYWDRGAQAFPYPPKVDALAQLLHASEAQLEYAPFEPGHRDFAQLQSVGLLLTPNAY
FT                   DHGFYTLPYPVFPDDLPPVPQAIGPVIKSGNKVPCDGIWEPVVVEREKLLGIVPIGHRR
FT                   LRNNGCFNYFIRDIRAPKLRDNDLGLPVKTHWRLLWEDKRYTDGVIPDESEYFLEGPQQ
FT                   NRDIVAYVRTNGLMIRAATGRCVVQRQSLVA"
FT   CDS_pept        complement(65788..66429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00063"
FT                   /product="anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00063"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42043"
FT                   /db_xref="GOA:A0A0H3KAY9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAY9"
FT                   /protein_id="BAG42043.1"
FT                   /translation="MKQWQQDAQRLRAALESVRMPGENPALDPAAIRARRAERARMRFA
FT                   MAASFVFCVGLGTFGGWQARGWNAQPAVAPMSDALNAYRMLVVNRTAKVDYRPTGANDL
FT                   QRWLTTRVGTSAKLPDLSAAGFRPVGGRLFTTDVGATSAMVLYEDDAGRTLSFYVRPAE
FT                   SSRRLLPAGQRVDGPLLARYGSVNGLNFAVVGPADSLEEKAVVRALDQQT"
FT   CDS_pept        complement(66546..67064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00064"
FT                   /product="ECF subfamily RNA polymerase sigma-70 factor"
FT                   /note="COG1595: DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog, Mesorhizobium loti"
FT                   /note="KEGG, K03088"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00064"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42044"
FT                   /db_xref="GOA:A0A0H3KFL8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFL8"
FT                   /protein_id="BAG42044.1"
FT                   /translation="MPSNALDDDALRELIPRLRRFALWLARDVHAADDLVQSTLERALS
FT                   RWTSRRDDASLRSWLFTILYRQFLDGKRSAKRYAWLLGRIRDDEEPHWPSAEREVAARA
FT                   TLEAFGRLSDEQRSLLLLVAVEGFTYQEVADLLDVPIGTVMSRLSRARQALRLLSDGEL
FT                   PAPSLRLMK"
FT   CDS_pept        67220..68311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00065"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="COG0753: Catalase, Helicobacter pylori 26695"
FT                   /note="KEGG, K00429"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00065"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42045"
FT                   /db_xref="GOA:A0A0H3KB60"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB60"
FT                   /protein_id="BAG42045.1"
FT                   /translation="MERSSSSSPPPREPGRRGWRWAAIGGAVAGAALAFGYVGGWLAPA
FT                   RLTPHRLVDALQTAGGLHPGFRRNHAKGVCVTGYFEGNGTASQYSVAPFFKPVRTPVVG
FT                   RFALPGGNPYAPDSSVPIRSLALKLTAPDGEQWRTGMNAMPVFPVATPQAFYAQLLATR
FT                   PDPATGKPDPAKVKAFFAAHPETAAFREWVKGAKPSASYVTERYDALNAFYFIDAAGQR
FT                   HAVRWRVVPEQTAGAGDVATAADPNVLEQDLTRRIADGAQKWKLLVTLAEPGDPVDDAT
FT                   KVWPAQRTTIDAGTLVLDHVEPQDSGPCRDVNYDPTVLPRGIQVSGDPLLAARSAAYAD
FT                   SYLRRTSEEAGVADAARLSAEGR"
FT   CDS_pept        68308..68841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00066"
FT                   /product="putative cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00066"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42046"
FT                   /db_xref="GOA:A0A0H3KJJ0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJJ0"
FT                   /protein_id="BAG42046.1"
FT                   /translation="MMKASTTFSLPARVLHWVMAAMVLTMLFVGVGMVASVSERHDFLV
FT                   ALHKPLGVAVLVLVCVRIVVRLSSKPPALPDDLPWWQKVAAHGSHLVLYALMVAMPLIG
FT                   WAMLSAGGYPVTLGGGVQLPAIVAANPVTFAWLRVAHRVLAYLFFLTFLAHFGAALYHG
FT                   LIRRDGVLRAMVGR"
FT   CDS_pept        69560..70600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00067"
FT                   /product="hypothetical protein"
FT                   /note="COG4127: Uncharacterized conserved protein,
FT                   Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00067"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42047"
FT                   /db_xref="GOA:A0A0H3KB67"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR016984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB67"
FT                   /protein_id="BAG42047.1"
FT                   /translation="MAIWLVRAGSHGEYEQKFIQESRIYVTWDDLDVDLAKLEQRNELT
FT                   AEMTQRYPEAKRKTVLNWVSQVWPFAHEMQKGDLVVLPLKTQAAVYIGEITGDYHAEKA
FT                   GPNPFFHWRPVKWIGEAIPRTHFGKDLLFSFGAFLTICRIQRNNAEQRIAVMRANGWKA
FT                   ETLAAPAKAATATTTDVEAADTDLDELARDQIAALVSARFKGHGLTRLVEGILKAQGYT
FT                   TYRSPEGADGGTDILAGSGPLGFSAPRLCVEVKSEDSPIGREPVDKLLGAMTKFNADQD
FT                   LFVAWGGFKGNVQKQLASQFFRLRLWTQKELLEQLFEQYERLDEDLKAELPLKRVWMVA
FT                   SQEDGF"
FT   CDS_pept        complement(70717..73191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BMULJ_00068"
FT                   /product="DNA gyrase subunit B"
FT                   /note="COG0187: Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K02470"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00068"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42048"
FT                   /db_xref="GOA:A0A0H3KAZ1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAZ1"
FT                   /protein_id="BAG42048.1"
FT                   /translation="MSEQHNSQPDNSSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGL
FT                   HHLVFEVLDNSIDEALAGYCNDIHVTIHADNSISVVDNGRGIPTDVKMNDKHEPKRSAA
FT                   EIVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSSWLRLTVRRNGKKHFMEFHRGVA
FT                   QDRVIEVVDGEEVSPMQVIGDTENRGTEVHFMADPTIFGTVEYHYDILAKRMRELSFLN
FT                   NGVRIRLTDLRSGKEDDFAFAGGVKGFVEYINKTKSNLHPTIFHVIGEKDGVGVEVAMQ
FT                   WNDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADNEIAKKAKVETTGDDMR
FT                   EGLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPNDAKIICGKI
FT                   VEAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQ
FT                   GRDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLVTALGCGIGKDDYNLDKLRYHRI
FT                   IIMTDADVDGAHIRTLLLTFFYRQMPEMIERGYVYIAQPPLYKVKAGKDERYLKDDAEL
FT                   NAHMLRLALQGSELLPSENATPITGDALGELARSYLMSQSVIERLSRLYDPAALEAIMD
FT                   GVSIDLSSEASTEASAKALHAALHDDTLKNEVRVVPAYDPVRELRSLRVERAHHGNVRV
FT                   SVIDEEFQHTADYQQLVNTAKTFEGLIQAGAVIKRGERSMAVTDFKNAMKWLLADAERN
FT                   VSKQRYKGLGEMNPEQLWETTMDPNVRRLLRVQIEDAIAADGIFTTLMGDEVEPRRAFI
FT                   ESNALRAGNIDV"
FT   CDS_pept        complement(73383..74489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BMULJ_00069"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0592: DNA polymerase sliding clamp subunit (PCNA
FT                   homolog), Ralstonia solanacearum"
FT                   /note="KEGG, K00961"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00069"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42049"
FT                   /db_xref="GOA:A0A0H3KFM3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFM3"
FT                   /protein_id="BAG42049.1"
FT                   /translation="MQLVKTERDTLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGSDQVATTVAARKLLDILRAMPDGQVTLSLADKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQAKDFGASLTVPQKSFRQLLGMVHFAMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAFSSMKIDGGTFGRQEVIVPRKTILELQRLLEDIDDTVTIDIAQ
FT                   TQAKFTFGQVELVSKLVEGKFPDFQRVIPKAHKNTFQIGREELQRSLQRAAILTSDKFK
FT                   GVRCIVAPGQLKIMSTNADQEEAQEELEIAYQGDTVDIGFNVTYLLDVLANLKVDTVQV
FT                   SLGDASSSALITVPENDEFKYVVMPMRI"
FT   CDS_pept        complement(74658..76232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BMULJ_00070"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="COG0593: ATPase involved in DNA replication
FT                   initiation, Ralstonia solanacearum"
FT                   /note="DnaA protein"
FT                   /note="KEGG, K02313"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42050"
FT                   /db_xref="GOA:A9AI97"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI97"
FT                   /protein_id="BAG42050.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDASANTLSIAAP
FT                   NRFKLDWVKSQFSGRIADLARDFWNAPIEVQFVLDPKAGMRSPAAGAAPAAPRAPLASG
FT                   PAATVAAIAANLTANQSATPAAPADVPMTPSAAAAHHLNNDDADIDLPSLPAHEAAAGR
FT                   RTWRPGPGAAPAAGGEADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGISY
FT                   NPLFLYGGVGLGKTHLIHAIGNQLLLDKPGARIRYIHAEQYVSDVVKAYQRKAFDDFKR
FT                   YYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLI
FT                   SRFDSGLTVAIEPPELEMRVAILMRKAQSEGVNLSEDVAFFVAKHLRSNVRELEGALRK
FT                   ILAYSKFHGREISIELTKEALKDLLTVQNRQISVENIQKTVADFYNIKVADMYSKKRPA
FT                   NIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHV
FT                   LEQTLKG"
FT   CDS_pept        76651..76785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="BMULJ_00071"
FT                   /product="large subunit ribosomal protein L34"
FT                   /note="KEGG, K02914"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00071"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42051"
FT                   /db_xref="GOA:A9ACI3"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ACI3"
FT                   /protein_id="BAG42051.1"
FT                   /translation="MKRTYQPSVTRRKRTHGFRVRMKTAGGRKVINARRAKGRKRLAI"
FT   CDS_pept        76855..77262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="BMULJ_00072"
FT                   /product="ribonuclease P"
FT                   /EC_number="3.1.26.5"
FT                   /note="COG0594: RNase P protein component, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01164"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00072"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42052"
FT                   /db_xref="GOA:A0A0H3KB65"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB65"
FT                   /protein_id="BAG42052.1"
FT                   /translation="MQTKAAFPKAARLLKTDEFSSVFRLRPWRRSAHFVIYGKPTGQPA
FT                   RLGLVVGKKYAPRAVTRNLVKRLAREAFRVRRAEFAGYDLLLRQHTRFDKKALPSAASA
FT                   PLAAMCAAEIRELLDRAAREIARRASKPASE"
FT   CDS_pept        77339..77605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00073"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0759: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K08998"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00073"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42053"
FT                   /db_xref="GOA:A0A0H3KJJ7"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJJ7"
FT                   /protein_id="BAG42053.1"
FT                   /translation="MKTVLTALLRFYKVAVSPLLGNRCRFYPSCSDYAREAIQYHGAAR
FT                   GTYLAVRRVCRCHPFSAGGIDLVPPPNSDTRARGDADAQSHRL"
FT   CDS_pept        77614..79275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /locus_tag="BMULJ_00074"
FT                   /product="preprotein translocase YidC subunit"
FT                   /note="COG0706: Preprotein translocase subunit YidC,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03217"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00074"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42054"
FT                   /db_xref="GOA:A9ACA0"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ACA0"
FT                   /protein_id="BAG42054.1"
FT                   /translation="MDIKRTVLWVIFFMSAVMLYDNWQRSHGRPSMFFPSATQTAPAAA
FT                   GGASGAGATTTAGNVPAPAAGTAPATTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTL
FT                   KKQGDGKQPDLYITLFDHTAGHTYLARTGLLGGDFPNHNDVYTQVNAGPTSLSGDQNTL
FT                   KLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDNVGTTPVTPTLYMELVRDNTAVETP
FT                   MFSHTFLGPAVYTDAKHFQKINFSDLDKNKADYVTSADNGWVAMVQHYFASAWIPQHGV
FT                   KRDIYAEKIDPSLYRVGVKQPVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKD
FT                   YGWVTIIAKPLFWLLEKIHSYVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITP
FT                   RMQALRERFKNDPQKMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMR
FT                   GAPWILWIHDLSQRDPYFILPVLMAVSMYVQTSLNPTPPDPVQAKMMKFMPIAFSVMFF
FT                   FFPAGLVLYYVVNNVLSIAQQYYITRKLGGVKKKPA"
FT   CDS_pept        complement(79378..79812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00075"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42055"
FT                   /db_xref="GOA:A0A0H3KB70"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB70"
FT                   /protein_id="BAG42055.1"
FT                   /translation="MPTPEEKAAFSERLKFALRRSPEKIAGATELANRFNLRHRGTHPV
FT                   SPQTAHKWLTGRTIPTPDKLETLAEWLRVELHWLHYGPSPSAADHGTPQPLPRDERYPP
FT                   TPETIELASKIEALSPHQRYLVQELVEQFYGEPKGDAKKP"
FT   CDS_pept        80147..81541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /locus_tag="BMULJ_00076"
FT                   /product="tRNA modification GTPase"
FT                   /note="COG0486: Predicted GTPase, Ralstonia solanacearum"
FT                   /note="KEGG, K03650"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00076"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42056"
FT                   /db_xref="GOA:A0A0H3KAZ3"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAZ3"
FT                   /protein_id="BAG42056.1"
FT                   /translation="MLATDSDPIVAIATAAGRGGIGVVRVSFGRGGEAAALPMIDALCG
FT                   QRLAPRHASYVPFLDAQGAPLDRGIALYFPAPHSYTGEHVLELQGHGGPIVMQLLLQRC
FT                   LDVGRAVGLRLAEPGEFTRRAFLNDKLDLAQAEAVADLIEASTEAAARSAGRSLDGAFS
FT                   RQIHALVDDVINLRMLVEATLDFPEEEIDFLEAADARGKLAKIRAQLAHVLGDARQGAL
FT                   LREGLSVVLAGQPNVGKSSLLNALAGAELAIVTPIAGTTRDKVAQTIQVEGIPLHIIDT
FT                   AGLRETEDEVERIGIARTWSEIERADVVLHLLDSRTGMTADDDAIAARFPAGVPVVRVL
FT                   NKTDLTGVPASVAHPAAEGDLTEVHLSAKRGDGIDLLRAELLRIAGWQAGAEGVYLARE
FT                   RHLMALRAAQDHLARAAEHAEQRAQSLDLFAEELRLAQEQLNAITGEFTSDDLLGVIFS
FT                   RFCIGK"
FT   CDS_pept        complement(81645..81764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00077"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00077"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFN0"
FT                   /protein_id="BAG42057.1"
FT                   /translation="MKKTLLLIAGVAALLSGCIVVPDGGYYDGGYHHHHRHWD"
FT   CDS_pept        complement(81978..82226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00078"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42058"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB71"
FT                   /protein_id="BAG42058.1"
FT                   /translation="MNDKLPTPAHDIPNEAIDLQIADVLAAVRYPANKDAIVDAARDAG
FT                   ASNEVLSMLDGLPEQDYPDVDAVTRWVAGNFGPGIGT"
FT   CDS_pept        complement(82303..82473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00079"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42059"
FT                   /db_xref="GOA:A0A0H3KJK2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJK2"
FT                   /protein_id="BAG42059.1"
FT                   /translation="MIEHVILGIFLVLPLVIVAALFSDELWQEHRRQHPRDEHAPHIDW
FT                   KHPWRRVRRGH"
FT   CDS_pept        82623..83165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="BMULJ_00080"
FT                   /product="diamine N-acetyltransferase"
FT                   /EC_number="2.3.1.57"
FT                   /note="COG1670: Acetyltransferases, including N-acetylases
FT                   of ribosomal proteins, Listeria innocua"
FT                   /note="KEGG, K00657"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42060"
FT                   /db_xref="GOA:A0A0H3KB73"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB73"
FT                   /protein_id="BAG42060.1"
FT                   /translation="MQLQNETHTLALRPLERQDLRFVHELNNDAKIMRYWFEEPYETFA
FT                   ELSQLYDRHVHDQRERRFVAVDTQGELVGLVELIELDYIHRRGEFQIIIAPQCQGRGYA
FT                   GQATRLAIEYAFKVLNLRKLYLIVDTSNAAAIHIYEKCGFQHEAELKEEFFGNGTYHNA
FT                   YRMCIFQRDYFAKQQAA"
FT   CDS_pept        83619..83966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00081"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00081"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KAZ8"
FT                   /protein_id="BAG42061.1"
FT                   /translation="MMKRTGVFLALVGACAMVSIAQAGGDVAVQPKQEIQLTKNAWGCL
FT                   SKDNLDSVLSHERDGKAQAKQQYFDDFRCLSVPEGQRFRVVSVEHGDVQFVSADNSDQQ
FT                   GLWTDARFIKQ"
FT   CDS_pept        84157..84711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00082"
FT                   /product="probable YaeQ family protein"
FT                   /note="COG4681: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00082"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42062"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFN6"
FT                   /protein_id="BAG42062.1"
FT                   /translation="MALKSTIYKAELQIADMDRHYYADHALTVARHPSETDERMMVRIA
FT                   AFALLAHERLEFGKGLSDTDEPDLWQKDLTGAIDAWIEVGQPDERRISKAAGRAAQVTV
FT                   IAYGGKTSDIWWQGVRSKVERLRNVQVLSLADGVAAALGRLAERTMRLQCTVQDGAAWI
FT                   SSADHDPVAVEWTTLKARADA"
FT   CDS_pept        complement(84736..85149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00083"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COG0346: Lactoylglutathione lyase and related
FT                   lyases, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00083"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42063"
FT                   /db_xref="GOA:A0A0H3KB75"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB75"
FT                   /protein_id="BAG42063.1"
FT                   /translation="MKPTLRGIDHVVLRVTDMAAMTRFYCDAVGCHVEKEQPDLGLVQL
FT                   RAGDALIDLLAVGSKIDRADSGPPGTGRNVDHVCLRVEPFDPDALIAHFARFGARPGEP
FT                   VERYGAGGYGPSIYLFDPEGNMLEFKGPPAVVG"
FT   CDS_pept        85528..86625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="BMULJ_00084"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="COG0350: Methylated DNA-protein cysteine
FT                   methyltransferase, Ralstonia solanacearum"
FT                   /note="KEGG, K00567"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00084"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42064"
FT                   /db_xref="GOA:A0A0H3KJK7"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJK7"
FT                   /protein_id="BAG42064.1"
FT                   /translation="MKTAYPTDDARWGAVTARDPHADGAFFYAVRTTGVFCRPSCASRL
FT                   PRREHVAFFDDPAAARAAGFRPCKRCQPEGLPRELEIVNRACAVLDAHSERLTLQQLSD
FT                   AVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRQALQRGQPVTRAAVDAGFNSPSRLY
FT                   ASVSRELGMAPSAFRRQGAGLRIDYATAPTSLGTVLVAATDKGICRIAFGDEPAALVHE
FT                   LKASFARAELVESPARLAPFIAQIGAYLDGTRHTFDLPLDIAPTAFQQRVWEALTHIPY
FT                   GETRSYSEIAAALGAPGAVRAVASACASNPVALAIPCHRVVQKGGALAGYRWGVRRKAT
FT                   LLASEARRARDDAPATAAIEEDSTA"
FT   CDS_pept        86622..87593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="BMULJ_00085"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /note="COG0122: 3-methyladenine DNA
FT                   glycosylase/8-oxoguanine DNA glycosylase, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K01247"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00085"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42065"
FT                   /db_xref="GOA:A0A0H3KB78"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB78"
FT                   /protein_id="BAG42065.1"
FT                   /translation="MSIEIATIASTADGGHVPPSAQLELRFKAPYDWPRVLRFFSGRAI
FT                   PGVEQVAHGVYRRIVDLHGEPGRLTVTRHPRRHCLIATVEGAAARHVDDAFAARVASMF
FT                   DLGADPAAIGSGLARDPWFAPLVAAAPGLRVPGAWSGFELAVRAIVGQQVSVKAATTIV
FT                   GRLVERAGERVLHDDADAADGAPAWRFPTPDALAACDLAKIGMPGKRAAALTGMARAVA
FT                   AGDVPVDTAQADLATLRATWLELPGIGPWTVEYIAMRAWRDPDAWPASDLVLMQSIAAR
FT                   DPSLDRLASQKQRTEGWRPWRAYAALHLWNEVADRMGAARGG"
FT   CDS_pept        87899..89500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="BMULJ_00086"
FT                   /product="glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="COG2918: Gamma-glutamylcysteine synthetase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K01919"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00086"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42066"
FT                   /db_xref="GOA:A0A0H3KB02"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB02"
FT                   /protein_id="BAG42066.1"
FT                   /translation="MTHRQSELLLNRLDALSTGPTRQHLPDGLRGIEKESLRVTRDGMI
FT                   AFTPHPRALGSALTHPSLTTDYSEALLELITPAEGDAALTLERLDELHRYVYASLGDEL
FT                   LWNNSMPGLLPADDEIPIANYGTSNIGRLKTVYRRGLAYRYGRTMQCIAGIHYNYSLHE
FT                   EVWRRLHADEGSTATLVDYQSERYLALIRNFRRRSWLLMYLFGASPALDTRFLRGKPNT
FT                   LEAFDADTLYRPYATSLRMSDLGYSNTTAQAALHVDYNTLPGYLDALSKAVSEPYPPYE
FT                   AIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHALASRGVQYIEVRCLDI
FT                   DPFEPTGIAIDTARFLDAFLLACALDASPTLDCDAYKEANANFASVTMEGRKPGLMLTR
FT                   DGEPIAMRAWADALMADIETIGRRLDEIRGDDAHARAIAAQREKLADPERTPSARVLRT
FT                   MRENGQSFLAFARAQSEAHAAYYRAHRPSADAMRASTALAEQSLAEQAELEAKEAGSFD
FT                   AFVAAYRAYTLNRFSV"
FT   CDS_pept        complement(89597..89908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00087"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42067"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFP1"
FT                   /protein_id="BAG42067.1"
FT                   /translation="MNTLKQAVCAALLIGSACAAHGQTASRPLTRAEVRQELAELQAVG
FT                   YRASLASSPNFPDDMQTIMRRAAAARERAGYGDTGREIVESGKPALPRAADRETYAHH"
FT   CDS_pept        90262..91926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00088"
FT                   /product="LctP family lactate transporter"
FT                   /note="COG1620: L-lactate permease, Bacillus subtilis"
FT                   /note="KEGG, K03303"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00088"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42068"
FT                   /db_xref="GOA:A0A0H3KB77"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB77"
FT                   /protein_id="BAG42068.1"
FT                   /translation="MNPTVALPPGIVFAQPLTPVAGSLLLSFLVAVIPIAVALIALGVL
FT                   RRPAWQASLAGLVAGLAVAIGAWGMPAGLAFNAVGAGMALAVVPVMWIVFNALLLYNIA
FT                   VKSGRFDQFRQWMLDNLPDDRRLVLLVVAFSFGCLLEGISGFGTPVAITSALLIALGFP
FT                   ALEALTYTLLFNTAPVAFGALGVPITVLGAVTSLPPTTLAAMVGRQLPFFALLLPFYVV
FT                   GAYGGMRSIARLWPALLVSGGSFALAQFVTSNYLGYQLTDVLSSLTSLIVTIGFLQMWK
FT                   PQPDPQFSLARGAGAGTATGVVTAGSGMRAGFGGWLPWIVVSIVVIVWVHANIAAIGDV
FT                   KIKWPGLHNAVFVSLYQKPYAAIWDFQPLGTGTAILVSAIITAALTRTGVGAFFECVVK
FT                   TWRQTWIAIVTVMMIVGLAYLLNYSGISYTLGTGVASTGALFPLVSASLGWIAVFLSGS
FT                   DTSGNALFGNLQVVAARQLGLDPVLMAATNSSGGVMGKMISPQNIATGVSTTDLKGREG
FT                   IVFARTFWHSVVLTLLLGVLVFLQQHVLTWMIPALPK"
FT   CDS_pept        92063..92788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00089"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG1802: Transcriptional regulators, Deinococcus
FT                   radiodurans"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00089"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42069"
FT                   /db_xref="GOA:A0A0H3KJL3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR017723"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJL3"
FT                   /protein_id="BAG42069.1"
FT                   /translation="MTAPNALNAIELLQSQSLAMIVQDMLERAIVSGEYAPGEKLNEVE
FT                   IATKLNVSRGPVREAFRALEQAGLLRNEKNRGVTVRVVPLREAEEIYEVRAMLDESVAR
FT                   ALAKRMSPDTLKILKGIVKSMKEAAKTHDVTRYTELNVQFHDAMVVGVGNTHLTDTYRR
FT                   LVRQLGLLRQAAIEAEEDAIAVSAAEHDKIVQALADGDEDKAVALVREHVAHGLARMRR
FT                   THEQGLPAAGKAAREKARA"
FT   CDS_pept        complement(92914..94302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00090"
FT                   /product="sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Pseudomonas aeruginosa"
FT                   /note="KEGG, K00301"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42070"
FT                   /db_xref="GOA:A0A0H3KB83"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017715"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB83"
FT                   /protein_id="BAG42070.1"
FT                   /translation="MRPFWIEQALFNDGDLAPALQGATQADVCIVGGGFTGLWTAIQTK
FT                   RQNPALDIAIVESDLCGAGASGRNGGCLLTWSAKFLTLRRLFGEAEAIRLVKASEAAVQ
FT                   HIADFCREHAIDAELRRDGTLYTATSPAQIGTLAPVLDALAACGIHSYEPLPPAEVARR
FT                   SGSARNLDGVYSPIAATVHPGKLVRGLRRVALAMGIRLYERTPMLALTPGQPVVVRTPC
FT                   GSVTAKKLVLAINAWMASRFPQFERTIAVVSSDMVITDRCPELLERTGLVDGVSVLDSR
FT                   IFVYYYRTTVDGRLMLGKGGNTFSWRSRIAPVFDRRSPYESELTRSLHAFFPSLAGVPI
FT                   TASWNGPSDRSVTGFPFFGRFDGAPNVYYGFGYSGNGVGPTYMGGQILSSLVLDADNAW
FT                   TSSPLVQGPLGRFPPEPLRYVGAHVVRNAIRRKERAEDENRRPAVVDTWLAKFASAAGK
FT                   ADKG"
FT   CDS_pept        complement(94372..95502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnW"
FT                   /locus_tag="BMULJ_00091"
FT                   /product="2-aminoethylphosphonate-pyruvate transaminase"
FT                   /EC_number="2.6.1.37"
FT                   /note="COG0075: Serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase, Pseudomonas aeruginosa"
FT                   /note="KEGG, K03430"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00091"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42071"
FT                   /db_xref="GOA:A0A0H3KB06"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB06"
FT                   /protein_id="BAG42071.1"
FT                   /translation="MTLADQPILLTPGPLTTSARTRDAMLRDWGSWDSDFNAITARLRT
FT                   RLVQIVHGEETHECVPLQGSGTFSVEAAIGTLVPRDGHVLVPNNGAYCQRIAKICRVLG
FT                   RRLTTIDYSEDRRVDPADIDRALAADPGITHVALVHCETGTGVMNPLHEVAQVVAKHGR
FT                   GLIVDAMSSFGAIEIDARTTPFDAVIAASGKCLEGVPGIGFVIAKRSTLERCEGNCHSL
FT                   AMDLYDQWVYMQRTTQWRFTPPTHVVAALDAALAQYLDEGGLAARGGRYQRNYRALIDG
FT                   MRALGFRPFLDPAIQAPIIVTFHAPDDPNYDFKTFYQEVKKRGYILYPGKLTQVETFRV
FT                   GCIGHFGEAGIPGAVAAIADTLKAMGVQRMSAEAAA"
FT   CDS_pept        complement(95549..97276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00092"
FT                   /product="iron(III) transport system permease protein"
FT                   /note="COG1178: ABC-type Fe3+ transport system, permease
FT                   component, Sinorhizobium meliloti"
FT                   /note="KEGG, K02011"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00092"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42072"
FT                   /db_xref="GOA:A0A0H3KFP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017664"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFP5"
FT                   /protein_id="BAG42072.1"
FT                   /translation="MSAVLAERRRGATAPADVRQITHWHDRVAQLALVAMAALLSLFLL
FT                   LPLALVVHKCFVDADGHFVGLHNFVTYLEDSAVLRSMLHSLTVGALVTAIVVPMAFTFA
FT                   YALTRSCMPFKNAARTIALLPLLAPTLLSAVSFIYWFGNAGLLKPLLHGHSIYGLPGIV
FT                   VSMVYASFPHVLMILVTALSLADGRLYEAAAAMGTSRTRKFFTITLPGAKYGLISATMV
FT                   SFTMCINDFGVPVVIGGSYNVLSTDIYKLIIGLQDFNRSAVVSLMLLCPALVAFGVDYF
FT                   IRRRQQSQLGARSTPYQPKPSRGFDLAMFAYCAIVCAFFLAVVGIAVFASFVKFWPYQM
FT                   SVGLQHYRMGLIAAGIFDAYKNSLKMAATVAIGGTIVVFGGAYLIEKTRGARWLRGFIS
FT                   LCAILPMGVPGLVLGISYIFLFNAPGNPLSGLYGTLWLLAIVTVVHYYASSHLTAVTAL
FT                   RQIDGEFEAVSASLKVPFYKTFVRVTVPVCLPAILLIARYLFVNGMTTVSAVAFLYSPD
FT                   TQPASVAILNLDDAGQMGPAAAMATLVLATSSCACLLFACVSHVLLRRTQAWRTPYRR"
FT   CDS_pept        complement(97273..98364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="BMULJ_00093"
FT                   /product="spermidine/putrescine transport system
FT                   ATP-binding protein"
FT                   /note="COG3842: ABC-type spermidine/putrescine transport
FT                   systems, ATPase components, Sinorhizobium meliloti"
FT                   /note="KEGG, K02052"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00093"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42073"
FT                   /db_xref="GOA:A0A0H3KB81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017666"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB81"
FT                   /protein_id="BAG42073.1"
FT                   /translation="MAPYLSVERIEKRYNDTQVLSDINLSVMKGEMICFLGPSGCGKTT
FT                   LLRIIAGLETQNAGHIMQDGRDISRLPPQLRDYGIVFQSYALFPNLTVYDNVAYGLVNR
FT                   KMKRDAIHERVHTLLALVGLPDSHRKHPGQLSGGQQQRIALARALATSPGLLLLDEPLS
FT                   ALDARVRVRLRQEIRALQQRLGVTTIMVTHDQEEALSMADRIVVMNQGVIEQIGTPLEI
FT                   YRQPASPFVADFIGRVNTIPAEVAHDGTLRAGGVGIDCRHGTARPAQGAAVSVYVRPED
FT                   LRIRVAGEAADNVLAGRVEKLEFLGAFCRVSFRIDGLDGQEIVADLSYRDVDRTGVCAG
FT                   ARVDLALDREHVRVFPVAQERLQ"
FT   CDS_pept        complement(98456..99511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00094"
FT                   /product="iron(III) transport system substrate-binding
FT                   protein"
FT                   /note="COG1840: ABC-type Fe3+ transport system, periplasmic
FT                   component, Sinorhizobium meliloti"
FT                   /note="KEGG, K02012"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00094"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42074"
FT                   /db_xref="InterPro:IPR017663"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJM0"
FT                   /protein_id="BAG42074.1"
FT                   /translation="MNEVPVCKRVKAWAAGAARCALVAAIALGAAQAAHAKTSLLVYTA
FT                   LEDEAMKPYKDAFEKANPDIEIRWVRDSTGSVTAKLLAEKNNPRADVVLGLAASSLTLL
FT                   DLQGMLMPYAPKGFEQLTRKYSDANNPPHWVGMDVWGATICYNRVVGQAKGIPKPTSWE
FT                   DLTKPVYKGAIVMPSPVSSGTGYLDVTAWLQTFGEDRGWKFMDALDKNVAQYVHSGSKP
FT                   CTLAGTGEFPVGISFEFRGHELQAQGAPIDLVFPKEGLGWDMEGTAIMKTTKQPDAAKK
FT                   LADFMASKQANEITARWWAIVAYPGVARKLAGIPDNYADLLVKNDFVWSAKNRTSILDT
FT                   WQKRYGAKAQQ"
FT   CDS_pept        99721..100959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00095"
FT                   /product="phosphonoacetate hydrolase"
FT                   /note="COG1524: Uncharacterized proteins of the AP
FT                   superfamily, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00095"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42075"
FT                   /db_xref="GOA:A0A0H3KB87"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR012710"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB87"
FT                   /protein_id="BAG42075.1"
FT                   /translation="MTETPVSVEVNGRRYKWMSRPVVVVCVDGCAYEYLERAAEAGVAP
FT                   YLRTLLKPGTALKGECVVPSFTNPNNLSIVTGVPPAVHGISGNYFYDRDTGAEVLMNDP
FT                   KYLVAPTVLATFAEQGARVAVVTAKDKLRRLLGKGLKGICFSSEKADEANLDENGIDNV
FT                   LELVGRPVPSVYSAELSEFVFAAGVRLLETRPIDLMYLSTTDYVQHKCAPGTPGANAFY
FT                   QMMDAYLKRLDELGAIVAITADHGMNAKHDGETGEPNVIYLQELFDEWLGHDAARVILP
FT                   ITDPYVVHHGALGSFATVYVPASADVDALRARLGAVDGIELVLSGAEGCARFELPPDRM
FT                   GDLIVISKQDVVLGTRRIKHDLSGLDVPLRSHGGLSEQIVPLIFSQPVSADVAGRARLR
FT                   NFDIIDIALNHLR"
FT   CDS_pept        100984..102438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapN"
FT                   /locus_tag="BMULJ_00096"
FT                   /product="NADP-dependent glyceraldehyde-3-phosphate
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.9"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K00131"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00096"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42076"
FT                   /db_xref="GOA:A0A0H3KB10"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017656"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB10"
FT                   /protein_id="BAG42076.1"
FT                   /translation="MNAIAASTAACDVRHEALRIDGERIRRDATIDVRNPYDGTLVGTV
FT                   PKATLDDVRRAFAVARAYRPTLTRHERAAILRRAADIVRARTAEIAALITAEAGLCIKD
FT                   STYEAGRVADVLTFGAGEVLKDDGQIFSCDLTPHGKKRRVYTQREPLLGAISAITPFNH
FT                   PMNQVAHKVVPSIATNNRIVVKPSEKVPLSCYLFADILYEAGLPPQMLQVITGDPSEIA
FT                   DELVTNPAIDLITFTGGVSIGKSIASRMGYRRAVLELGGNDPIIVMEDADLDEASTLAV
FT                   SGSYKNSGQRCTAIKRMLVHEAVADRFTELVVEKTRAWSYGNPADPSNDMGTVIDEAAA
FT                   MFCESRVNDAIARGARLLVGNVRDGALYSPTVVDRVTPDMPLVKYETFGPVSPIMRFRD
FT                   IDEAIRMSNSTDYALSSSICTNRFDYITRFITELEVGSVNVREVPGYRLELTPFGGVKD
FT                   SGLGYKEGVQEAMKSFTNTKTYSLPW"
FT   CDS_pept        complement(102462..103370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00097"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42077"
FT                   /db_xref="GOA:A0A0H3KFQ0"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFQ0"
FT                   /protein_id="BAG42077.1"
FT                   /translation="MPLNARIALALGIALLVAAAILAVTAGYATGHLIRMPGTVVRIVQ
FT                   DSDAMRAYRPIVAYVADNGERREIAGSTASIVPAYDIGEHVDVLLDPAHPNRPATIDDF
FT                   AQRWFPACAAALLAIASFAIGSLLYVNARRHAARDTMPGAAARQRALQRWDVAVVLIPI
FT                   AIGTGFLAGAGATGLRQWQTVRHYAYATGRVIAFADSTHAAHGASASSRCAAVVAFTAD
FT                   DGRRITFRQRTPIAHSRLQAGEAVTVLYDPVMPERAIVDRFWDRWGITAILFAIGAPFL
FT                   AAGLFVAATLWPGQPPYERAH"
FT   tRNA            complement(103693..103768)
FT                   /locus_tag="BMULJ_00098"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon CTT"
FT   CDS_pept        103959..104363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00099"
FT                   /product="phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00099"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42078"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB86"
FT                   /protein_id="BAG42078.1"
FT                   /translation="MDENAVRELLDRLLAPWVRSLDLVPVSIGDDSVTLRLPFSGEFRH
FT                   SGGVICGQVFTAAADTAMVVAISAALGEFRPMTTVSLNTNFMRPVRKGDVLVTARVLRM
FT                   GRNLVFGEVELFDEDGKMAVHATSTYALTS"
FT   CDS_pept        104372..105238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00100"
FT                   /product="patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42079"
FT                   /db_xref="GOA:A0A0H3KJM5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJM5"
FT                   /protein_id="BAG42079.1"
FT                   /translation="MFDQIVFAGGGNRCWWQAGFWDVAQPALGLRPRVIAGISAGAATA
FT                   CMLYTRDAAWVMRYYEEALRENRKNVYWRNLFGREPVFPHYRIYRQALLDIYGEPFARL
FT                   ASAPEIRIGVSHVPRWLGARSAVAAGLVAYNIEKYLRKTLHPTLGRTLGFRPEFVRAQD
FT                   CAHVDELADLILQSSCTPPFTPVLRRGGRPVLDGGMVDNVPVGALDASPGDVLVLVTRR
FT                   YPRPQMFTVAHGDQRRLYVQPSTKVPISSWDYTSPSQMQHAYDLGRRDGEHFLARVGAM
FT                   TDGRVAA"
FT   CDS_pept        complement(105258..106271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="BMULJ_00101"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COG0111: Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases, Ralstonia solanacearum"
FT                   /note="KEGG, K00058"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00101"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42080"
FT                   /db_xref="GOA:A0A0H3KB94"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB94"
FT                   /protein_id="BAG42080.1"
FT                   /translation="MKIAILDDYQDAVRKLNCFEMLADHDVKVFNNTVRGLGQLASRLA
FT                   EVEALVLIRERTPISSQLLAKLPNLRMISQTGRISSHIDLDACTDRGIAVLEGTGSPIA
FT                   PAELTWALVMAAQRRIPQYVANLKQGAWQQSGLKTSALPPNFGLGQVLRGQTLGIWGYG
FT                   KIGRLVAGYGKAFGMNVMIWGREHSLEAARADGYTAAESREALFEQSDVLSLHLRLHDD
FT                   TRGIVKQEDLMRMKPTSLLVNTSRAELLEENALVNALSHNRPGMVAIDVYESEPILQGY
FT                   SLLRMENVICTPHIGYVERESYELYFSAAFKNILAFDQGDTSSVVNPEALLPVRKR"
FT   CDS_pept        106695..107744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00102"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00102"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42081"
FT                   /db_xref="GOA:A0A0H3KB13"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB13"
FT                   /protein_id="BAG42081.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASAMDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRIVAPVVFGL
FT                   HNLAPVLQSYTEQFPKVVPDLTLVDRQVDLVEEGFDVGIVVTRQMRSASIVTRRLTTGC
FT                   MTVCATPSYLEKHGVPTHPEQLAEHPSLSLPTEYWGDERVFTGPDGEVRVRPTNVIVAN
FT                   NTAMLRQFALLGMGVAILPSYLIGGDIARGALVRLLPDFKLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEYFSKSTDATMGEQWAAQGATLPPIGVEARAEQPEPADPNLSPRLPRAGR
FT                   QRVSAPSPL"
FT   CDS_pept        complement(107884..110481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="BMULJ_00103"
FT                   /product="DNA topoisomerase type I"
FT                   /EC_number="5.99.1.2"
FT                   /note="COG0550: Topoisomerase IA, Ralstonia solanacearum"
FT                   /note="KEGG, K01862"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00103"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42082"
FT                   /db_xref="GOA:A0A0H3KFQ6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFQ6"
FT                   /protein_id="BAG42082.1"
FT                   /translation="MSKALIIAEKPSVANDIARALGGFTKHDEYFESDEYVLSSAVGHL
FT                   LEIAAPEEYEVKRGKWSFAHLPVIPPHFDLNPIAKSESRLKVLTKLMKRKDVDRLINAC
FT                   DAGREGELIFRLIVQHAKAKQPVQRLWLQSMTPQAIRDGFAHLRSDADMQPLADAARCR
FT                   SEADWLVGINGTRAMTAFNSKGGGFFLTTVGRVQTPTLSIVVEREEKIRRFVPRDYWEV
FT                   KAEFACAAGFYEGKWFDPKFKRDEFDPEKRDSRLWSLPAAETIVAACRDQVGTVSEESK
FT                   PSTQLSPLLFDLTSLQREANSRFGFSAKNTLGLAQALYEKHKVLTYPRTDARALPEDYI
FT                   GTVKSTLEMLKESHNYLPHAKQVLDKGWVKPNKRIFDNSKISDHFAIIPTLQAPKSLSE
FT                   PEQKLYDMVVKRFLAVFFPAAEYRVTTRITEVAGHHFKTEGKVLVEPGWLQVYGRDAEG
FT                   ADANLVQVQKDEKVKTDEIAAVALVTKPPARYSEATLLSAMEGAGKLVEDDELREAMAA
FT                   KGLGTPATRAAIIEGLLGEKYLVREGRELIPTAKAFQLMTLLRGLGVKELTAPELTGEW
FT                   EYKLSQMERGNLGRDAFMQEIARMTQQIVKRAKEYDSDTIPGDYATLETPCPNCGGQVK
FT                   ENYRRFACTKCDFSISKIPGSRQFEIAEVEELLQKKEIGPLSGFRSKMGRPFSAILKLT
FT                   FDDEIKNYKLEFDFGQDQGGDEGEAPDFSAQEPVGACPKCKGRVFEHGMSYVCEHSVAN
FT                   PKTCDFRSGKVILQQEITREQMAKLLADGRTDLLPNFKSSRTGRNFKAYLVKQPDGKIG
FT                   FEFEKKEPKAAAAKKTAKSATKDTETVTEGADEKPAPARKTAARKTTTRKTGS"
FT   CDS_pept        complement(110685..111065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00104"
FT                   /product="thiol-disulfide isomerase"
FT                   /note="COG0526: Thiol-disulfide isomerase and thioredoxins,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00104"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42083"
FT                   /db_xref="GOA:A0A0H3KB92"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB92"
FT                   /protein_id="BAG42083.1"
FT                   /translation="MPALNLDTDADRIAERLADPATLLVACLCAEWCGTCRDYRALFDQ
FT                   LADAHPDACFAWIDIETHADRLDDLDVENFPTILIEDAHTARFFGTVLPHAAIVERMLS
FT                   DLTAVPGTPHAPKLRNVLTVEA"
FT   CDS_pept        complement(111103..112380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="BMULJ_00105"
FT                   /product="DNA processing protein"
FT                   /note="COG0758: Predicted Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptake, Ralstonia solanacearum"
FT                   /note="KEGG, K04096"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00105"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42084"
FT                   /db_xref="GOA:A0A0H3KJM9"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJM9"
FT                   /protein_id="BAG42084.1"
FT                   /translation="MSPQALTRAGLRAWLQLAHAPSLPPAVLRALLDAFGSADALLRAP
FT                   DDAIAAASSPTAVRAVRASERADLDARTDAALAWLDVRGNAIVTLDDPAYPPRLRDLHD
FT                   PPPLLYVKGRLDLLHTRGIAVVGSRHATPQGLADAARFARALSDAGLTVVSGLALGIDA
FT                   AAHQGALDGPSSTIAVIATGADLVYPARHHALAHAIAARGAIVSEWPLGTPARASHFPQ
FT                   RNRLIAALALGALVVEAAPRSGSLITARLANELGRDVFAMPGSIHAPLAQGCHALIRDG
FT                   AKLTATPLDILEEYGLGEPAARGAHTCAEPAAGDARANVGVADLNDLTAAAAPPPATAP
FT                   DAATPGAAHELPACPAEQAVLTALGYGPVTYEWLAERCGLPDDTLHRALLALELAGRVA
FT                   PLAGGRYGRLDGPPNPAARGVLHSPA"
FT   CDS_pept        112612..113115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="BMULJ_00106"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COG0242: N-formylmethionyl-tRNA deformylase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01462"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00106"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42085"
FT                   /db_xref="GOA:A0A0H3KB98"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="PDB:5J46"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0H3KB98"
FT                   /protein_id="BAG42085.1"
FT                   /translation="MALLNILHYPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGI
FT                   GLAATQVDVHERVIVIDVSEDKNELRAFINPEIIWSSDGKQVYEEGCLSVPGIYDEVER
FT                   PDRVRVRALNEQGETFELDCEGLLAVCIQHEMDHLMGRVFVEYLSPLKQSRIKTKMKKL
FT                   ERAM"
FT   CDS_pept        113150..114133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BMULJ_00107"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="COG0223: Methionyl-tRNA formyltransferase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00604"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00107"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42086"
FT                   /db_xref="GOA:A9AC69"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AC69"
FT                   /protein_id="BAG42086.1"
FT                   /translation="MTHTLRVIFAGTPEFAAAALAAIHDAGFAAPLVLTQPDRPAGRGM
FT                   KLQASAVKRYALEHGLPVAQPPSLRRAGKYPAEAAEAIELLRATPHDVMVVAAYGLLLP
FT                   QEVLDIPRHGCINIHASLLPRWRGAAPIHRAIEAGDAETGVTLMQMDAGLDTGAMIQAS
FT                   RIAIAPDDTTATLHDRLAADGARLIVDALARLERDGTLAATPQPADGVTYAEKIGKHEA
FT                   ALDWRKPADVLARQVRAFDPFPGGVATLDGAAIKIWAAEPATGRGDAAPGTIVEAAPDG
FT                   VIVACGTGALRVTQLQKPGGKRLPAREFLAGSPLAAGQRFALPDAG"
FT   CDS_pept        114255..114896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00108"
FT                   /product="putative threonine efflux protein"
FT                   /note="COG1280: Putative threonine efflux protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00108"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42087"
FT                   /db_xref="GOA:A0A0H3KB17"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB17"
FT                   /protein_id="BAG42087.1"
FT                   /translation="MFGIVHFGFFLPAVFLLNVTPGPDTAYVVGRSVAQGRRAGLMSAL
FT                   GISAGCCVHVLACAFGLTALLAASAAAFTVIKLVGAAYLIYLGVRMVLAKPAAATPDAG
FT                   TASASPAKPLRQLFLQGFWTNVLNPKVVLFFVSFFPQFVAADSPHKTLAFLTLGAVFVT
FT                   MSTIWSGLVAWVAGSVTQRFSGKPGVKKWLDRTVGSAFVGLGLRLATAQR"
FT   CDS_pept        114996..115853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="BMULJ_00109"
FT                   /product="heat shock protein"
FT                   /note="COG0501: Zn-dependent protease with chaperone
FT                   function, Ralstonia solanacearum"
FT                   /note="HtpX protein"
FT                   /note="KEGG, K03799"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00109"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42088"
FT                   /db_xref="GOA:A9AC67"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AC67"
FT                   /protein_id="BAG42088.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLFALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDENTAPQFYRMVRELATRANLPMPRVYLINEDAPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTITATMAGAISAIANFAMF
FT                   FGGRDENGRPVNPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASA
FT                   LDKIHRYAAGIPFQAAEAHPATAQMMIMNPLHGGGLQNLFSTHPATEERIARLMEMART
FT                   GRFD"
FT   CDS_pept        116031..117434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="BMULJ_00110"
FT                   /product="Sun protein"
FT                   /note="COG0144: tRNA and rRNA cytosine-C5-methylases,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03500"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42089"
FT                   /db_xref="GOA:A0A0H3KFR1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFR1"
FT                   /protein_id="BAG42089.1"
FT                   /translation="MTRTRSASPSSSGRAARLSALRVAPDSLGFALDAAAQAVDAVRRG
FT                   TALPAALSAVFAQMASGAQALARGATQDVAYRTMRRLGSVDWLIARLVGKAPPAHVHAV
FT                   LACALALLLDADGEAAYPPFTVVDQAVTAIGARREYAFAKGMVNAVLRRFLRERDTLVA
FT                   AMHADPVAQWNYRAWWIDAVKRAWPDAWQAILAAGDRQGPLTLRVNARRTSVDAYLGTL
FT                   RDNGIEAAAIGRHAVRLASALPVERIPGFADGVVSVQDAGAQLAAEWLGARDGMRALDA
FT                   CAAPGGKTGHILELADAEVVALESDASRATRIGENLARLSLAADVRVGDAGAPDAWYDG
FT                   RPFDRILADVPCSASGIVRRHPDIRWLRREADIPALVAEQRRILSALWPLVKPGGELLY
FT                   VTCSIFPEEGEQQARWFEAACEDAVRLDAPGQLLPRAASGGAGSEGAAGVPDPTTDHDG
FT                   FFYARFQKR"
FT   CDS_pept        117431..118021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00111"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00111"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42090"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB97"
FT                   /protein_id="BAG42090.1"
FT                   /translation="MTIKHLFPLRLAAVLLVALTLCVAIVRPAHAESIAVQRASLQADG
FT                   NGWSLDARFDFELNPNLEDAVNKGIPLYFTTDFELSRARWYWFDEQPVSVSQTIRLSFQ
FT                   PLTREYRVSTGGLQLGFGTLKDALAVVKHITSWHVIDRNQVRAGETYTASVRMQLDTAL
FT                   MPKPFQVDAVNNRDWTLASDWKRFTFTVAERAK"
FT   CDS_pept        118062..120464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00112"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="COG5000: Signal transduction histidine kinase
FT                   involved in nitrogen fixation and metabolism regulation,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00936"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00112"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42091"
FT                   /db_xref="GOA:A0A0H3KJN4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJN4"
FT                   /protein_id="BAG42091.1"
FT                   /translation="MIVSTVAITALLLLVLLAAASANTEFFDRYYSWLYAANIIVALVF
FT                   LLVVLGLIGMIVVRLRKGKFGTRLLAKLAIFFALVGVVPGGIIYIVSYQFVSRSIESWF
FT                   DVNVETALTAGLNLGRGMLDASLSDLQTKARLMSDQLASVDANTNGTTLTLLRLRDQFG
FT                   VQDATIVEPSRGGSGASPDLHIVAQASGNFAALIPDDLPTPLMLSQAREHGAYAAIEGE
FT                   VDGDPRAHGAKGALRLRVVRPIPDATTSMLQPAERFLQLTQPVPPTLAHNADAVQRAYR
FT                   EYQEKSLGRTGLRKMYIGTLTLALFLATFIAMMLALALGQQLARPLFLLAQGTKEVAEG
FT                   DYTPKREIKTRDELGFLTQSFNAMTRQLSEARLAVEKNRIALEHSKAYLESILANLTAG
FT                   VFVLDRQFRLTTANRGAERIFRQPFNSLIGTTLDQIGVVAGFGAMVRKAFADREAASDS
FT                   GSGDTGHWQQQFAVEVPGETDPLTLLVRGTRLVSTVEGQADDPQTSGYVVVFDDISDVI
FT                   SAQRSVAWGEVARRLAHEIKNPLTPIQLSAERLQMKLSDKLAPHDADVLKRGATMIVNQ
FT                   VAAMKRMVDDFREYARTPPAVLANLQLNDLVSEVLGLYGVGEGKNPIVVELAPSLPVIR
FT                   GDATQLRQVIHNLLQNAQDSVAESEHPRVLIETKTVEYGDPDAEGKTRVAVRLTVSDNG
FT                   PGFPARILTRAFEPYVTTKAKGTGLGLATVKKIVDEHGARIDLRNRMHGETVEGAQVSI
FT                   LFLQMASDAPNAGPDGAAPAAASAAGKPAAGRSASTKTKASEQTKAA"
FT   CDS_pept        120465..121166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00113"
FT                   /product="sigma54 dependent DNA-binding transcriptional
FT                   regulator"
FT                   /EC_number="3.1.1.61"
FT                   /note="COG2204: Response regulator containing CheY-like
FT                   receiver, AAA-type ATPase, and DNA-binding domains,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K05971"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00113"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42092"
FT                   /db_xref="GOA:A0A0H3KBA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBA4"
FT                   /protein_id="BAG42092.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVEAAENAQAAREYRLNQA
FT                   PDLVLLDIWMPDTDGVTLLKEWAAQGLLTMPVIMMSGHATIDTAVEATKIGALDFLEKP
FT                   IALQKLLKAVEHGLARGAAPVSANAAAKAGAGQAAGPAAVASAAALPTLGDDVAAALGL
FT                   AGQTAAIPFDIPLREARDAFERAYFEYHLARENGSMTRVAEKTGLERTHLYRKLKQLGV
FT                   ELGKKPSEGAA"
FT   tRNA            121229..121304
FT                   /locus_tag="BMULJ_00114"
FT                   /product="tRNA-Phe"
FT                   /note="anticodon GAA"
FT   CDS_pept        121630..122364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exsB"
FT                   /locus_tag="BMULJ_00115"
FT                   /product="ExsB protein"
FT                   /note="COG0603: Predicted PP-loop superfamily ATPase,
FT                   Caulobacter vibrioides"
FT                   /note="KEGG, K06920"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00115"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42093"
FT                   /db_xref="GOA:A9AC62"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AC62"
FT                   /protein_id="BAG42093.1"
FT                   /translation="MIRTDAKDGALVLFSGGQDSATCVAWALERYQTVETLGFDYGQRH
FT                   RVELECREGVREALKRQFPAWADRLGDDHMIDLSVLGAISDTAMTRAIEIETAANGLPN
FT                   TFVPGRNLLFMTIAAAIAYRRGLRVLVGGMCETDFSGYPDCRDDTMKALQVALNLGMDT
FT                   RIVLETPLMWLDKAQTWQLAEQLGGQALVELIRVETHTCYVGERAELHDWGFGCGECPA
FT                   CKLRKRGYEAYLKGERVTEAPL"
FT   CDS_pept        122439..123071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00116"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0602: Organic radical activating enzymes,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00116"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42094"
FT                   /db_xref="GOA:A0A0H3KB22"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="PDB:4NJG"
FT                   /db_xref="PDB:4NJH"
FT                   /db_xref="PDB:4NJI"
FT                   /db_xref="PDB:4NJJ"
FT                   /db_xref="PDB:4NJK"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0H3KB22"
FT                   /protein_id="BAG42094.1"
FT                   /translation="MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAV
FT                   CRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVD
FT                   ALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYA
FT                   KLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP"
FT   CDS_pept        123091..123543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpS"
FT                   /locus_tag="BMULJ_00117"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /EC_number="4.2.3.12"
FT                   /note="COG0720: 6-pyruvoyl-tetrahydropterin synthase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01737"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00117"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42095"
FT                   /db_xref="GOA:A0A0H3KFR5"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFR5"
FT                   /protein_id="BAG42095.1"
FT                   /translation="MLITRKLEFDAGHRIPDHRSQCRNLHGHRYVLEITLRGDLVDTEG
FT                   APDRGMVMDFADVKALAVEHLVSKWDHAFLVYARDEVVRSFLEQMADHKTVVLDRIPTV
FT                   ENLAAIAFDILASVYDAHYGVNLRLERVRLYETPNCWADVERDAGR"
FT   CDS_pept        123765..124550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garL"
FT                   /locus_tag="BMULJ_00118"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="COG3836: 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase, Sinorhizobium meliloti"
FT                   /note="KEGG, K01630"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00118"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42096"
FT                   /db_xref="GOA:A0A0H3KBA3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBA3"
FT                   /protein_id="BAG42096.1"
FT                   /translation="MSTLTNSLKQRLHDGDEPLYGLWLTLASDTAAEALAHAGYDWLCI
FT                   DMEHAPNDSRDVASQLRAMAAARLPTEPVVRVPAREPWLVKRALDAGARTLMFPCIETA
FT                   DDAAHAVRLTRFPSPESPDGVRGVAGMVRAAAFGMRRDYVQTANAQIAVIVQIESARGI
FT                   DEVERIAATPGVDCVFVGPADLAASLGHLGDVRHPDVESAIARVLAAGRQAGVAVGIFA
FT                   SDSASARQCRDAGYRMIALSADVIWLLRATRQALQEVRS"
FT   CDS_pept        124547..125320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00119"
FT                   /product="SEL1 subfamily protein"
FT                   /note="COG0790: FOG: TPR repeat, SEL1 subfamily, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K07126"
FT                   /note="contains TRP repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00119"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42097"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJN9"
FT                   /protein_id="BAG42097.1"
FT                   /translation="MSAADGACRGRAARRAPRAARLAAALGLGALCAAAAAQRAPHAQP
FT                   EPARETQSAIADYNAGDYRAALVQFHDAAERGDRLAQFNYAMMLLTGEGVTANVDEGLR
FT                   WLKRAANANMSHAQYVYGRMFDDGEFVARNPAEAHRWFLRAAKQGHVQAALSLANQFLD
FT                   GRGTPRDNRQAFLWYKQAADAGEPTAQYVTASFYERGGDGVTRDLNIARAYYAAAAAQG
FT                   DETAELKYQELSARLKAQGSGAGSGAQGDSHAAPQ"
FT   CDS_pept        complement(125361..126509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="BMULJ_00120"
FT                   /product="rod shape-determining protein"
FT                   /note="COG0772: Bacterial cell division membrane protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K05837"
FT                   /note="RodA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42098"
FT                   /db_xref="GOA:A0A0H3KBB1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBB1"
FT                   /protein_id="BAG42098.1"
FT                   /translation="MQFDKRAWLDKIKQMFAGFDRPLALIVFLLLCVGIVTLYSASIDM
FT                   PGRVEDQLRNILLTFVLMWVIANIPPTTLMRFAVPLYTFGVALLVAVALFGMTKKGAKR
FT                   WLNVGVVIQPSEILKIATPLMLAWYYQRREGALRWYDFVAAFGILLVPVGLIAKQPDLG
FT                   TGLLVFAAGFFVIYLAGLSFKLIVPVLVAGVIAVGSIAVFEERICQPEVQWPLMHDYQK
FT                   HRVCTLLDPTSDPLGKGFHTIQAVIAIGSGGVLGKGYLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEWGLVGGLVLLTLYMALIARGLYIAAQGATLFGRLLAGSLTLAFFVYAFVNIGMVS
FT                   GVLPVVGVPLPFMSYGGTALTTLGIAIGMIMSVGRQRRLMKS"
FT   CDS_pept        complement(126521..128848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="BMULJ_00121"
FT                   /product="penicillin-binding protein 2"
FT                   /note="COG0768: Cell division protein
FT                   FtsI/penicillin-binding protein 2, Ralstonia solanacearum"
FT                   /note="KEGG, K05515"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00121"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42099"
FT                   /db_xref="GOA:A0A0H3KB26"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB26"
FT                   /protein_id="BAG42099.1"
FT                   /translation="MTEFNDTQQQLSKFRLRVAAAGVFVFVCFGLLASRFFYLQLMQHG
FT                   KYALQAEENRISVAPIVPNRGIITDRNGVILAKNYSAYTLEITPSKLDDTLENTIDKLS
FT                   QIIPIDARDRRRFKKLQEDSKNFESLPIRTRLTDDEVARFTAQRFRFPGVDVRARLFRQ
FT                   YPLGTTAAHVIGYIGRISKRDQDRIDAMSDENDSDQETYDPRRDANNYKGTDYIGKIGV
FT                   EQSYETELHGLTGFEEVEVTAGGRPVRTLSRTQATPGDNLVLSLDIGLQQVAEQAFAGK
FT                   RGALVAIEPKTGDVLAFVSSPSFDPNSFVDGIDQQTWDELNNSPDKPLLNRPLHGTYPP
FT                   GSTYKPFMALAGLTLGKRTPGWGFQDPGYFTFGGHTFRNDVRSGQGWVDMNKAIMVSND
FT                   TYFYMLARDLGVNAIANFMKPFGFGQITGIDIQGEARGILPSTDWKKKAFKKAAQQKWF
FT                   DGETISLGIGQGYNSFTILQLAHATATLANNGIVMKPHLVKEIEDPITRARHLTVPKES
FT                   GVIPLKQADIDVVKRGMENVIENPSGTAYKVFRGAPYLAAGKTGTAQVFSLQGGNYKGH
FT                   LLAEHLRDHALFIAYAPVDHPQIALALIVENGGWGAQSAGPIARRVLDFYLVERQNAQN
FT                   EAAAVAAAASATEPVNAPVIGDGSKPVTVAAGFKPLPQPVVPNAASAAQAASGASATGA
FT                   SDTPGAAGAAAASAAPPVDASAAAPLAASLPPMRRMHRPHRPAGDDPRKPPQDGQPFAA
FT                   GPRDDHSRATAAADAANAGTAH"
FT   CDS_pept        complement(128951..129463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="BMULJ_00122"
FT                   /product="rod shape-determining protein"
FT                   /note="COG2891: Cell shape-determining protein, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03571"
FT                   /note="MreD protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00122"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42100"
FT                   /db_xref="GOA:A0A0H3KFR9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFR9"
FT                   /protein_id="BAG42100.1"
FT                   /translation="MNRPQYILQPVNPYFIAFSLAAAFLLNLMPWGRLPGVPDFVALVL
FT                   LFWNIHQPRKVGMGVAFALGILMDVHDAGLLGEHALAYTLLSYGAITIHRRVLWMPIGV
FT                   QVLYVTPLLVGAQLVPFVIRLMMGAAFPGWRYLVDGFVEAALWPLASHLLLMPQRRPVD
FT                   PDDTRPI"
FT   CDS_pept        complement(129460..130563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="BMULJ_00123"
FT                   /product="rod shape-determining protein"
FT                   /note="COG1792: Cell shape-determining protein, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03570"
FT                   /note="MreC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00123"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42101"
FT                   /db_xref="GOA:A0A0H3KBA8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBA8"
FT                   /protein_id="BAG42101.1"
FT                   /translation="MEYSPPPLFKQGPPALARLIFFVALAIALLVSDARFSTLEIVRGV
FT                   LGTVLYPLQRAALVPRDLFMGAADLAVTGATLRGENEQLRKRNLQLSTLANQAAILTQE
FT                   NVHLRALLALRQQIAAQSTPVEIQYDTSDPFTQKIVIGQGSQQGIQDGAPVVSEDGVVG
FT                   QVTRVFPLQAEVTLITDRDLAIPVQVLRTGLRSVIYGTPKGDSLDLRFVPTSADLVAGD
FT                   ELVTSGLDGVYPPGLPVAKVVRVDKLADTAFARVTCAPVAAVRGARQMLVLHYQNDIPP
FT                   RPADPEPAAEKNAKGKKAAKAAAAKGEKAEKGEKADASAKPADAAKQPADAAPPAGAKP
FT                   APAKPAAPGKPAGTAAKPATAPSGAQR"
FT   CDS_pept        complement(130689..131732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="BMULJ_00124"
FT                   /product="rod shape-determining protein"
FT                   /note="COG1077: Actin-like ATPase involved in cell
FT                   morphogenesis, Ralstonia solanacearum"
FT                   /note="KEGG, K03569"
FT                   /note="MreB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00124"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42102"
FT                   /db_xref="GOA:A0A0H3KJP2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJP2"
FT                   /protein_id="BAG42102.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   CDS_pept        132097..132396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BMULJ_00125"
FT                   /product="aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln)
FT                   amidotransferase subunit C"
FT                   /note="COG0721: Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K02435"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00125"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42103"
FT                   /db_xref="GOA:A0A0H3KBB6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBB6"
FT                   /protein_id="BAG42103.1"
FT                   /translation="MALTLTDVKRIAHLARLEMADADAEHTLGQLNEFFGLVEQMQAVD
FT                   TAGIAPLAHPIEQIQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE"
FT   CDS_pept        132467..133966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BMULJ_00126"
FT                   /product="aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln)
FT                   amidotransferase subunit A"
FT                   /note="COG0154: Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases, Ralstonia solanacearum"
FT                   /note="KEGG, K02433"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00126"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42104"
FT                   /db_xref="GOA:A9AC51"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AC51"
FT                   /protein_id="BAG42104.1"
FT                   /translation="MHAKSLTELRAALAAKECSAVELAQHYLKRIDAARDLNAFVHVEP
FT                   ELTLAQAKAADAELARGAGGPLTGLPIAHKDVFVTRGWRSTAGSKMLANYESPFDATVV
FT                   ARLQAAGMVTLGKTNMDEFAMGSSNENSAFGAVKNPWDTNAVPGGSSGGSSAAVAARLA
FT                   PAATGTDTGGSIRQPASFAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMAQSASDCALL
FT                   LNAMAGFDERDSTSLERDDEDFARHLGQPWAPGNDAGKPLAGLRIGLPNEYFGDGLADD
FT                   VRAAIDAALKQYEALGATLVPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAA
FT                   QYGDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIANDFQEAF
FT                   KSCDVIMGPASPTVAWDLGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAK
FT                   RPVGLQIIGNYFNEARMLQVADAFQRATDWHKQVPQVPAGV"
FT   CDS_pept        133971..135446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BMULJ_00127"
FT                   /product="aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln)
FT                   amidotransferase subunit B"
FT                   /note="COG0064: Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog), Ralstonia solanacearum"
FT                   /note="KEGG, K02434"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00127"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42105"
FT                   /db_xref="GOA:A9AC50"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AC50"
FT                   /protein_id="BAG42105.1"
FT                   /translation="MSTQWEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLA
FT                   LPGVLPVLNRGAVERAIRFGLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQG
FT                   GAITIQVPANEKAGKPAYEKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEI
FT                   VTEPEMRSAAEAVAYAKALHALVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAE
FT                   IKNLNSFRFLEEAINYEVRRQIELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRY
FT                   FPDPDLMPLVIGRDWVERVQAGMPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFE
FT                   AVVAKAGAANAKIAANWLMGDVSSQLNRDGIEIDAIPVSAAQLALLLQRIADGTISNKI
FT                   AKEVFATMWEEKASDDGAADRIIEAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGK
FT                   EKAFNALIGQAMKATKGKANPQQVNELLKKKLG"
FT   CDS_pept        135562..136401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00128"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2326: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00128"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42106"
FT                   /db_xref="GOA:A0A0H3KB31"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB31"
FT                   /protein_id="BAG42106.1"
FT                   /translation="MAKQPSLDDFRVPYFKHGKDGAAFRLDAFDPSAKPFSSGSKDADR
FT                   ERLSIVSTELDVQQERLHTQQKKRVLLVLQGMDTSGKDGTVRAVFRDVDPLGLRIVPFK
FT                   APTPIEAAHDFLWRVHAQVPAAGELAIFNRSHYEDVLVPRVLGTIDDKECERRYRQIRD
FT                   FETMLAENGTTIVKCFLHISKDEQRERLQARIDDPTKHWKFDIADLDARKHWDAYQAAY
FT                   RDALAATSAEHAPWYVIPANSKTHRNVMIAELLLRAMTEMKLQYPPPKPELEGVKVR"
FT   CDS_pept        136439..137209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="BMULJ_00129"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="COG0708: Exonuclease III, Ralstonia solanacearum"
FT                   /note="KEGG, K01142"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00129"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42107"
FT                   /db_xref="GOA:A0A0H3KFS5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFS5"
FT                   /protein_id="BAG42107.1"
FT                   /translation="MMRVITANLNGIRSAAKKGFFDWLGEQNADCVCVQEIKVSADDLP
FT                   AEFVAPHGLKSYFHHAAKKGYSGAGLYSRREPDDVIIGFGSSEFDPEGRYVEARYGKLS
FT                   VVSVYVPSGSSGDERQQAKYRFMDEFMPHLAELKKTREVILCGDVNIVHKEIDIKNWKS
FT                   NQKNSGCLPEERAWLSKLFDDVGYVDVFRTLDPRPEQYTWWSNRGQAYAKNVGWRIDYQ
FT                   IATPGVASTAKSTSIFKDIKFSDHAPLTVDYDYA"
FT   CDS_pept        complement(137311..138363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="BMULJ_00130"
FT                   /product="NADP-dependent alcohol dehydrogenase"
FT                   /EC_number="1.1.1.2"
FT                   /note="COG1064: Zn-dependent alcohol dehydrogenases,
FT                   Xylella fastidiosa 9a5c"
FT                   /note="KEGG, K00002"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42108"
FT                   /db_xref="GOA:A0A0H3KBB4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBB4"
FT                   /protein_id="BAG42108.1"
FT                   /translation="MSTTYAYAATDAQSPLAPFEFQRRALRDLDVQIEILYCGVCHSDL
FT                   HQARNEWRNTIYPVVPGHEIVGRVTATGPQVSRFKVGELVGVGCLVDSCRTCASCAEGL
FT                   EQYCENGFVGTYNGQDRVTGDITYGGYSTQIVVDEAFVLRVPDTLDAAGAAPLLCAGIT
FT                   TYSPLRQWNVGPGKKVGIVGLGGLGHMGVKLARAMGAHVVLFTTSPSKIEDGKRLGAHE
FT                   VVVSKDEAQMNAHLNSFDFILNTVAAQHDLNPFLHLLKRDGTMTLVGAPEHDHPSPQVF
FT                   NLIFKRRRLAGSLIGGIAETQEMLDFCAQHGITSDIEIIPMQQINAAYERMLKSDVKYR
FT                   FVIDMASIKQ"
FT   CDS_pept        138593..139480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00131"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00131"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42109"
FT                   /db_xref="GOA:A0A0H3KJP5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJP5"
FT                   /protein_id="BAG42109.1"
FT                   /translation="MSFQPLFADSADRVRRRMIELHTRLAPDEGDTPAAIDGVRFIRVS
FT                   RPAPRLPVLYEPSIVVVCQGRKLGYLGERSFVYDAQQYLAISIRVDLAVIAELAILLDE
FT                   TLGAAVSEPHGVYSTPLDAPLADAVLRLLETLASPHDTRVLGPSIMREIAYRVLTGAQG
FT                   DAIRAALVQQHHFGRIAKALRRIHADLQADLDVETLAREAGMSLAVFHAQFKHVTATSP
FT                   MQYVKTARLHQARLMMVQNGLGAGAAAARVGYASASQFSREFKRLFGRSPGDEVRAMRD
FT                   SSDRTAGAVAAAQR"
FT   CDS_pept        complement(139494..140543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00132"
FT                   /product="putative Zn-dependent protease"
FT                   /note="COG0501: Zn-dependent protease with chaperone
FT                   function, Ralstonia solanacearum"
FT                   /note="contains chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00132"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42110"
FT                   /db_xref="GOA:A0A0H3KBC2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBC2"
FT                   /protein_id="BAG42110.1"
FT                   /translation="MRNDRLRALARLVASLSVGAAALGVPAAQASDTAGNAAGNATGAA
FT                   PSAAPAPAAATPAPPSAADATQPSGAAASAKAYTPAPQQVRLGNAIAFRSLIPSPLLEQ
FT                   LTASEYAQIVQRAADEKRLLPASQPRMKRLHAIVAKLAPYSVKWNDRVKGWTWDVNAIR
FT                   SREIRLTCLPGGKILVYTGLLDRVRLNDDELGVLIAHGIAHALREHARSNFGATSQTSL
FT                   RAATLPPLFGVGDPLPQSLHLGERLQTLRYDPTDETEADVIGGDIAARAGFDPRAAITL
FT                   WDKLAAATRANKTAGFIYTHPYGASRRQDLLNRLPDLMPLYAKAIGKRVDALPDYAGIS
FT                   AQRRKVVRR"
FT   CDS_pept        complement(140533..141954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="BMULJ_00133"
FT                   /product="beta-lactamase induction signal transducer"
FT                   /note="AmpG protein"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Neisseria meningitidis MC58"
FT                   /note="KEGG, K08218"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00133"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42111"
FT                   /db_xref="GOA:A0A0H3KB37"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB37"
FT                   /protein_id="BAG42111.1"
FT                   /translation="MSKTPHEAPALTAHEEHPGWRAYLNTHMLICVFLGFTSGLPLFTL
FT                   VYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFLWAPLMDRYIPRLPGWRPGRRRGWMLL
FT                   TQVLVAGAIAALGFVSPRDSIWTVAALTTLVAFFGASSDIVIDAYRRELLRDTEQGLGN
FT                   AVHVNAYKIAALIPGSLSLILSDHLPWDVVFAVTGAFMLPGILMTLVVREPDVVGSPPR
FT                   SLRDAIVLPFREFIQRDGWAGALLVIAFIFLFKVGDTMATTLSTSFFLDVGFTRTEIGI
FT                   VAKTTALVASVAGGIIGGVWLVKIGIGRGLWIFGVLQMVSTLGFAWLAQLGPGSPVLAV
FT                   LYDFTVAASHAIASGLSIFGIAVTPHFSPMTVALAIVYGAETFATGLTMAAFVAYIAST
FT                   TDPRYTATQFALFTSLASVPRTLASAASGFIVAKIGWFDYFLVCTALGIPGMLLLFWIA
FT                   PWNGTARNGEASRAQ"
FT   CDS_pept        complement(142099..142707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="BMULJ_00134"
FT                   /product="methionine biosynthesis protein"
FT                   /note="COG0500: SAM-dependent methyltransferases, Ralstonia
FT                   solanacearum"
FT                   /note="MetW protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00134"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42112"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFT0"
FT                   /protein_id="BAG42112.1"
FT                   /translation="MNQQALNSLSARADFRAIARWVEPRSTVLDLGCGDGSLLSLLMEE
FT                   LDVTGYGIELNDAGVLASAKNGINVIQQNLEDGLRLFEDHSFDFAILSQTLQTIHQTAA
FT                   ILRETARVGRECIVSFPNFGYWAHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIKDFEA
FT                   LAPEVGITILDRVVLHEGQPIRWGANWRGSLAVYRVKRS"
FT   CDS_pept        complement(142704..143849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="BMULJ_00135"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="COG2021: Homoserine acetyltransferase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00641"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00135"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42113"
FT                   /db_xref="GOA:A9AC42"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AC42"
FT                   /protein_id="BAG42113.1"
FT                   /translation="MESIGIVAPQTMHFAEPLRLQSGSVIGNYQLVVETYGELNAARSN
FT                   AVLVCHALNASHHVAGVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTG
FT                   PMSIDPSTGKPYGARFPVVTVEDWVHAQARVADAFGIERFAAVMGGSLGGMQALAWSLM
FT                   YPERVAHCIDIASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPKRGLRVARM
FT                   IGHITYLSDDDMAEKFGRALRRADGALDAYNFSFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFDGNLTAALAHTQAKYLIASFSTDWRFAPARSREIVKALLDNK
FT                   RTVSYAEIDAPHGHDAFLLDDARYHNLIRAYYERIANEVGA"
FT   CDS_pept        complement(144136..147141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00136"
FT                   /product="outer membrane autotransporter barrel"
FT                   /note="COG3468: Type V secretory pathway, adhesin AidA,
FT                   Escherichia coli O157:H7"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00136"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42114"
FT                   /db_xref="GOA:A0A0H3KBC0"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBC0"
FT                   /protein_id="BAG42114.1"
FT                   /translation="MPDMPPVRRSLCSALIAAILGPLPAAAQVVNNPQYAIGEHVEIAA
FT                   GDYATVNHDPVLNVSKGGLMTVAGPVRVFSKGIGAMGLSVHGAGSRIELQDSQVHTTGN
FT                   SAYGLYLFNGSGAPNGASALLDNTTLNTLDDNAAGVRMYGAGNRLDMAGGSIDTLGREA
FT                   YGIYVGPGPGASIAVGDTRIRTVGAFAPAIALGSDGNHAKLERIDVTTEGQESAALSQI
FT                   GENTMTVADSTLRTNGVLAPAVDVREGAMTMARTDVITTGESSHGLYASRELALDAQTA
FT                   QLDVADSRVTTQGLGAAGAIARDGAEVTVTGTAVETHGDKAIGALSVRDDSIASLVDST
FT                   VVTHGELARGVQASYGGLVDLVDTTVRTEGERAAGAGIFGGELHLDGGSIVSAQGSAIE
FT                   ATTGLVRASRGAHIEGGNGTLLAVAAKAGEPVHLLLDNATARGNIVNVPAEDGSPTPAV
FT                   TNLALSRGAAWEGATQAVRALSMQGGSQWTVTGDSAVQGVRLDGSTIAFAAPAGGAHKT
FT                   LVVHGDYAAKDGKVVLNTVYGDDLAPSDKLVIDGGRASGNTALVVKRTSGDGATTKVGI
FT                   PLVETRNGGTTDAAAFALDAASDGYRKDFGTVSAGGYDYMLTRGGASGRADDWYLVSAA
FT                   KPAPPEPPAPPQPPEPPAPPQPIDPETVPPKPEVVPPPVRAVAPEPDAYLANADAAILM
FT                   PIHTLHERSDQTLRAETDENARDGAVWLRAQGLSTSLGGGNGSGGRSVSGNGRLLHVGA
FT                   DMFRLEDGRGGSFRIGAMGLYASATSWSTRTLWNPVAQRYMPATARGSIDGYNAGLYAT
FT                   WYGNRDILTGPHVDTWLMFGAYSNRIGGSLPSDSYRSRTLTASIEGGYSLGVYDDGRSR
FT                   FFVEPAAQIVYANYQAKGHDSPGGYIGVQRSNDVLARIGVRVHGVTPISALQALRPFIE
FT                   ANWWHGPGSHQLSVDGNPFELRMPRDRAEFKLGATGQLTRNLSVSASVGVDSNFSNYAT
FT                   VKGQLAAKYRWR"
FT   CDS_pept        complement(147732..148397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="BMULJ_00137"
FT                   /product="TetR/AcrR family transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K05501"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00137"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42115"
FT                   /db_xref="GOA:A0A0H3KJP9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJP9"
FT                   /protein_id="BAG42115.1"
FT                   /translation="MQPTHPQDHRVTDDQATPARARARPKPGERRMLILQTLASMLEAP
FT                   KREKITTAALAARLDVSEAALYRHFASKAQMYDGLIEFIEETFFGLINQIAAKEPDGVL
FT                   QARAIGMMLLNFAAKNPGMTRVLTGEALVGEHERLAERIDRMLERIEASVRQCLRVALA
FT                   ERTAAAGSGAPLPAGYDPAVRANLLVGYAVGAWQRYTRSGFTKPPGELAEQKLQLILQ"
FT   CDS_pept        complement(148364..149155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00138"
FT                   /product="putative hydrolase of the HAD superfamily"
FT                   /note="COG1011: Predicted hydrolase (HAD superfamily),
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K07025"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00138"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42116"
FT                   /db_xref="GOA:A0A0H3KBC5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBC5"
FT                   /protein_id="BAG42116.1"
FT                   /translation="MSARRPPSGIDLPASLRRRRVSRSRPRAGAPVWLFDLDNTLHHAS
FT                   HAIFPEINRAMTQYIVDTLQVERAEADRLRTGYTMRYGAALLGLTRHHPIDPHDFLRVV
FT                   HTFADLPAMLRAERGLARVVAALPGRKFVLTNAPERYARAVLRELRIERLFERVIAIEH
FT                   MRDRRTWRAKPDSAMLRRVLRDAHACIEDAILVEDTRSHLKHYKRLGIGTVWITGHLPG
FT                   HLPSTGRPHYVDRRIRSLKSLRLGTRSGRQKCSRLTRRTTA"
FT   CDS_pept        complement(149152..150051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="BMULJ_00139"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COG0548: Acetylglutamate kinase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00930"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00139"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42117"
FT                   /db_xref="GOA:A0A0H3KB40"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB40"
FT                   /protein_id="BAG42117.1"
FT                   /translation="MSEPLDLSQIAPTLKAEILAEALPYIRRYHGKTVVIKYGGNAMTE
FT                   ERLKQGFARDVILLKLVGINPVIVHGGGPQIDHALKKIGKAGTFIQGMRVTDEETMEVV
FT                   EWVLGGEVQQDIVMLINHFGGHAVGLTGKDGGLIHARKLLMPDRDNPGEYIDIGQVGEV
FT                   EAINPAVVKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLATVLNAEKLVMMTNIP
FT                   GVMDKEGNLLTDLSAREIDALFEDGTISGGMLPKISSALDAAKSGVKSVHIVDGRIEHS
FT                   VLLEILTEQPFGTMIRSH"
FT   CDS_pept        150346..150570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42118"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFT4"
FT                   /protein_id="BAG42118.1"
FT                   /translation="MTDSAAGVRSVPRRVRCARCGRGFDCGAHTQPFECWCASMPTPPG
FT                   APPSAPGMRCLCPECLAAEIAQRMAGAPG"
FT   CDS_pept        150669..152072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00141"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00936"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00141"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42119"
FT                   /db_xref="GOA:A0A0H3KBC4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBC4"
FT                   /protein_id="BAG42119.1"
FT                   /translation="MQRITTTGRVNLSHLFWLRNLAIIGQLVTIGVVQTYFGVHLPLPA
FT                   MLMVIALEIVFNALTWVRVLRARPETNFELLGQLWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWHLMIWLAAFAVACYAALGFDSVPLNMDNPANLFDYYRTGMWVNFMV
FT                   SVGLIAWFVARMSNALRQRDSALGDAQQRLLRDERAVALGVQAATVAHEMGTPLSTIAM
FT                   LAEELRDAARDDPGLARYEADLKVLEEQMMLCTSALARLRSRASAPASRQPVDEWLDTF
FT                   VEHWRLRHPHVQFELLGARPSGVALDDTVAAGQILTILLDNAARASPHRVTLAAKVVHD
FT                   RTPDQIAFEVCDDGPGIPAALRESLGAMPVDSTQGGHGVGLYLAFSAAARLGGEIELSD
FT                   VTPRVGGAARAGAATAAAAQASGQGAAPAERAAGADGRPVAGGRGTRAVLRLPVARIAV
FT                   QPAAASHHT"
FT   CDS_pept        152087..152629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00142"
FT                   /product="signal transduction response regulator"
FT                   /note="COG4567: Response regulator consisting of a
FT                   CheY-like receiver domain and a Fis-type HTH domain,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00142"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42120"
FT                   /db_xref="GOA:A0A0H3KJQ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJQ3"
FT                   /protein_id="BAG42120.1"
FT                   /translation="MSDNNFLVIDDNEVFAGTLARGLERRGYAVQQAHDKETALRLAAA
FT                   GKFQFITVDLHLGDDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKEGADNYLAK
FT                   PANVESILAALQTNASEVQAEEAIENPVVLSVDRLEWEHIQRVLAENNNNISATARALN
FT                   MHRRTLQRKLAKKPVRQ"
FT   CDS_pept        complement(152655..153026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00143"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42121"
FT                   /db_xref="GOA:A0A0H3KBD1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBD1"
FT                   /protein_id="BAG42121.1"
FT                   /translation="MPFLFPSIAGLFVPELRALTRADLHALLERVRRDSLHRYNVAFVI
FT                   SWLGGIAGALLLGLLLGAGVAFVAGRCLPAAWVSAIMTGLVGALMWPLTHALGTALMTI
FT                   RLKAEINAQLARDAGRSPR"
FT   CDS_pept        complement(153241..154575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="BMULJ_00144"
FT                   /product="ATP-dependent HslUV protease ATP-binding subunit
FT                   HslU"
FT                   /note="COG1220: ATP-dependent protease HslVU (ClpYQ),
FT                   ATPase subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K03667"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00144"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42122"
FT                   /db_xref="GOA:A0A0H3KB45"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB45"
FT                   /protein_id="BAG42122.1"
FT                   /translation="MTPAEIVSELDKHIIGQAKAKKAVAVALRNRWRRQQVAEPLRQEI
FT                   TPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLVEIS
FT                   VKQTRESEMRKVRSKATDQAEDRILDILLPQPRAVGFGGNADHANDDNNATRQTFRKRL
FT                   REGQLDDKEIELDLEQPSVGMDIMAPPGMEEMTEQIRSMFSNLGSGKKQRRKVKIKEAL
FT                   KLLTDEEAAKMLNDEEVKTKAVQNVEQNGIVFLDEIDKITSRNNEGSGGEVSRQGVQRD
FT                   LLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLSVND
FT                   FEAILVATDASLVKQYQALLATEDVELEFADDGIRRLAEIAYSVNEKTENIGARRLYTV
FT                   IEKLLEEVSFSAGNHAGERVTIDAKYVDRALGEVSQDEDLSRYVL"
FT   CDS_pept        complement(154595..155131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpQ"
FT                   /locus_tag="BMULJ_00145"
FT                   /product="ATP-dependent HslUV protease subunit HslV"
FT                   /note="COG5405: ATP-dependent protease HslVU (ClpYQ),
FT                   peptidase subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K01419"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00145"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42123"
FT                   /db_xref="GOA:A9AC32"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AC32"
FT                   /protein_id="BAG42123.1"
FT                   /translation="MEQFHGTTIVSVRRGDKVALGGDGQVTLGNIVMKGGARKVRRIYN
FT                   NQVLVGFAGGTADAFSLLDRFEAKLEKHQGNLTRAAVELAKDWRTDRMLRRLEAMLITA
FT                   DANTTLVITGNGDVLDPEGGICAIGSGGAYAQAAARALAENTELSPREIVEKSLEIAGD
FT                   MCIYTNHNRVIETIE"
FT   CDS_pept        complement(155366..155782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="BMULJ_00146"
FT                   /product="DnaK suppressor protein"
FT                   /note="COG1734: DnaK suppressor protein, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06204"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00146"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42124"
FT                   /db_xref="GOA:A0A0H3KFT8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFT8"
FT                   /protein_id="BAG42124.1"
FT                   /translation="MTKKLLTEAEILKMSDKDYMNEDQLAFFKARLEQLQAEILHNAGQ
FT                   TTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSLARIESGEYGWCEET
FT                   GEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
FT   CDS_pept        complement(155859..156326)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00147"
FT                   /note="inactivated hypothetical protein"
FT   CDS_pept        complement(156258..157337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00148"
FT                   /product="cobalamin biosynthesis protein"
FT                   /note="COG0523: Putative GTPases (G3E family), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00148"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42125"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBC9"
FT                   /protein_id="BAG42125.1"
FT                   /translation="MATPVTILTGFLGSGKTTLLKRILNEQHGMKIAVIENEFGEENID
FT                   NEILVQDTNEQIIQMSNGCICCTIRGDLARALGDLAAKKREGKLDFDRIVIETTGLANP
FT                   GPVAQTFFIDSEIADDFLLDAVITLVDAKHANAQLDEHEVVQRQVGFADRLFITKSDLV
FT                   DDETVAGLKHRLMHMNPKATIKLVNFGEADIKEIFDLRGFNLNAKLEIDPDFLAEDDHA
FT                   HHDHDHDHDHAHCDHDHGQCAHDHDHGHGHHNHHHAHHDDKIKSFVYRNDRPFDPNKLE
FT                   DFLGGILQIYGERMLRYKGVLYMKGVDRKVVFQGVHQMMGSDLAAKWLPAEKKTNKMVF
FT                   IGVDLPQDLITDGLDACLA"
FT   CDS_pept        complement(157610..158824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00149"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="COG1092: Predicted SAM-dependent methyltransferases,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K06969"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00149"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42126"
FT                   /db_xref="GOA:A0A0H3KJQ7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJQ7"
FT                   /protein_id="BAG42126.1"
FT                   /translation="MQTVTLKPSKEKSLLRRHPWIYANAIDRVDGKPAPGATVVVRAHD
FT                   GRFLARGAYSPQSQIRVRVWSFDENEPIDHAFFKRRVQRAVAHRTAMVSGTGAVRLVFG
FT                   EADGLPGLIVDHYVADTAEAGAAPRGQLVCQFMAAGVEAWKDAIVAALVGATGCPNVYE
FT                   RSDVSIRDKEGLEQTTGVLAGDAPPATLIVDENGVRYHVDVPNGHKTGFYVDQRDNRAL
FT                   VAQHAAGRDVLNCFCYTGGFSLAALKGGATRVVSIDSSGDALALAQQNVVANGFDPARA
FT                   TWLDADAFKTLRRLVDEGERFDLIVLDPPKFAPTRDSVDRAARAYKDINLSGFRLLRPG
FT                   GLLFTYSCSGAIDMDLFQKIVAGAAADAKVDARILKRLGAGVDHPLLAAFPEGEYLKGL
FT                   LLQVV"
FT   CDS_pept        complement(158901..159821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="BMULJ_00150"
FT                   /product="tyrosine recombinase"
FT                   /note="COG4973: Site-specific recombinase XerC, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03733"
FT                   /note="XerC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42127"
FT                   /db_xref="GOA:A0A0H3KBD7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBD7"
FT                   /protein_id="BAG42127.1"
FT                   /translation="MTDDPIAAYLSNLKYVRQLSEHTLRAYTHELDELKKLAAGRPLDT
FT                   LVAADIRGAVARAHAGGLSARSISHRLSAWRAFYRWLAQRVEMPANPVAAVRAPKRPKT
FT                   LPKALSVDDASALMDAPLADTTEGIRDHAILELFYSSGLRLAELIGLDVAYTQTGDYRS
FT                   AGWLDLAEAEVTVRGKGNKERKVPVGRKAIDALNAWLAVRGEFVKHDPHPLFLSVRGNR
FT                   MSPGVVRERVKRAALAAGIPAHVHPHVLRHSFATHVLQSSGDLRAVQELLGHASVSATQ
FT                   VYTSLDFQHLAKIYDSAHPRAKKRD"
FT   CDS_pept        complement(159835..160563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00151"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3159: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00151"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42128"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB49"
FT                   /protein_id="BAG42128.1"
FT                   /translation="MNDREVADYLLANPEFFARHAELLATIRLANPHGKAAISLQERQM
FT                   EMLRDKNKHLERRLAELVRYGHENDSLSAKFGRWTARVIAERDPYALPRTIADGIADVF
FT                   DVPQTALRVWDVADTYAQADFARQVGEEVRLFANGLVTPYCGANTGFEAAQWLAPAVAA
FT                   PAANAADGGDAAAPAGDGAAASVALLALRAPQAGADAPAFGLLVLGSPDPRRFHDGMAT
FT                   DFLAQIATLASAALTRLLPH"
FT   CDS_pept        complement(160603..161472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="BMULJ_00152"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="COG0253: Diaminopimelate epimerase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01778"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00152"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42129"
FT                   /db_xref="GOA:A0A0H3KFU2"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFU2"
FT                   /protein_id="BAG42129.1"
FT                   /translation="MKLSFTKMHGAGNDFVVLDGYSRTLPPLTAAQVRALASRHFGIGA
FT                   DQLLLVEKPTVDGADFKYRIFNCDGGEVEHCGNGARCFVKFVSDRGLTDKRSVRVQVMK
FT                   GLITLTMQDNGEVVVDMGAPVFAPEQVPFDASGLDGRSEGRDTLWPLEVGGRTRWISTV
FT                   SMGNPHAVQVVDDAEAYPVLEEGPLIERHARFPQRVNAGFMQIVSRSEVKLRVYERGAG
FT                   ETLACGTGACAAVAAGIRRGLLDSPVTVHTHGGTLTIGWDGARDESAALMMAGPAATVF
FT                   EGEIDLPA"
FT   CDS_pept        complement(161894..162778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="BMULJ_00153"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="COG1560: Lauroyl/myristoyl acyltransferase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K02517"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00153"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42130"
FT                   /db_xref="GOA:A0A0H3KBD4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBD4"
FT                   /protein_id="BAG42130.1"
FT                   /translation="MLGRLGTHLAIGLLKLFALLPYGLTARIGDGLGWLLYQIPSRRKR
FT                   IVHTNLKLCFPDWSDARREEVAGRHFRHAIRSYVERSVQWFGSEKKLAKLIQVDSAVDL
FT                   DDPDLPPTLFLGLHFVGIEAGSIWLNRSLHRRCGSLYQPFSNPVLEAEAKKARGRFDAE
FT                   MVGRADSARVVLRWLRDRKPVMLGADMDYGLRNSTFVPFFGVPACTLTAVGRLAKTGHA
FT                   QVVPFIGEVLPNYKGYRLRVFKPWEHYPTGDDDLDARRMNEFLEEQIPLMPEQYYWVHK
FT                   RFKTRPPGEPSLY"
FT   CDS_pept        163044..164231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BMULJ_00154"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COG0192: S-adenosylmethionine synthetase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00789"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00154"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42131"
FT                   /db_xref="GOA:A0A0H3KJR4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJR4"
FT                   /protein_id="BAG42131.1"
FT                   /translation="MANDYLFTSESVSEGHPDKVADQISDAILDAILEQDKYSRVAAET
FT                   LCNTGLVVLAGEITTTANIDYIQIARDTIKRIGYDNTDYGIDYKGCAVLVAYDKQSPDI
FT                   AQGVDRAHDDNLDQGAGDQGLMFGYACDETPELMPLPIYLSHRLVERQASLRRDGRLPW
FT                   LRPDAKSQVTIRYVDGKPDSIDTVVLSTQHAPDIELPALREAVIEEIIKPTLPADLIKG
FT                   DIKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYA
FT                   GRYVAKNIVAAGLASRALIQVSYAIGVAEPTSVMVNTFGTGRVSDAVITKLVREHFDLR
FT                   PKGIIKMLDLLRPIYEKTAAYGHFGREEPEFSWEATDKALALAEAAGVEPTARVA"
FT   CDS_pept        complement(164328..164669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00155"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBE2"
FT                   /protein_id="BAG42132.1"
FT                   /translation="MPFRLTSRLSRAAKRVVPSAPARPLRHHRTRVRALAERTHALSRL
FT                   DGIRAWFHAFLSLMSAQALARRAGLRSLLQKPSSLRALALRRAQAPQRRVNRPRRLAAS
FT                   NGWFGFGGR"
FT   CDS_pept        165022..165795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phyH"
FT                   /locus_tag="BMULJ_00156"
FT                   /product="phytanoyl-CoA hydroxylase"
FT                   /EC_number="1.14.11.18"
FT                   /note="COG5285: Protein involved in biosynthesis of
FT                   mitomycin antibiotics/polyketide fumonisin, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00477"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00156"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42133"
FT                   /db_xref="GOA:A0A0H3KB56"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB56"
FT                   /protein_id="BAG42133.1"
FT                   /translation="MSSPLQSESIREQVAELRERGFVVARGLVGEQQCATLKRIAQQQL
FT                   EEAAAPIEFEADLRYPGAPESKHAPGGHTVRRLLDAYGRDPAFAERAIAPEIGAWMREY
FT                   FGEQPVLSRAHHNCMMTKHPAYGSLTGWHRDFRYWAFERADMVSVWLALGPETNENGAL
FT                   WLVPGSHTAEFGPDAFDDAKFFRSDLPANRAMIDAATCPSLNTGDVVFFHCNTLHSAGQ
FT                   NRSDDVKFSLVYTYHGISNRPIPGTRSASKPEVQF"
FT   CDS_pept        complement(165934..166143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00157"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42134"
FT                   /db_xref="GOA:A0A0H3KFU9"
FT                   /db_xref="InterPro:IPR021521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFU9"
FT                   /protein_id="BAG42134.1"
FT                   /translation="MSRVISVALLVGGIVLLYFGGQSFHSLNDNLSRFFTGSPATKTIL
FT                   LIAGGAVALLVGLIGLAMPGSNKR"
FT   CDS_pept        166322..167365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00158"
FT                   /product="NADP-dependent aryl-alcohol dehydrogenase"
FT                   /EC_number="1.1.1.91"
FT                   /note="COG0667: Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases), Escherichia coli O157:H7"
FT                   /note="KEGG, K05882"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00158"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42135"
FT                   /db_xref="GOA:A0A0H3KBE0"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBE0"
FT                   /protein_id="BAG42135.1"
FT                   /translation="MAYEAASERYADMQYRTCGKSGLKLPALSLGLWHNFGDSTPIATQ
FT                   REILRTAFDLGITHFDLANNYGPPYGSAEINFGRLLKEDFRPYRDELLISTKAGWDMWP
FT                   GPYGSGGGSRKYVLASLDQSLQRMGLDYVDIFYSHRFDAHTPLEETAGALAAAVQQGKA
FT                   LYIGISSYSAAKTREMAELLAQYKVPLLIHQPSYNMLNRWIERELLDTLDEIGTGSIAF
FT                   TPLAQGLLTSKYLGGVPADARVNKPGGGSLKQEHLSAANLEHVRKLNEIAQRRGQSLAQ
FT                   MALAWVLRGGRVTSALIGASRAEQVRENVGALKNLEFSADELAEIDRYATEGGINLWEK
FT                   PSTDQAI"
FT   CDS_pept        complement(167453..167638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00159"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42136"
FT                   /db_xref="GOA:A0A0H3KJR9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJR9"
FT                   /protein_id="BAG42136.1"
FT                   /translation="MTTYFTIGDFILLIPMALAGALFLGAVPCATQFRHNLLRALGVIL
FT                   GVGVAVLLVEGLPALI"
FT   CDS_pept        complement(167932..168813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00160"
FT                   /product="drug/metabolite transporter (DMT) superfamily
FT                   permease"
FT                   /note="COG0697: Permeases of the drug/metabolite
FT                   transporter (DMT) superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42137"
FT                   /db_xref="GOA:A0A0H3KBE8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBE8"
FT                   /protein_id="BAG42137.1"
FT                   /translation="MVSFKPALRAHGATSLFVLLWSSGAIFAELGLRHASAFVFLAARF
FT                   ALASLVLLVLARLRGRWLPPRGERRMTVLTGVLMMGGYSIFYLLALERGIAPGVLATIL
FT                   GVQPILTLAFVERRWQPMRVAGLALALAGLALVVCRGVGDARLPMSGIACALLALGALT
FT                   IGSLLQKRVRAAPADVLPLQNAIGLMLCAMVLPFRPIAFEVSWAFVVPLLWLGIVISVV
FT                   AQLLFYRLMQRGDLVNVTSLFYLVPIVTTLMDAMWLGNRPAPLALVGMAAIVAGLALVF
FT                   RTPAARVQSGRA"
FT   CDS_pept        169461..169673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00161"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB61"
FT                   /protein_id="BAG42138.1"
FT                   /translation="MHVGSIVCTTHIAVPKGARGIVQRILGDMAMVTWYAGVPGESKEL
FT                   NTEPFFLEDLIDTGESVLPAGAAIH"
FT   CDS_pept        169732..170754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00162"
FT                   /product="putative homoserine kinase type II"
FT                   /note="COG2334: Putative homoserine kinase type II (protein
FT                   kinase fold), Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00162"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42139"
FT                   /db_xref="GOA:A0A0H3KFV3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFV3"
FT                   /protein_id="BAG42139.1"
FT                   /translation="MNDVTSAPASPDGPPFAGLTPECVLDALDSVLMPAGLRTDGRLLA
FT                   LNSYENRVYQVGVEDGPPVVAKFYRPARWSDEAILEEHAFVAELAAREIPAVPARAFDG
FT                   RTLHAFDGFRFSIFERRGGRAPDLDRSDTLEWLGRFIGRIHAVGATQPYVARPSLDIRT
FT                   FGYEPRDYLLAHDFIPDDVRPAYETAVALALEGVEAAFERAGEIRLLRTHGDCHPSNVL
FT                   WTDAGPHFVDFDDSRMAPAVQDLWLLLPGDRAGASRALADLLAGYEDFCEFEPRELHLV
FT                   EALRTLRLIHYAAWLARRWDDPAFPAAFPWFNTHRYWEARVLELREQIGAMQEGPLWPV
FT                   "
FT   CDS_pept        complement(170899..172341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="calB"
FT                   /locus_tag="BMULJ_00163"
FT                   /product="coniferyl-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.68"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K00154"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00163"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42140"
FT                   /db_xref="GOA:A0A0H3KBE5"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBE5"
FT                   /protein_id="BAG42140.1"
FT                   /translation="MKNDLPELAPQAQPSIDALDTLLREQRAAYLRAPYPAWETRARHL
FT                   RALRTMLIDHADALADAISADFGHRSKQEVLLAEIWMAKEEIDDALRHGKRWMKPMRKP
FT                   MNKWLRPARAKVIPQPLGVVGIVAPWNYPVLLAAGPLVCALAAGNRAMIKMSELTPRTA
FT                   ALFEQLIATTFARDHVAVVNGDAQVGAAFSALPFDHLLFTGSTQVGRHVMRAAADNLTP
FT                   VTLELGGKSPAIIGPNARFDAAVDAIVAGKTLNAGQTCIAPDYVLLPRGMEAAFIERAR
FT                   ARFATLYPDLQNNGDYTTIVSDRHFARLQQLAGDAQAAGAQLHALSDAASDPASRRFVP
FT                   CALTHVPASAQVMHEEIFGPLLPLVPYERLDEAIAYVNARPRPLALYLFDEDAGTIERV
FT                   MHETISGGVTVNETLMHIACGSLPFGGVGASGMGAYHGYDGFVTFSKMKPVVMQPRINL
FT                   RGLIAPPYGKRFAAVIKLMLKF"
FT   CDS_pept        complement(172338..172751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00164"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJU2"
FT                   /protein_id="BAG42141.1"
FT                   /translation="MQRQVLQAACRPDYRDAPHGLRISFQTRTCTATHAMTRAPGANRT
FT                   AMAIADRLDGLRAQRFDGARAVSRARVAAHGNGASPGDRSLHVRRHSTLRDAAYACRAR
FT                   RTACGVTVARARRLPSRLARCRPARPDILKETT"
FT   CDS_pept        172968..174608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="BMULJ_00165"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /note="COG2303: Choline dehydrogenase and related
FT                   flavoproteins, Ralstonia solanacearum"
FT                   /note="KEGG, K00108"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00165"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42142"
FT                   /db_xref="GOA:A0A0H3KBH2"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBH2"
FT                   /protein_id="BAG42142.1"
FT                   /translation="MQYDYIIVGGGSGGSSVAARLADACPDATIALIEAGPHTERNLLV
FT                   NMPVGIAALVPFKLRTNYGYETVPQPGLGGRRGYQPRGRGMGGSSAINAMIYTRGHPSD
FT                   YDEWAQLGATGWGWQDVLPYFRRAEGNQRGADAWHGADGPLTVSDLRFRNPFSERFIEA
FT                   AHAAGYPLNDDFNGATQEGVGFYQVTHRDGSRCSVARAYIYGRNRPNLHVITDATVLRV
FT                   GFDGKRAVGVAVSRNGRIETLGARAEVILSAGAFNSPQLLMCSGIGPAAQLRRHGIAVV
FT                   HDAPDVGENLIDHIDFIINTRVNSSELVGICLRGIAKMTPALARYFSSRTGMMTSNVAE
FT                   AGGFIKSDPSLDRPDLQLHFCTALVDDHNRKMHWGFGYSLHVCALRPYSRGTVALASGD
FT                   ARDPPLIDPRFFSDSRDLDLLVRGAQAMRRILSQPPLASHGGRELYTHPDQSEAELREA
FT                   IVAHADTIYHPVGTCRMGSDARAVVDPQLRVRGVEGLRVVDASVMPTLIGGNTNAPSVM
FT                   IGERAADFIVAARKGGVPRDQPAATVHGR"
FT   CDS_pept        complement(174633..175982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /locus_tag="BMULJ_00166"
FT                   /product="flagellar hook-length control protein"
FT                   /note="COG3144: Flagellar hook-length control protein,
FT                   Ralstonia solanacearum"
FT                   /note="FliK protein"
FT                   /note="KEGG, K02414"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00166"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42143"
FT                   /db_xref="GOA:A0A0H3KB85"
FT                   /db_xref="InterPro:IPR001635"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB85"
FT                   /protein_id="BAG42143.1"
FT                   /translation="MPSLSLTGALIDTVGAALKAAGRSASSAASGDRDAATPATAPFAQ
FT                   TLQQRVDTRHDADRTATADTAPPKSANAKPVTAKPDDDDASPDQAHASTAANPDAAALA
FT                   AAAAVQAQLQAHADGASPADASAQSAAADGQPALATTASTTAGTAPDATSAAAPATTRD
FT                   ALHAALDKLTGGAGAVALPASGAAAPSSAATAAAPLTPSIPKAPTFGHVLADAKGAAPQ
FT                   AQMQTQAQAQAAAQPASAAQPSAAATQPDAQTAAAATDAAEPNAAATLAAAAATAAAHA
FT                   NLPTPPASAAIAAANAHVLAPPVGTADWTDALSQKVVFLSNAHQQSAELTLNPPDLGPL
FT                   QVVLRVADNHAHALFVSQHAQVRDAVEAALPKLRDAMEAGGLGLGSATVSDGGFASQQQ
FT                   PQQQFAGGRPSQRAGGGSSGADAPVDAAASATAGTSAAVVQRAGLVDTFA"
FT   CDS_pept        complement(176015..176473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="BMULJ_00167"
FT                   /product="flagellar FliJ protein"
FT                   /note="COG2882: Flagellar biosynthesis chaperone, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02413"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00167"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42144"
FT                   /db_xref="GOA:A0A0H3KFZ3"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="InterPro:IPR018006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFZ3"
FT                   /protein_id="BAG42144.1"
FT                   /translation="MAHGFPLQLLLDRAQEDLDDAAKQLGTAQRDRTAAAEQLDALLRY
FT                   RDEYHARFAQSAQHGMPAGNWRNFQAFIDTLDAAIAQQRSVLAAAELRIDEARPNWQQK
FT                   KRTVGSYEILQARGVAQEAQRAAKREQREADEHAAKILRMRADAARTS"
FT   CDS_pept        complement(176515..178086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="BMULJ_00168"
FT                   /product="flagellum-specific ATP synthase"
FT                   /note="COG1157: Flagellar biosynthesis/type III secretory
FT                   pathway ATPase, Salmonella typhimurium LT2"
FT                   /note="KEGG, K02412"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00168"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42145"
FT                   /db_xref="GOA:A0A0H3KBG7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBG7"
FT                   /protein_id="BAG42145.1"
FT                   /translation="MTPHTPESLAHGAMTPLERELARASRGPDALDDTHETHDTADAHA
FT                   APAADRAAQRTSSAPDARRAPHNPHLAHWREHLHALSARSQRALPLRPCGRLTRAAGLV
FT                   LEAIGLRLSVGAECTIELPPGSTLPYAEAEVVGFSGERLFLMPTTDVAGVLPGARVWPL
FT                   ERAPVADPLAGAKRLPVGWEMLGRVVDAAGRPLDGLGPLASKVDAPLSAPSINPLDREP
FT                   IHHVLDVGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERG
FT                   REVKEFIEQILGEDGLARSVVVAAPADVSPLLRMQGAAYATSLAEYFRDQGKHVLLLMD
FT                   SLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERTGNGPEGGGSITAFYTVLTE
FT                   GDDQQDPIADSARAILDGHIVLSRALAEAGHYPAIDIEASISRAMTALIDDTHLDRVRH
FT                   FKQMLSRYQRNRDLIAVGAYAPGRDAQLDRAIALYPRIEAFLQQGFRECAPFAPSLAAL
FT                   DALFDS"
FT   CDS_pept        complement(178083..178760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="BMULJ_00169"
FT                   /product="flagellar assembly protein"
FT                   /note="COG1317: Flagellar biosynthesis/type III secretory
FT                   pathway protein, Ralstonia solanacearum"
FT                   /note="FliH protein"
FT                   /note="KEGG, K02411"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00169"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42146"
FT                   /db_xref="GOA:A0A0H3KJU6"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJU6"
FT                   /protein_id="BAG42146.1"
FT                   /translation="MSDPASARTLTAYQRWEMASFDPPPPPPPPDDAAAAAAALAEELQ
FT                   RVRDAAHAEGHAAGHVEGQARGYQAGFEQGRQQGFEAGQAEAREQAAQLAALAASFREA
FT                   LASAEHDLAADVAQLALEIAQQVVRQHVKHDPAALVAAVRDVLAAEPALSGAPHLAVNP
FT                   ADLPVVEAYLQDDLDALGWSVRTDASIERGGCRAHAATGEVDATLPTRWQRVAAAIGKV
FT                   STW"
FT   CDS_pept        complement(178753..179748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="BMULJ_00170"
FT                   /product="flagellar motor switch protein"
FT                   /note="COG1536: Flagellar motor switch protein, Ralstonia
FT                   solanacearum"
FT                   /note="FliG protein"
FT                   /note="KEGG, K02410"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42147"
FT                   /db_xref="GOA:A0A0H3KBH7"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBH7"
FT                   /protein_id="BAG42147.1"
FT                   /translation="MNAEGLTKSALLLMSIGEEEAAQVFRFLAPREVQKIGAAMAALKN
FT                   VTREQVEDVLQEFVKEAEQHTALSLDSSEYIRSVLTKALGEDKAGVLIDRILQGSDTSG
FT                   IEGLKWMDSGAVAELIKNEHPQIIATILVHLDRDQASEIASCFTERLRNDVILRIATLD
FT                   GIQPAALRELDDVLTSLLSGSDNLKRSPMGGIRTAAEILNFMTSVHEEGVLESVRQYDP
FT                   DLAQKIVDQMFVFENLLDLEDRAIQMVLKEVESETLIVALKGAPPPLRQKFLANMSQRA
FT                   AELLAEDLDARGPVRVSEVETQQRRILQIVRNLAESGQIVIGGKAEDAYV"
FT   CDS_pept        complement(179738..181501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="BMULJ_00171"
FT                   /product="flagellar M-ring protein"
FT                   /note="COG1766: Flagellar biosynthesis/type III secretory
FT                   pathway lipoprotein, Ralstonia solanacearum"
FT                   /note="FliF protein"
FT                   /note="KEGG, K02409"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00171"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42148"
FT                   /db_xref="GOA:A0A0H3KB89"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB89"
FT                   /protein_id="BAG42148.1"
FT                   /translation="MDSQANSLINPDARAGLASPVPGAAAAAALPGAGGAGADFGLGGF
FT                   AERIPGIARMKGNPKLPFLIAVAFAVAVVTALVLWSRAPDYRVLYSNLSDRDGGAIIAA
FT                   LQQANVPYKFADAGGAILVPAAQVHETRLKLAALGLPKGGAVGFELMDNQKFGISQFAE
FT                   QVNYQRALEGELQRTIESINAVRGARVHLAIPKPSVFVRDREAPSASVFVDLYPGRVLD
FT                   EGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLTQPASATGLDASQLKYVQQVERNTQK
FT                   RIDAILAPIFGAGNARSQVSADIDFSKLEQTSESYGPNGSPQQAAIRSQQTSTSTELAQ
FT                   SGASGVPGALSNTPPQPASAPIVAGNGANAPQTTPVSDRKDQTTNYELDKTIRHVEQPM
FT                   GTVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKLAQIEQLVKDAMGYDAKRGDSVNVMN
FT                   SAFSTATDPNADLPWWRQPDMIALAKEAAKWLGIAAAAAALYFMFVRPAMRRAFPPPEP
FT                   AAPALALPGEPVVLDGLPAPEPEDESDPALLAFENEKNRYERNLDYARTIARQDPKIVA
FT                   TVVKNWVSDER"
FT   CDS_pept        181750..182094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="BMULJ_00172"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /note="COG1677: Flagellar hook-basal body protein, Yersinia
FT                   pestis"
FT                   /note="FliE protein"
FT                   /note="KEGG, K02408"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00172"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42149"
FT                   /db_xref="GOA:A9ABS7"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ABS7"
FT                   /protein_id="BAG42149.1"
FT                   /translation="MTANVSGIGSVLQQMQAMAAQASGGVASPAAALAGSGAATAGTFA
FT                   SAMKASLDKISGDQQRALGEAQAFEVGAANVSLNDVMVDMQKANIGFQFGLQVRNKLVS
FT                   AYNDIMQMSV"
FT   CDS_pept        182298..182732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="BMULJ_00173"
FT                   /product="flagellar protein"
FT                   /note="COG1516: Flagellin-specific chaperone FliS, Yersinia
FT                   pestis"
FT                   /note="FliS protein"
FT                   /note="KEGG, K02422"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00173"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42150"
FT                   /db_xref="GOA:A0A0H3KFZ7"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFZ7"
FT                   /protein_id="BAG42150.1"
FT                   /translation="MFSPGHAGANAYARVGVETGVMGASPHRLIAMLYQGARQAVALAR
FT                   MHLQQGNVPARGDAIGKAIRIVESGLQAALNREAGGEIAARLDALYAYIGRRLLEANVQ
FT                   ASDAMLVEVDGLLATLEEAWTGIGPEVARMAAQQTGDMPR"
FT   CDS_pept        182729..183061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliT"
FT                   /locus_tag="BMULJ_00174"
FT                   /product="flagellar protein"
FT                   /note="FliT protein"
FT                   /note="KEGG, K02423"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00174"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42151"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBH1"
FT                   /protein_id="BAG42151.1"
FT                   /translation="MNRKADYFARYEALAAVSGRMLRAARGADWHALSGLQDEYLRLVD
FT                   ALKEAERDIALDESELGRKLALIRRILADDAAIRDLASPEIARLSALFETRRSTKVLTE
FT                   LYRTRG"
FT   CDS_pept        183140..184498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00175"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42152"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJV0"
FT                   /protein_id="BAG42152.1"
FT                   /translation="MTGIDSVAAALLASRLDSLLTGGVASAAVGGAAAQVGTPGAGVAP
FT                   SSEAGGALPQPPAASTQTALSDVARVLDAIARTGGDATPAVVGRMPLVPDPAALFAAAA
FT                   DGAAGQAGHAAAASASGAATAAAAEAAPPSLAGALRAALAQAVGESGLFYESHLSQWFA
FT                   GQRPLAALLREPQARIAIAQTSADPDAAPDDDALDALLTPRLSLPSARAAVQPGAVASG
FT                   GAASGGARPAGSAPEPTPGAQSHPPLARAAADATDPLHELADWRASVARPADAAAPSDA
FT                   ASPTPVHPAAVPIVRQQLDTLATDQFRWTGEAWPGVRVDWTIEPDESGGHAPRSGDDAG
FT                   DGIAWRTRLTLTLPTLGTVDAELVLNGAQLVARLRANQAGAARLAQHEPALRRRFEGSG
FT                   LQLGGLSIRAVDEQPEPFDVFAAQAAASAYAHAAAGGATAPVPPVPPDDGALR"
FT   CDS_pept        184495..184812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="BMULJ_00176"
FT                   /product="flagellar biosynthesis protein"
FT                   /note="KEGG, K04061"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00176"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42153"
FT                   /db_xref="GOA:A0A0H3KBI0"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBI0"
FT                   /protein_id="BAG42153.1"
FT                   /translation="MTTPHRKRAAALVYDPKGGDTAPRVVAKGYGALAEMIVARAKDAG
FT                   LYVHTAPEMVSLLMQVDLDDRIPPQLYQAVADLLAWLYALDRTDAPGDAAAPRFPLPPL
FT                   R"
FT   CDS_pept        185075..185809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00177"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3295: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00177"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42154"
FT                   /db_xref="GOA:A0A0H3KB91"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB91"
FT                   /protein_id="BAG42154.1"
FT                   /translation="MNAPETIDPLHADLPREGVAVLHPAARPLTDAELAARRSRSRRAT
FT                   FIKWLRKVHGWVGLWGAVLGLLFGVTGVLLNHRAPPLKIATGEPQVEQLQLALPDPAPK
FT                   TPAAMTKWLQRELHFEGRPGRVRKEPAQPVAWGDRHVMQPEHWLMGLFGPRQNLQAEYW
FT                   VGNGYVSVKRTGNTFLTTLNNLHRGVGMSIGWVLLMDTIAGSLILLSLTGVLLWTELNK
FT                   RRTVGVVLVAGSVAAALAAGLA"
FT   CDS_pept        complement(185877..186902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhC"
FT                   /locus_tag="BMULJ_00178"
FT                   /product="xanthine dehydrogenase accessory factor"
FT                   /note="COG1975: Xanthine and CO dehydrogenases maturation
FT                   factor, XdhC/CoxF family, Ralstonia solanacearum"
FT                   /note="KEGG, K07402"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00178"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42155"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG01"
FT                   /protein_id="BAG42155.1"
FT                   /translation="MESVDLDVLKSSARWLDEGRRVLLVTVVKTWGSSPRPEGAMLAVR
FT                   EDGLVVGSVSGGCIEDDLIARVHANGIARDARPEAVKYGVTAEEAHRFGLPCGGTIQLV
FT                   LEPLTRDSGIAALCAEVEAGRLVTRTMTLATGRASLSPAQATDGLAFDGERLVTIHGPR
FT                   YRMLVIGAGQLSRYLCQIAVGLDYQVTVCDPREEYTDGWDVPGTRIVRTMPDDTVLDMK
FT                   LDARSAVIALTHDPKLDDLALMEALKTPAFYVGALGSRRNNAARRERLREFDLSEAELS
FT                   RLHGPAGIYIGSRTPPEIAISILAEVTAAKNNVSLPTILQVEGAKAAREIAANGGATCG
FT                   L"
FT   CDS_pept        complement(187060..188460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00179"
FT                   /product="APA family basic amino acid/polyamine antiporter"
FT                   /note="COG0531: Amino acid transporters, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03294"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00179"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42156"
FT                   /db_xref="GOA:A0A0H3KBH6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBH6"
FT                   /protein_id="BAG42156.1"
FT                   /translation="MSLFRKKNVDRMIAGAHAAGLKKALGAIDLTFLGIGAIIGTGIFV
FT                   LTGTGAVQAGPALMLSFVIAAIACGLAALSYAEFASTIPVAGSIYTYSYATLGELVAWI
FT                   IGWDLMLEYGLAASAVSVGWSGYLQSLLQGFGLTLPTVLTAAPGAVPGVVTWFNLPAFL
FT                   VMIVITTLLSIGIRESTRINNVMVFIKVSVVLLVIAVGLFHVTPANWKPFMPHGWNGVF
FT                   GAAAVMFFAFIGFDAVSSAAEEVKNPKRDLPIGIIASLAVCAVLYVTVAAVATGIVPSA
FT                   QYASISHPISYALQVAGEKWVAGFIDLGAVLGMLTVILVMSYGQTRIIFAMSRDGLLPG
FT                   TLSRVHPRYATPFLTTWLVGLFFGLIAALVPLNVLAELINIGTLAAFSMVSIAVLVLRR
FT                   THPHLPRAFRCPGVPVVPLLAVAACVFLMVNLQPVTWIAFGVWLVIGLAVYFLYSRHHS
FT                   KLARGHAE"
FT   CDS_pept        complement(188680..189336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00180"
FT                   /product="signal transduction response regulator"
FT                   /note="COG2197: Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42157"
FT                   /db_xref="GOA:A0A0H3KJV3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJV3"
FT                   /protein_id="BAG42157.1"
FT                   /translation="MGLNILLVDDHAIVRQGICQLLVDRGIAREVTEAENGADALAAVD
FT                   RQTFDVILLDISLPDTNGIEVLKRLKRKLPRTPVLMFSMYREDQYAVRALKAGAAGYLS
FT                   KTVNAAQMIGAIQQVAAGRKYVSPAMAEALAEYVSFENEPLPHEKLSDREYQTLCMLAS
FT                   GKRLTDIANTLSLSVKTVSVYRSRLLEKMRLSNNAELTFYVMSNRLVDMSPASGT"
FT   CDS_pept        complement(189344..190168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00181"
FT                   /product="putative signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00181"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42158"
FT                   /db_xref="GOA:A0A0H3KBI4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBI4"
FT                   /protein_id="BAG42158.1"
FT                   /translation="MDTSLNAPHGAHAPFPSRLPAPGSAAATSADPVSHPVSQSDPCAQ
FT                   RIAVLSAQLLAADEAARRHLAGELHDGLGAELTAARFALANAQAWLPADAPQGCLRALE
FT                   LAQRALDAATDASRRLIDARGVPAFESGVVPALSAWIDGFAARTGLRTSFVCAADARVP
FT                   HLAGDAALAIFRVAQEALSNVAKHARAASADVRIDADDTFLSLIVTDDGTGFARKRRAG
FT                   YGLTGMQARCAAFGGRLDTASGAAGRGTRVTAYFAWDALLGAPAAARFASLS"
FT   CDS_pept        complement(190583..191353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="BMULJ_00182"
FT                   /product="ferredoxin-NADP+ reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="COG1018: Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1, Neisseria meningitidis Z2491"
FT                   /note="KEGG, K00528"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00182"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42159"
FT                   /db_xref="GOA:A0A0H3KB99"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KB99"
FT                   /protein_id="BAG42159.1"
FT                   /translation="MSKYDTAIVQSVHHWTDTLFSFTCTREPSLRFNNGEFTMVGLEVD
FT                   GKPLARAYSIVSPNYEEHLEFFSIKVQDGPLTSRLQHLKVGDTVLIGKKPTGTLVVDNL
FT                   LPGKTLWLLSTGTGLAPFMSIIRDPDIYDRFEKVVLTHTCRLKGELAYMDYIKHDLPGH
FT                   EYLGDIIKEKLVYYPTVTREAFDNEGRITDLIASGKLFTDLGVAPFSPENDRVMLCGST
FT                   AMLKDTTALLKQAGLVEGKNNAPGHYVIERAFVD"
FT   CDS_pept        complement(191607..192422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00183"
FT                   /product="metal-dependent hydrolase"
FT                   /note="COG3568: Metal-dependent hydrolase, Salmonella
FT                   typhimurium LT2"
FT                   /note="KEGG, K06896"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00183"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42160"
FT                   /db_xref="GOA:A0A0H3KG04"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG04"
FT                   /protein_id="BAG42160.1"
FT                   /translation="MAADALSVPFAEPHAAPDEITAVSWNLHKGRSPLGFTAWNAMRDW
FT                   MQSTHADVYFLQEAMARRMPRPVLAQGFGAPMDDVDDDVWHCQATEIARALDWQIALGP
FT                   NVFKPSWRHGNAILSPHPLDLGGRWDISAHRFERRGLLVARATLAGARPVTLLCAHLAL
FT                   TRAARLRQMHWIAHWIVRNAGDDPLVLAGDFNDWRNDSVAVFGEIGLSEVATLLGESGR
FT                   TFPAFSPALALDKMFVRGLTPLEWRAPSSETAWLSDHLPYIARLRLDPR"
FT   CDS_pept        complement(192428..192916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00184"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBH9"
FT                   /protein_id="BAG42161.1"
FT                   /translation="MLKHGLAVLFASVALAAHAQSPAPAAVAWEIQVVRDGQTIDTFQQ
FT                   QTTVGQTRTDTHRYPSAVPVGCGNAARVVPTERSRAVTVAPLAVDTAAGTVSLALDVQE
FT                   TLDDESARQSDPCMPASPRQIVASHPGLSVGADAWTDWTLVEQHPHLVYRVRAHVAKD"
FT   CDS_pept        complement(193161..193880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00185"
FT                   /product="nitroreductase family protein"
FT                   /note="COG0778: Nitroreductase, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00185"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42162"
FT                   /db_xref="GOA:A0A0H3KJV7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJV7"
FT                   /protein_id="BAG42162.1"
FT                   /translation="MSVPAAPPNVDPDAIRAVDAALTSRRSVRAFLPTPVPRATLEAIL
FT                   EAASRAPSGTNIQPWHVYVATGATRDALAAALTAAYDDPARDEKYVAEYDYYPREWVSP
FT                   YIDRRRKVGWDLYGLLNIGRDEKARMHAQHARNFRFFDAPVALFFTLDRIMTHGAWLDC
FT                   GMFLQGVMTAARARGLDTCPQAAFVPFHRIVAEHLDIPDNEQLVCGMSLGYADPHAVEN
FT                   RLVTERASVAEFARFFA"
FT   CDS_pept        194108..194467
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00186"
FT                   /note="inactivated ATP-dependent protease"
FT   mobile_element  194443..196299
FT                   /mobile_element_type="insertion sequence: ISBmu4"
FT                   /note="IS110 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        194889..196250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00187"
FT                   /product="ISBmu4 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00187"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42163"
FT                   /db_xref="GOA:A0A0H3KHX3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KHX3"
FT                   /protein_id="BAG42163.1"
FT                   /translation="MASISNAPVRHRTVGIDLAISAVQVAQIFDDGRAIGKPIRFRLTS
FT                   TDLRRFVSAIKSGVGADTPITAVMEPTGMAWFPVANWLQRAGIKVIRVKGQRVKALRKY
FT                   LSEHAKTDAADAHVLGAIPGFGGRGLDPVHVPGPEQHSLQRLTKQRHRYQELVCSARRR
FT                   VLDLIRWACPALEPVLPDTVTQLTLAILGELLDPRKVVAMRRDVLARFLSQHASGNHPK
FT                   SGPFIDSLVEKLKAAAEETIELHGDSVDFTALQFEVAQEVEHLRLWDRHVRAIEREVEQ
FT                   IYQRVHPSDALRSIPGIGATLAPLLIGVLGYAKRFRNEDHIRGFCGMFPTRSSSGGIEK
FT                   PGQRLTKSGSDRVKRALYIAADVARKIDPDLAAVYWRLMVNKGHHHKQAICAVATRLIN
FT                   RIYRVLKTGEPYVLRDQEGNSISVQEGKRIVAAQFKVPLEVRQSRRNQPMPEPA"
FT   CDS_pept        196322..196945
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00188"
FT                   /note="EC 3.4.21.53"
FT                   /note="KEGG, K01338"
FT                   /note="inactivated ATP-dependent protease domain protein"
FT   CDS_pept        197086..198195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00189"
FT                   /product="sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /note="COG0579: Predicted dehydrogenase, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K00301"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00189"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42164"
FT                   /db_xref="GOA:A0A0H3KBA1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBA1"
FT                   /protein_id="BAG42164.1"
FT                   /translation="MEQMDCVVIGAGVVGLAIARELAARGRETLVLEAADAIGTGTSSR
FT                   NSEVIHAGLYYPRGSLKALSCVRGRDLLYDFCETHHVPHRRVGKLLVATTASQVKQLKA
FT                   IAARAEENGVLDLLPLTRAEAQALEPALECVEALFSPSTGIVDSHQLMLALLGDAQRDG
FT                   AVCALKSPVESIDVLRGGRFVVRTGGDAPTEIEAACVINSAGLGAQALARRTRGLDPRW
FT                   VPPLYLARGNYFSLSGRAPFSHLVYPMPDRAGLGIHLTLDLAGQARFGPDVEWIDALRY
FT                   EVDPARAGAFYASIRAYWPELPDGALQPAYAGIRPKVAGPGEPPADFIVQGAAQHGVRG
FT                   LVNLFGIESPGLTASLALAQRVGEMAAYG"
FT   CDS_pept        198364..198675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00190"
FT                   /product="putative iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42165"
FT                   /db_xref="GOA:A0A0H3KG07"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG07"
FT                   /protein_id="BAG42165.1"
FT                   /translation="MKTSRRSFLISSVGVVSALALSREALADAPMLSESDPTAQALGYK
FT                   ADATKVDKAKYPKYAAGQDCAACMLYQGKKGSTSGPCAAFGGKQVAAKGWCSAFSKMG"
FT   CDS_pept        198865..200172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00191"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00191"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42166"
FT                   /db_xref="GOA:A0A0H3KBI3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBI3"
FT                   /protein_id="BAG42166.1"
FT                   /translation="MATIANSTKPVRPERALNRRAVAAAVIGNALEWYDFTVFSFMAVV
FT                   IAELFFPTSSEYGSLLLTTATFGVAFFMRPIGGIVLGLYADRAGRKAALSLVILLMTAG
FT                   IFLLAVAPPYAAIGIGGPLLIVFGRLLQGFSAGGEFGSATALLIEAAPFSKRGFYGSWQ
FT                   MSSQAAALLIGAVVGAAVTRGLSPEALRAWGWRVPFILGLMIGPIGFYIRRHLADSEAF
FT                   LHAQQNARRATLGDVFARHSREVLCGLGSVIALTVTIYVLISYLPTFAVKQLKLPYAES
FT                   FYAVIAGNLLLTVLSPLAGAWSDRIGRKGLSLWSLVLTLALIYPLFAWLDAAPSIGRLI
FT                   AVQVVLSITLAGYYGPFGAMIAELFPANVRSTGLSIAYNVAVMLFGGFGQFIVTWLIKV
FT                   TGTPLAPTYYVMAGLALSIVAVAFVPARSADLDAPA"
FT   CDS_pept        200514..202142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00192"
FT                   /product="peptide/nickel transport system substrate-binding
FT                   protein"
FT                   /note="COG0747: ABC-type dipeptide transport system,
FT                   periplasmic component, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02035"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00192"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42167"
FT                   /db_xref="GOA:A0A0H3KJW2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJW2"
FT                   /protein_id="BAG42167.1"
FT                   /translation="MEHNRLLHTLRVTAIAGVAAASLGVAGSAFAQIPNKTLVYCSEGS
FT                   PAGFDSAQYTTGVDFTAATFTVYNRLVEFVRGGTKVEPGLAEKWDVSSDGKVYTFHLRH
FT                   GVKFHTTDFFKPTREFNADDVVFTFERMLDPNNAFRKAYPVSFPYFTDMGLDKLITKVE
FT                   KVDPYTVKFTLAEPNAPFIQNMAMEFASILSAEYADQLMKAGKAADINQKPVGTGPFIF
FT                   RSYTKDATIRFDGNPDYWKKGEVKLSKLIFSITPDPGVRVQKIKRNECQVMSYPRPADI
FT                   ATLKADSNIDMPSQPGFNLGYLAYNVEHKPVDKLDVRQALDMAINKKAILESVYQGAGQ
FT                   AANAPMPPTQWSYDKNLKMPAYDTAKAKALLAKAGYPNGFEITLWAMPVQRAYNPNARL
FT                   MAEMIQADWAKIGVKAKIVTYEWGEYIKRAHGGEQDTMLIGWTGDNGDPDNWLGTLLGC
FT                   EAIKGNNFSHWCYKPFDDLIQKGRTTTGQDARTKLYTQAQQIFAQQLPFSPIANSTVYQ
FT                   PVRKNVVDMRIEPLGYARFDGVSVK"
FT   CDS_pept        202255..203265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00193"
FT                   /product="peptide/nickel transport system permease protein"
FT                   /note="COG0601: ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K02033"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00193"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42168"
FT                   /db_xref="GOA:A0A0H3KBJ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBJ1"
FT                   /protein_id="BAG42168.1"
FT                   /translation="MLRFVLRRVGMVIPTFIGITILAFALIHLIPGDPIEVMMGERGVD
FT                   PAMHAEAMKRLGLDQPLPVQYFHYIGRALHGDLGTSIVTNTSVAGEFFARFPATVELSL
FT                   CALVFALVVGLPAGVIAALRRGSIVDHGVMGTALTGYSMPIFWWGLILIMVFSSYLGWT
FT                   PVSGRIAVEYDFPHPTGFMLIDALLAPDEGSFKSAVSHLILPAIVLGTIPLAVIARMTR
FT                   SSMLEVLREDYIRTARAKGLSPARVVVVHALRNALIPVVTVIGLQIGTLLAGAVLTETL
FT                   FSWPGVGKWLIDAIGRRDYPVVQGGILLIATLVIVVNLIVDLLYGVLNPRIRHTR"
FT   CDS_pept        203269..204186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00194"
FT                   /product="peptide/nickel transport system permease protein"
FT                   /note="COG1173: ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K02034"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00194"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42169"
FT                   /db_xref="GOA:A0A0H3KBA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBA5"
FT                   /protein_id="BAG42169.1"
FT                   /translation="MSNLQNTLPSESAPAGGRALALREFWANFSRNRGAVGAGIVVLVL
FT                   IAVAIFAPLIAPHSPVEQYRDYVKIPPAWLDGGNRQFILGTDEAGRDILSRLMFGARMS
FT                   FWIGFVSVVLALIPGIVLGLVAAFFQKWADTAVMRIMDVLLALPSLLLAVAVVAIIGPG
FT                   LTNTMFAIAIVALPAYVRLTRASALGELQKEYVTASRVAGAGTLRLMFSQVLPNCTAPL
FT                   IVQATLGFSSAILDAAALGFLGLGVQPPTAEWGAMLASARDYIDNAWWIVTMPGLSILI
FT                   SVLAINLLGDGLRDALDPKLKRMA"
FT   CDS_pept        204188..205186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00195"
FT                   /product="peptide/nickel transport system ATP-binding
FT                   protein"
FT                   /note="COG0444: ABC-type dipeptide/oligopeptide/nickel
FT                   transport system, ATPase component, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02031"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00195"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42170"
FT                   /db_xref="GOA:A0A0H3KG11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG11"
FT                   /protein_id="BAG42170.1"
FT                   /translation="MTSNLLTIRNLAVNFNGLPAVDRINLSIAPGEVVGVVGESGSGKS
FT                   VTMMALMGLIDAPGKVTADEITFDGVDLLKASPKVRRRIVGKDVAMVFQDALTSLNPSY
FT                   TVGYQIKEVLKLHEGLRGDALHRRALELLDQVGIPDAKNRIGAFPHQMSGGMNQRVMIA
FT                   MAVACNPKLLIADEPTTALDVTIQAQIMDLLVKLQKERGMALVLISHDLAVVSEVAQRV
FT                   AVMYAGEIIETNRVPDIFRAPHHPYTEALLAAIPEHNKGARRLAALPGMVPGRDDRPSG
FT                   CLFAPRCKYVVDDCRKARPALDPLVPGNDAMRARCIKPLNLSHVDLNGGAR"
FT   CDS_pept        205183..206199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00196"
FT                   /product="peptide/nickel transport system ATP-binding
FT                   protein"
FT                   /note="COG4608: ABC-type oligopeptide transport system,
FT                   ATPase component, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02032"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00196"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42171"
FT                   /db_xref="GOA:A0A0H3KBI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBI6"
FT                   /protein_id="BAG42171.1"
FT                   /translation="MNAVNETRRVEHDEDDVLVADQLAKHYTVRRGMFGQGTVKALNGV
FT                   SFALKRGRTLAVVGESGCGKSTLARQLTMIETPTSGRLSIDGQNVAGASRDTIAELRRR
FT                   VQMVFQNPFASLNPRKTVEQTLAEPLEINTKLTAIERAQRIAQIMRTVGLRPEHAKRYP
FT                   HMFSGGQRQRVAIARAMILEPRIVVADEPVSALDVSIQAQILNLFMDLQEQFKTSYVFI
FT                   SHNLAVVEHVADDVMVMYFGSVAELGDKATIYARPRHPYTRALMSATPAIFEEDRRVQI
FT                   KLQGELPSPLNPPSGCAFHQRCPYAIERCRVEEPQLRDVDGRRVACHRAEEVGEANA"
FT   CDS_pept        206192..207340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00197"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42172"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJW5"
FT                   /protein_id="BAG42172.1"
FT                   /translation="MPERLAARASSARRSGAGSARMLRACRSARRWSVRTVTGAALAGA
FT                   CLAAGIGVPVDVARAEGRAPATSPIHPSQVPPPGVSLPGFHVPPSESNGTVARGAVRVQ
FT                   PARMPFYVATKGRVTLYVLGTLHTGDPSDYPSAQPFRPRILAALAASPTLALELSPDDL
FT                   LESQDDVSKYGVCRYACLPRLLPEPLWQRLAARLRGNPAALAEIRKMRPWLASLVVETY
FT                   DSLSAGLQTEYGTEAQLQNVFLKKKGGRVIGLETLAEQMRAFTGLTLAEQREMLAQDMV
FT                   QTPAQNADDVKTLHRLWRIGDADAIAAWAVAKSERLARSKALSASIDNKILYERNRRFV
FT                   ARMTAIAAPNRPLFVAIGALHLGGPRGVLELLRQQGYSVDAN"
FT   CDS_pept        complement(208092..208856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00198"
FT                   /product="LamB/YcsF family protein"
FT                   /note="COG1540: Uncharacterized proteins, homologs of
FT                   lactam utilization protein B, Ralstonia solanacearum"
FT                   /note="KEGG, K07160"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00198"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42173"
FT                   /db_xref="GOA:A9ABQ1"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ABQ1"
FT                   /protein_id="BAG42173.1"
FT                   /translation="MEIDLNADLGEGCGSDEALLDLVTSANIACGWHAGGANAMRDCVR
FT                   WAVQKGVAIGAHPSFHDPENFGRKEMQLPAGDIYAGVLYQLGALSAIAQAEGGRIAHVK
FT                   PHGALYNQAARDPMIADAVVSAIHDFDPSLAVFGLANSVFVAAARQAGLAAVEEVFADR
FT                   GYRADGSLVPRSEPGALIDDEDAVLARTLDMVRDRQVRAVSGEWVPLNAQTVCLHGDGP
FT                   HALAFARRIREALEKAGVEVVAPGVLQAGEGI"
FT   CDS_pept        complement(208917..209984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00199"
FT                   /product="allophanate hydrolase"
FT                   /EC_number="3.5.1.54"
FT                   /note="COG1984: Allophanate hydrolase subunit 2, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01457"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00199"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42174"
FT                   /db_xref="GOA:A0A0H3KBJ5"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBJ5"
FT                   /protein_id="BAG42174.1"
FT                   /translation="MSQNHAPGNIEVLRAGPLSSVQDLGRRGARHLGVALGGALDGLAL
FT                   EVGNRLVGNRPDAAAVEITIGPAAFRFTRAARIAITGTKFGATLDGKPVYSWWSLPVEA
FT                   GQTLVLPAAKRGMRGYLCIAGGIDVLPVLGSRSTDLASHFGGLGGRALRDGDRLPVGVP
FT                   PAGIGCLAPDAPEFGVKAPAWCAFVRVEEPPRRHRPAHAPWAMPVRVLPGPDFASFAAD
FT                   SQQAFWDEEWLVTANSNRMGYRLAGVELVRERPAELLSHAVLPGTIQVPPNGQPIVLMH
FT                   DAQTTGGYPKIGTVIRADLWKLAQARLNLPIRFVRTTLEAARAALIAERAYLRQIDVAI
FT                   EMREEARRRAQSRAA"
FT   CDS_pept        complement(209981..210637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipI"
FT                   /locus_tag="BMULJ_00200"
FT                   /product="inhibitor of KinA"
FT                   /note="COG2049: Allophanate hydrolase subunit 1, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06351"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42175"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBA7"
FT                   /protein_id="BAG42175.1"
FT                   /translation="MTQPRIYPLGDTALVCEVPPPATLDCQRRVWAVAAHARTWPDVVD
FT                   VVPGMNNLTIVFDALAASAESLTPLLRDAWQTADVEHADGREVEIPVEYGGAAGPDLAA
FT                   VAAHTGLSADEVVERHAAGEYVVFFIGFQPGFAYLGGLEAALHVPRRTVPRLEVPAGSV
FT                   GIGGAQTGIYPATSPGGWQLIGRTSLALFDPTRQPPTLLLPGDRVRFVIAGVDAR"
FT   CDS_pept        210786..211298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00201"
FT                   /product="predicted transcription regulator"
FT                   /note="COG5631: Predicted transcription regulator, contains
FT                   HTH domain (MarR family), Ralstonia solanacearum"
FT                   /note="contains HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00201"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42176"
FT                   /db_xref="GOA:A0A0H3KG13"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG13"
FT                   /protein_id="BAG42176.1"
FT                   /translation="MKRHPTKIVSSEHLVSDSSAELSELEYGLIMAGNAFNRWMVRCMS
FT                   AAGAKDMTAVEVSLLHHVSHRERKKKLADICFVLNIEDTHVATYALKKLIARGYVQSEK
FT                   SGKEVFFSATDAGRDLCLKYREVREHCLIETLKDSGLTNEQIGDAAQLLRHASGLYDTA
FT                   ARAAASL"
FT   CDS_pept        complement(211355..211951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00202"
FT                   /product="putative 5-formyltetrahydrofolate cyclo-ligase
FT                   family protein"
FT                   /note="COG0212: 5-formyltetrahydrofolate cyclo-ligase,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00202"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42177"
FT                   /db_xref="GOA:A0A0H3KBJ0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBJ0"
FT                   /protein_id="BAG42177.1"
FT                   /translation="MSESIARNPVPNPKVALRKTLSGARRDAASRPAANASLEARLRAL
FT                   LERLAPVTVGFYWPLPGEFDARDAVLAWCAAGSGRRAALPVIGERHTPLAFHAWDAHTP
FT                   MREGHHRIPEPASGVVVVPDLLLIPCVGFDLQRYRLGYGGGYYDRTLAAWPGASLPVTV
FT                   GIAYDACRVDALPAEAHDLAMDWIVTDAQLYPSAE"
FT   CDS_pept        212101..213924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="BMULJ_00203"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /note="COG0741: Soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains), Ralstonia solanacearum"
FT                   /note="KEGG, K08309"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00203"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42178"
FT                   /db_xref="GOA:A0A0H3KJW9"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJW9"
FT                   /protein_id="BAG42178.1"
FT                   /translation="MQLREAARRNDAAKAAQLAAMIPNYPVPSYVEYFQIKPQLFDSTG
FT                   RARVDAPDAPVVSFLQRYDGQAIADRMRNDYLLVLGARHDWRNFDEQYKRFVLDDDTQV
FT                   KCYALESRAARGENVADAARALLVEPKYYGDACVDLITALAVNQQFTSDDVWQQARFAY
FT                   EQNYTSLGGKIVDALGARPVGFDQATSAPPLYLARGVGADAASHQLALIALGRMARNDP
FT                   DSAAAMLTSIAPSLTKQEQAIAWGAIGYQGALKRSPLASVWYAKSANAPLSNSGYEWRT
FT                   RAALLAGNWPMVRWSIEQMPPSLREDPAWIYWHARALKQSGDTLQANQEFEQVAGQFNF
FT                   YGQLAGEELGQRTTIPPRTRVSDAEIDAMSKVPGFALAQRFYSLNLRLEGNREWNWPLR
FT                   GMTDRQLLAAAEYGKRIGLLDRTVNTADRTKAEHDFTLRYPSPYRDIVERYAQSTGLDI
FT                   EWAYGLIRQESRFITSARSSAGAGGLMQLMPATAQLVAKKLGMGTITRAQMHDIDTNIQ
FT                   LGTWYLADIYNNFDSSPVLATAGYNAGPGRPRQWRQVLTQPVEGAIFAETIPFNETRDY
FT                   VKNVLSNTVYYAALFEGKPQSLKKRLGMISP"
FT   CDS_pept        213983..214942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00204"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.5.3"
FT                   /note="COG0702: Predicted nucleoside-diphosphate-sugar
FT                   epimerases, Ralstonia solanacearum"
FT                   /note="KEGG, K00329"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00204"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42179"
FT                   /db_xref="GOA:A0A0H3KBK0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBK0"
FT                   /protein_id="BAG42179.1"
FT                   /translation="MDGQTVALLGGTGFIGSRLVAALIDAGKHVRIGTRRREHARHLSM
FT                   LPVDIVELETFDTRSLARFVAGAQAAVNLVGVLHGGRGTPYGAGFERAHVALPAALARA
FT                   CVEAGVRRVLHMSALGADSHGPSMYQRSKGDGEAALHAIAATEPLAVTIFRPSVVFGPG
FT                   DAFLNTFARLQRIAPVLPLAMPDARFQPVFVGDVVRAFVNTLELSAAHGRTYELGGPTV
FT                   YTLEQLVRYCGTLVGRQARIVRLPDALARLQARVFECLPGEPVITRDNLASMSVPNVLS
FT                   GPLAPELGIVPASLESIAPAYLGDAAQRSRFEAFRSRR"
FT   CDS_pept        215002..215649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00205"
FT                   /product="glutathione S-transferase"
FT                   /note="COG0625: Glutathione S-transferase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K04097"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00205"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42180"
FT                   /db_xref="GOA:A0A0H3KBA9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBA9"
FT                   /protein_id="BAG42180.1"
FT                   /translation="MKLVIGDKNYSSWSMRPWLLLTHFGIPFEEIAIELRRDDTAARIR
FT                   EYSPSGKLPCLIDDHGVAIWESLAIAETLAERFPQYPMWPADPARRAHARSISAEMHAG
FT                   FAALRTQMGMNVRASMPGRGATPEALADVARIDALWSACIAASGGPFLFGEFGIADAMY
FT                   APVVMRFNTYAPTLSPEAAGYAARITALPAVRQWIDAARRETNVIAEYEPTR"
FT   CDS_pept        215646..216887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="BMULJ_00206"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /note="COG0617: tRNA nucleotidyltransferase/poly(A)
FT                   polymerase, Ralstonia solanacearum"
FT                   /note="KEGG, K00974"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00206"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42181"
FT                   /db_xref="GOA:A9ABP3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ABP3"
FT                   /protein_id="BAG42181.1"
FT                   /translation="MNIYAVGGAIRDELLGVPVQDRDYVVVGATPEQMIAQGFRPVGKD
FT                   FPVFLHPDTHEEYALARTERKTAAGYHGFQFHYAPDVTLDEDLARRDLTINAMAREVSP
FT                   DGTLIGPVIDPFDGQRDLRARVFRHVSDAFVEDPVRILRLARFAARFADFTVADDTLAL
FT                   MRRMVDAGEVDALVPERVWQELARGLMEAKPSRMFAVLRDCGALARILPEVDGLWGVPQ
FT                   RADYHPEVDTGVHVMMVVDYAAKQRYSLPVRFAALTHDLGKATTPDDVLPRHTGHEGRS
FT                   VDLLKPLCERLRVPNECRDLALVVAREHGNLHRVMEMGAAALVRFFERTDALRKPARFA
FT                   EMLQACEADARGRLGLEAQPYPQAERLRVALAAARSVDAGAIARATGSDSAKIKDAVHR
FT                   ARIEAVAHALEIGE"
FT   CDS_pept        complement(217094..217924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00207"
FT                   /product="XRE family transcriptional regulator"
FT                   /note="COG1396: Predicted transcriptional regulators,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00207"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42182"
FT                   /db_xref="GOA:A0A0H3KG17"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG17"
FT                   /protein_id="BAG42182.1"
FT                   /translation="MRIGQRIRRLRREAKKTLLEVATEAKLSVGFLSQVERHLTGISIS
FT                   SLVNVAKALNVPLGALIDQPRQAQPDSHAGRRESYAVDRTSQWYERLSTTFDGSQLNAL
FT                   KVRMMEGYRSEWVAHGGDEFVYVLSGRICYTIGKKDYPLSPGDSLHFDARKRHRVANVG
FT                   DGPAEVIAVGTLPLFDDSRATFVSATLDVAQRTGDAQADARHAQTRTRDAAPRRRAPVA
FT                   TKRAAKHAAKSAAQSAPTSADAGAAASDSESPARVGRRTASAPAPRKRAARAKP"
FT   CDS_pept        218420..220270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="BMULJ_00208"
FT                   /product="X-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /note="COG0006: Xaa-Pro aminopeptidase, Caulobacter
FT                   vibrioides"
FT                   /note="KEGG, K01262"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00208"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42183"
FT                   /db_xref="GOA:A0A0H3KBJ3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBJ3"
FT                   /protein_id="BAG42183.1"
FT                   /translation="MIDRLTYSFSSLSPYQASVADTQAALSRTLDTLQLDALVVTSQDE
FT                   YVTEYLPRHNNPRYALSGFDGSAGCGVFLGEAAARALGMPPFVLFVDGRYHLQAEQQCD
FT                   PARVRVEKLGLDRTIWAAIADWLVAHAAHVPRIGYDGWRVSVGQRERLFAATRDAALTW
FT                   TSVADRAVDRTIALPGWHVERPIFELPESMTGARVAEHVAALNRRLAARTGAADGKTAF
FT                   VTCASDDLAYLLNSRGYHLPNASSHLGFLFVIGEQIVLFLPEGCDRCPVELASYPALHV
FT                   IRRDFGALERFVAQFAVEHVCYGFDAVNCALADSVRRVWPHAAHIDFNPVEAMRAAKTP
FT                   AVLDRFRDAFARSSAAIAETMRWAKAGEPGRRHTEYDLARAINDAYGARSAVALTFPSI
FT                   AANGANSAHAHYTAASADVELTEGELVLLDSGAYYEAGFATDCTRVVLRRTRADTVAQP
FT                   WQREIYTVALKACIKGLVTHYPKDATGGDVDALVRQVCRDHGYDYGHGTGHGVGIHVHE
FT                   GGVRFAPGAPYGLVPNAVISVEPGIYVPGKGGVRIENIVIIRPSEREPDKVRFENLVAV
FT                   GYDWDLIDLALLDDDERAYLRDYERMCVERGTQVTACPLL"
FT   CDS_pept        complement(220338..220778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgN"
FT                   /locus_tag="BMULJ_00209"
FT                   /product="flagella synthesis protein"
FT                   /note="FlgN protein"
FT                   /note="KEGG, K02399"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00209"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42184"
FT                   /db_xref="GOA:A0A0H3KJX2"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJX2"
FT                   /protein_id="BAG42184.1"
FT                   /translation="MREELLTTVNDEHATVEAFASLLAYEEKALTTAEPLAMLPDIVEK
FT                   KTALLDRLAQLERTRDTQLAALGFPAGKKGMDLAAERDTRLAGCWTLLQQAAERARRAN
FT                   ANNGMLIRIRMDYNERALAVLRSAPAPAGVYGPDGRVSALMR"
FT   CDS_pept        complement(220824..221162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="BMULJ_00210"
FT                   /product="negative regulator of flagellin synthesis"
FT                   /note="FlgM protein"
FT                   /note="KEGG, K02398"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42185"
FT                   /db_xref="GOA:A0A0H3KBK4"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBK4"
FT                   /protein_id="BAG42185.1"
FT                   /translation="MKIDTTPNPSPVAPASTGNGAARPQSGAAASTAPQASDAGSAGGD
FT                   ATVNLSGLSGQLRAQSASGGADIDMGLVQSIKDALKDGTLTIDANKIADGVLNTARELL
FT                   QQQRPRGN"
FT   CDS_pept        complement(221263..222429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="BMULJ_00211"
FT                   /product="flagella basal body P-ring formation protein"
FT                   /note="COG1261: Flagellar basal body P-ring biosynthesis
FT                   protein, Ralstonia solanacearum"
FT                   /note="FlgA protein"
FT                   /note="KEGG, K02386"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00211"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42186"
FT                   /db_xref="GOA:A0A0H3KBB3"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBB3"
FT                   /protein_id="BAG42186.1"
FT                   /translation="MTGGALRGTDERPMQRRRARALGLAAVLSAVAAVAHADDGMIVIP
FT                   GRGDTAEHALASANAASGGRLGANGAAPMRDAGNVTPAGPANFVANAPADAAPGTRGNA
FT                   AVVAPAAAAPRAADPGGIVTVVAGASDAAPNVGRTPPRAALATRAVPAVSATRPAAVTA
FT                   AATAAPASPPPTQSAGAPAQQDPDTIRRTALTFLQQQIAGLPGKTSATVAPAFPRGLAA
FT                   CTTLEPFLPTGARLWGRTTVGVRCAGERPWTVYLQAKVTVHATYYVAARQIAPGEPLSA
FT                   ADLVARDGDLTVLPLAVITDPAQAIGATALARIAAGLPLRQDMLKSAASVSAGQTVRVV
FT                   AAGPGFTISAEGSALANAAPGQSVRVRMAAGQIVTAIVKDAGTVEIPL"
FT   CDS_pept        222631..223119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="BMULJ_00212"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="COG1815: Flagellar basal body protein, Ralstonia
FT                   solanacearum"
FT                   /note="FlgB protein"
FT                   /note="KEGG, K02387"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00212"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42187"
FT                   /db_xref="GOA:A0A0H3KG21"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG21"
FT                   /protein_id="BAG42187.1"
FT                   /translation="MLDKLDAEFAFGRQALDVRAYRQELLSSNIANADTPGYRARDVDF
FT                   ASTLAHSLKQANGGLAPSNAAQLPLAQPAGVTSGMTMVSTAPGHMAGTVKLIPTGGPSD
FT                   DYGRAQYRMPLQPSLDGNTVDLDVERVQFANNALRYETGMTVMTQQIKAMIAAITTNS"
FT   CDS_pept        223160..223585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="BMULJ_00213"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="COG1558: Flagellar basal body rod protein, Yersinia
FT                   pestis"
FT                   /note="FlgC protein"
FT                   /note="KEGG, K02388"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00213"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42188"
FT                   /db_xref="GOA:A0A0H3KBJ8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBJ8"
FT                   /protein_id="BAG42188.1"
FT                   /translation="MPSLMNIFGVAGSALSAQSQRLNVTASNLANADSATGPDGKPYKA
FT                   KQVVFATDPIGGARTASGQGVGGVRVTKVIDDPSPMKSTYDPANPAADANGYVQMPNVD
FT                   PVQEMVNMISASRSYQANVETLNTAKQLMLKTLTIGS"
FT   CDS_pept        223641..224384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="BMULJ_00214"
FT                   /product="flagellar basal-body rod modification protein"
FT                   /note="COG1843: Flagellar hook capping protein, Ralstonia
FT                   solanacearum"
FT                   /note="FlgD protein"
FT                   /note="KEGG, K02389"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00214"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42189"
FT                   /db_xref="GOA:A0A0H3KJX5"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJX5"
FT                   /protein_id="BAG42189.1"
FT                   /translation="MTSSSTTIGSNGTNVSTLPTDTMNTNNVSTTGTSASDLQATFLKL
FT                   LVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLAAGQQTQAALLIG
FT                   SNVLAPGNTVAVKSGAASPFGVSLTSDVSNLTITVKNSAGAVVNTINAGSQSAGTVPFN
FT                   WTPTDAAGNALPDGQYTISAQYTGTDGKSYAPTVLTAAQVQSVIKQSDGTPGLVLSNGS
FT                   TVGLTQVASIFPNTGSSSSGSASTN"
FT   CDS_pept        224412..225656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="BMULJ_00215"
FT                   /product="flagellar hook protein"
FT                   /note="COG1749: Flagellar hook protein FlgE, Ralstonia
FT                   solanacearum"
FT                   /note="FlgE protein"
FT                   /note="KEGG, K02390"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00215"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42190"
FT                   /db_xref="GOA:A0A0H3KBK9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBK9"
FT                   /protein_id="BAG42190.1"
FT                   /translation="MGYQQGLSGLAGASNALDVIGNNIANANTVGFKSSTAQFSDMYAN
FT                   SIATSVNTQIGIGTALASVQQQFGQGTINTTNSSLDVAINGNGFFQMSNNGTITYTRDG
FT                   TFQRDKNGYIVNSQGLNLMGYAADKNGVINTAQTVPLQAPTTNIAPTATTKITGQFNLN
FT                   SQDTVPTKTPFDATDTTTYNYSTSIQVYDSLGGSQAVNIYFVKSAAGTWEAYAGVQGGK
FT                   TNDLGTIQFDSSGAISGTTKAGTPVTPTEALGQFQFTVPNTDGSATPQTLTLDLTGTTQ
FT                   YGGKDGVNNLAQDGYASGTLATFTIGTDGKVTGNYSNGQTAVLGQIALANFNNPNGLVN
FT                   IGGNQYAETAASGVPQISVPGSTNHGTLQGSALENSNVDLTSQLVNLITAQRNYQANAQ
FT                   TIKTQQTVDQTLINL"
FT   CDS_pept        225677..226435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="BMULJ_00216"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="COG4787: Flagellar basal body rod protein,
FT                   Salmonella typhimurium LT2"
FT                   /note="FlgF protein"
FT                   /note="KEGG, K02391"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00216"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42191"
FT                   /db_xref="GOA:A0A0H3KBB5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBB5"
FT                   /protein_id="BAG42191.1"
FT                   /translation="MDRLIYTAMTGASQSLDQQAIVANNLANASTTGFRAQLATYRAVP
FT                   MNFGDGSAVDPNTTRTYVLASTPGADFAPGPITRTGNPLDVAVQGPGWLSVQLPDGSEA
FT                   YTRAGNLHVDQNGQLVNASNLPVVGNGGPISVPPNAEVTIGKDGTVSALMPGDPPTAVA
FT                   IVDQMKLVNPDPATLVRGNDGLFRTTDGNPADADPNVAVVPNSLEGSNVNPVTAMVAMI
FT                   DNARAFQLQSKLIQTADQNEQSANQLLNFS"
FT   CDS_pept        226473..227261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="BMULJ_00217"
FT                   /product="flagellar basal-body rod protein"
FT                   /note="COG4786: Flagellar basal body rod protein, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02392"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00217"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42192"
FT                   /db_xref="GOA:A0A0H3KG26"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG26"
FT                   /protein_id="BAG42192.1"
FT                   /translation="MNRSLYIAATGMNAQQAQMDVISNNLANVSTNGFKGSRAVFEDLL
FT                   YQTIRQPGANSTQQTELPSGLQLGTGVQQVATERLYTQGSLTQTGNSKDVAINGAGFFQ
FT                   VLMPDGTNAYTRDGSFQTNAQGQLVTSSGYQILPAITVPQNATSLTIGKDGVVSVTQPG
FT                   SSNAVQIGSLQIATFINPAGLEAKGENLFAETTSSGAPNVSQPGLNGAGTLNQGYVEAS
FT                   NVNVVQELVNMIQTQRAYEINSKAVTTSDQMLQTVTQMKS"
FT   CDS_pept        227280..227969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="BMULJ_00218"
FT                   /product="flagellar L-ring protein precursor"
FT                   /note="COG2063: Flagellar basal body L-ring protein,
FT                   Salmonella typhimurium LT2"
FT                   /note="FlgH protein"
FT                   /note="KEGG, K02393"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00218"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42193"
FT                   /db_xref="GOA:A9ABN1"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ABN1"
FT                   /protein_id="BAG42193.1"
FT                   /translation="MKQVRLLPSAAVRAACALAAAALAGCAQIPREPIVQQPMTAQPPL
FT                   PVSMQAPGSIFNPGYAGRPLFEDQRPRNIGDILTIVIAENINATKSSGANTNRQGNTDF
FT                   NVPTAGFLGGLFSKANLSAAGTNKFAATGGASAANTFNGTITVTVTNVLPNGNLVVSGE
FT                   KQMLINQGNEFVRFSGVVNPNTISGSNSVYSTQVADARIEYSAKGYINEAETMGWLQRF
FT                   FLNIAPW"
FT   CDS_pept        227975..229147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="BMULJ_00219"
FT                   /product="flagellar P-ring protein precursor"
FT                   /note="COG1706: Flagellar basal-body P-ring protein,
FT                   Ralstonia solanacearum"
FT                   /note="FlgI protein"
FT                   /note="KEGG, K02394"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00219"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42194"
FT                   /db_xref="GOA:A0A0H3KBK2"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBK2"
FT                   /protein_id="BAG42194.1"
FT                   /translation="MHDTVLRRLSSRVPAAAAGLLIAVACALGAPAAHAERLKDLAQIQ
FT                   GVRDNPLIGYGLVVGLDGTGDQTMQTPFTTQTLANMLANLGISINNGSANGGTSSLNNM
FT                   QLKNVAAVMVTATLPPFARPGEALDVTVSSLGNAKSLRGGTLLLTPLKGADGQVYALAQ
FT                   GNMAVGGAGASANGSRVQVNQLAAGRIVGGAIVERSVPNALAQMNGMLQLQLNDMDYGT
FT                   AQRIVAAVNSSFGPGVATALDGRTIQLAAPADPAQQVAFMARLQNLDVSPDKAAARVIL
FT                   NARTGSIVMNQMVTLQSCAVAHGNLSVVVNTQPVVSQPGPFSNGQTVVAQQSQIQLKQD
FT                   NGALKMVTAGANLADVVKALNTLGATPADLMSILQAMKAAGALRADLEII"
FT   CDS_pept        229148..230107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgJ"
FT                   /locus_tag="BMULJ_00220"
FT                   /product="flagellar protein"
FT                   /note="COG1705: Muramidase (flagellum-specific), Ralstonia
FT                   solanacearum"
FT                   /note="FlgJ protein"
FT                   /note="KEGG, K02395"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42195"
FT                   /db_xref="GOA:A0A0H3KJX9"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013377"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJX9"
FT                   /protein_id="BAG42195.1"
FT                   /translation="MANFPGATDLTQRFALDVQGFDALRAQAKQSPQGGAKAVAGQFDA
FT                   MFTQMMLKSMRDATPEGGLFDSHTSKMYTSMLDQQLAQQMSSRGIGVADALMKQLMRNA
FT                   GQGAGAAADLGAGFGAAGNEGSLAAMSAMANAYANAAANNGGLSRARGYSAGSALTPPL
FT                   KGATGAPDADAFVDRLAGPAQAASAATGIPARFIVGQAALESGWGKREIRAADGSTSYN
FT                   VFGIKATRGWTGRTVSALTTEYVNGTPRRVVAKFRAYDSYEHAMTDYANLLKNNPRYAG
FT                   VLSASRSVEGFAQGMQKAGYATDPNYAKKLISIMQQIG"
FT   CDS_pept        230322..231077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00221"
FT                   /product="predicted glycosyltransferase"
FT                   /note="COG5581: Predicted glycosyltransferase, Yersinia
FT                   pestis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00221"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42196"
FT                   /db_xref="GOA:A0A0H3KBL4"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBL4"
FT                   /protein_id="BAG42196.1"
FT                   /translation="MNIETSTAPSLDSGHSGPDYARRNPLEIGVQLRNLVNRGDFLTVE
FT                   YPGGQLVTRLLEVDVGARTFTFDWGALSKQNASILGAAHCAFSAAPEGVRVEFTTGTPR
FT                   ETRYEGLPAFVADFPDVLVCIQRREYFRVDAPVVDPFLCRGALPDGERFQFEVHNLSLG
FT                   GVGLRTADERVEALALGTVLPDVELELNGHGKLSLDLQLVSQRATQLPNGARRYQLGFR
FT                   FLSLPGSAENTLQRLITQLEMKRRSLARA"
FT   CDS_pept        231259..233238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="BMULJ_00222"
FT                   /product="flagellar hook-associated protein 1"
FT                   /note="COG1256: Flagellar hook-associated protein,
FT                   Ralstonia solanacearum"
FT                   /note="FlgK protein"
FT                   /note="KEGG, K02396"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00222"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42197"
FT                   /db_xref="GOA:A0A0H3KBB9"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBB9"
FT                   /protein_id="BAG42197.1"
FT                   /translation="MSNTLMNLGVSGLNAALWGLTTTGQNISNAATPGYSVERPVYAEA
FT                   SGQYTSSGYLPQGVNTVTVQRQYSQYLSDQLNTAQTQSGALSTWYSLVAQLNNYIGSPT
FT                   AGISTAITNYFTGLQNVANNAADPTVRQTAMSNAQTLADQITAAGQQYDALRQSVNTQL
FT                   TSTVSQINTYTAQIAQLNQQIAAASSQGQPPNQLMDQRDLAVSNLSSLAGVQVVRNSDG
FT                   YSVFLAGGQPLVVADKSYQLATVTSPSDPSELTVVSQGIAGANPPGPNQYLPDTSLSGG
FT                   TLGGLLAFRSQTLDPAQAKLGAIAASFAAQVNAQNALGIDLSGNVGSNLFAVGAPTVYT
FT                   DTRNQGDATLSVSFSNASQPTTGDYTLSFDGTQYTLTDRATGSVVGTSNTMPGSIGGLD
FT                   FSVSSGTMQAGDQFTVLPTRGALDGFQLATSNGSAIAAASPVVTSAASTNAGTATITQG
FT                   PVSAGYQVPATTLTYDAATKSLSGFPAGTTVTIAGTPPQTVTITSSTTPVPYDPAAGAT
FT                   LTMSGTAPGALNGVTVSLSGAPADGDTFRIGPYAGGTNDGTNALALSKLVTAKSFGNGT
FT                   VTLTGAYASYVNDIGNAASQLKSSSAAQTALVGQITSAQQSVSGVNQNEEAANLMQYQQ
FT                   LYQANAKVIQTAATLFQTVLGLFN"
FT   CDS_pept        233256..234491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="BMULJ_00223"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="COG1344: Flagellin and related hook-associated
FT                   proteins, Pseudomonas aeruginosa"
FT                   /note="FlgL protein"
FT                   /note="KEGG, K02397"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00223"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42198"
FT                   /db_xref="GOA:A0A0H3KG30"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG30"
FT                   /protein_id="BAG42198.1"
FT                   /translation="MRISTAQFYQLNVAQMSDQQAQLAQLYQQISSGVSLSTAADNPLG
FT                   AAQAVQLSMTSATLSQYATNQNVALSSLQKEDQALTTVNDLLNTIHSSVMHAGDGSLSD
FT                   SDRSALATQLQGYRDQLLTLANSTDGAGNYLFAGYQSTTAPFANGTGGGVVYSGDRGAR
FT                   QVQIADTRTIAQGDDGASVFLSVPMLGSQPVPAAGAANQGTATIGAVTITDPSAATNAH
FT                   TFTITFGGTSAAPTYTVTDETVAPPTTTAPQPYAAGTAIALGNGLSVPVSGTPSPNDTF
FT                   SVTPAPQAGTDVFATLDTMIAALKVPIGSDTVAAAKLANAMTTGTTKLDNTMTNILTVQ
FT                   ASVGGREQEIQAMQAVNQTNTLQVTSNLADLTSTNMVSTISQFLQMQNALTGAQKAYAQ
FT                   LQNLSLFQYINP"
FT   CDS_pept        234849..236156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrP"
FT                   /locus_tag="BMULJ_00224"
FT                   /product="uracil permease"
FT                   /note="COG2233: Xanthine/uracil permeases, Escherichia coli
FT                   K12"
FT                   /note="KEGG, K02824"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00224"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42199"
FT                   /db_xref="GOA:A0A0H3KBK8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBK8"
FT                   /protein_id="BAG42199.1"
FT                   /translation="MSDSYFPRWRVQSTGASVRVVGPDERLPWPQMVAMGVQHVVAMFG
FT                   STVLAPLLMGFDPNLCIFMSGIGTLLFFVLVGGRVPSYLGSSFAFIGLVIAVTGYGGTG
FT                   PNPNIPVALGGIVACGVVYVALGALVSAIGTRWIETLMPPVVTGAVVAVIGLNLAPIAV
FT                   KGVSASNFDSTMALVTVLCVGGVAVFARGMMQRLLILVGLVIAYVIYAIATNGMGLGKP
FT                   IDFSIVSHAAWFGMPAFTAPVFDPHAMLMLAPVAVILVAENLGHIKAVSAMTGQNLDRY
FT                   VGRAFIGDGLATIVSGSVGGTGVTTYSENIGVMAVTRIYSTLVFAVAAVIAIVLGFSPK
FT                   FGAVIQTIPGAVLGGVSIVVFGLIAVTGARIWVVNKVDFSDNRNLIVAAVTLVLGAGDF
FT                   SLKIGGFGLGGIGTATFGAIILYALLRKEKEPGPVV"
FT   CDS_pept        complement(236276..237160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00225"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Caulobacter
FT                   vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00225"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42200"
FT                   /db_xref="GOA:A0A0H3KJY3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJY3"
FT                   /protein_id="BAG42200.1"
FT                   /translation="MRRDLPPFSALRAFEAAARHESFSAAGDELHVTHGAISRQIAGFE
FT                   AWLGKPVFHRYGKRVKLTDEGRRYLDTVRAAFDSIALATEQLRHTGTARVLRINALPTF
FT                   AMKWLLPRLSRFQRDVPNVELKLSTSNAPLDTLDGFDVAIRRGPGHWPACTSGRFLDES
FT                   VIPVCSPALLKRAPIARADDLARHVLLHSDTRPEGWRDWFAAAGVTMKARKRQSFDHFY
FT                   LALQAAVDGLGVALGPLPLIDDELASGRLVMPLAGPRIATRSYWWIAPRAPADDPLVAQ
FT                   FCAWLEAQSNVGA"
FT   CDS_pept        237256..237882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="BMULJ_00226"
FT                   /product="chromate transporter"
FT                   /note="COG2059: Chromate transport protein ChrA, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K07240"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00226"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42201"
FT                   /db_xref="GOA:A0A0H3KBL9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBL9"
FT                   /protein_id="BAG42201.1"
FT                   /translation="MPSASPPPVTPPRRVGLAELFTGFLSLGLMSFGGALPFARRTIVE
FT                   ERRWLSADEFTDLLGLCQFLPGGNVINLSVAVGMRFRGIPGAFAGILGLIAGPTLVVVA
FT                   LGVLYAKTQNDPRVQHLFAGLAAAAAGLLAAMAVKVAKPLRHARAAAGIAALAFVAIAV
FT                   LRIPLLTTMLVLTPVSIWLAARRRDTAAGAAGRAPTPEPRDGGRR"
FT   CDS_pept        237879..238406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="BMULJ_00227"
FT                   /product="chromate transporter"
FT                   /note="COG2059: Chromate transport protein ChrA, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K07240"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00227"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42202"
FT                   /db_xref="GOA:A0A0H3KBC3"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBC3"
FT                   /protein_id="BAG42202.1"
FT                   /translation="MNDTLIAIATIFSQLSLLAFGGGNTILPEMQRQVVDVHHWMSAHE
FT                   FTALFALAQAAPGPNMMIVSLVGWHVAGWSGLLVASLAKFGPSSIVTVLALHAWERFRD
FT                   RPWRRYVQQGLMPVTAGLVAASAVLIAQASNRTAIQWGITAVCAVLAYRTRIHPLWLLA
FT                   GGALIGLTGFGQ"
FT   CDS_pept        complement(238420..238758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00228"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00228"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42203"
FT                   /db_xref="GOA:A0A0H3KG34"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG34"
FT                   /protein_id="BAG42203.1"
FT                   /translation="MTPAKFFLRYTVIPFVAIVLVAVWAFNRESGEIDARQYAALAAAY
FT                   PNFTPKLKREVADALRGGRLAKNDYATIMRDALEAGYVIDWPAAASDVGSERGRLLGAV
FT                   NSDAPASP"
FT   CDS_pept        238978..239688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00229"
FT                   /product="putative membrane protein"
FT                   /note="COG3619: Predicted membrane protein, Methanosarcina
FT                   acetivorans str.C2A"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00229"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42204"
FT                   /db_xref="GOA:A0A0H3KBL3"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBL3"
FT                   /protein_id="BAG42204.1"
FT                   /translation="MDLDGASRNLTVAALLTLSGGYLDAYTYVGHGHVFANTMTGNVAL
FT                   LGINLSAGEWGAALHHVPPLVGFVIAVLVAHLLGLAAQRGWVRHTAFASLIVEIAFLGI
FT                   AASGIVGASSAWLIPGISFVATLQTLSFTHLEELSYTSVMTTGNLRRATQKLFVGLIPR
FT                   YDAGALHDSALLATISFCFMAGAVLGGFATRIAPAVALWGAVLLLVGAFAEIVRRARRR
FT                   AGRGDIGGGDAQAA"
FT   CDS_pept        239970..241091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00230"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42205"
FT                   /db_xref="GOA:A0A0H3KJY8"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJY8"
FT                   /protein_id="BAG42205.1"
FT                   /translation="MKQTTRLAALAGGAALAFASQYAAAQSSVTLWGVADVSVRYLTNA
FT                   NANNDGLLQMTNGAITNSRFGIYGTEDLGGGLKALFNLESGVNLQNGAFADSGRLFNRA
FT                   AYVGLQSPYGTVTLGRQKTPLFDLLSDTYDPLTVGNYLENAWLPVALGGGLYADNQIKY
FT                   TGKFAGLTAKAMYSTGTNYKDTSPDGFSGQIPGSLGKGNAWGVSLSYVMGPLSIAAGAQ
FT                   QNSDNSARKQTIYHANVVYAFSKAKIYAGYLRSKDDTGFVDSLLAQQTIPTAKGTGRID
FT                   DGPFAGVSWQVSTPLTLTGAFYYDHMRNAMTANGTLASGNRYAIVGIAEYALSKRTEIY
FT                   GTIDFNKTNGAANVELPGRSNQTGIAIGLRNIF"
FT   CDS_pept        241417..241644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00231"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBM4"
FT                   /protein_id="BAG42206.1"
FT                   /translation="MGILNTVGEIAGAVAAVEAAEKLDPDAGLLTKAAAAVAGFKGAEA
FT                   LEGLVEKKEDATEQAADDTQATDGSDTSQA"
FT   CDS_pept        241883..243238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="BMULJ_00232"
FT                   /product="NADPH glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="COG1249: Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes, Caulobacter vibrioides"
FT                   /note="KEGG, K00383"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00232"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42207"
FT                   /db_xref="GOA:A0A0H3KBC6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006324"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBC6"
FT                   /protein_id="BAG42207.1"
FT                   /translation="MDFDYDLFVIGAGSGGVRLARMSASYGARVGIAEQEQIGGTCVLR
FT                   GCIPKKLLVYASHYPHDIEDAKGFGWTFGAGTLDWHALIAAKDREINRLSDIYVNLLRQ
FT                   SGVDMIAGRATIVDAHTVAVGERRIRARHIAIATGSRPSLPPRPGIEHAITSREALSLD
FT                   ALPARIAVVGGGYIAVEFAGIFNGFGSRVDLFYRGETILRGFDDDVRQFLSDEMTKQGI
FT                   AIHTGATIEAIERADDGTLSLRVGDAKHGPYDAVLYATGRVPNVEGLGLEAAGVVLDAR
FT                   GAIAVDAYSATSVDSIHAIGDVTSRPQLTPVATRDGALLAMTLFGGRRVATDHEWVPSA
FT                   VFSQPEVATVGLTEARAREQYGAVDIYRTSFKALRHTLSGRDERTLMKLVVARDSQRVV
FT                   GAHMVGREAGEIIQGIAIAIRAGATKAQFDETIGIHPTAAEEFVTMRQKVGE"
FT   CDS_pept        243841..244494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00233"
FT                   /product="putative lipoprotein"
FT                   /note="COG1462: Uncharacterized protein involved in
FT                   formation of curli polymers, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00233"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42208"
FT                   /db_xref="GOA:A0A0H3KG38"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG38"
FT                   /protein_id="BAG42208.1"
FT                   /translation="MLVAAAAVAALSGCATESSRTLDVPAVSSAQKPYAGKPVAIAVGK
FT                   FDNRSSYMRGIFSDGIDRLGGQAKTILVTRLQQSHRFNVLDRENLDEIKQEAGFMKKAQ
FT                   AVKGANYVVTGDVTEFGRKDVGDHQLFGILGRGKTQVAYAKVNLNIVDTTTSEVVASSQ
FT                   GAGEFSLSNREVIGFGGTAGYDSTLNGKVLDLAIQEAVNHLVDQVDAGALKASQ"
FT   CDS_pept        244549..244920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00234"
FT                   /product="putative lipoprotein"
FT                   /note="COG4259: Uncharacterized protein conserved in
FT                   bacteria, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00234"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42209"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBL8"
FT                   /protein_id="BAG42209.1"
FT                   /translation="MKRGIWLPATAAALLLAGCAAPSTPPLYQWNGYQPQVYEYFKGQQ
FT                   SPQAQIDALEKALQEIRAKGRTPPPGFHAHLGMLYASVGNEQRAEQELQAEKQLFPESS
FT                   AYMDFLMKKKSVPQKTAQQ"
FT   CDS_pept        244931..245605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00235"
FT                   /product="putative lipoprotein"
FT                   /note="COG4380: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00235"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42210"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJZ0"
FT                   /protein_id="BAG42210.1"
FT                   /translation="MFKTLSFKLLSVLSIAALLSACAQPVKRPDYAAFKKSQPRSILVL
FT                   PPVNETTDVGATYGMLSQMTLPLAESGYYVVPVAVMDETFKQNGLTNAAEIQQTSPAKL
FT                   REIFGADAALYSKVKQYGSVYQVVDSTTIVAASAKLVDLKTGDVLWQGEGRATGKEVGN
FT                   NMSVNAFGIVGMLVQAAIKQVAHSLSDEAHDVAALTSSRLLSAGTPNGLLYGPRSPKYG
FT                   TD"
FT   CDS_pept        complement(245703..247004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puuB"
FT                   /locus_tag="BMULJ_00236"
FT                   /product="gamma-glutamylputrescine oxidase"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Pseudomonas aeruginosa"
FT                   /note="KEGG, K09471"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00236"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42211"
FT                   /db_xref="GOA:A0A0H3KBM9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBM9"
FT                   /protein_id="BAG42211.1"
FT                   /translation="MQTFANQPHTASYYAATANDVTRHAPLDGATDADVCVIGAGLTGL
FT                   SAALNLAERGHSVTVLEASRVGWAASGRNGGQLIGGFACDIDTFGRFMPEEDVKRIWDM
FT                   GLETLSLVKSRIAQHSIDCAFVPGYLTAANTARDVDALKRWRDEAATRFGYDRFRFVDG
FT                   ADLGDYVQSTRYRGGLYDPDSGHLHPLNYTLGLARAATKAGVRIHEESCATRVRDIAGG
FT                   HLVETERGHVRARYVVLACNTYVGTLAPALSKKIMPVGTYVIATEPLGDARAAALMPAR
FT                   AAICDSRFVLDYFRPAPDTRIVWGGKVSYSTLPPRNLAEAMRRDMLKTFPQLADVKIDY
FT                   AWGGFVDITMNRAPHFGRIAPTLYFAQGFSGHGVNTTALAGKLIAEAIDGQASLFDLFG
FT                   RIRHRDFPGGAALRTPALVLAMSWYRLLDAFGVH"
FT   CDS_pept        complement(247030..248331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00237"
FT                   /product="glycine/D-amino acid oxidase"
FT                   /EC_number="1.-.-.-"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Pseudomonas aeruginosa"
FT                   /note="KEGG, K00540"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00237"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42212"
FT                   /db_xref="GOA:A0A0H3KBD0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBD0"
FT                   /protein_id="BAG42212.1"
FT                   /translation="MKQSFARRADALARDSYYEASVVRAADDAPLDRTLDVDVCVIGAG
FT                   FAGLSTALDCRARGLSVAVIDAHRPGWGASGRNGGQAIAGFAKDDEIERQLGADGARAA
FT                   WSLSFDGLALIAERIARYGIDCDFTRGYLTVATKPRGVDALRAWMDAATSRWGHPSLAW
FT                   LDADAIGTRIASTRYLAGVHDPLSGHLHPLKYCLGLADAARREGVALHAHTPALDVVRG
FT                   ARPVVRTPGGEVRCRFVVSCCNAGPGGILPAATAARIAPIASYIIATEPLAQDRADALI
FT                   AQREAVCDNNFFLDYFRLSADNRMLFGGRANSAGASPDTLAEAIRQRMVRVFPQLADVR
FT                   VAHAWGGFVDVTRNRAPDFGALDPNFFYVQGFSGHGVALTGIAGRAIADAIAGDTRTFD
FT                   LFARVRHRRFPGGDAWRQPALELGMLYHRVRELF"
FT   CDS_pept        complement(248480..250057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00238"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42213"
FT                   /db_xref="InterPro:IPR021485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG42"
FT                   /protein_id="BAG42213.1"
FT                   /translation="MKKKLICLLVAGALPGIALADSTSAQIKALQAQVAALQQQMKAMQ
FT                   AQLAARPGAAANASGGTKAAVAPVAVAADPGSPDYGKAPAMLTNDDVTEMKQQIASQQL
FT                   KVDTLTDAANTGPLAGLSVTGYIDPTYIYNRAAGTSSFLFANHENAYNYFNSTFGDLYL
FT                   DIKKTFGVGPMAPSAEITLMPNRGNGITLLQNSRGSITDNLLNTAVVNVPITATTTLVA
FT                   GLIPSFGGYEVQQSNQMLTLTHNLLYDFSDPGSYVGAGMNYTKGAWAWKFFLGNEQYRT
FT                   YGSVTQTGTNALGDPITTSNKVPTFTARADYTWSSALDIGGSFNIGRQTLPSAIDPTTG
FT                   NVSYGVGGAAPSAYGTFFFAEADATYTLADVQYNAELDHGQQQHAAYNGGLAQWYGLSL
FT                   LAHRKFNAPVVGRMGVTLRYDALVNRKNGGGGGGIALNGNGMDPYNGFGVDADCLATSK
FT                   ANGGLGFDCKGAIRQDVALDLLFYPTQQITVKVEYRHDWANNKVFLRNDGSYGKSNDLL
FT                   ATQFIYSF"
FT   CDS_pept        complement(250159..250998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="BMULJ_00239"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1177: ABC-type spermidine/putrescine transport
FT                   system, permease component II, Escherichia coli K12"
FT                   /note="KEGG, K02053"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00239"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42214"
FT                   /db_xref="GOA:A0A0H3KBM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBM2"
FT                   /protein_id="BAG42214.1"
FT                   /translation="MIKPSKPLSTGVLAFGFLFLYIPIISLVVYSFNESKLVTVWSGFS
FT                   LKWYAALWQDDELLTAAWLSLKIGLLTATASVVIGTWAGFVLARFGRFRGFTLYTGMIN
FT                   APLVIPEVIQGISLLLLFVALEQMFGWPKGRGMVTIWIGHVMLCVSYVAIIVQSRVKEM
FT                   NKSLEEAALDLGATPLKVFFVVTLPLISQALLSGWLLSFTLSIDDLVLSAFLSGPGSTT
FT                   LPLVVFSRVRLGLNPEMNALATLFITAVTIGVIVVNQMMIARERRRVADLKHAFAAA"
FT   CDS_pept        complement(250995..251981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="BMULJ_00240"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1176: ABC-type spermidine/putrescine transport
FT                   system, permease component I, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02054"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42215"
FT                   /db_xref="GOA:A0A0H3KJZ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJZ7"
FT                   /protein_id="BAG42215.1"
FT                   /translation="MRTSASTSSAPVSPGAVPAAAAPRRRARFPALSRLLPSGRSVAIG
FT                   VPFLWLAVFFALPFVLVLKISFADQVMGIPPYTSLVQVKDGVVHFALQLSHYAFLLQDD
FT                   LYVATYLSSLKMAAVSTVFCLLIGYPMAYYIARSEPGTRNVLMMAVMLPFWTSFLIRVY
FT                   AWIGILKDDGLLNHALIALGIIHTPLRLYHSDAGVYIGMVYSYLPFMVMPLYAHLVKMD
FT                   LTLLEAAYDLGAKPWVAFTRITLPLSKNGIIAGSLLVFIPAVGEYVIPELLGGADTLMI
FT                   GRVMWDEFFNNMDWPMASAVTVAMVLLLLVPMALFQYYQVKELEEAK"
FT   CDS_pept        complement(251992..253158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="BMULJ_00241"
FT                   /product="spermidine/putrescine transport system
FT                   ATP-binding protein"
FT                   /note="COG3842: ABC-type spermidine/putrescine transport
FT                   systems, ATPase components, Neisseria meningitidis Z2491"
FT                   /note="KEGG, K02052"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00241"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42216"
FT                   /db_xref="GOA:A0A0H3KBN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBN6"
FT                   /protein_id="BAG42216.1"
FT                   /translation="MVTPMQSIPSSAAARHVQPAAAVRSANDAFVRIENVVKKFGDSTA
FT                   VDNVNLTIAKNELFALLGSSGCGKSTLLRMLAGLETATSGKIYVDGEDLASLPPYRRPV
FT                   NMMFQSYALFPHMSVESNVAFGLKQEGTPKHEIRERVADALALVQMSKYAKRKPHQLSG
FT                   GQQQRVALARSLVKRPKLLLLDEPMSALDKKIRQKTQLELVNIIDKVDVTCVMVTHDQE
FT                   EAMTMASRLAVMSEGRIVQIGTPGEVYEYPNSRFSAEFIGSTNLFEGRVVEDEPDHIFV
FT                   ESDDLETRMYVSHGVTGPLGMPVGISVRPERVHVSREKPNAPHNWARGVVTDIAYMGSY
FT                   SLYHVRLPSGKTVVSNLSSSHLMHDGAPSWNDDVFVSWSPASGVVLTQ"
FT   CDS_pept        complement(253335..254450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="BMULJ_00242"
FT                   /product="spermidine/putrescine transport system
FT                   substrate-binding protein"
FT                   /note="COG0687: Spermidine/putrescine-binding periplasmic
FT                   protein, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02055"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00242"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42217"
FT                   /db_xref="GOA:A0A0H3KBD3"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBD3"
FT                   /protein_id="BAG42217.1"
FT                   /translation="MRARFLRQACSAAALAAAAAFTSVASPSAHADELNVYNWSDYIAP
FT                   DTIPNFQKQTGIHVKYDNYDSDDTLQAKLLAGSSGYDIVVPTSNYMAKQIQAGVYQKLD
FT                   KSKLPNLANLDPVLMKMISDADPGNQYGVPWAYGTDGIGYNVQAVKKALGDKAPVDSWA
FT                   LVFDPANMEKLKSCGVSILDQAVDVFAATLQYMGRNPNSTNPADYQAAFDVLKKVRPYI
FT                   TQFNSSGYINDLANNDVCVALGWSGDVGIAHRRAAEAKRSYDIRFANPKEGGLLWFDVM
FT                   VIPKDAPHPENALKWINYVSDPKVNAAITNTVFYPTANKAARQFVTPAVAQDPTVYPSE
FT                   EVLKKMVLMKPMPADILRLENRLWAQLKTGH"
FT   CDS_pept        complement(254512..255939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="BMULJ_00243"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /note="COG0161: Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase, Pseudomonas aeruginosa"
FT                   /note="KEGG, K00833"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00243"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42218"
FT                   /db_xref="GOA:A0A0H3KG45"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG45"
FT                   /protein_id="BAG42218.1"
FT                   /translation="MTYRNESAWIQPAAPAARSTQARSTAEYRALDAAHHIHPFSDMGA
FT                   LNRAGSRVIVKADGVYLWDSDGNKIIDGMAGLWCVNVGYGRKELADAAYRQLQELPFYN
FT                   TFFKTTHPPVIELSAMLAEVTPPGFNHFFYCNSGSEGNDTVLRVVHQYWRVQGKPQKKY
FT                   VISRKNGYHGSTIAGGTLGGMGYMHEQMPSKVEHIVHIDQPYFFGEAQPGETPEAFGLA
FT                   RAQQLEAKILELGAENVAAFIGEPFQGAGGVIFPPSTYWPEIQRICRKYDILLVADEVI
FT                   GGFGRTGEWFAHQHFGFEPDLITMAKGLTSGYVPMGAVGIHERVARPIIDNGEFNHGLT
FT                   YSGHPVAAAVAVANLKLLRDEGIVERVKRDTGPYFQALMRETFARHPIVGEVHGHGLVA
FT                   SLQLAEAPAERRRFANGGDVGTICRDFCFNGNLIMRATGDRMLLSPPLVISRQEIDELV
FT                   SKAKRAVDATAQQLGLS"
FT   CDS_pept        complement(255968..257305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="BMULJ_00244"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="COG0174: Glutamine synthetase, Caulobacter
FT                   vibrioides"
FT                   /note="KEGG, K01915"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00244"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42219"
FT                   /db_xref="GOA:A0A0H3KBM8"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBM8"
FT                   /protein_id="BAG42219.1"
FT                   /translation="MQDIEDFLKQHRITEIEAIIPDMAGIARGKITPRNKFTSGESMRL
FT                   PQAVMVQTVTGDYPEDGSLSGVTDPDMVCVPDTSTIRLIPWAVDPTAQVIHDCVHFDGS
FT                   PVEISPRYVLRRVLDLYKKKGWKPVVAPELEFYLVDMNKDPDLPLRPPVGRTGRPETGR
FT                   QSYSIEAVNEFDPLFEDIYEYCETQDLDIDTLIHEVGAAQMEINFMHGDALSLADQVFL
FT                   FKRTVREAALRHNMYATFMAKPMEGEPGSAMHVHQSIVDEESGQNLFTSPETGGATSMF
FT                   YNFLAGLQKYTPALMPIFAPYINSYRRLSRFMAAPINVQWGYDNRTVGFRIPHSSPAAR
FT                   RIENRIPGVDCNPYLALAATLAAGYLGITQRLEPTEPLVSDGYSLPYQLPRNLEDGLTL
FT                   MSACEPLGEILGHKFLKAYFALKETEYEAFFRVISSWERRHLLLHV"
FT   CDS_pept        complement(257334..258119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00245"
FT                   /product="putative glutamine amidotransferase"
FT                   /note="COG2071: Predicted glutamine amidotransferases,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K07010"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00245"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42220"
FT                   /db_xref="GOA:A0A0H3KK00"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK00"
FT                   /protein_id="BAG42220.1"
FT                   /translation="MERKPLVGITADYTQIGAHASHTVGDKYVAAIVDGAQALAMLLPA
FT                   LGERQSIDDVLDAVDGLLFTGSYSNIEPHRYGGEPSAPGTKHDPARDATTLPLMRAAIA
FT                   AGVPVLAVCRGFQELNVVCGGTLHQRVHEVPGLADHREDDDAPLNVQYGPAHTVRVTPG
FT                   SMLHKLAGGRDEVHVNSLHKQGIAQLGSSLAIEAVAPDGLIEAVSVVDARAFALAVQWH
FT                   PEWRHAHDALSSAIFRAFGDACRARRDARSHARPAAALA"
FT   CDS_pept        complement(258403..258627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00246"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42221"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBP0"
FT                   /protein_id="BAG42221.1"
FT                   /translation="MRVRGPLVRWDRGDVRSLRSAAPASDGSCGWHSPRLLHLSIYTIL
FT                   SRRSVRRHNAVSARAFVAVDTDEVASLLP"
FT   CDS_pept        259041..259592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00247"
FT                   /product="XRE family transcriptional regulator"
FT                   /note="COG1396: Predicted transcriptional regulators,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00247"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42222"
FT                   /db_xref="GOA:A0A0H3KBD6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBD6"
FT                   /protein_id="BAG42222.1"
FT                   /translation="MSTEVAERLRFVRNKHGLSQRELAKRAGVTNGTISLIEQGRVSPS
FT                   VGSLKKLLECIPMSLAEFFTFELVESRSVVSRRDEMPNLGNESLAFHLVGAGVKDRNMC
FT                   IMREVYQPHADTGPEMLAHAGHEGGVVVSGRLELTVDGATWLLDPGDGYYFESRLPHRF
FT                   RNPSADQICEVVSANSPATF"
FT   CDS_pept        259676..261166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puuC"
FT                   /locus_tag="BMULJ_00248"
FT                   /product="gamma-glutamyl-gamma-aminobutyraldehyde
FT                   dehydrogenase"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K09472"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00248"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42223"
FT                   /db_xref="GOA:A0A0H3KG50"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG50"
FT                   /protein_id="BAG42223.1"
FT                   /translation="MNKLTLADWQDKAASLAIEGRAFIDGTLRDAHGGRTFDCVSPIDG
FT                   RVLTKVADCGEADVNAAVAAARRAFDAGVWAGLNPRARKAVLLRWAALMRAHLDELALL
FT                   ETLDAGKPIGDTTTVDVPGAAYCVEWFAEAIDKVGGEVAPADHHLVGLVTREPVGVVAA
FT                   VVPWNFPILMAAWKFGPALAAGNSVVLKPSEKSPLTAIRVAQLAFEAGIPPGVFNVVPG
FT                   AGEPGKLLALHPDVDCIAFTGSTAVGKLIMQYAAQSNLKRVWLELGGKSPNIVLPDCPD
FT                   LDRAAQAAAGAIFYNMGEMCTAGSRLLVHRDIKDAFVEKLVAAARAYVPGNPLDPSVSM
FT                   GAIVDRVQLERVLGYIDAGRKEGTLVTGGARVKEETGGFYVEPTVFEVKPDAKIAREEI
FT                   FGPVLSLIVFDDVDEAVRIANDTEYGLAAAVWTSNLTTAHDVSRRLRAGTVWVNCYDEG
FT                   GDMNFPFGGYKQSGNGRDKSLHALEKYTELKSTLVRLR"
FT   CDS_pept        complement(261212..261412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00249"
FT                   /product="putative copper chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00249"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42224"
FT                   /db_xref="GOA:A0A0H3KBN5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBN5"
FT                   /protein_id="BAG42224.1"
FT                   /translation="MEFEVQDMTCGGCANAITRAVTAADPAAKLDIDVAAKTVKVESTQ
FT                   GAERVQAVIEAAGFHPALRSA"
FT   CDS_pept        261759..262091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00250"
FT                   /product="probable Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42225"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK06"
FT                   /protein_id="BAG42225.1"
FT                   /translation="MNRIAFGFALALLGACVTPAFAADDVVNLTLKDHKFSPDGVTIPA
FT                   GKKVKFVVKNLDATPAEFESDDFKAEKVVPAGKSVEILVGPLKAGTYEFHDEYHEAQSK
FT                   TQLTVK"
FT   CDS_pept        262098..262934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftr1"
FT                   /locus_tag="BMULJ_00251"
FT                   /product="high-affinity iron transporter"
FT                   /note="COG0672: High-affinity Fe2+/Pb2+ permease,
FT                   Rickettsia prowazekii"
FT                   /note="KEGG, K07243"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00251"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42226"
FT                   /db_xref="GOA:A0A0H3KBP6"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBP6"
FT                   /protein_id="BAG42226.1"
FT                   /translation="MLSTALIVFREVLEAALVVSIVMAATRGVPRRGWWVGGGLVGGVI
FT                   GAGLIAAFADAISQWASGMGQEVFNAGVMFVATLMLAWHSIWMSRHGREMAMQMNAAGR
FT                   AVAAGSKPLTGLAIVVGVAVLREGSEAVLFLYGIAAGDPGQTPQMIAGGLLGVLGGAGL
FT                   GYAMYAGLLQIPLKRLFSVTNWLIVLLAAGMASQCVGFLLAAGLVPSWGDAIWDTSWLL
FT                   KDSSLVGKALHTLIGYTARPAGIQIAAYVATLAAIVVLSRVVGRQQRTVQPPRPAA"
FT   CDS_pept        complement(263050..263268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00252"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBD9"
FT                   /protein_id="BAG42227.1"
FT                   /translation="MEAENYCGYQIWGHAILQQDEILQPERFAASGTITQNNKLVEASG
FT                   VLGVFDTEDEAREAGLEWARAWIDNHR"
FT   CDS_pept        complement(263268..263732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00253"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42228"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG55"
FT                   /protein_id="BAG42228.1"
FT                   /translation="MVRLFGCGLLALTFASTGWAAEHYVEVWNPPEARLPAARTPSRTP
FT                   GARTGADAHAAKGAEKHASAQSKAIAKPPHKRRVAQALKAEPHRAPAAVDTPVAPRPVE
FT                   QPAPGRLTVMQPAAPDAPHALDFSDIPRQYTPDGNVLRVGTRPGAAEVTR"
FT   CDS_pept        complement(263743..264465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00254"
FT                   /product="hypothetical protein"
FT                   /note="COG4737: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00254"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42229"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBN9"
FT                   /protein_id="BAG42229.1"
FT                   /translation="MPASVRRVFKTKWFHKAARKAGIVDAELCRAVRELARGQGVDLGG
FT                   NVWKKRLDGNRRRAIVLGRIEQAWVFLFAKCDRDDIDERELRAFRQLAVDFGHRTDGDL
FT                   ATLIALDELVEICNGQESVQERRNGGDPQRRVRSLSRQPDRQEDDARIRRALHRGRAAV
FT                   RAGGDCTHPQIGQRQPERVRALSEHDDVDDPPMGTGRQAAERHRSAHAADRREARARGV
FT                   LLSTPLRLAGRPRAPKRI"
FT   CDS_pept        complement(263793..264113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00255"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG2944: Predicted transcriptional regulator,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K07726"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00255"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42230"
FT                   /db_xref="GOA:A0A0H3KK08"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK08"
FT                   /protein_id="BAG42230.1"
FT                   /translation="MAKSRFKSDATEAIHSAASGLYRANLIDKKTMREYDALCIEAAPQ
FT                   FAPEAIARIRKSVNVSQSVFALYLNTTTSTIRQWEQGDKRPSGIAARMLQIVEKHGLEV
FT                   FS"
FT   CDS_pept        complement(264608..266425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BMULJ_00256"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COG0449: Glucosamine 6-phosphate synthetase,
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains, Ralstonia solanacearum"
FT                   /note="KEGG, K00820"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00256"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42231"
FT                   /db_xref="GOA:A0A0H3KBQ2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBQ2"
FT                   /protein_id="BAG42231.1"
FT                   /translation="MCGIVGAVAQRNIVPVLIEGLRRLEYRGYDSCGVAVLEADAPKRA
FT                   RSVARVADLDAQVRDSHLEGTTGIAHTRWATHGAPVTHNAHPIFSSGALALVHNGIIEN
FT                   FEPLRDALRAKGYEFVSQTDTEVIAHLVHSLYRGDLFDAVREAVQQLHGAYAIAVIHKD
FT                   QPHTVVGARQGSPLVVGHGDGENFVASDALALAGSTDRFTFLEEGDVCELSLDGVKIVD
FT                   RHGALAQREIRVVSAYGGAVELGPYRHFMQKEIFEQPRAIGDTVPQTDAFDATLFGDAA
FT                   PAAFAQIDSLLILACGTSYYSGLTAKYWLESIAKIPTQVEIASEYRYRDSVPNPRQLVL
FT                   VISQSGETADTLAALKHAQALGHTHTLAICNVATSAMVRLTGMQFLTHAGTEIGVASTK
FT                   AFTTQLVALFVLAATLGKLRGHVDAAQETEYLKQLRHLPAALNSVLALEPQIIAWADEF
FT                   ARKENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVTEAMPVITVA
FT                   PNDTLLEKLKSNMQEVRARGGELYVFADADTQIVNGDGLHVIRMPEHYGQLSPILHVVP
FT                   LQLLAYHTACARGTDVDKPRNLAKSVTVE"
FT   CDS_pept        complement(266479..267840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BMULJ_00257"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="COG1207: N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains), Ralstonia solanacearum"
FT                   /note="KEGG, K00972"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00257"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42232"
FT                   /db_xref="GOA:A9AKB1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AKB1"
FT                   /protein_id="BAG42232.1"
FT                   /translation="MNIVILAAGTGKRMRSALPKVLHPVAGRPLLSHVIATARTLQPSR
FT                   LVVVVGHGAEQVRAAVAAPDIQFAVQAEQLGTGHAVRQALPLLDPAQPTLVLYGDVPLT
FT                   RASTLQRLVDAARDGRYGILTVTLDDPTGYGRIVRDASGFVTRIVEQKDATPDELKIAE
FT                   INTGIIVTPTAQLAMWLGALKNENAQGEYYLTDVVELAIEAGFEIVTAQPDEEWETLGV
FT                   NSKAQLAELERIHQRNVADALLADGVTLADPARIDVRGTLRCGRDVSIDVNCVFEGDVT
FT                   LADNVTIGANCVIRNASVGAGTRIDAFTHIDGAELGAHTVIGPYARLRPGAQLADEAHV
FT                   GNFVEVKNAVIGHGSKANHLTYIGDADIGARVNIGAGTITCNYDGANKFRTVIEDDVFV
FT                   GSDTQLVAPVHVGRGVTIAAGTTVWKDVADGVLALNEKTQTAKSGYVRPVKKKS"
FT   CDS_pept        complement(267977..268972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00258"
FT                   /product="predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /note="COG0037: Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control, Neisseria meningitidis
FT                   Z2491"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00258"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42233"
FT                   /db_xref="GOA:A9AKB0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AKB0"
FT                   /protein_id="BAG42233.1"
FT                   /translation="MNAPQTNDTAADVATIEASAAEVGRRALTRREQKEAYEDNKLFKR
FT                   IVRQVGQAIGDYNMIEDGDKVMVCLSGGKDSYAMLDILLRLRERAPIDFDIVAVNLDQK
FT                   QPGFPEHVLPEYLTQIGVPFHIENQDTYSIVKRLVPEGKTTCSLCSRLRRGILYRVAGE
FT                   LGATKIALGHHRDDIVQTLLLNMFYGGKLKGMPPKLQSDDGKNVVIRPLAYVKETDLEK
FT                   YAELREFPIIPCNLCGSQPNLKRAEMKALIREWDKRFPGRVDNMFNALANVVPSHLMDT
FT                   TLFPFASLRATGQADPQGDIAFDEEPCASGDETAAPGGAKPISIVQFDDL"
FT   CDS_pept        complement(268969..269373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BMULJ_00259"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="COG1539: Dihydroneopterin aldolase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01633"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00259"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42234"
FT                   /db_xref="GOA:A0A0H3KBE1"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBE1"
FT                   /protein_id="BAG42234.1"
FT                   /translation="MFSALLHPRLADCRRLYLRDYEVHINIGAFEHEKRGEQRVVINVD
FT                   LFVPLARSTPVDDRLHEVVDYDLMKQSVAQCVARGHIHLQETLCDAIAAHLLAHDAVRA
FT                   VRVCTEKPDAYPDCDAVGVEVFRIKDEERA"
FT   CDS_pept        complement(269450..270193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00260"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42235"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KG56"
FT                   /protein_id="BAG42235.1"
FT                   /translation="MTVSADTPAARVALVAGAFDRRADPAPLGRALAAAFARRGWDVAL
FT                   QCGPGAARADADAAAADVAALGRRAAVLDADLALEADAATLIAACGAALGRPACAVFVS
FT                   ACAGADDAQTIDGATLAAALARNVTAPLALARALADATPDAARDDEALRACAIHVLDQA
FT                   LFHPAPAQLSHALMQAALSRATSALALALAPKVRVAALVRGRAPHADDIAAAACYLANA
FT                   PGVTGATLTVDGGEHLVPPADGPNE"
FT   CDS_pept        270207..271397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00261"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1565: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00261"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42236"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBP2"
FT                   /protein_id="BAG42236.1"
FT                   /translation="MNPKAHEPASLPAPGPDALAQSETLAAQLRAEIAAAGGWLPFSRF
FT                   MERALYAPGLGYYSGGARKFGRRADDGSDFVTAPELSPLFAQTLAQPVADALAASGTRS
FT                   VMEFGAGTGKLAAGLLAALDALGAALDEYLIVDLSGELRARQRDTIAAAAPTLAAKVRW
FT                   LDALPERFEGVVIGNEVLDAMPVRLFAKAGDAWRERGVALDAQQAFVFDDRAVAPADVP
FT                   PALAGLDVDDGYVTETHEAALAFTRTVCTMLARGAVLLIDYGFPAHEYYHPQRDRGTLM
FT                   CHYRHHAHDDPFLYPGLQDITAHVEFTGIYEAGIAAGADLLGYTSQARFLLNAGITDAL
FT                   AAIDPSDVTQFLPAANAVQKLISEAEMGELFKVIAFSRGIDGTLDAFVRGDRSHAL"
FT   CDS_pept        271408..271602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00262"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00262"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42237"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK13"
FT                   /protein_id="BAG42237.1"
FT                   /translation="MLRWLMASFVAVMILTRCWPWLGKLGIGRLPGDVTLTLGGRRYPF
FT                   PFMSTLVVTMLVSTLARLL"
FT   CDS_pept        complement(271669..271890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00263"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42238"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBQ7"
FT                   /protein_id="BAG42238.1"
FT                   /translation="MDTNTFTKGIYTAKAHTRKADGGQFEGYVILTRDEGDTPDNTVYE
FT                   VGATSSSEEEAFEEAKALAHRILGEIEL"
FT   CDS_pept        complement(271982..272890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scrK"
FT                   /locus_tag="BMULJ_00264"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="COG0524: Sugar kinases, ribokinase family,
FT                   Deinococcus radiodurans"
FT                   /note="KEGG, K00847"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00264"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42239"
FT                   /db_xref="GOA:A0A0H3KBE6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBE6"
FT                   /protein_id="BAG42239.1"
FT                   /translation="MSGGTFPAFVSAGDILTDMVRAGDAQWTSVPGGAGWNVARAVARL
FT                   GVPSALAGAIGEDCFSDVLWHTSEAAGLDLRFLQRVARPPLLAIVHETRPPAYFFIGEA
FT                   SADLAFDPARLPAGWAEHVQWAHFGCISLVREPLAGTLVALAADLHARGVKISFDPNVR
FT                   NLMTAAYRPTLEKMARLADLIKVSDEDLRHLFGSDGDDAIDAVRALNPRAAVLVTRGAQ
FT                   PATLYADGERYEARPPRVEVADTVGAGDASIGGMLFSLMAAPQRAWREHLAFALAAGAA
FT                   ACRHTGAHAPTLDEVVALLER"
FT   CDS_pept        complement(272887..274167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00265"
FT                   /product="putative N-acylglucosamine 2-epimerase family
FT                   protein"
FT                   /note="COG2942: N-acyl-D-glucosamine 2-epimerase, Xylella
FT                   fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00265"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42240"
FT                   /db_xref="GOA:A0A0H3KGB4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGB4"
FT                   /protein_id="BAG42240.1"
FT                   /translation="MNMPPVQSCPATPAAHAQPAPFVANFRDPSFLLSHVEDTLRFYAP
FT                   NVLDPTGGFYHYFRDDGSVYNRTSRHLVSSCRFVFNYAMAYRHFGDPRHLDYARHGLRF
FT                   LRDAHWDEQLQGYDWELEWRDGAKRATLDGTRHCYGLAFVLLAAAHATMAGIEEARPLI
FT                   AATYELAEHRFWDPAAGLYADDATPNWIVSTYRGQNANMHMTEALLAAYEATGHLTYLD
FT                   RAEKVATNITQRQAALAGGLVWEHYHADWSVDWDYNKEDSSNIFRPWGFQPGHQTEWAK
FT                   LLLILERHRPLDWLVPRAAELFDAALTHAWDTDHGGLCYGFGPDFTICDHNKYFWVQAE
FT                   TFAAAAMLGARTGAERFWDWYDEIWRYSWAHFVDHRYGAWYRILTCDNRKYSDEKSPAG
FT                   KTDYHTMGACYDVLATLARTARSEQAQ"
FT   CDS_pept        complement(274164..275183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00266"
FT                   /product="LacI family transcriptional regulator"
FT                   /note="COG1609: Transcriptional regulators, Caulobacter
FT                   vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00266"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42241"
FT                   /db_xref="GOA:A0A0H3KBP5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBP5"
FT                   /protein_id="BAG42241.1"
FT                   /translation="MGTTIRDVARAAEVSIGTVSRALKNQPGLSETTRARIVEIAQRLG
FT                   YDHAQLRPRIRRLTFLLHRQHNRFPASPFFSHVLHGVEDACRERGIVPTLLTVGPNDDV
FT                   LRQMRPHAPDAIAVAGFIEPETIEALAATGRPLVLIDLWAPGLRSVNIDNATGAALAMR
FT                   HLLATGRSRIAFIGGSPAHYSIAQRAIGYRRAFFEAGRLFDPAYEVTIDAGLDPDTGAT
FT                   RAMQQLLDAPGPRPDAVFAYNDAAALAAQRVCLARGLRIPDDIAIVGFDDIPAAAHANP
FT                   PLTTLAVDKEALGRRGVELLLAESPEHTEISLPVELIVRASSQSAGSPALDTATVTES"
FT   CDS_pept        complement(275966..277807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00267"
FT                   /product="signal transduction GGDEF/EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00267"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42242"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK16"
FT                   /protein_id="BAG42242.1"
FT                   /translation="MPAPPPASAAAGSTSRLIADRALAAVFQPIVDLGSGTVIGYEGLI
FT                   RGPHGTELEPPAALFAQAAREGETLALEQAAALTCLDAFAALGCDGKLFLNFSAGTILQ
FT                   LARERERARMLLGRARVGAERIVIELTEQNATTDVAHIVPAIASLRDAGIQFALDDYGT
FT                   ANASMNLWLRLHPDVVKIDRFFIHDIARDPLKFEAVKAMQHFAHASGAKLIAEGIENEC
FT                   DLIVVRDMGICCVQGFLLGRPNARPSRVVAAAAREAIRTPHIAVFPGATRIARPAGTIA
FT                   SKMLVPAPALPRDATSNDVLDLFNRMPDLHAVALVERGRPVALVNRRGFIDRFALPYHR
FT                   EVFGKKPCLQFANDAPLMIENSTTFEQLAMLLASHDQRYLADGFVITEHGRYVGLGTGE
FT                   SLVRAVTEMRIEAARYANPLTFLPGNIPISAHIDRLLARDAGFHACYVDLNQFKPFNDQ
FT                   YGYWQGDEVLKFAATVLAGVCDPQRDFLGHVGGDDFLVLFQRDDWRSRALAAIERFNQG
FT                   AQLFYTQADRQAGGLRGEDRHGNPAFFGFVTMAIGAVSVPAGAHGAKRYGSDEIASVAA
FT                   LAKRRAKQQPGGLAVVDLDAGRAALRERGEPPGASAG"
FT   CDS_pept        complement(278060..278185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00268"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00268"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42243"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBR3"
FT                   /protein_id="BAG42243.1"
FT                   /translation="MREVRLMACGRSRGAESARPEPSRDEGDASAVRRMLSAGKR"
FT   CDS_pept        complement(278312..279343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00269"
FT                   /product="predicted Na+-dependent transporter"
FT                   /note="COG0385: Predicted Na+-dependent transporter,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00269"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42244"
FT                   /db_xref="GOA:A0A0H3KBE7"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBE7"
FT                   /protein_id="BAG42244.1"
FT                   /translation="MARPRFLPDNFTLALVGTVVLASLLPCRGPAAHAFNWATNIAVGL
FT                   LFFLHGAKLSREAVIAGATHWRLHAVVLLSTFALFPLLGLALKPVLQPLVTPTLYAGVL
FT                   FLCTLPSTVQSSIAFTSIAKGNVPAAVCAASASSLLGIFVTPALVGLMITSQSAAAASP
FT                   WSTVGSIVMQLLVPFIAGQLLRPVIGGWIDRNRGVLRFVDQGSILLVVYVAFSEAVNQG
FT                   LWHQIPAHALAGLVAVNLVLLAIALLLTAFVSKRLGFNRADQITIIFCGSKKSLAAGVP
FT                   MAKVIFSAQAVGAIVLPLMLFHQIQLMACAALAQRWGARDMSGERDEGDASAAPRTLSA
FT                   GKR"
FT   CDS_pept        279742..280173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00270"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42245"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGB7"
FT                   /protein_id="BAG42245.1"
FT                   /translation="MAGALGALLMPLALAQPPHGSHGFGGGDMHAYGQPAGGAPVWRRA
FT                   APLAPAPGPGVKAGGSRWGLRPTPSYGHYAAQSPYRPISAEVRQMTRPSGTGNMPLRAG
FT                   SIRADVARYNEERGGRPMPPPRSQEEPAHSPFFSPFYRN"
FT   CDS_pept        280519..281595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00271"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00271"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42246"
FT                   /db_xref="GOA:A0A0H3KBP8"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBP8"
FT                   /protein_id="BAG42246.1"
FT                   /translation="MKAFARRASRTSVKLIAAAACVAAAAPVHAQSSVSLYGQVDEWIG
FT                   ATKFPGGDRAWNVSGGGMSTSYWGMHGAEDLGGGYKAIFTLESFFRAQNGQYGRFTGDT
FT                   FFARNAYVGISSPYGTVTAGRLTTHLFLSTILFNPFYDSYTFSPMVYHVFLGLGTFPTY
FT                   PSDQGAVGDSGWNNAVSYTSPSFGGLNFGAMYALGNQAGDNGSKKWSAQFNYANGPFAA
FT                   TAVYQYVNFNNGPRDLSALVAGMKSQGIALVGATYDLKYVKLFGQYMYTKNDQVAGSWH
FT                   VNTAQGGVSVPIGVGNAMASYAYSRDGGGLDQTRQTWAVGYDYPLSKRTDIYAAYMNDH
FT                   ISGLSTGNTFGAGIRAKF"
FT   CDS_pept        281758..282720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00272"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00272"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42247"
FT                   /db_xref="GOA:A0A0H3KK20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK20"
FT                   /protein_id="BAG42247.1"
FT                   /translation="MDTLVSMNVFRYVVEVGSFVGAAERMQMSAAMASKHVMHLEQQLG
FT                   ARLLHRTTRRVAPTEAGREYYERLVQALSELDEAGQAVGAASVVPQGRLRVTSLSAFGL
FT                   RHVMQAVTDYAERFPDVTVEITLSDRVVELIDEGYDVAVRAAPSGLKSSSLVARQIATA
FT                   HILLVASPEYLKKHGTPETLADLAQHNYLRRDSNASTLDAMLNDAAAASRVALNGNLIV
FT                   NHLEGLRAAVLAGAGIALLGTEVVGDDIEAGRLVPVLVDAVPPRELPIYAVYASRRHVS
FT                   AKVRSFVDFLAARFEGQSLCPSIESRSHVLPMSRMKRTG"
FT   CDS_pept        complement(282844..283803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00273"
FT                   /product="2-nitropropane dioxygenase"
FT                   /EC_number="1.13.12.16"
FT                   /note="COG2070: Dioxygenases related to 2-nitropropane
FT                   dioxygenase, Ralstonia solanacearum"
FT                   /note="KEGG, K00459"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00273"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42248"
FT                   /db_xref="GOA:A0A0H3KBR8"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBR8"
FT                   /protein_id="BAG42248.1"
FT                   /translation="MALPAVLQNLTLPVIASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQIQSELAAYKSSHPDAVIGPIAVNQIVHQSNVRLEHDVRVCVDHKVPI
FT                   FITSLRAPAREIVDAVHSYGGIVLHDVINLRHAQKALEAGVDGLILVAAGAGGHAGTTS
FT                   PFALVGEVRRIFDGPIVLSGAIANGGSILAAQAMGADLAYMGTRFIATQEAHAVEDYKR
FT                   AILNAKSSDIIYTNLFTGVHGNYIRESIEKAGLDPEALPESDKSKMNFGGDKAKAWKDI
FT                   WGAGQGVGLMDDLPSVGALVERLKSEYDAAKARLGVTR"
FT   CDS_pept        284067..284963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00274"
FT                   /product="haloacetate dehalogenase"
FT                   /EC_number="3.8.1.3"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01561"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00274"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42249"
FT                   /db_xref="GOA:A0A0H3KBF0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBF0"
FT                   /protein_id="BAG42249.1"
FT                   /translation="MSFDAFAPFRVTVQDTEIFGVKGGAGPPLLLLHGHPQTHVIWHRV
FT                   AATLANHFTVIATDLRGYGASGKPPSDAQHAPYSKRAMAADQVAVMRHFGFAQFHVCAH
FT                   DRGARVAHRLALDHPSAVERMMLLDIAPTLAMYEQTDRAFATAYFHWFFLIQPEPLPET
FT                   LIEGHTDAYIERVMGNRSAGLAPFAPHALDAYRTALAQPGAVHAMCEDYRASATIDLEH
FT                   DRADLERGNKIACPLRVLWGANGVVARCFEPLDEWRRVARDVSGRALDCGHYIPEEAPV
FT                   ALIDEMLAFFEAREPAV"
FT   CDS_pept        complement(285009..285500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00275"
FT                   /product="Lrp/AsnC family leucine-responsive regulatory
FT                   protein"
FT                   /note="COG1522: Transcriptional regulators, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K03719"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00275"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42250"
FT                   /db_xref="GOA:A0A0H3KGC1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGC1"
FT                   /protein_id="BAG42250.1"
FT                   /translation="MPKRLSPPAVASLDAIDRAIVAALADDARIATSALARQIGLSAPA
FT                   TADRVRRLEAQGVIAGFTVELDPRALGYTLQAIVRVKPLPGQLHLVEELLRRIPEFVEC
FT                   DKVTGDDCFVCRLYLRTIEHLDGILSKVTERAETSTAIVKSTPVPRRLPPLVEEEESRR
FT                   "
FT   CDS_pept        285615..286520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00276"
FT                   /product="drug/metabolite transporter (DMT) superfamily
FT                   permease"
FT                   /note="COG0697: Permeases of the drug/metabolite
FT                   transporter (DMT) superfamily, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00276"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42251"
FT                   /db_xref="GOA:A0A0H3KBQ3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBQ3"
FT                   /protein_id="BAG42251.1"
FT                   /translation="MASNEIRRGAAEMVVAMVMSGSIGWLVMSSQQPLANVVFFRCVFG
FT                   AATLAIVCAALGLLRRALFSPRMLILTALGSIAIVANWLLLFAAYSRASISMATAVYNT
FT                   QPFMLVALGAIVFRERITASTLVWLALAFVGLVCVVRVEPAVLAVPGEYLEGVALALGA
FT                   AFLYAVSSIITKHLKGTPPHLLALLQVALGIVLLAPFAHFDTPPATPAQWAHLVVLGIV
FT                   NTGVMYVLLYGAIQKLPTAMTGALSFVYPIVAIVVDRIAFGQTLAWAQVFGALLILLAA
FT                   AGVNLGWRIVPTRRRAPAGN"
FT   CDS_pept        complement(286729..286935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00277"
FT                   /product="predicted Fe-S protein"
FT                   /note="KEGG, K06938"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00277"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42252"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK25"
FT                   /protein_id="BAG42252.1"
FT                   /translation="MSDAPVPVGVVGSPCTDVCRIDPRTDWCAGCLRTRDEIRAWRSAD
FT                   DDARRVVLARLDARRRMLARSGE"
FT   CDS_pept        complement(286932..287438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00278"
FT                   /product="prolyl-tRNA synthetase-like domain protein"
FT                   /note="COG2606: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00278"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42253"
FT                   /db_xref="GOA:A0A0H3KBS3"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBS3"
FT                   /protein_id="BAG42253.1"
FT                   /translation="MTTPASLDTLPDSARRVALLLRERGHTKDIVMLAETGKTSAEAAA
FT                   GLGCSVAQIAKSILFRRQADGAPVLVVASGANRVDERKVAAQVGPVGRADAKFVRDNTG
FT                   YAIGGVCPIGHLVEPVTLIDADLLALDSLWAAAGHPHAVFNLSPQELLALTGAPVADVA
FT                   LRDPA"
FT   CDS_pept        complement(287473..288405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgL"
FT                   /locus_tag="BMULJ_00279"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="COG0119: Isopropylmalate/homocitrate/citramalate
FT                   synthases, Ralstonia solanacearum"
FT                   /note="KEGG, K01640"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00279"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42254"
FT                   /db_xref="GOA:A0A0H3KBF2"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBF2"
FT                   /protein_id="BAG42254.1"
FT                   /translation="MTFPTAVKIVEVGPRDGLQNEKTFVPTDVKIALVDKLSRAGFRNI
FT                   EAASFVSPKWVPQMADGADVMAGIERRAGTVYSVLTPNLKGFENALAARADEVVIFGAA
FT                   SEAFSQRNINCSIAESIARFEPVAKAAKDAGLRLRGSVSCALGCPYQGEVPVASVVDVV
FT                   ERFAALGCDEIDIADTIGVGTPKRTREVLDAVARVFPRERLSGHFHDTYGQALANIYAA
FT                   LFEGIEIFHASVAGLGGCPYAKGATGNVATEDVLYLMQGLGIDTGIDLAQVVAAGDFIS
FT                   NAIGRANVSRAGRALLAKAQSAADAPSCA"
FT   CDS_pept        complement(288436..289377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="BMULJ_00280"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COG0111: Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases, Ralstonia solanacearum"
FT                   /note="KEGG, K00058"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42255"
FT                   /db_xref="GOA:A0A0H3KGC6"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGC6"
FT                   /protein_id="BAG42255.1"
FT                   /translation="MKILFHSPHQDAAAWRDAFARVLPEAELRAWQPGDTAAADYALVW
FT                   RAPPAFFAPRDGLRAIFNLGAGVDALLALERAHPGTLPRHVPLVRLEDSGMAQQMIEYV
FT                   THAVLRYLRRFDEYDALQRERRWQVLDAHPRASFVVAVLGLGVLGTQVARALAALGLPV
FT                   RGYSRSAKRIDGIETFAGDDALDACLDGAKVLVNLLPSTPATDGLLCARTFARLAPGAY
FT                   LINVARGAHLVEADLLDALASGRIAAATLDVFQHEPLPADHPFWQTPRITITPHSSAET
FT                   LRDEAVEQIAAKIRAFERGEPVGGIVDYARGY"
FT   CDS_pept        complement(289382..289819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00281"
FT                   /product="glyoxalase/bleomycin resistance protein"
FT                   /note="COG3565: Predicted dioxygenase of extradiol
FT                   dioxygenase family, Pseudomonas aeruginosa"
FT                   /note="KEGG, K06991"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00281"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42256"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBQ6"
FT                   /protein_id="BAG42256.1"
FT                   /translation="MSATPSRALRPFHLAFPVSSLADARAFYGGLLGCPEGRSADHWVD
FT                   FDFFGHQLVAHLAPDETGASAVNAVDGDDVPVRHFGVVLSMDEWHALADRLRDAQIRFV
FT                   IEPHVRFKGEVGEQATMFFLDPCGNALEFKAFADIGQLFAK"
FT   CDS_pept        290017..290682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00282"
FT                   /product="predicted esterase of the alpha/beta hydrolase
FT                   fold"
FT                   /note="COG3545: Predicted esterase of the alpha/beta
FT                   hydrolase fold, Ralstonia solanacearum"
FT                   /note="KEGG, K07002"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00282"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42257"
FT                   /db_xref="GOA:A0A0H3KK28"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK28"
FT                   /protein_id="BAG42257.1"
FT                   /translation="MRGCSKSAWPPRLVTVPGLHGSEGAHWQTWLERQFPRALRVEQDD
FT                   WDAPDLARWAQAVRALLERERGPFVLAAHSFGCLAAAHALAQWPLAADVAGVLLVAPAS
FT                   PRKFTFAGPFDARRLPVPSIVIGSETDPWMPLADARTLAQQLGSAFVNLGDAGHINTAA
FT                   GFGPWPRAKYFVDTLVHCAAPLRFRDAADDAGDVSAVLSETDFSLERSVVRLEQSLSA"
FT   CDS_pept        complement(291664..293781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcC"
FT                   /locus_tag="BMULJ_00283"
FT                   /product="phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="COG3511: Phospholipase C, Ralstonia solanacearum"
FT                   /note="KEGG, K01114"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00283"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42258"
FT                   /db_xref="GOA:A0A0H3KBS8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBS8"
FT                   /protein_id="BAG42258.1"
FT                   /translation="MTSSSRRRFLHTVAQSAGAAVALNAFPESIRRALAIPAARGTGTI
FT                   RDVEHIVVFMQENRSFDHYFGHLRGVRGYNDRFPIPLPNGKPVWYQPSKADPSRAVLPF
FT                   RLNTLTTSAQCVGDLDHSWYKTHAAIDGGRYDQWPANKTDMTMGYHVREDIPFHYALAD
FT                   AFTVCDHYFCSLPGPTHPNRAYLMTGTVDPTGKFGGPLLDNNDYVDGDGPPAYQLLSWT
FT                   TFPERLEARGVSWQIYQQGTTGSDPYNGNYGTNILQNFANFINAQPGSSLYQRAQTVRT
FT                   LDDLKADVLAGRLPQVSWLLPPAAFSEHPKYTPAYGANYTSQILDALTANPDVWRKTVL
FT                   FIMYDENDGFFDHIVPPQPPTSDAQGASTVTTDGELHTVVNPGRGGSYTADGLPYGLGP
FT                   RVPMTIVSPWTKGGFVCSQVFDHTSVIRFIGARFGVDEPNITPWRRTVCGDLTSAFDFR
FT                   SSDATFPPLPDTSQYRSLADQQCTSQPAPTVPATPSPIDPQEPGVRPARALPYELHVNA
FT                   TLRGAHTLRIEFANRGDQGAHFYVYGTNRTDGPWRYTVGARRVLHAEFDLTVTNGAYAF
FT                   SVYGPNGFVRIFAGDVSAAAARRRNDAQPEVKAGYDVANGNLYLKLHNHGTARVTLTLT
FT                   DNAYGAPSREVTLHGGDERVEQWLLASSHQWYDVTVSDGANGTFSRRFAGHVENGRPSY
FT                   SDPAAVRPVAA"
FT   CDS_pept        complement(293826..294104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00284"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBF7"
FT                   /protein_id="BAG42259.1"
FT                   /translation="MHRVAFVVVLCVAALAACSDDAPHDTQAADASQQAGASAGSANAF
FT                   NGGASANVAASAAAPLAPPVVHYPPDDDDAQAATDARASDAATAPSH"
FT   CDS_pept        294640..295389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00285"
FT                   /product="carbon-monoxide dehydrogenase small subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="COG2080: Aerobic-type carbon monoxide dehydrogenase,
FT                   small subunit CoxS/CutS homologs, Sinorhizobium meliloti"
FT                   /note="KEGG, K03518"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00285"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42260"
FT                   /db_xref="GOA:A0A0H3KGD1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGD1"
FT                   /protein_id="BAG42260.1"
FT                   /translation="MSTDRPLSPSSAQGGACSSAAPCQHGATPPVHDTPSSAARRRFLQ
FT                   SAAAAATVGAAPAMHAQPAHASAASAPPSRAAVPARPVHLDINGHAYTLQLEPRVTLLD
FT                   ALREYAGLTGTKKGCDRGQCGACTVLVDGRRINACLTLAVMHEGQRITTVEGLARDGVL
FT                   SPVQRAFVEHDAFQCGYCTPGQLCSATALLDEFASGAASAATADVRQRLAQLSDDEIRE
FT                   RMSGNLCRCGAYSNIVAAVRAAHARNA"
FT   CDS_pept        295405..296406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxM"
FT                   /locus_tag="BMULJ_00286"
FT                   /product="aerobic-type carbon monoxide dehydrogenase medium
FT                   subunit"
FT                   /note="COG1319: Aerobic-type carbon monoxide dehydrogenase,
FT                   middle subunit CoxM/CutM homologs, Sinorhizobium meliloti"
FT                   /note="CoxM protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00286"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42261"
FT                   /db_xref="GOA:A0A0H3KBR0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBR0"
FT                   /protein_id="BAG42261.1"
FT                   /translation="MEAISYERATDVAGAVRAAQQPGAAFIGGGTNLLDLMKGGVARPV
FT                   TLIDVTHIAGLDTVDALPDGGLRIGALVRNSDAADHPRVRSAYPLLSQALLAGASAQLR
FT                   NMATVGGNLMQRTRCPYFYDPAFAQCNKRDPGSGCAAIGGDNRMHAILGASAHCVAVNP
FT                   SDMSVALAALDAVVRTSGPRGERQIPFASFHRLPGDRPDLDTTLEPGELITAVDLPPPQ
FT                   FADHAHYVKVRDRASYAFALVSVAAALRMDGARIEHARIALGGVAHKPLRATAAEQHLA
FT                   GREPTDATLREAAALALRDAQPLDGNAFKVALAQRAIVRAVKTAARSTGGHA"
FT   CDS_pept        296403..298625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxL"
FT                   /locus_tag="BMULJ_00287"
FT                   /product="aerobic-type carbon monoxide dehydrogenase large
FT                   subunit"
FT                   /note="COG1529: Aerobic-type carbon monoxide dehydrogenase,
FT                   large subunit CoxL/CutL homologs, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00287"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42262"
FT                   /db_xref="GOA:A0A0H3KK31"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK31"
FT                   /protein_id="BAG42262.1"
FT                   /translation="MNTLTGQPLDRVDGVLKVTGGARYAAEFDDARLAHAVLVTSTIAS
FT                   GRIESIDTARARAMPGVLLVITHENALRLPNAGRPPLSPPAGRRLTLLQDDAVRYSNEP
FT                   VAVVVADALEHATDAAQAVRVHYRASEAALDFAREKRRARVPPKQQGREMDTQRGDVDA
FT                   GLRAGDVHVDATYTTPMQHHNPIEPHATMARWDGPTLTLHDATQGVTGTRNAVAAVFGI
FT                   APEHVRVISPFLGGGFGCKGSSWSHVSLCAMAAKQTGRPVRLVLTRPQMFGPVGGRPLT
FT                   EQRIVLAARRDGTLTAMRHDSIVTTSTFEDWTEMCGMPSRIMYAVPNQATTHRIVSLNV
FT                   GTPTFMRAPGEASGSFALESAMDELAWQLGMDPVALRLANYAQVDPEDGKPWSSNALRE
FT                   CYRVGAQRFGWSRRTQAPRTLRDGDTLIGLGMAAATYPGNRSEASARARILPDGTAEVA
FT                   SGTQDIGTGTYTVMTQVAADALGFAPQNVRFSLGDSGLPGAPVSGGSQSAASVAPAVRE
FT                   AALQARAKLIAMAIADAGSPLHGAAADDVTVDDGWVVHRADRSRRDPAAAVIARAGGQP
FT                   IEALATTKQGDEKQRYAFHSFGAVFAEVHVDAELGTIRVPRIVGVYSVGALLNAKTARS
FT                   QLLGGMVWGLGTALEEGSHLDLRAGRFTNANLAEYHVPVNADIGELDVTFVDEHDPHFN
FT                   PLGIRGIGEIGITGVPAAIANAVYHATGVRVRDLPITLDKVMAAST"
FT   CDS_pept        complement(298634..299554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00288"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00288"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42263"
FT                   /db_xref="GOA:A0A0H3KBT3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBT3"
FT                   /protein_id="BAG42263.1"
FT                   /translation="MRRIHLPPLQTLRAFEAAVRLQSFTRAADELALTQGAVSQHIRAL
FT                   EAQLGYPLFTRERGGATPSHAAHALALQVRQGLSVLERAFEPTHAVRARPRDGDVTLDV
FT                   SVLPSVAERWLAPRLPRFAAAHPQISIVLHPDTALAPLRKRDRIDVALRYGPGTWPGVV
FT                   AEKLMNETVFPVASPAYRNRDGIAPRAPADLVRATLLRHPAQPWEPWFQAARLDLTESA
FT                   RAPRFADANALIDAVLKGRGVALARRSLIERELASGALVRVSTVRITDVYAHYVVWRPG
FT                   HPREAAIRTWLDWLRSEVRRRTPRR"
FT   CDS_pept        299666..300304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BMULJ_00289"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="COG0625: Glutathione S-transferase, Sinorhizobium
FT                   meliloti"
FT                   /note="KEGG, K00799"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00289"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42264"
FT                   /db_xref="GOA:A0A0H3KBF8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBF8"
FT                   /protein_id="BAG42264.1"
FT                   /translation="MNAYRLYLSPGACSLAAHIALEETGAPFDVEIVQVRKQENLTDGY
FT                   LAINPKARVPVLAIPGESRVLTETPAILTYLARRHPDAQLLPLDDALREARCHEWLAWL
FT                   VGWVHGVGYGALWRPGRFVGDPALHGAISEHGRGVIDAANATIEAALADGRTWAEPGGH
FT                   SIVDPFLLVLYRWGGAIGFDMTRHRAWTAHAQREAERPAARRALAREAA"
FT   CDS_pept        300436..302637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfuA"
FT                   /locus_tag="BMULJ_00290"
FT                   /product="outer membrane receptor for monomeric catechols"
FT                   /note="COG4774: Outer membrane receptor for monomeric
FT                   catechols, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42265"
FT                   /db_xref="GOA:A0A0H3KGD4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGD4"
FT                   /protein_id="BAG42265.1"
FT                   /translation="MTSPIQSSATPPRRPAASVAFAMMTCAAAPAAADDTDPRRAPHLS
FT                   PIVVQGERDTGSRVDRSGSAKYATPLLDVPQTITVVPREVLDEQQVTSLREALSNVAGI
FT                   TFNAGEGGGGSGDMLLIRGFSAHANLQLDGLRDSAQNNRSDLFNIDAVEVIKGPNSVFG
FT                   GAGTTGGSVNLISKAPQRKAFIEAGTVLGTSGYRRATLDANRPLPGSDGSSVFRLNAMA
FT                   HVNDVPGRNDIRKRRWGVAPSLGFGLGTPTRVTLGYFHQYDHNLPDYGLPARNGQVLGG
FT                   VARDAYFGWRNLDRERIESNTFTVKAEHDVSPQLKLQNLSRYAHLNRDTVVSASHANLD
FT                   GMPPGRYKPAGPQGYGRDASTAMWMNQTNATGEFSTFGVGHTLVAGFEISRETYARSTY
FT                   SHGLARHFPKNGYALAAPPGYWTGPARRENTARTDTALDVKALYAFDTISFGRYWDLDV
FT                   GLRHDWIDGWARNTPAGKPTERGETSDRHLSTRAGLVFKPTDNGRLYAAYGTSFNPSAE
FT                   FLVTTGSGVTAASGGLAPEKNESVELGAKWEGLAGLAVNGALFQTYKHHARERMSDGTY
FT                   LLAGKQRVRGVELGAAGKITPKWDLFANYTYLASATLDSPSSPRRNGKALGNTPRHAFN
FT                   LWTTYRLPAGWTIGYGSHFVGRRNVTSEGDGTLGAYWVHNLMASYDVNRRLRFQLNVDN
FT                   LFDRAYVERVRQQPGNASRSSAVEFGDGRAAMLSAVYTF"
FT   CDS_pept        complement(302647..303900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00291"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00291"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42266"
FT                   /db_xref="GOA:A0A0H3KBR4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBR4"
FT                   /protein_id="BAG42266.1"
FT                   /translation="MERSLALSRSSAERRCAARWLVLAAGVAANMSFSAAAAGIPTTAV
FT                   WMRSAYRLDNGSLGLVLGALGFGVALSELPWGIAADRFGDRRVLLTGLIATAAMLALMA
FT                   VAIVPTPDAVPPLAHIVAMMCGVGLLGGSVNGSSGRAVMRWFGERERGLAMSIRQTAVP
FT                   MGGGVGAALLPWLASHAGFGAVYGTLMLLCAGSAVLTWRWLREPPAAADAAQPHARQPA
FT                   APRATTPLANRAVWRLVIGIGVLCVPQFAVLTFATVFLHDFGRLGVAGISAAMVALQLG
FT                   AMAMRVWSGRHTDRHRNRRAYLRGSVLVAGGSFALLAAATAGSPHVPVAAIVAILVFAG
FT                   ICVSAWHGVAYTELATLAGADHAGTALGMANTMVYVGLFLTPLAIPPLLAASTWSVVWL
FT                   AAGACACATLPLFPKRPA"
FT   CDS_pept        303998..305032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00292"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00292"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42267"
FT                   /db_xref="GOA:A0A0H3KK35"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK35"
FT                   /protein_id="BAG42267.1"
FT                   /translation="MVDMTEHEHAIESRGDTTLAQPNFDIAALRSLVAGVDLGSFAKAA
FT                   DRVARSTSAVSAQIRKLEEQAGTPLFVKAGRGLALTDAGEAMLRYARRIVELNDEAAAA
FT                   VRGVNLDGRVRVGLQEDFGEAILPDVLGRFARAHPKVRIDARVSRNADLFDRLEANQLD
FT                   LALVWGDPASAERASRPGIDSETIAHVPMRWIGAAHATQPEFDGGAVPGAQDRAGPRAI
FT                   AATPEPLPLVMFDRPCRFFGAATDALDRAGVPWRVAFTTPSLAGLWAAAAAGLGLTVRS
FT                   HYGLPASVRVLDAAACGLPALPSVPLVLLRRTSSATPTVDRLARIVTQAVREATHPAAA
FT                   ALAA"
FT   CDS_pept        complement(305088..305987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BMULJ_00293"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="COG0329: Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase, Ralstonia solanacearum"
FT                   /note="KEGG, K01714"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00293"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42268"
FT                   /db_xref="GOA:A0A0H3KBT7"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBT7"
FT                   /protein_id="BAG42268.1"
FT                   /translation="MHTSPRFEGIWLPIVTPFHRGDVDHRALARLARHYAAAGIAGFVA
FT                   GATTGEGVLLDAREQDAVFATLRDAVPDRPIVVGLTASATHAAAARARELAALRPDGLL
FT                   VTPPVYVRPTQDGIRRHVEAIVEAADLPVLVYNIPYRTGVNVELDTLQALARDARVAGI
FT                   KECGCTLERMSRLVHETPLAVLSGDDNQNFAALCAGAHGTIASSAHVLPEWHVRMHALL
FT                   RDGRLADARRIAVALQPLVAALFAEPNPAPVKAVLAAQGWCDDGLRLPFVPASDALCAR
FT                   LRTLCAELDAHAPASAMA"
FT   CDS_pept        306426..307445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysP"
FT                   /locus_tag="BMULJ_00294"
FT                   /product="sulfate transport system substrate-binding
FT                   protein"
FT                   /note="COG1613: ABC-type sulfate transport system,
FT                   periplasmic component, Ralstonia solanacearum"
FT                   /note="KEGG, K02048"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00294"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42269"
FT                   /db_xref="GOA:A0A0H3KBG2"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBG2"
FT                   /protein_id="BAG42269.1"
FT                   /translation="MASIKGIGRWLHTGAAAALVAAATVAHADTSILNVSYDVTRELYK
FT                   DINASFAAAYKQKTGETVTIKQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAERGQ
FT                   LLPKDWRARFPDNSSPYSTTMVFLVRKGNPKAIKDWSDLAKPGVQVIIANPKTSGNGRY
FT                   AYLAAWGYQKQKGATDQQALEFEKAIFRNVPVLDSGGRGATTTFTQRGIGDVLVTFENE
FT                   VALMDTGASGAQFDAVYPSASILAEPPVAVVDKVVDKKGTRKVAQAYLDYLYTPEAQEI
FT                   IAQHHLRPRDANVLKKHAAEFKPLKTFSVEQIFGSWANAQKTHFADGGTFDRVIVDRK"
FT   repeat_region   307487..307489
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  307490..308936
FT                   /mobile_element_type="insertion sequence: ISBmu5a"
FT                   /note="IS3 family"
FT   repeat_region   307490..307503
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu5a, terminal inverted repeat"
FT   CDS_pept        307540..308067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00295"
FT                   /product="ISBmu5a transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00295"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42270"
FT                   /db_xref="GOA:A0A0H3KD18"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KD18"
FT                   /protein_id="BAG42270.1"
FT                   /translation="MTKYDERFRRRVVQAYLAGEAGTKTLAHRYGVGSTMVRRWVASYR
FT                   EHGEDGLSKKHSHYDARFKLSVLQRMWRDELSYARVAVVFGIRNERSIPVWERLYHEGG
FT                   IEALMPRRRGRPPKMTTLPPPKPTDDAAQKEPSREELLKEIVYLRAEVAYLKKLDALLQ
FT                   SKKQTAPRKKRK"
FT   CDS_pept        308157..308903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00296"
FT                   /product="ISBmu5a transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00296"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42271"
FT                   /db_xref="GOA:A0A0H3KF33"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KF33"
FT                   /protein_id="BAG42271.1"
FT                   /translation="MDAGDRYAELKVKIRSVYDHHKGRYGYRRITTVIRQAGHAINHKT
FT                   VQRLMGQLQLKSLVRPKRYRSWRGEVGRVAPNLLRRQFDAERPNQKWVTDVTEFNVGGQ
FT                   KLYLSPVMDLYNGEIVAYQMDERPSFELVSGMLKKAVAKLDDEGRPLLHSDQGWQYQMP
FT                   AYRRLLKQHALTQSMSRRGNCLDNAAMESFFGTLKSECYRLARFANVEQLRDALSRYIH
FT                   YYNHERIKLKLNGLSPVQYRTQPSAA"
FT   repeat_region   308924..308936
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu5a, terminal inverted repeat"
FT   repeat_region   308937..308939
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(309015..309629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BMULJ_00297"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="COG0625: Glutathione S-transferase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00799"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00297"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42272"
FT                   /db_xref="GOA:A0A0H3KK39"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK39"
FT                   /protein_id="BAG42272.1"
FT                   /translation="MKLYYWPKTRAFRALWMLEEIGAVYELVPIDLRSHEQGSDAFVQV
FT                   NPMAKLPALDDGSAPFAESGAVLLYLADRCPDAGLGIAPNDPERGRFLQWMFFTPTCLE
FT                   PAMAEKFTGASGNPVAFGWGNITRVQRALAQTLAHSRWLVGDRFTAADLLLASTLKIAF
FT                   DAHLLPHEGVLGDYVARAEDRDGYRRAVAVEQREAARLLHA"
FT   repeat_region   complement(312275..312282)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication. Matches to flanking
FT                   nucleotides of ISBmu12e."
FT   mobile_element  complement(312283..313637)
FT                   /mobile_element_type="insertion sequence: ISBmu12d"
FT                   /note="IS256 family. ISBmu12d and ISBmu12e (chromosome 1,
FT                   location(3134251..3135605)) are the sites for previous
FT                   intra chromosomal rearrangement. The left and right
FT                   flanking 8 nucleotides of ISBmu12d matches to that of
FT                   flanking right and left, respectively, of ISBmu12e. The
FT                   comparative genome analysis of ATCC 17616 with related
FT                   Burkholderia species showed that the rearrangement took
FT                   place recently between the two."
FT   repeat_region   complement(312283..312310)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12d, terminal inverted repeat"
FT   CDS_pept        complement(312322..313581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00298"
FT                   /product="ISBmu12d transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00298"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42273"
FT                   /db_xref="GOA:A0A0H3KBU3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBU3"
FT                   /protein_id="BAG42273.1"
FT                   /translation="MPRKRKEEVTIEPGKGLNLDPELIKQLVPGTLDRATINEQLAALK
FT                   KAIFERALGGELTHHLGYEKGEAKPVGRTNHRNGTSRKRIATDDDLLDVEIPRDREGTF
FT                   DPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDE
FT                   VREWQQRPLEPMYPVVFFDALRVKIRDEGVVRNKAIYLALGVRRDGTRDVLGLWIEQTE
FT                   GAKFWLRVVNDLKLRGVQDILIAVVDGLKGFPEAINTVFPETTVQTCIVHLIRNSLDFA
FT                   SWKDRKSVAAALKEVYRAPSAEAAAVALDAFDTSPWGTKYPPIAALWRRAWDQVIPFYA
FT                   FAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHD
FT                   WKSAMTQFALLYPERFNIGI"
FT   repeat_region   complement(313610..313637)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12d, terminal inverted repeat"
FT   repeat_region   complement(313638..313645)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication. Matches to flanking
FT                   nucleotides of ISBmu12e."
FT   CDS_pept        313951..314259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00299"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42274"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBG4"
FT                   /protein_id="BAG42274.1"
FT                   /translation="MSTITATEVSLKQVFEHPGDFTGWLYLPPTPWTFDTEGVFVEDAK
FT                   DDAVSIAATRPGWQITLNSTTIEEIVINAHDQVDEPSIAQLFDAFVFYLENDEFILL"
FT   CDS_pept        complement(314346..315128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00300"
FT                   /product="putative membrane protein"
FT                   /note="COG3455: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42275"
FT                   /db_xref="GOA:A0A0H3KGE3"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGE3"
FT                   /protein_id="BAG42275.1"
FT                   /translation="MSYAPSLFGDNAPTPVHTPSSTDAAFQARSLLDLLYDGFFMLFLL
FT                   KNGREPESASEFSTRIQEFLSDFERGAKKLNIAAEDVYGAKFAYCAAVDEMVLSSQFKI
FT                   RADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLE
FT                   GPEKLAYLTARLGDEIAHMKGKRAPFAPHWPLPDRIAHRLKREVPVWAIGAVFALVALL
FT                   GYLGLNAYLKGKTLQALAPYSQVIKVGPESANLTISLP"
FT   CDS_pept        complement(315125..316471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00301"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3522: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00301"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42276"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBS2"
FT                   /protein_id="BAG42276.1"
FT                   /translation="MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGL
FT                   RTLRIDHDALGSNVLRVAELALVFPDGTLYAAPQGDDLPPPIALDTLPDGINEFVFYLA
FT                   LHPLRENGTNYSDDPAAGFTTRFVSQQTSVADNFTDAAEADITFLKTQVKLIAHSEPRD
FT                   QLLSVPLVRVRRTATSGFEVDDSFVPPCLAIEASPILHQRLRQLVDALQAKVNALYGFH
FT                   REPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMTF
FT                   SKGYSLADLPVYRHDDPGPGFARLDVMLRELLGTVISTRYFAITLDEVRPSFHLGRLDS
FT                   GKIDDKTEFYLAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPP
FT                   AIPVRPGACYFALDSRGALYERMLQAQSAMIYAPTGINDLKFELIAVTS"
FT   CDS_pept        complement(316574..317185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00302"
FT                   /product="putative lipoprotein"
FT                   /note="COG3521: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00302"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42277"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK44"
FT                   /protein_id="BAG42277.1"
FT                   /translation="MRSPMIRYGLPLIACALLAGCAAAPLLGSAASAVMSATGIGKPEV
FT                   PDSQKPPRNIGLTLAAAPNLNAATDNKPLALVVRLYALKDPTSFQQAPFDAFTDPNKEK
FT                   AALGADLLNVREITLIPGQRYTATEKVSREAQAFGIVALFRDPALQRWKLTFDPAKSEK
FT                   SGIIIGLHNCAMTVTGGTVIAPQQGAPSQPLNMLSSVSCG"
FT   CDS_pept        317561..318193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00303"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00303"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42278"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBU8"
FT                   /protein_id="BAG42278.1"
FT                   /translation="MKDRLFAKLSGVVLACGVIAGCASQPTTPPTAEVFNKSLAEADEV
FT                   AKSGDQDRALGLYQALAKSDPTREEPWSRIAQIQFAQNHYGQAIVAAQEALQRDSTDRQ
FT                   AKSVLAVAGLRIATQSLGELRQDASLAGDAKSDAQALAKQLRETLGENALFPPEQKVQA
FT                   RKVRRPIHRAKAAAATATADSGAATQPAQTSSSSAPQKGGDPFSALR"
FT   CDS_pept        318229..318744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00304"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3516: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00304"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42279"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBG8"
FT                   /protein_id="BAG42279.1"
FT                   /translation="MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVAD
FT                   LAGQSEVEQPKLRDRKFVNIDRDNFDDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRS
FT                   LSDFNPDEVVEQVEPLRRLLEARSKLADLRNKLAGNDKLEDLLSEVLKNTQQLQALAKG
FT                   TGGDKDGE"
FT   CDS_pept        318760..320250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00305"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3517: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00305"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42280"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGE8"
FT                   /protein_id="BAG42280.1"
FT                   /translation="MNQQTAPAQASGAEYAAGTSLLDEIVEKSKVAKSDSEHARAKDLI
FT                   GELVHQVLDGTVVVSDNLSATIDARVAELDRLISAQLSAVMHAPEFQRLESTWRGLDYL
FT                   VKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSALFKKVYEEEFGTFGGSPFGALIG
FT                   DYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFADLGKPRDLGKVFDTVE
FT                   YAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGQTAETFNFVEDVDGTDHDKYLWCNA
FT                   AWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRR
FT                   EKELSDLGFIPLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRV
FT                   AHYLKAMMRDKIGSFASAQNVETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEI
FT                   PGKPGSYRSVAFLRPHFQLDELSISLRLVADLPKPANS"
FT   CDS_pept        320322..320825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00306"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3157: Hemolysin-coregulated protein
FT                   (uncharacterized), Ralstonia solanacearum"
FT                   /note="KEGG, K06887"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00306"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42281"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBS7"
FT                   /protein_id="BAG42281.1"
FT                   /translation="MLHMHMQFGSPAIKGESADKDHQGWIELKSWDHSIIQPRSATAST
FT                   AGGHTATRCEHGDMIFTKEIDSSSPLLYQHASGGTTFDEVTIHFSRADGEGKRVQYLEI
FT                   KLKYVIISSIAPSVREEGLPVETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDK
FT                   TYAV"
FT   CDS_pept        320888..321373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00307"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3518: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00307"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42282"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK47"
FT                   /protein_id="BAG42282.1"
FT                   /translation="MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAIL
FT                   NTRIAHTETELATLPECQKSVLTYGLNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQ
FT                   QVQVTFELNEQSTNALYFAIQALLVVHPAEEPVSFDAMLQPSTLQYSVTRARTARML"
FT   CDS_pept        321452..323287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00308"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3519: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00308"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42283"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBV2"
FT                   /protein_id="BAG42283.1"
FT                   /translation="MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHV
FT                   ERMIESFALLGARINKKLDDDYPEFTEALLEVLYPHYLRPFPSCSIAQFAAAAPGQQTE
FT                   PVVIRRGTELKSRPIRGVQCRFRTAYDVTLAPIRISEARYTPVALAPSATVLPSNATGV
FT                   ISITFESLAAQLDLGALKLPTLRAHLHGEQSFVAALTDCLFVNVLGAYVEPERNGRWTA
FT                   LRQLPIAQAGFDEDDALIDYPAKSHPAYRLLTEYFGFPDKFDFVDFDIAAIARASGRCQ
FT                   RATLHLVLQDVRSDSHVARLLELLAASHFRLFCTPVVNLFRQHGEPIRITHRAVSYPVI
FT                   AEARRAFAYEVYSIDSVKLVRQQAHEESVIEFRPFYSLHHGEAARIGHYWFARRNDSVA
FT                   QKSPGYETEISIVDIDFEPTSPQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQDGGAQT
FT                   AGIALLRRPTQTVRFERGRAAHWRLVSHLALNHVSLVAHGLAPLKEMLTLYDLRRTAVS
FT                   TRQIDGLVAIEQRGAVQWLPGKPFATFVRGIEVRLTIDEEHFVGASLASFVRVLDSFFG
FT                   LYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA"
FT   CDS_pept        323251..324351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00309"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3520: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00309"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42284"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBH0"
FT                   /protein_id="BAG42284.1"
FT                   /translation="MQAPHRRIDSGVVDTLLDEPHRFEFFQAVRVLEGLFARQAADAPG
FT                   AWRQGDVVAHRIAFRNTLSLGFPPSEIEGARSFDDDGLPLDSAEQREAAVAGGELGRVE
FT                   LTPAFFGLLGAQGALPLHYTEQIAAREHLKRDHAARAFFDVFSNRATALFYAAWKKYRL
FT                   PFHYELDRDERYLPLLLAIAGVPSDDVRDSLAAGAGGVLDEAVAGYALAARHRPMSAAY
FT                   LQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGQVNAVLGATALVGERVWQRDMRARI
FT                   VIGPLSKRDYEAFLPGGAQAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRL
FT                   GWDAFLCTRDADEDRSDARYELHVIH"
FT   CDS_pept        324396..327065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="BMULJ_00310"
FT                   /product="protease associated ATPase"
FT                   /note="COG0542: ATPases with chaperone activity,
FT                   ATP-binding subunit, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42285"
FT                   /db_xref="GOA:A0A0H3KGF1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGF1"
FT                   /protein_id="BAG42285.1"
FT                   /translation="MSTPLKTLITKLNPLCRHAAERAASACLARGHYEVDLEHLFLALL
FT                   EEPAGDLSLALRASRIDAHALRADLERELTRLKTGNTRTPVFSVHLIALFEQAWLIASL
FT                   DSQLGRIRSGHLLLALLTAPDLAQFAQRMSARFSEVNVTDLKHKFDEITAGSSEAEPHR
FT                   ADAEHGDAAAPAEGGAPAAGASKTPALDTYTTNLTQRARDGKIDPVIGREAEIRQAIDI
FT                   LMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASVK
FT                   GEFENRLKSVIDEVKKSPHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTI
FT                   AATTWSEYKKYFEKDAALARRFQVVKVEEPSESLAAAMLRGMAGLMEKHFNVRILDDAI
FT                   TEAVRLSHRYISGRQLPDKAISVLDTACAKVALAHSATPAAIDDTKKRTERIDAEIASL
FT                   ERDAASGAAHDERLGELRGARDAALEQLAKDEARYEAERAIVAEITALRETLDRARAPA
FT                   DDGQPVDVQATREKLAERVAALHALQGGEPMVPLQVDGHVVAEIVAAWTGIPLGRMVKD
FT                   EIGTVLNLKPLLAARVIGQDHALEAIAQRVRTASANLEDPNKPRGVFMFVGPSGVGKTE
FT                   TALALADILYGGERKMITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYS
FT                   VVLLDEVEKAHPDVLEMFFQVFDKGMMDDAEGREIDFRNTLIILTSNVGSAAVMQACLN
FT                   KPAEELPDPDALAEALRPQLYKAFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRSR
FT                   IEANHKAAFEWDESLVEAVLARCTEVDSGARNVDHILNGTLLPEIAGHVLGRIADGASI
FT                   ARIAVRADDAGEFAYTVE"
FT   CDS_pept        327104..328225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00311"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3515: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00311"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42286"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBT1"
FT                   /protein_id="BAG42286.1"
FT                   /translation="MPINLPELLTPISDASPTGDDLLFSNEFDAIQEARRYDDPTLDQG
FT                   EWVTEIKEADWGLVVERATDLLRTRTKDLRVAVWLTEALALEDGITGLTEGYALLEGLC
FT                   REYWDTVHPLPEGEDVEYRLGNVAWLAGRTAELLRGIPMTDGAANAFTTLDWEVAQHVA
FT                   QAIKRDPEHADDIARGKPSVEQIDASRRVTPIAFYATLLANLKAFEFALDAFEDTLVAR
FT                   AGDAAPSFRQTRDAFETVYRLAERFAREQGYTGSAPHKEAAPAAQPERIEPSFGTPIQT
FT                   EETHVQSQTAPRPPVTQTIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWA
FT                   DMPLHKWLESVVKDDGSLSHIRELLGVRPDEQS"
FT   CDS_pept        328294..330855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00312"
FT                   /product="putative Rhs element Vgr protein"
FT                   /note="COG3501: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00312"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42287"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK51"
FT                   /protein_id="BAG42287.1"
FT                   /translation="MNVTELIQAIRGGLIQQDRLLKTDIPSLPSNALVPRRAVIRAELG
FT                   RDFSVALDFVSAASDIELKTLIAKPITLWIQQADKSYLPINGYVHTARRLGADGSLSSY
FT                   QLTFASWMHFLKFRSDMRYWQDESVDAILADVFDAHPQAKGRYQFALSKPLPSRSYCRQ
FT                   SETDWNFVHRLMEDEGLFGFWRHAEDGSAHTLVVTDDLHAVDALSPNVVRFERSGAGTE
FT                   TAGLTQWAASRTLQSSLHTTRTFDYKSPSSAASPNGTSLPTKSGQGHLAEQTEIYEYTG
FT                   AYTYPGQDRGEQLSKIRLEEWESRAKRFFGVGGVRGIDAGRRFTLADHPEHDRDSAQDR
FT                   EFAAIVVSRYVENNLPLSDEEAHFPHSLQDELARVKAAYRDAAAFVVGHDDGSAGFYLV
FT                   EVEAQRASVPYRSALVHRKPEMQLETAVVVGPPDEEVYTDELNRIKVMFVWDRQSEGRE
FT                   NASCWVRVVQSDTGGGYGGVHIPRVGEEVLIGYVGGDCDRPIALHRVYNGATAPQWHSN
FT                   GILSGFRSKEYAGSGHNEMVLDDATGQNRARLFSSSANSLLHLGYLIEQDGNTRGAYLG
FT                   SGFDLRTDAYGAVRAGQGLYVTTHPKQASSQPLDVSEARQQLVNAEGLIDSMSQVSEMH
FT                   QAAGLGDGHDALKQFADATQNSVAGATAGGGRTGGGGTGNANAFKEPVMLFGSPAGVAL
FT                   SSQQSIHVSVDRQTNIVSGQSTFIASGKSLIAGIRDRISLFAQNAGMKLFAGKGKVEIQ
FT                   AHADSVEVTAQKVVKLMSATEHVDVAAKQEVLLTSGGAYIRIKGGNIEIHAPGKVDFKG
FT                   AQHQFSGPASMPYPLPAMPGGTCKQCVLNAHSGREAMVEAD"
FT   CDS_pept        330855..331895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00313"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42288"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBV7"
FT                   /protein_id="BAG42288.1"
FT                   /translation="MDELNDVTGRNDATGANETIDAAPNPREPEWPAFLAMLKASLAHT
FT                   DEVGRAMRLYVLVDTRGYQELDVRLATVHRLRYASLWTDTGLEAYTDIAPYLIAFDRDT
FT                   LDDENAEQHRLLRQLWLDAVDLHAVTWMWSTWSFDALDAHLRRYVQYRLPNGQAYYLFF
FT                   FDNHVFDRIRRVWNDAQTRQFVAPFNEIRYRDRQLDEVVWRNDAPAVEGAMPAADAAGL
FT                   SEQQHAKLIELGYPDKLVLKFRETMAAVVDHLSDAELHDLVVEQLDRAAAHGIVDEVGL
FT                   LSYVVTGVQVAPRFDEHPIVKSCLEAASRGETSVDAALASIDDATWDAIRDAHERELLE
FT                   AREDAA"
FT   CDS_pept        332140..332991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00314"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42289"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBH4"
FT                   /protein_id="BAG42289.1"
FT                   /translation="MHRRTKLARVTGRVLATCLLFAAVTACGKAEPTYSGISLMGRNYL
FT                   PYNMNGFTITDAYGNKAIGGGDDPPGAGGGSVTCCYKLKGTEFTVKWKYYDADRWTMDD
FT                   SHAQQVETKVVMPPSVVPEKVGSRILEVHFYPDRHVEFQFPGQLLDESRIPVVDVSRWM
FT                   ATHYQEQLDKNFDDTDGQSHRRIARAVAAAWLKYQLTDRDDLEQYAYFSLLVNSRFDAH
FT                   PEVQRILRAVAKRPGAFAKSMQALPKNVLSELESGKFKPVNVPTIPDGLVPPPRAEEKQ
FT                   HG"
FT   CDS_pept        332984..335278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00315"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42290"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGF6"
FT                   /protein_id="BAG42290.1"
FT                   /translation="MAERIKLDPDDATPMSTYMQLVCQDANMYPKGDCLPCGATIRMGF
FT                   FFDAFGRNRDIDDKSSSQYSNICRLWEAHRDNDDRHRPVNQFWFRFYYSGLGTPLNESA
FT                   KANEWINAGVAAAKMSGKKALNGAESVARSFTRVDTPLKQTSVKKRVDGVKKEFIENFL
FT                   EGEFSLRPLDKAFQDLRRDIEHMPAQARRIMNVVNASPERYWERTKATGTVLWRNAKND
FT                   FKNNVKSSPMKAGWAVARSLFVGIAMENVPIVRDNAVMAKAFGTGVDTRLTAAKDQFEE
FT                   AYRAVKRQMPKIRAIEVSVFGADRGCVLARAFINDLAEKYKRRDDMDLAIDSVPIQIKF
FT                   VGLLDAVSSAMSEETGQLIGMVPYLGLIKTSYKDRALAIPASVQRCVHFAAAHEMRFYQ
FT                   RLDSLEKTRGEQFLYPGTSCDVVGGAPKGSLGFNAELMRIPLRDMLLEALKAGAAMDTM
FT                   EDLRDKKPDTFRKFTIARPINADGKQYRIKQLVDAYYALVPRKAGVDFVPHAKIFMRWI
FT                   AARYMDPEFRRTISDPVADWKRNMSDADLQRKTTKSQLDWELQRQGTNMSMLASRSPAD
FT                   QEKLRGMKAASDAAQKRYEQLIAEAPKDYSTVWERLEKEAAKKLLRAPYQEGLRQSAER
FT                   IRNLPETWDSDNKASAAAVEALLLPEAEMELVSAWKEGVEGKHPLPPDVMALFDLLVHD
FT                   TLLTSWQDHVLAPSLYFRTRDTDEFGVSDLDKEAKQRQKDDRVAARIDQAAKQSKEWAR
FT                   GYKGGATPSVH"
FT   CDS_pept        335275..336939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00316"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBT6"
FT                   /protein_id="BAG42291.1"
FT                   /translation="MSGDENFLPPAVARAVWSAILPNALAVARTLAVLRIAAANLLFAS
FT                   ITACSKSEPTYVAVSTEALNYLPYKLVRFTITDQYGNRVRGGGDLEPGAGEGSIACCYS
FT                   LKGTNFKVQWTYYDADDWRPGEQVKKQQPEANASLAPTNAPDSIGSRILEIHFYPDHHV
FT                   ELAFPGEMLGSTRLPIVNVSRELTKRYGKQLDEKYGDNDVQLHRRISRTICRVPVVAVL
FT                   ATAMLLSACDKPSPEPVYGGLSVEGFNYLPYNLTRFTVTDKYGNKASGGGDLIPGSGEG
FT                   SVSCCYTLKGTEFTVDWTYYDIDKHVDPYAPLEKIHETARVHLPPTEMSGTAGETILGI
FT                   HFYPDNHVELEFRHDLRGTRILYVEVWDWVRKHHKQLLNPSNDDEAVEYRRAARLAAAG
FT                   WTRYRLTDTGDLQQYVYFTLLNPGFDEYPAVRKIINETEGKPGAFGDAMQNLSPEVVND
FT                   IKRFDTKGRAGVDPDFDDSGLHPVDRTPKTVRTKRANSELAYKHDDCIPCGGIVHMGFF
FT                   FDGFARHRDMDDPDTSHPCPRVEVDRVMPMPRHCKMR"
FT   CDS_pept        338215..338982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00317"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42292"
FT                   /db_xref="GOA:A0A0H3KK56"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK56"
FT                   /protein_id="BAG42292.1"
FT                   /translation="MTVTNISRHQSDYVLTMIKKAVPLVLVMSLLGAALSYAAYSDDLS
FT                   VSAWPWRIGVLIAVLSCAALLFVYVRYRGTNDLCAYGLVMAIGTISTYYFFGIFCYFCY
FT                   FVFAPMPDVVRWPGLFGGIALNLVWALVVQRNVHRIVNTTPFLDKVIKEHGETLVYDVQ
FT                   RGAAEFDRYHNEPNIMPTVFKYIVFGIAPFYLVMSRLLSSNFGTNGVLLFLAVFGMPVA
FT                   LLFVSLFVRNYALMVVLPRKIAKERGRRVLVAE"
FT   CDS_pept        339436..340251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00318"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBW2"
FT                   /protein_id="BAG42293.1"
FT                   /translation="MTWRRAGVAVSLLATTLGLSGCGKSEPVYSGISIIGRNYLPYNMS
FT                   GFTIADTFGNTASGGGDDPPGAGGGSVKCCYKLKGTEFVVKWNYYDVDQWHKGNKQMFH
FT                   AETKVPMPPSPVPDDAGARILEVHFFPDRHVEFQFPGKLLDDARLPIVDVVRWMTQYQA
FT                   QLDKRYDEREDQQFRRIARVIASAWLKYRLTDRDDLQQYVYFTLLVSDRFDEHPEIQRL
FT                   LQTTTGKPGLFAKSLQLLPKSVLSALSRDAFKGVAVPAISDGLLPPPHG"
FT   CDS_pept        340655..341299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00319"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBJ4"
FT                   /protein_id="BAG42294.1"
FT                   /translation="MPGGGGGVTCCYKLKGTEFTVKWNYVDVDQWHKGNEQTLHAEAKV
FT                   TMPPSQVPEKVGDRILEVHFYPDRHVELQFPGALMDKPRIPTVDVSRWMASQYQGQLNE
FT                   RYDEREDQQFRRVARVVSIAWLKYHLTDLDDLKQYAYYNLLVSNRFDSHPEIQRILQAD
FT                   AGKPGAFAKAMQSLPKKALSELASDKFESVAVPSIPDGLVPPPRVEEKKHG"
FT   CDS_pept        341444..341800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00320"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42295"
FT                   /db_xref="GOA:A0A0H3KGG0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGG0"
FT                   /protein_id="BAG42295.1"
FT                   /translation="MTNDVVAKGGENSVDDGAIVCRKDFFEILDATYAERSPFVKWHSW
FT                   IVMAFAPFFLVLSRLLSMYFGTGGVLFFIAAITFPASLWLIGVMIQVAVTMIQLPRAME
FT                   QKYRRPVLMGDASF"
FT   CDS_pept        341869..342777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00321"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42296"
FT                   /db_xref="GOA:A0A0H3KBU0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBU0"
FT                   /protein_id="BAG42296.1"
FT                   /translation="MRHTAPQCRAISRRRRNAASASARAFVVLRIAAANLLFVSIAACS
FT                   KSEPTYVAVSTEALNYLPYNLARFTITDQYGNKARGGGDLEPGAGEGSIACCYSLKGTN
FT                   FKVQWTYYDADDWRPGEQVKKQQAEANASLAPTNVPDSIGSRILEIHFYADHHVELAFP
FT                   GEMLGSTRLPIVDVSRELTKRYGKQLDEKYGDNDAQLHRRISRTVAAAWLKYRFTDRDD
FT                   LARYAYFALLVNARFDAHPAVQKRIRSSNGTRGAFAKEMAALSPDIAAELAQDRFPSVA
FT                   VPPIEAGLLPPPRDDSRGSRG"
FT   CDS_pept        343208..343954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00322"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK62"
FT                   /protein_id="BAG42297.1"
FT                   /translation="MYSGISIIGRNYLPYNMSGFTIIDRYGNKASGGGDDPPGAGGGSV
FT                   TCCYKLKGTEFTVRWKYYDADQWTMKNPYMKQSETKVVMPPAAIPEKVGSRILEVHFYP
FT                   DRHVELQFPGELLDDSRIPIADVSRWMAARYQAELDDKFHDTDGQSHRRIARIVASAWL
FT                   KYGLTDRRDLEQYAYYALLVNGRFDAHPEVQRVLQACAGKRGMFAKSMQSLPKSVLSAL
FT                   SNDVFDAVAVPAISDGLLPPSRARPG"
FT   CDS_pept        344046..344951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00323"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBW7"
FT                   /protein_id="BAG42298.1"
FT                   /translation="MQCVTSTARLKRETSTSRTMKLPKLMNRALAGCLLVVAVTACGKS
FT                   EPTYSEISIMAQNYLPYNLDKFTIVDAYGNKASGGGDSMPGGGGGVTCCYQLEGTDFTV
FT                   KWDYYDVDQWHKGDEQTFHTEAKVTLPQSTIPEKVGARILAVHFYPDRHVELQFPAAPA
FT                   DDSRIPMIAVSHRISSHYQAQLNKRYDEREDQQYRRIARVVAAAWLKYRLTDVDDLEQY
FT                   AYFDLLVNSRFDAHPAVQQILKAASGKPGTFAKSMQSLPMTTLSELNSNKFETVAVPTI
FT                   PAGLLPSPRVEAHREMKDDR"
FT   CDS_pept        complement(345127..346077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00324"
FT                   /product="OOP family OmpA-OmpF porin"
FT                   /note="COG2885: Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03286"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00324"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42299"
FT                   /db_xref="GOA:A0A0H3KBK1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBK1"
FT                   /protein_id="BAG42299.1"
FT                   /translation="MQRTNHALRARRCAVVAALVAAGFVASGAAYAQNAGGATVTPVGN
FT                   GTVAASALPANAGAGSASAAASATLVRGTAGTLAPPPANAAPGQVVVGGKVPDEATKAA
FT                   VLQKLRDTYGAANVVDQIEVGDVATPPNWSANVQKLLGTQLKQISKGQLKINGTQIEMK
FT                   GEVHNEAQRQQIASDMANTLNPTYTIKNGLRVSASEQGLLDQTLANRTIEFETGSATLT
FT                   PQGKQILDQMAAALAKLQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKGIAP
FT                   QQMTTTGVGPDQPIAPNDTAEGRARNRRIEFRVGQ"
FT   CDS_pept        complement(346082..347071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00325"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3913: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00325"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42300"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGG4"
FT                   /protein_id="BAG42300.1"
FT                   /translation="MTQTVQAQVAYFGKIPSRGDFVKSAHNPQLLQTLDRWIAQALELL
FT                   AEDPRWKIVYEDAKPMHFAFLGSRSKLAIAGHMVASHDVSMRRFPFLGATALEVDRPLA
FT                   FLARSPLAFARLWSRVAAQIAPLLASEEPPGALQALGDTQVPIDIGGPGTSHDGTFNDF
FT                   VEHQSLYGLQQMLLESGHPVRLRGAMLALGSLLRPVMQSGSSHIERGLTLPLPVDPFYR
FT                   SLVAAFWLELIAPFVAQADFELAIFIGTIAERERLIIGFNGASAKTLLSVVDPQTYAAH
FT                   NIDIDDPEWIDAHAQNDPQVSKLVSYLDQPQLSLRVAIDAFREAFIGG"
FT   CDS_pept        complement(347068..350154)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00326"
FT                   /note="COG3523: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /note="inactivated hypothetical protein"
FT   CDS_pept        complement(349607..351016)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00327"
FT                   /note="inactivated hypothetical protein"
FT   CDS_pept        complement(351315..352160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00328"
FT                   /product="probable peptidase M15B and M15C,
FT                   D,D-carboxypeptidase VanY/endolysins"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00328"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42301"
FT                   /db_xref="GOA:A0A0H3KBU6"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBU6"
FT                   /protein_id="BAG42301.1"
FT                   /translation="MIAVALVAYFAVAVAVAALLLLPGIRATVFDSVAQFHGRLTRRAN
FT                   DRAARARSQIVKSARVTRSTLSDVQNLLVRRRLMIMVSAGILATPPLVAIALRGRQLFQ
FT                   YDDTARVPDEKIAALLQGEQLVPPPPLPPEVFATREVEQIRPALKDASRDWNLLDPDFR
FT                   TRLLLVYKIMHEQYGYEMALLEGYRSPERQNRLAQMGSNVTNAAAFQSYHQFGLAADNA
FT                   FLRDGKLVISEKDPWAMRGYQLYGQVAEQVGLTWGGRWKMMDLGHVEYHKPGFKLGRGS
FT                   "
FT   CDS_pept        352282..353256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00329"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00329"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK66"
FT                   /protein_id="BAG42302.1"
FT                   /translation="MSAPENSNSKTPPSLLSDTKPADNGGSQPSRILADLEGRVTPPAE
FT                   PPRRSLKAPIAAVVALLVAVGGWGAWRWQQQSADEPAAVAAAPAQPAGKAAPASGASAQ
FT                   VAQNGASAASAVQPATIVNDEPASAAVASASAPPAADDSRLSRALANGADDASGATTAG
FT                   AATTAATAATTAAAATAAKTAKADAKPDAKSAKVAARSKADAKVDAKAEARKHRKEQTE
FT                   LAQKKRRDTSVRTASAKDDPDADLLAALVARTKPADKKAAAQKAQPVPTKAAAATGGSL
FT                   AARVKECSERGFFEDQLCRWRVCDGHWGKDPACPTAAQSDARQ"
FT   CDS_pept        353470..354498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00330"
FT                   /product="MIT family metal ion transporter"
FT                   /note="COG0598: Mg2+ and Co2+ transporters, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K03284"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42303"
FT                   /db_xref="GOA:A0A0H3KBX1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBX1"
FT                   /protein_id="BAG42303.1"
FT                   /translation="MDLIAQTYGADTSGMICGFRFMRGEPGVPLDASAAADWLRTCCAR
FT                   DAADADDFVWLHFNLAHGASERWMRTHLGLPDSFFEFLHEGSRSTRIEQEDGALRAIVN
FT                   DVMFNLELTPSEIATLFVHVEQRIMVTARLKPLRSVDTLRACVRDGERFRSPAELLMHL
FT                   LRDQADLLIQIMRRTSVDVDRIEDSFLSQRLTSNRIELGTMRRTLTRLQRMLAPEPGSI
FT                   FRLLARPPAWLHADDVQELRESTEEFSLVLADLAGLVERIKLLQEEIGSRLDEQNNRTL
FT                   FTLTLVTVIALPINIVAGFFGMNVGGVPFAENKHGFWLMVLFVAGFTALAAWWAFRRRN
FT                   DR"
FT   CDS_pept        complement(354625..356796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="BMULJ_00331"
FT                   /product="membrane alanyl aminopeptidase"
FT                   /EC_number="3.4.11.2"
FT                   /note="COG0308: Aminopeptidase N, Ralstonia solanacearum"
FT                   /note="KEGG, K01256"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00331"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42304"
FT                   /db_xref="GOA:A0A0H3KBK5"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBK5"
FT                   /protein_id="BAG42304.1"
FT                   /translation="MSISIRKMRYLPLVAALALAGCGGDDGGLGSASALSSAAAPNAGS
FT                   SPAAGGPQTSASNVDKSVAPVELPDTVVPINYRLWFRPNEALNAFDGRADVEIKVLKPV
FT                   NNIVIAGHRIKFTNGRITLQPGNIQLIATPQDKGDFYQLRPVSGSISPGNYSLHMEWSG
FT                   IINFKSYDDPVNKTGGSCGDDPYPGCSAAEGIFRVDLKATDGTTSGAILTQGETNLARQ
FT                   WFPGWDEPAFRPTYEVTAEVPQNWRVVSNAAEKPSTNVGGGYKLVQFEKTPPMPSYLLF
FT                   FGGGLFDTYEDDFTSPLPGGKGGLHLRVFTPPGMRDWAKPAMDRTKQALDFYYRYTGIP
FT                   LPLTKFDTVAANDAFKEQKDLNFGGMENWGSILEFADDILPEPGQPMSQYGNEVLTHEV
FT                   AHQWFGDLVTTDWWDNVWLNESFATFFETKTTIQFFPDEFSWLDQVKNKYRVINRDIGP
FT                   NAFPVAPNFNGWASNDFVLSASAFTYDKGGHVLKTLENYLGEQTLRKGLQQYLTDYSFG
FT                   NGTPKRLWDALSKASGQPVGPIGDSYVRQTGVPLVSLDTQCDLTKNQTIVTLKQQPFPN
FT                   KNAYPGLQWTVPITLAYGQGLSKRTTLALKDTQAQTRLDGCTGVVADPSGLDYYVVNYS
FT                   DAAWSGVLTQVNSSTDPVLLANLKSEAALLVANNLAPASRSTSIGSVASPAAMKLRQTP
FT                   TFDGLAPTTKERPALRYQGAFKPRKVLTQ"
FT   CDS_pept        complement(356925..357158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00332"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGG6"
FT                   /protein_id="BAG42305.1"
FT                   /translation="MTATLRNGDTAPSFRPATWPGPPRGASVQSRRAPAHGAPSVVRAH
FT                   SIQYNTRPAISNRQVNRYPETQRGQQTMITFT"
FT   CDS_pept        357440..357937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00333"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00333"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42306"
FT                   /db_xref="GOA:A0A0H3KBV0"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBV0"
FT                   /protein_id="BAG42306.1"
FT                   /translation="MLQALFRFAPLRAVLLLFAAALVLGGCASLTREPLSVSVVGLDPL
FT                   VGQGLEMRFSLKLRVQNPNDTPIEYDGIAVALELNGAPFASGVSDRSGIVPRFGEAVLE
FT                   VPVSVSAFAAARQAWNLPGAAANGELPYALRGRLAGGVLGTVHFSDAGTLRLPAMSSWG
FT                   AS"
FT   CDS_pept        358047..359180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00334"
FT                   /product="methylase"
FT                   /note="COG2890: Methylase of polypeptide chain release
FT                   factors, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00334"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42307"
FT                   /db_xref="GOA:A0A0H3KK71"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK71"
FT                   /protein_id="BAG42307.1"
FT                   /translation="MTDFPVFHWTDADGVDHAVRWRSEAGVPPPKRAVPADDRLTADAA
FT                   YRLACEGTALVWQGDFQNARQLVQAMARRVERKPKKAKAAAGVEAFNLHRLAQSQRART
FT                   LGMLLIPLDADYTIPLRRAPDVRAACEEAYGPGGAPSMVSLRELLGLVGAHEWRKKGVP
FT                   IPALGGAAIHPHYGVFSPVRGEYVTLVARAPLPATSLAFDIGTGTGVLAAVLASRGVER
FT                   VVATDQDPRALACARENLERLGYAGRVDVVEADLFPPGRAPLVVCNPPWVPARPSAPIE
FT                   YAVYDPDSRMLRGFLAGLAAHLEPGGEGWLILSDFAEHLGLRPRDTLLQWIDAAGLVVL
FT                   GRDDIRPAHPKSADAADPLHAARRAELTSLWRLGARA"
FT   CDS_pept        359270..360160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00335"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="COG0500: SAM-dependent methyltransferases, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00335"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42308"
FT                   /db_xref="GOA:A0A0H3KBX5"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBX5"
FT                   /protein_id="BAG42308.1"
FT                   /translation="MSNKTYEIRPEQSVELLKELHILTRDGKMNQDSRRKLKQVYHLFQ
FT                   FIEPLLASVQADRGAVTLVDHGAGKSYLGFILYDLFFKQQPGHGTPAFASHVYGIETRE
FT                   ELVARSTELAARLGFGGMSFLNLSVADSITSPKLPDTVDVVTALHACDTATDDAIRFAL
FT                   AKHARHIVLVPCCQAEVAGVLRRHKGKSLANALTEVWRHPLHTREFGSQITNVLRCLQL
FT                   EAHGYQVSVTELVGWEHSMKNELIIAQYKNLPRRRPSERLNEILDMFGLAELRERFFVP
FT                   QRDAAAGETVEEHAG"
FT   CDS_pept        complement(360211..360783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00336"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3310: Uncharacterized protein conserved in
FT                   bacteria, Xylella fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00336"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42309"
FT                   /db_xref="InterPro:IPR009858"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBK7"
FT                   /protein_id="BAG42309.1"
FT                   /translation="MIDTRPESTDEIVAATRHWLARAVIGLNLCPFAKSVYVKDQVRYA
FT                   VSDATALDTALADLEAELRALEAADPRQIDTTLVIYPHAFADFVDYNDALFFADRLVQQ
FT                   LKLDGVLQIASFHPQYRFDGSEPDDIENYTNRAPYPILHLLREDSIARAVDAFPDAAAI
FT                   YEKNQETLRRLGHDGWRAWMSGAGDDV"
FT   CDS_pept        complement(360839..361459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00337"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00337"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42310"
FT                   /db_xref="GOA:A0A0H3KGH1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGH1"
FT                   /protein_id="BAG42310.1"
FT                   /translation="MSGIEAVKPPARRTRRAIAGATAQEHLLRAAQELFYREGVRSVGV
FT                   EAVVELAGVNKMSLYRQFSSKDDLILAYLARMDACFFERVDASLAKHPGEPKAQLIQYF
FT                   VDLAERATQKDYRGCPFVNVAAEFPDASHPARERVAQNKEQLMKRLVALCEAAGARDPK
FT                   ALADSLALVIEGIYAASQTYRHGETPIGIAPALVTQLIEAACA"
FT   CDS_pept        361672..362955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00338"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00338"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42311"
FT                   /db_xref="GOA:A0A0H3KBV5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBV5"
FT                   /protein_id="BAG42311.1"
FT                   /translation="MNWAVTRIGGRFHYGWLAAAVVFLILLAAAGTRATPSVLMVPLER
FT                   ELGWSRAAISLAISVNIALYGLTGPFAAAAMQRFGLRPTILTALATMGAGVALSSMMTQ
FT                   SWQMVLIWGLMVGCSTGVVALTLSATFVTRWFHARRGLVMGILTASTATGQLVFLPMLA
FT                   AIAQRHGWRPVVLVVALAAAIVIPLVALLLPERPADVNLRPYGEPADAPAAPDATKENP
FT                   LAVAFRTLLTASRSRDFWLLFFSFFICGASTNGYVGTHLIAMCSDYGMTEVQGASLLAA
FT                   MGVFDLFGTTLSGWLSDRYDNRVLLFWYYGLRGLSLIYLPHAFGIDFFGLPLFAMFYGL
FT                   DWIATVPPTVRLATDVFGKAAAPVVFGWIVAGHQLGAAFAALGAGMLRASLGTYTVASM
FT                   ISGGLCIIGALIVLRINRGPSRAAAQAA"
FT   CDS_pept        363102..363707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00339"
FT                   /product="nitroreductase family protein"
FT                   /note="COG0778: Nitroreductase, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00339"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42312"
FT                   /db_xref="GOA:A0A0H3KK74"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK74"
FT                   /protein_id="BAG42312.1"
FT                   /translation="MSVKPAPTTVSIHELIAGRWSPRAYSDAPIGAADLHAVLEAARWA
FT                   PSAYNAQPWRFIVFDRTRDEAAFKRAFSTLVPFNQGWNAPAPVLIAVTAHTLTPKGEPA
FT                   PTALYDAGAAAMSLVLQAHALGLAAHQMSGFDANAFREGFEIPADVAIPAIISLGHYGN
FT                   VDKLDPVLRDREKAPRTRHPLGEIVYAGAWKKGFEAAA"
FT   CDS_pept        363855..365105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00340"
FT                   /product="hypothetical chaperone protein"
FT                   /note="COG0443: Molecular chaperone, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K04046"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42313"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBX7"
FT                   /protein_id="BAG42313.1"
FT                   /translation="MTYCAIDFGTSNSAVALPHGDGMRLAPVEGDHLTLPTAIFFNNDE
FT                   ETVEYGRAALASYIDGFDGRLMRSMKSILGSPLAETTTDLGDGTAIAYTDVIARFLQHL
FT                   KQKAEACAGAPIRRAVLGRPVFFVDDDPRADRLAQNQLQAAAQSVGFADVRFQYEPIAA
FT                   AFDYESRQQAERLVLVADIGGGTSDFSLVRVGPDRMTRLDRKDDVLAHHGVHVAGTDYD
FT                   RRVELSAILPEFGYRALDPEGRELPNRIYFDLATWHLINTVYTPKRLGELKLMKHLYRD
FT                   ARQHERLVRVVEQRLGHALMARAEEAKIGVAAGGETMIDLNDVEEDLQIAFDAARLIDA
FT                   SREDTARIVDAARETVRLAGVAPRDVGALYFTGGSTGLAFLSGALAAAFPDAQPVFGDR
FT                   LASVATGLGIHAQRLFG"
FT   CDS_pept        complement(365217..365420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="BMULJ_00341"
FT                   /product="CspA family cold shock protein"
FT                   /note="COG1278: Cold shock proteins, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03704"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00341"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42314"
FT                   /db_xref="GOA:A0A0H3KBL2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBL2"
FT                   /protein_id="BAG42314.1"
FT                   /translation="MATGTVKWFNDAKGFGFITPEGGGDDLFAHFSEIRVEGFKTLQEN
FT                   QKVEFEVKTGPKGLQAANIRPL"
FT   CDS_pept        365843..367441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00342"
FT                   /product="amino acid transporter"
FT                   /note="COG0531: Amino acid transporters, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00342"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42315"
FT                   /db_xref="GOA:A0A0H3KGH4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGH4"
FT                   /protein_id="BAG42315.1"
FT                   /translation="MKSSIQRNIGPFALMLTGLGSIIGSGWLFGAWKAAKIAGPAAICA
FT                   WIIGAVVILAIALTYAELGAMFPESGGMVRYARYSHGSLVGFISAWANWIAIVSVIPIE
FT                   AEASIQYMSTWPYPWAHALFVNGELTTPGLLLSAVLVVVYFLLNYWGVKAFARANTAIT
FT                   IFKFLIPGLTILGLMLTSFHSENLGTSSGASFAPYGWSAVLTAVATSGIVFAFNGFQSP
FT                   VNLAGEARNPSRSVPFAVIASILLALVIYVLLQMAYIGAVNPVDVAKGWQHFNFSSPFA
FT                   ELAIALNLNWLAILLYVDAFISPSGTGTTYMATTTRMIYAMERNNTMPKMFGNVHPLYG
FT                   VPRQAMWFNLLVSFIFLFFFRGWSSLAAVISVATVISYLTGPISLMALRRAATDIERPL
FT                   SIPAMKLIAPFAFVCASLILYWAKWPLTGEIILLMIVALPVYFYFQGKSGWTGWGADLK
FT                   AAWWLVAYLPTMAVLSLIGSKEFGGYGYLPYGWDMLVVAVISLGFYFWGVNTGYRTQYL
FT                   DERESHDEILEGIGA"
FT   CDS_pept        complement(367597..368388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00343"
FT                   /product="class III extradiol-type catechol dioxygenase"
FT                   /note="COG3384: Uncharacterized conserved protein,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00343"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42316"
FT                   /db_xref="GOA:A0A0H3KBV9"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBV9"
FT                   /protein_id="BAG42316.1"
FT                   /translation="MNRLPSLYLSHGAPTLPIDPALPSGAFTELGAELPRPRAVLMLSA
FT                   HWGTQQPVASIAAHPDTIHDFYGFPRALYEIRYPAPGAPDVAQHAADLLNAAGIATATL
FT                   EHGLDHGAWVPMLLMFPHADVPVAQLSIQPRADAAHHFAVGRALRPLRDEDVMVIGSGQ
FT                   ITHNLRAADFGASPEDADPRVAEFTDWFEAKLAERDIDALLDYRRQAPHAALMHPTDEH
FT                   LLPVFAALGAADDDYRLGIQALGTYQRVLAMTNYVFSSATA"
FT   CDS_pept        complement(368607..369203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="BMULJ_00344"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="COG0163: 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase, Ralstonia solanacearum"
FT                   /note="KEGG, K03186"
FT                   /note="UbiX protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00344"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42317"
FT                   /db_xref="GOA:A0A0H3KK78"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK78"
FT                   /protein_id="BAG42317.1"
FT                   /translation="MVSPSAPRRRLIVAITGATGAIYGVRLLDLLRAAGGVETHLLISN
FT                   AGWLNIQHELKLSKSDVESRADVVHSVRDVGATIASGSFATHGMVIAPCSMKTLASIAH
FT                   GLSDNLITRAADVTLKERRRLVLMVRETPLNLAHLRNMTAVTEMGGIVFPPLPAFYAMP
FT                   KTIDELVDQTVTRVLDLFAPDTPLTTPWAGLRHAQ"
FT   CDS_pept        complement(369217..369528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhD"
FT                   /locus_tag="BMULJ_00345"
FT                   /product="monothiol glutaredoxin"
FT                   /note="COG0278: Glutaredoxin-related protein, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K07390"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00345"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42318"
FT                   /db_xref="GOA:A0A0H3KBY0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBY0"
FT                   /protein_id="BAG42318.1"
FT                   /translation="MDTQQRIKQIVDENPVVLFMKGNAQFPMCGFSGRAVQVLKACGVD
FT                   QFKTVNVLEDEEIRQGIKEFSNWPTIPQLYVKGEFIGGSDIMMEMYQSGELQQLFAAA"
FT   CDS_pept        complement(369596..370438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="BMULJ_00346"
FT                   /product="HemK protein"
FT                   /note="COG2890: Methylase of polypeptide chain release
FT                   factors, Ralstonia solanacearum"
FT                   /note="KEGG, K02493"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00346"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42319"
FT                   /db_xref="GOA:A0A0H3KBL6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBL6"
FT                   /protein_id="BAG42319.1"
FT                   /translation="MSAPTADDLLRATPLDAVDARVLLAHALGWTRTQLITRGDRPLDA
FT                   EAVERYRALEARRAAGEPVAQLVGMREFFGRPFDVTPDVLIPRPETELLVEAALDAIDG
FT                   LAHPAVLDLGTGSGAIAVSIAAERPDARVWALDRSAAALAVAQRNADKLLDARRPGGPL
FT                   QWLQSDWYAALDPALAFDAIVSNPPYIAQHDPHLSQGDLRFEPRGALTDDADGLSAIRT
FT                   IVAGARAHLKPGGTLWIEHGYDQAEAVRALLASHGFDAVESLADLAAIERTTGGRLPR"
FT   CDS_pept        complement(370449..371531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="BMULJ_00347"
FT                   /product="peptide chain release factor RF-1"
FT                   /note="COG0216: Protein chain release factor A, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02835"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00347"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42320"
FT                   /db_xref="GOA:A9AJ68"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJ68"
FT                   /protein_id="BAG42320.1"
FT                   /translation="MKTSMQRKLDQLSTRLAELNDLLSRENVTADLDQYRKLTREHAEL
FT                   GPVVEQYALWRQSRSDETAAQELLADPSMRDFAEEEIRSARERMARLEVELQKMLLPKD
FT                   PNDDRNIFVEIRAGTGGDESALFAGDLLRMYLRFAERQRWQVEMMSESPSDLGGYKEVI
FT                   VRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINLADL
FT                   RIDTFRASGAGGQHINKTDSAVRVTHLPTGIVVECQDDRSQHKNKDRALKVLAARIKDK
FT                   QYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEAIMDGDLDEL
FT                   IGALVSEHQAELLASLGDAD"
FT   CDS_pept        complement(371614..372912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00348"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="COG0373: Glutamyl-tRNA reductase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02492"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00348"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42321"
FT                   /db_xref="GOA:A9AJ67"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJ67"
FT                   /protein_id="BAG42321.1"
FT                   /translation="MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAP
FT                   NAPEAAILSTCNRTELYCATDDRAARDAAIRWLSDYHRIPVDELAPHVYALPQSEAVRH
FT                   AFRVASGLDSMVLGETQILGQMKDAVRTASEAGALGTYLNQLFQRTFAVAKEVRGTTEI
FT                   GAQSVSMAAAAVRLAQRIFEKVSDQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAE
FT                   RGQRLAERFNGRAMPLSDLPARMQEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFM
FT                   VDLAVPRDIEPEVSKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQW
FT                   LDTRSVVPVIRHMHTQADALRRLEVEKAQKMLARGDDPAAVLEALSQALTNKLIHGPTS
FT                   ALNRVNGADRDSLIELMRGFYQHAPRSNDQSGH"
FT   CDS_pept        complement(372939..373700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00349"
FT                   /product="signal transduction response regulator"
FT                   /note="COG0745: Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain, Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00349"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42322"
FT                   /db_xref="GOA:A0A0H3KGI0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGI0"
FT                   /protein_id="BAG42322.1"
FT                   /translation="MRIALIDPDADHAAFLNRQLFIGGHVCHAFSTSAAFFEWFAGDTC
FT                   DMLIVAGWAGDSPAEDIIPRAQAVLPGLPAIAVFQLSRESEIVACLHAGADDCLVRPVG
FT                   GPELLARVTALSRRAGVRRPPVRSREMYGEYAFDATHLLVSFGQHTVALTPKEFRFARL
FT                   LLANLSRPVSRAHILETVWARHRDMKSRTLDTHASRLRSKLRLLPERGYRLLPLYGYGY
FT                   QLDRVPIEPPNRRPRIADARYSAGEQSAETL"
FT   CDS_pept        373869..374123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00350"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42323"
FT                   /db_xref="GOA:A0A0H3KBW4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBW4"
FT                   /protein_id="BAG42323.1"
FT                   /translation="MNWFGIVVLGAAVGLVGRWLHPMRRAGRPAWWASVLVGIAAAAAA
FT                   RMVGNLSGLFYDGETLEWPVCTGAAFVAVAVTVALAARR"
FT   CDS_pept        374142..375956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="BMULJ_00351"
FT                   /product="X-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /note="COG0006: Xaa-Pro aminopeptidase, Neisseria
FT                   meningitidis Z2491"
FT                   /note="KEGG, K01262"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00351"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42324"
FT                   /db_xref="GOA:A0A0H3KK81"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK81"
FT                   /protein_id="BAG42324.1"
FT                   /translation="MNARLPEVSPVPARLALLRGAMVREDLAAYLVPSADPHLSEYLPE
FT                   RWQARRWLSGFTGSVGTLVVTADFAGLWVDSRYWVQAEAELAGTGVQLMKMTGGQQSAP
FT                   HVDWLAQNVPAGATVGVDGAVLGVAAARALTAALSARGIALRTDLDLLDAIWPERPALP
FT                   ADPVFEHVAPQADTTRASKLADVRRAMQAQGAQWHFVSTLDDLAWLFNLRGADVSFNPV
FT                   FVAHAMIGLDSATLFVADGKVSPALAASLAQDGVEVRPYGDARAALAALPDGATLLVDP
FT                   RRVTFGTLEAVPAGVKRVEAVNPSTFAKSRKTPAEIAHVRVTMEHDGAALAEFFAWFEQ
FT                   AVNRDTITELTIDEQLTAARARRPGYVSPSFATIAGFNANGAMPHYRATPASHATIAGD
FT                   GLLLVDSGGQYLTGTTDITRVVPVGTVSDLQRRDFTIVLKSMMALSRARFPRGIRSPML
FT                   DAIARAPMWAAGLDYGHGTGHGVGYFLNVHEGPQVISHYAPAEPYTAMEEGMITSIEPG
FT                   VYRPGQWGVRIENLVVNRAAGQTEFGDFLAFETLTLCPIDTRCVLIEMLHEEERAWLNA
FT                   YHATVRERVGRHVSGDAKAWLDARTQPI"
FT   CDS_pept        376015..376566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00352"
FT                   /product="isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="KEGG, K05993"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00352"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42325"
FT                   /db_xref="GOA:A0A0H3KBY4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBY4"
FT                   /protein_id="BAG42325.1"
FT                   /translation="MTDTAVIVVDMQRGLVQRATPAYRLDDVVSGINRLTAAARAARAP
FT                   VCFVQHDGDAADDIVPGTPGWELHRGLVVEAGDWRIRKRMSDAFHDTPLAAQLDRHGIR
FT                   SVLICGYATEFCVDAAARRAALLGYRTTVVSDLHTTNTRAHLSAEQIVAHHHFIWENGS
FT                   LSGNAVRPRPLADVLATELA"
FT   CDS_pept        376563..377186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00353"
FT                   /product="2-haloacid dehalogenase"
FT                   /EC_number="3.8.1.2"
FT                   /note="COG1011: Predicted hydrolase (HAD superfamily),
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K01560"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00353"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42326"
FT                   /db_xref="GOA:A0A0H3KBM0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBM0"
FT                   /protein_id="BAG42326.1"
FT                   /translation="MTIKAVVFDFGGVLIDWSPEYLYRKLIADDAERRWFLTHVCAMEW
FT                   VVRQDGGQTIEEGTNELVAQFPEHEALIRAFYARWHEMIGGVLAEGVALVERLEARGMP
FT                   LFGLTNWSAQTFPYAWEHFPVLRRFKDIVVSGHVKLVKPDPTIYRAMHARIDPHLPGIA
FT                   PHELVFIDDNAKNAAAATALGWHGIHHTSAAATEARLRELGALA"
FT   CDS_pept        complement(377260..378927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00354"
FT                   /product="sulfate-transporting ATPase"
FT                   /EC_number="3.6.3.25"
FT                   /note="COG0488: ATPase components of ABC transporters with
FT                   duplicated ATPase domains, Ralstonia solanacearum"
FT                   /note="KEGG, K06020"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00354"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42327"
FT                   /db_xref="GOA:A0A0H3KGI4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGI4"
FT                   /protein_id="BAG42327.1"
FT                   /translation="MAQYVFTMNRVGKIVPPKRQILKDISLSFFPGAKIGVLGLNGSGK
FT                   STLIRIMAGVDKDIEGEATPMPNLNIGYLPQEPQLDPSKTVREAVEEGLGDLFQANKKL
FT                   EEIYAAYAEPDADFDALAAEQAKYEAILASSDGGSPEQQLEVAADALRLPPWDAKIEHL
FT                   SGGEKRRVALCKLLLEKPDMLLLDEPTNHLDAESVDWLEQFLVRFPGTVVAVTHDRYFL
FT                   DNAAEWILELDRGHGIPWKGNYSSWLDQKEERLKQEEAAESARQKAIKKELEWVRQNPK
FT                   GRQAKSKARIARFEELNSQEYQKRNETQEIFIPVGDRLGNEVIEFKNVSKSYGDRLLID
FT                   NLSFKIPAGAIVGIIGPNGAGKSTLFRMITGKEQPDSGEIVTGPTVKLAYVDQSRDALD
FT                   GSKTVFEEISGGADVLTVGKYETPSRAYIGRFNFKGGDQQKIVGNLSGGERGRLHLAKT
FT                   LISGGNVLLLDEPSNDLDVETLRALEDALLEFAGSVMVISHDRWFLDRIATHILAFEGD
FT                   SQVTFFDGNYQEYEADKRARLGEEAAKPKRIRYKPITR"
FT   CDS_pept        complement(379111..379419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00355"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42328"
FT                   /db_xref="InterPro:IPR022236"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBW9"
FT                   /protein_id="BAG42328.1"
FT                   /translation="MPALLRHATRIAALSIALFAATAPLSAPAHAFRASPAYGNEADLD
FT                   RHDTYRNRDGETVHAPARSKSGRVPEGASARCRDGAYSFSRHRRGTCSGHGGVAEWL"
FT   CDS_pept        complement(379524..380441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00356"
FT                   /product="LysR family glycine cleavage system
FT                   transcriptional activator"
FT                   /note="COG0583: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K03566"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00356"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42329"
FT                   /db_xref="GOA:A0A0H3KK88"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK88"
FT                   /protein_id="BAG42329.1"
FT                   /translation="MNRSRLPPLNALRAFEAAARHLSVKSAAEELSVTPGAVSQMIRTL
FT                   ETHLGVQLFERVNRGILLTAAGRDYLPPVRNAFRQIADASQRVSGAADSGVLTISVTPF
FT                   FASAWLVPRLARFRDACPDVDLQIVTSHALADFARDGVDVAIRHGLGRYAGLCSEHLLT
FT                   VEIVALASPELVARLGMPRTPADLVDWPHLHDAERKGWHTWFDAQRIDDFGPPRGPAFD
FT                   DAGLLLQAIVAGQGAGLLPAAMVRGELANGRLVQLADVARLDDFAYYLVYPPHHAERPK
FT                   VAAFRRWVLDAARAGDAPSMSGAT"
FT   CDS_pept        380634..381959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00357"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00357"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42330"
FT                   /db_xref="GOA:A0A0H3KBY9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBY9"
FT                   /protein_id="BAG42330.1"
FT                   /translation="MIDRLRTSRVFYGWYVVAAAFAVTFVGFGSAYTFSAFVEPLQRDF
FT                   AASRGQISLVFSLAGFLYFGFGIVSGPLADRFGSRRLAVVGMLLTAAGLAAAGAARTLL
FT                   QVYAAYGLGVGFGVGCAYVPAVGAVQRWFVRRRGFASGLAVAGIGVGTLVMPPLASALI
FT                   AQVGWRGAYFALAVLAVVLGAGMSLLIENDPRGGGLLPDGDVTDPAADGASAPALDRGP
FT                   CAGPAPSDAAPRRSATDVPGAGATVREAVMSRPFASLYAACLVCSFGVFVPFVHLVPYA
FT                   VDHGVAPAAAVLLLGAIGVGSTAGRFFLGGLADRFGRRASLLAMFAGMAVALVAWAGAG
FT                   TVATLAAFALVFGVFYGGWVAVLPAVVMDAFGGRNVSAIIGVLYTSVAFGTLIGPAAAG
FT                   FIYDAGGGYLVPILASAAANAIAFAIVATSGRTRAAARAAGG"
FT   CDS_pept        382028..382366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00358"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3801: Uncharacterized protein conserved in
FT                   bacteria, Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00358"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42331"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBM3"
FT                   /protein_id="BAG42331.1"
FT                   /translation="MTFDEVRQIVLAWRGVEEGTSYGTPALKVRRKILARLREDGDTLV
FT                   VKGVGPDERAWLIESEPDVYYVTDHYVGWPIVLVRLSAASPDAVTNLLRREWEAIVPAK
FT                   WREAGDAS"
FT   CDS_pept        382734..384125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00359"
FT                   /product="AAT family amino acid transporter"
FT                   /note="COG1113: Gamma-aminobutyrate permease and related
FT                   permeases, Pseudomonas aeruginosa"
FT                   /note="KEGG, K03293"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00359"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42332"
FT                   /db_xref="GOA:A0A0H3KGI8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGI8"
FT                   /protein_id="BAG42332.1"
FT                   /translation="MKESKTGLGTGLKQRHVTMMSIAGVIGAGLFVGSGHAIAEAGPAS
FT                   ILAYAIAGVLVVLVMRMLGEMAVAHPDSGSFSTYADRAIGHWAGFTIGWLYWWFWVLVI
FT                   PIEATAAATILNAWFPGIATWMFALGITLLLTITNLFSVKNYGEFEFWFALIKVVAIVV
FT                   FLCVGAAAIVGIVPAPAVSGVSNLFAHHGFMPNGAGAVLAAMLTTMFSFLGTEIVTIAA
FT                   AESDNPQRQIVRATNSVIWRITLFYLGSILVVAAIVPWNDPLLPAHGSYQRAMELIGVP
FT                   NAKAIIDVIVLVSVASCLNSALYTASRMLFSLSKRKDAPAFLHRTDATGTPRAAVLAST
FT                   AFGFVTVIANYLMPEQVFGFLLATSGAIALLVYLVIAISQLRMRRTLEATGADLPLRMW
FT                   MFPWLTWAVILFICGTLTVMLVSEEHRMEVGATAVLALLVLLASWLNKRGRDARVGEGR
FT                   RVSAT"
FT   CDS_pept        complement(384270..385424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00360"
FT                   /product="hypothetical protein"
FT                   /note="COG2850: Uncharacterized conserved protein,
FT                   Neisseria meningitidis MC58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42333"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBX3"
FT                   /protein_id="BAG42333.1"
FT                   /translation="MSISFSVSPKDFALNYQEKRPLLMKGAVSLRNFSWRDVNEIFERS
FT                   NVASDDFKLTFDGIRPKSEYIESWWDIGTLRHRLIKPVVYDYLRKGATLIANKIATEPK
FT                   VNQLSRQLIEFTGRQVVSSAYLAFGERDSFRCHWDTRDVFAIQLIGRKRWVLYEPSLEA
FT                   PLYMQQSKDYEGLYPCPDTPYMDVMLEAGDLLYLPRGWWHNPLPVGEATFHLAFGTFPA
FT                   YVIDYLSWAINRMPHLLDARRSLSDWENDKNVLASIGQQFEDFICTRENYRRFFDDRTG
FT                   AIRIETDLALETLGNPAVSAIPDESRIRLSAYRPPGRDDRYVIANGTKVNLDDQGATLI
FT                   RLIVERPGISLGTLISCFADTDADRIRDLVTDLCRQDILEFSLA"
FT   CDS_pept        386453..387328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00361"
FT                   /product="probable alpha/beta hydrolase"
FT                   /note="COG4757: Predicted alpha/beta hydrolase, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00361"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42334"
FT                   /db_xref="GOA:A0A0H3KK95"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK95"
FT                   /protein_id="BAG42334.1"
FT                   /translation="MSGRPASRLRIEFRASDGFPLTGTYFPAISDAAANTPVLLCPATG
FT                   LRQSFYFPFADWLRGNGHSTFVFDYRGIGASLDVRHVRQSRARKQDWGQLDMPAALDWL
FT                   LGRTGARDAHLIGHSAGAQLVGLMPNHAAVRSLSAISASSGYVGNIRWPTRFTASLLAN
FT                   VYVPVAARLLDYVPAKVLGWGDDLPAAVGLQWARWCRRPGYVANDFGIGIASHYYNEFS
FT                   APVTVVAATDDPLATPANIEDWLRLLPRARSRIHFVSPQTCGGRAIGHVGMFRREHSSL
FT                   WPELTGGWTR"
FT   CDS_pept        387369..388430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00362"
FT                   /product="probable radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00362"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42335"
FT                   /db_xref="GOA:A0A0H3KBZ0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBZ0"
FT                   /protein_id="BAG42335.1"
FT                   /translation="MDDSIGMKARFKAVRNEAKETRASLYHLTNRCNLRCKGCWFFENE
FT                   FDEATRELDDISRLEARVKDEAARGINAPLLIGGEPALYLDRIEMFRKYMPKVSVSTNG
FT                   LRRIPYDGFEDVTIAVSVFGGGPMDDELRAIGPNGKRFAGLLDKALDNYRGDERAGFVF
FT                   AVSIDGIAYIEDTVRRIRDNGNRLLFNYYSSYDVAGPLRRSGEERLLNVLLELRAMYPE
FT                   TIASHPYYLTALMRGKTAWGTFGYDSCPSVSEAHAENVDRFASGWPALPKFNAYRADMH
FT                   TLARCCTSGECAKCRDSQAVISWLLVNAKHVLQEDDGLRIWTEVAESYFSQFVWSRYHP
FT                   RNLSPRASNRAIQ"
FT   CDS_pept        complement(388545..389639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00363"
FT                   /product="probable translation factor"
FT                   /note="COG0012: Predicted GTPase, probable translation
FT                   factor, Ralstonia solanacearum"
FT                   /note="KEGG, K06942"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00363"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42336"
FT                   /db_xref="GOA:A0A0H3KBM7"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBM7"
FT                   /protein_id="BAG42336.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTKAGIAAENYPFCTIEPNVGIVE
FT                   VPDARLKALAEIVKPERIVPAVVEFVDIAGLVAGASKGEGLGNQFLANIRETDAITHVV
FT                   RCFEDDNVVHVAGKVSPIDDIEVINTELALADLGTVEKALARYSKAAKSGNDKEAAKLV
FT                   AVLDKVRAHLDQGKAVRGLALSDDEQALLKPFCLITAKPAMYVANVKDDGFENNPHLDA
FT                   VRKYAESENSPVVAVCAAIEAEIADLDDADKEAFLADMGMSEPGLDRVIRAGFKLLGLQ
FT                   TYFTAGVKEVRAWTIHIGDTAPQAAGVIHTDFERGFIRAQTIAFDDFIAYKGEQGAKEA
FT                   GKMRAEGKEYVVHDGDVMNFLFNV"
FT   CDS_pept        390004..391182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="BMULJ_00364"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /note="COG0654: 2-polyprenyl-6-methoxyphenol hydroxylase
FT                   and related FAD-dependent oxidoreductases, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03185"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00364"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42337"
FT                   /db_xref="GOA:A0A0H3KGJ1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGJ1"
FT                   /protein_id="BAG42337.1"
FT                   /translation="MPAMTVHHTFDVAVVGGGLVGKTAALALTQSGYKTALLAQPVTPR
FT                   PADLAFDTRVYALSSSSQALLERLRVWQALDHGRLAPVYDMRVYGDAHAELHFSAYQAS
FT                   VPQLAWIAESSLIETSLDAALRFQPNLTWFDARAQGLDVRDDAAVLALSSGQVLEADLV
FT                   VGADGAHSWVRSQMGARVERRDYRQTGVVANFKASLPHRETAYQWFRDGEIVALLPLPD
FT                   GHVSLVWSAHTAHADELLALDPAQLAAEVERVSHAQVGTLECVTPAAGFPLALQTVDKL
FT                   IAPRVALVGDAAHLIHPLAGQGMNLGLRDVAALADAIANKESFRNLGDTVLLRRYERSR
FT                   REDIRALMVATDGLQRLFAVPGSFAKAVRNAGMAFVGAQPLVKRWLVSAALG"
FT   CDS_pept        391273..392001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="BMULJ_00365"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="COG1651: Protein-disulfide isomerase, Ralstonia
FT                   solanacearum"
FT                   /note="DsbC protein"
FT                   /note="KEGG, K03981"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00365"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42338"
FT                   /db_xref="GOA:A0A0H3KBX8"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBX8"
FT                   /protein_id="BAG42338.1"
FT                   /translation="MKKTIRIASLALAVTMAALGCTAQADQTTDKLKATLQARLGNDAP
FT                   IKSVSKSPVAGLYEVNLGSQIIYSDAAGDYVLLGDLVDAKTHKNLTDARLSELNKIDFT
FT                   SLPFANAIKVVKGNGARKIAVFSDPNCPYCKRLETTLQSVDNVTVYTFLYPVLSPDSTA
FT                   KSKAIWCATDRAKTWQSWMLDHRAPSGAGNCDTSALDKNLALGRGMNVTGTPTIFLPDG
FT                   RRLPGAVSADQLNQALASSK"
FT   CDS_pept        392105..393907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00366"
FT                   /product="family M61 unassigned peptidase"
FT                   /note="COG3975: Predicted protease with the C-terminal PDZ
FT                   domain, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00366"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42339"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKA0"
FT                   /protein_id="BAG42339.1"
FT                   /translation="MNQPIRYSIVPKDVAAHLFEVTVTVSDPDPDGQRFSLPVWIPGSY
FT                   LVREFARNIVTLDAFNDAGRKVRMAKTDKHTWQAAPVSGALTLRYVVYAWDLSVRSAYL
FT                   DESGGFFNGTAVFLNVAGRDDAPCEVDIAKPAGDAFRAWRVATALPEARGTKRYGFGAY
FT                   RAANYDELVDHPVTIGEFALATFDAHGVPHDIVIAGRVTQLDLERLRTDLKRVCEAQIA
FT                   LFEPKSKKAPMDRYVFMTLAVSDGYGGLEHRASTALICNRTDLPVKGRPETTEGYRTYL
FT                   GLCSHEYFHTWNVKRIKPAAFVPYDLTRENYTSLLWLFEGFTSYYDDLMLVRSGLMSQD
FT                   EYFAALGRTIGGVLRGTGRLKQSVADSSFDAWIKYYRQDENATNAIVSYYTKGSLVALA
FT                   FDLAIRAQTRHRKSLDDVMRLLWQRYGRDFYRGKQAGVAEDEVAALIEEATGVALGRLF
FT                   SDAVHGTRDLPLAELLAPFGVTLAPDLGAPGAVAKPSIGARLRGGADCTLAAVYEGGAA
FT                   HRAGLSAGDTLIALDGLRVTGTNLDALLARYRPGDKVEVHAFRRDELRTAKLKLDGPEV
FT                   SRYRLTAAAKPAALLKAREAWLKG"
FT   CDS_pept        394066..394662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpD"
FT                   /locus_tag="BMULJ_00367"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /note="COG1182: Acyl carrier protein phosphodiesterase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K01118"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00367"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42340"
FT                   /db_xref="GOA:A0A0H3KBZ4"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBZ4"
FT                   /protein_id="BAG42340.1"
FT                   /translation="MTTILQINSAARSQGAQSTLLSNELTAKLQQSNPGAKVVVRDLLA
FT                   DGLPHLDESVLGAFFTPAENRSAEQNAIVAKSDALIAELQAADIIVIGAPMYNFGISSQ
FT                   LKTYFDWIARAGVTFRYTENGPEGLIKGKKVYVVSARGGKYAGTPHDSQTPYLRSFLGF
FT                   VGMTDVSFIYAEGLNMGPEAQSAALAGAREAIAAA"
FT   CDS_pept        complement(394795..395700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="BMULJ_00368"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="COG0692: Uracil DNA glycosylase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03648"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00368"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42341"
FT                   /db_xref="GOA:A0A0H3KBN1"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBN1"
FT                   /protein_id="BAG42341.1"
FT                   /translation="MATRKTSRTPLQASLFDDPVPETAEADLRPAAPAAPAAERRPAGK
FT                   IAAGAAAAPHAAHAARDIPHLAAQFDALPAVWRDVLKPFIDSDAYAPLCRFVDDERAAG
FT                   KTIYPTDVFRALRLTSPDDVKVVILGQDPYHGDDRGTPQAHGLAFSVPPAVRTPPSLRN
FT                   IFKEISANFGHDTPRHGCLDTWARQGVLLLNTVLTVERGAAASHAKRGWEQCTDTLIRE
FT                   LANRHRGLVFMLWGAHAQAKRALFDASAHCVLEAPHPSPLSAHRGFLGCRHFALANDYL
FT                   VEHGRTPIDWRLPAVAETLA"
FT   CDS_pept        complement(395714..396340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00369"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3025: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00369"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42342"
FT                   /db_xref="GOA:A0A0H3KGJ3"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGJ3"
FT                   /protein_id="BAG42342.1"
FT                   /translation="MAIEKEIKLALPAGHAPAAHRFFETLTGERGREIALSNVYYDTPD
FT                   LALARSKSAVRVRRTPQGWLQTFKTVGNAEDGLHRRHEWELPVAGDALEVAALVAACDV
FT                   PEAAAALRDAAPALHALFRTDFSRTLWRVAIGGATVEAAVDIGEIVVHTDRDTRREPIS
FT                   EIELELLDGPEAALATLAAELQQALPGLAPENISKAQRGYRLRAQ"
FT   CDS_pept        complement(396340..397125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="BMULJ_00370"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="COG0134: Indole-3-glycerol phosphate synthase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01609"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42343"
FT                   /db_xref="GOA:A9AJ43"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJ43"
FT                   /protein_id="BAG42343.1"
FT                   /translation="MSDILDRIIAVKREEVAAAMRSTPLEALKLEASARDRRDFVGALR
FT                   AKHAAGQPAVIAEIKKASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGSVR
FT                   YLEEARAACDLPVLRKDFIVDAYQILEARAMGADAILLIAAALDTPLMQELEAYAHSLD
FT                   LAVLVEVHDRNEMEQALTLKTPLLGINNRNLRTFETSIRATLDMLDMIPQDRIVVTESG
FT                   ILSRADVDTMRAANVNTFLVGEAFMRADQPGEELARMFF"
FT   CDS_pept        complement(397154..398185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="BMULJ_00371"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="COG0547: Anthranilate phosphoribosyltransferase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00766"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00371"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42344"
FT                   /db_xref="GOA:Q845X9"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q845X9"
FT                   /protein_id="BAG42344.1"
FT                   /translation="MTITPQEALQRTIEHREIFHDEMLHLMRLIMRGDMSPVMAAAIIT
FT                   GLRVKKETIGEIAAAATVMREFANHVEVQDNSNFVDIVGTGGDGSHTFNISTASMFVTA
FT                   AAGAKVAKHGNRGVSSKSGSADVLEALGVNIDLQPDQVAASIAETGMGFMFAPNHHPAM
FT                   KNIAAVRRELGVRTIFNILGPLTNPAGAPNQLMGVFHPDLVGIQVRVMQRLGAQHVLVV
FT                   YGKDGMDEVSLGAATLVGELRDGQVHEYEIHPEDFGLQMVSNRTLKVENAEESRAMLLG
FT                   ALDNQPGVAREIVTLNAGTALYAANVAGSIADGIQLAREAIASGKARAKVDELVRFTQQ
FT                   FKR"
FT   CDS_pept        complement(398198..398785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="BMULJ_00372"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="COG0512: Anthranilate/para-aminobenzoate synthases
FT                   component II, Ralstonia solanacearum"
FT                   /note="KEGG, K01658"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00372"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42345"
FT                   /db_xref="GOA:A0A0H3KBY2"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBY2"
FT                   /protein_id="BAG42345.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFGELGEDVRTYRNDEITLDDIARLDPD
FT                   AICLSPGPSNPQHAGITLDVLREFAGKKPILGVCLGHQAIGEAFGGRVVRAKTIMHGKV
FT                   SRIETDGRGVFADLPKHFDVTRYHSLAIERESLPDCLEISATTDDGEIMGVRHKTLPIE
FT                   GVQFHPESILSEHGHALLENFLKQARAAAHAA"
FT   CDS_pept        complement(398799..400292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="BMULJ_00373"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="COG0147: Anthranilate/para-aminobenzoate synthases
FT                   component I, Ralstonia solanacearum"
FT                   /note="KEGG, K01656"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00373"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42346"
FT                   /db_xref="GOA:A0A0H3KKA5"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKA5"
FT                   /protein_id="BAG42346.1"
FT                   /translation="MTELEFQSLANEGYNRIPLIAEALADLETPLSLYLKLAQPERAGA
FT                   NSFLLESVVGGERFGRYSFIGLPARTLVRTRNGVSEVVRDGAVVETHDGDPFEFIASFQ
FT                   ARFKVAQRPGLPRFCGGLAGYFGYDAVRYIEKKLAHTAPRDDLGLPDIQLLLTEEVAVI
FT                   DNLAGKLYLIIYADPGQPEAYAKAKQRLRELKQRLRATVQPPVTSASVRTETFREFKKD
FT                   DYLAAVRQAKEYIAAGELMQIQVGQRLTKPYRDNPLSLYRALRSLNPSPYMYYYNFGEF
FT                   HVVGASPEILVRQEKRGDDQIVTIRPLAGTRPRGNTPERDAELATELLNDPKEIAEHVM
FT                   LIDLARNDVGRIADIGSVQVTDKMVIEKYSHVQHIVSSVEGKLKPGMTNFDVLRATFPA
FT                   GTLSGAPKVRAMELIDELEPVKRGLYGGAVGYLSFSGEMDLAIAIRTGLIHNGNLYVQA
FT                   AAGVVADSVPESEWQETENKARAVLRAAEQVQDGLDSDF"
FT   CDS_pept        complement(400652..401422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="BMULJ_00374"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="COG0546: Predicted phosphatases, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01091"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00374"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42347"
FT                   /db_xref="GOA:A0A0H3KBZ8"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBZ8"
FT                   /protein_id="BAG42347.1"
FT                   /translation="MAQPPLAPPASAAEPPAAGDRAIRLSAPRIDAALIDLDGTMVDTV
FT                   DDFTAGLNAMLAKLGAPATSRDEVIGYVGKGSEHLIHCVLTPRFTADELRTRFDDALAI
FT                   YQAEYAKINGRHTRLYPDVATGLDALRAAGIRLACVTNKPHRFAVELLEQYGLADRFGI
FT                   VLGGDSVARKKPDPLPMLAACDALGVAPHVSVAIGDSENDALAGRAAGMATLTVPYGYN
FT                   HGKPIQTINSDGIVDSLLVAARAIVAHNAGQPTV"
FT   CDS_pept        complement(401427..402113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="BMULJ_00375"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="COG0036: Pentose-5-phosphate-3-epimerase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01783"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00375"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42348"
FT                   /db_xref="GOA:A0A0H3KBN2"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBN2"
FT                   /protein_id="BAG42348.1"
FT                   /translation="MTQFRIAPSILSADFARLGEEVRNVVAAGADWIHFDVMDNHYVPN
FT                   LTIGPLVCEAIRPHVQVPIDVHLMVRPVDRIVPDFAKAGANLISFHPEGSDHIDRTLTL
FT                   IRDHGCKAGLVFNPATPLNYLDHVMDRLDYVLLMSVNPGFGGQSFIPETLNKLREARAR
FT                   IDAYTERTGREILLEVDGGVKADNIAEIAAAGADTFVAGSAIFGKPDYRKVIDEMRAAL
FT                   AAVERS"
FT   CDS_pept        402299..402673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="BMULJ_00376"
FT                   /product="ApaG protein"
FT                   /note="COG2967: Uncharacterized protein affecting Mg2+/Co2+
FT                   transport, Ralstonia solanacearum"
FT                   /note="KEGG, K06195"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00376"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42349"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGJ6"
FT                   /protein_id="BAG42349.1"
FT                   /translation="MSQYQFTVSVKTSYLPEQSDPERRQYAFAYTLTIRNTGQVAAQLI
FT                   ARHWIITDSENHVQEVKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAED
FT                   GERFEAPIDEFALHMPRTLH"
FT   CDS_pept        402893..404017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltA"
FT                   /locus_tag="BMULJ_00377"
FT                   /product="membrane-bound lytic murein transglycosylase A"
FT                   /note="COG2821: Membrane-bound lytic murein
FT                   transglycosylase, Ralstonia solanacearum"
FT                   /note="KEGG, K08304"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00377"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42350"
FT                   /db_xref="GOA:A0A0H3KBY5"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBY5"
FT                   /protein_id="BAG42350.1"
FT                   /translation="MWFGRRAAGWAAAVATAALLAACGGAPTRPTALKPPTGAAIVPGQ
FT                   VAAKRLTPVAWQQVPGWQDDSLIGATAALRQNCVRLARQPAWQRACAAAERLDELDANG
FT                   ARAFFETYFTPFQFANTDGTLDGLVTGYYEPLLHGSRVRRGPYQYALYRWPAGYRAGAP
FT                   LPARAQLERSGVLNGNELVWVDDPIEAFFLQVQGSGRVLLDDGSVMRVGFGGTNNQPYR
FT                   SIGKWLLDRGELTPAQATMQGIKAWAKANPGRVDALLDTNPRFVFFREMPTKEEAPHGG
FT                   ADGPIGALGVPLTPERSIAVDPASIPLGTPVFLQTTRPLTNTPMNRLVFAQDTGSAIKG
FT                   GVRADYFWGLGDDAGDLAGRMKQVGRMWLLFPNS"
FT   CDS_pept        complement(404225..405523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaK"
FT                   /locus_tag="BMULJ_00378"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="COG1541: Coenzyme F390 synthetase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01912"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00378"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42351"
FT                   /db_xref="GOA:A0A0H3KKB4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKB4"
FT                   /protein_id="BAG42351.1"
FT                   /translation="MTTPLPLEPIETASRDELTALQLERLKWSLRHAYDNSPVYRRKFD
FT                   EAGVHPDDLQTLADLSRFPFTTKSDLRDSYPFGMFAVPQERVSRIHASSGTTGKPTVVG
FT                   YTARDIDTWANLVARSIRAAGARPGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGG
FT                   GQTEKQVQLIQDFRPDIIMVTPSYMLSIADEFERQGVDPAQSSLRIGIFGAEPWTNDMR
FT                   VAIEQRMKIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPDTGEVLPDG
FT                   ELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFP
FT                   TQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQAAKQALAYDIK
FT                   SLIGVTAVIDVLPVNGIERSVGKARRVIDKRKG"
FT   CDS_pept        complement(405562..405954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaI"
FT                   /locus_tag="BMULJ_00379"
FT                   /product="phenylacetic acid degradation protein"
FT                   /note="COG2050: Uncharacterized protein, possibly involved
FT                   in aromatic compounds catabolism, Ralstonia solanacearum"
FT                   /note="KEGG, K02614"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00379"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42352"
FT                   /db_xref="GOA:A0A0H3KC01"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC01"
FT                   /protein_id="BAG42352.1"
FT                   /translation="MYEADACSRALGIEIVNVRAGYACLRMPVRADFLNGHQICHGGLI
FT                   FTLADSTFAFACNSYNVNTVAAGCSIEYLRPVHGGDVLTAEATEQTRSGRHGIYDIRVT
FT                   NRAGETVAMFRGKSAQIKGTVIPEDR"
FT   CDS_pept        complement(406022..406813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="BMULJ_00380"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="COG1024: Enoyl-CoA hydratase/carnithine racemase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01692"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42353"
FT                   /db_xref="GOA:A0A0H3KBN7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR011968"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBN7"
FT                   /protein_id="BAG42353.1"
FT                   /translation="MSYQAIRLDIDEAARVATITLDRPDKLNSFTRAMHRELQSALDEV
FT                   GAAGARALILTGAGRGFCAGQDLADLDFTPGASTDLGALIDEHFNPLIRRLQRMPIPVI
FT                   AAVNGTAAGAGANLALACDIVLAARSSSFIQAFVKIGLVPDSGGTWFLPQRVGMARALG
FT                   LALTGDKLGAEQAEQWGLIWRAVDDDALAASARELATRLAQQPTLAIASIKQAMRDGMT
FT                   HTLDQQLDLERDLQRKLGQSHDYAEGVNAFIEKRAPRFEGR"
FT   CDS_pept        complement(406861..408063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="BMULJ_00381"
FT                   /product="acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="COG0183: Acetyl-CoA acetyltransferase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00632"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00381"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42354"
FT                   /db_xref="GOA:A0A0H3KGJ9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGJ9"
FT                   /protein_id="BAG42354.1"
FT                   /translation="MTDAYICDAIRTPIGRYGGALKDVRADDLGAVPLKALVERNRDVD
FT                   WNAIDDVIYGCANQAGEDNRNVARMSALLAGLPTAVPGTTLNRLCGSGMDAIGTAARAI
FT                   KAGEARLMIAGGVESMTRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQQYGVDSM
FT                   PETAENVAVDYNVSRADQDLFALRSQQKAARAQQDGTLAEEIVPVTIAQKKGDPLVVSR
FT                   DEHPRETSLEALAKLKGVVRADGTVTAGNASGVNDGACALLLANAEAADQYGLRRRARV
FT                   IGMATAGVAPRVMGIGPAPATQKLLARLGMTIDQFDVIELNEAFASQGLAVLRMLGVAD
FT                   DDPRVNPNGGAIALGHPLGASGARLVTTAMYQLHRTNGRFALCTMCIGVGQGIALAIER
FT                   I"
FT   CDS_pept        complement(408150..409856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00382"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="KEGG, K00128"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00382"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42355"
FT                   /db_xref="GOA:A0A0H3KBY8"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="PDB:5UJU"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBY8"
FT                   /protein_id="BAG42355.1"
FT                   /translation="MTHALFTKHEDTLKRALAAIESRGYWSPFAEMPSPKVYGESGNAD
FT                   GEAAFKSHLGKTFELDQPASGETVGAERSPYGVALDIRYPKSTPDALIAAAAAAQRTWR
FT                   EAGPSAWIGVSLEILARLNRASFEIAYSVMHTTGQAFMMAFQAGGPHAQDRALEAVAYA
FT                   WDQLRRIPADAHWEKPQGKNPPLAMQKRYTIVPRGTGLVLGCCTFPTWNGYPGLFADLA
FT                   TGNTVIVKPHPGAILPLAITVRIARDVLREAGFDPNVVTLLATEPNDGALVQDLALRPE
FT                   IKLIDFTGSTQNGTWLERHAHQAQVYTEKAGVNQIVIDSTDDLKAAAKNIAFSLALYSG
FT                   QMCTAPQNIYVPRDGIRTADGHASFDEVAQAIAGAVQKLTGDPARSVELIGAIQNDGVT
FT                   ARIDAARAVGRVLLDSQTLQHPAFPDARVRTPLVLQLDVADREKFTQEWFGPISFVIAT
FT                   DSTAQSLDLAGEIAAEHGALTLSVYSTADDVIDAAHEAAVRGGVALSINLTGGVFVNQS
FT                   AAFSDFHGTGANPAANAALADAAFVANRFRVVQSRVHVAPKAAPAEVGQPA"
FT   CDS_pept        409985..410761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="BMULJ_00383"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="COG1024: Enoyl-CoA hydratase/carnithine racemase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01692"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00383"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42356"
FT                   /db_xref="GOA:A0A0H3KKC0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKC0"
FT                   /protein_id="BAG42356.1"
FT                   /translation="MSYENILVETRGRVGLITLNRPKALNALNDALMDELGAALKAFDA
FT                   DDAVGAIVVTGSEKAFAAGADIGMMATYSYMDVYRGDYITRNWETVRQIRKPIIAAVAG
FT                   FALGGGCELAMMCDIIFAADTAKFGQPEIKLGVMPGAGGTQRLPRAISKAKAMDMCLTA
FT                   RFMDADEAERAGLVSRVLPADKLLDEALSAAATIAEFSLPAVMMIKESVNRAYETTLAE
FT                   GVHFERRLFHSLFATEDQKEGMAAFVEKRKPVFKNR"
FT   rRNA            411340..412865
FT                   /locus_tag="BMULJ_00384"
FT                   /product="16S ribosomal RNA"
FT   tRNA            412927..413003
FT                   /locus_tag="BMULJ_00385"
FT                   /product="tRNA-Ile"
FT                   /note="anticodon GAT"
FT   tRNA            413044..413119
FT                   /locus_tag="BMULJ_00386"
FT                   /product="tRNA-Ala"
FT                   /note="anticodon TGC"
FT   rRNA            413837..416353
FT                   /locus_tag="BMULJ_00387"
FT                   /product="23S ribosomal RNA"
FT   rRNA            416468..416571
FT                   /locus_tag="BMULJ_00388"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        416809..418884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdh"
FT                   /locus_tag="BMULJ_00389"
FT                   /product="formate dehydrogenase"
FT                   /EC_number="1.2.1.2"
FT                   /note="COG0243: Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing, Ralstonia solanacearum"
FT                   /note="KEGG, K00122"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00389"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42357"
FT                   /db_xref="GOA:A0A0H3KC05"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC05"
FT                   /protein_id="BAG42357.1"
FT                   /translation="MNAATHVARAVCPHDCPDTCAMRVTVENGRAIKVAGDPDHPPTQG
FT                   VLCTKVSRYAERVHHPDRLTVPLKRIGAKGEGRFAPISWDEAFDEIGRRLGDIATRAPE
FT                   AIVPYSYAGTMGLVQGEGIAQRFFHKIGASRLERTICAAAGAAGLRFTYGASVGMHLEH
FT                   FEESELILIWGANPIASSLHFWTRAQEAKRRGARLVAIDPYRSLTAEKCHQHIALKPGT
FT                   DGAFALGMMHVLITENLLDHDYIADHTLGFDALKARALSYPPERVAQICGIDASELIDL
FT                   ARRYGATRKAAIRLNYGMQRVRGGGNAVRAIASLPALTGAWRDRAGGLLLSSSEFAPIN
FT                   QPALLRPDLIPGWPHKLPRIINMNAIGDALLHPGDAAFGPKIEAVIVYNSNPVAVAPDS
FT                   SKVAAGFAREDLFTVVLEHFKTDTVDFADIVLPATTQLEHLDVHKSYGHTYVMANLPAI
FT                   PPVGEARPNTEIFRGIARSMGLDEPALYHSDEEVARAALRWDDPSLDSDWDTLKREGWL
FT                   KLKLPDAPFASGGFRTPSGKCEFYSGRLEQMGLDPVPDHLPPFESAEAAPELAARYPLA
FT                   MISPPARHFLNSTFVNVESLRSTEGQPHLDMHPADAASRGIADGDLVRIFNDRGSMQAV
FT                   ARVTDRARAGLVVGLSIWWKKLSPDGCNANEVTSQALTDLGNSATFYDCLVEVEPA"
FT   CDS_pept        419022..420695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="BMULJ_00390"
FT                   /product="long-chain fatty-acid-CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="COG0318: Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II, Ralstonia solanacearum"
FT                   /note="KEGG, K01897"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42358"
FT                   /db_xref="GOA:A0A0H3KBP1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBP1"
FT                   /protein_id="BAG42358.1"
FT                   /translation="MEKIWLKSYPPGVPAEIDASPYPSVPDLLDESFTQYRDRTAFVCM
FT                   GKVITYGELDALSRRFGAWLQSRGLARGARVAIMMPNVLQYPVTIAAVLRAGYTVVNVN
FT                   PLYTPRELEHQLKDSGAEAIVILENFASTLQAVIANTAVKHVVVASMGDLLGIKGWIVN
FT                   YVVRNVKKMVPAWQLPSFTRFNAALAEGARQTFKPPKLGPDDVAFLQYTGGTTGVAKGA
FT                   TLLHRNIVSNVLQAGAWHQPAHDKYPDVKQFVTVVALPLYHVFALTVCGFLTMRTGGMG
FT                   VLIPNPRDIGGMIKELKGYQISTIPAVNTLYNALLNHPDFGQLDLSKLVIANGGGMAIQ
FT                   EGVAKRWYEKTHTAIVEGYGLSETSPVATCNPVTATEYSGTIGLPLPSTEVTIRDDAGN
FT                   DVPLGEPGEICIRGPQVMAGYWNRPEETAKVMCPDGFFKTGDVGVMDARGYVKIVDRKK
FT                   DMILVSGFNVYPNEVEDVVASHPGVFEVAAVGVPDEHSGEAVKLFVVKKDPALTDKDLL
FT                   AYCKERLTGYKRPKFVEFRTELPKTNVGKILRRELRDGRA"
FT   CDS_pept        complement(420988..422157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00391"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00391"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42359"
FT                   /db_xref="GOA:A0A0H3KGK2"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGK2"
FT                   /protein_id="BAG42359.1"
FT                   /translation="MKKSLLALVALGAFAGAAHAQSSVTLYGIIDEGFIFNNNANGKHL
FT                   YGLSSGVMQGSRFGLRGTEDLGGGLKAIFTLENGFDVNSGKLGQGGLMFGRQAYVGLSS
FT                   PYGTVTLGRQYDSVVDFVGPLEAGDQWGGYIAAHPGDLDNFNNAYRVNNAIKYTSPSYA
FT                   GFSFGGLYSLGGIAGQFARNQVWSLGAGYNNGPLVLGVGYLNARTPSNFGGMFNNGSSD
FT                   PTTSGKLPVTTPVYGAYANSANTYQVIGAGGAYTFGAATIGATYSNTKFKGFSVGPFVN
FT                   QTATFNNGEINFKYQLTPALILGAAYDYTQGSKINGSSAAKYHQGSLGVDYFMSKRTDV
FT                   YVIGVYQHASGNTLDSNGNVVQAHASINGLDPSSTSNQVAARVGIRHKF"
FT   CDS_pept        422438..423064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coq7"
FT                   /locus_tag="BMULJ_00392"
FT                   /product="ubiquinone biosynthesis monooxygenase"
FT                   /note="COG2941: Ubiquinone biosynthesis protein COQ7,
FT                   Ralstonia solanacearum"
FT                   /note="Coq7 protein"
FT                   /note="KEGG, K06134"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00392"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42360"
FT                   /db_xref="GOA:A9AJ26"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJ26"
FT                   /protein_id="BAG42360.1"
FT                   /translation="MVLDELISEFDRGLRSLTGISRMSRPVPAPAEAPAAELTPAERTH
FT                   AAGLMRVNHVGEVCAQALYQAQKLTARSSAAKAMFEEAAREEEDHLAWTAHRLKELDSR
FT                   PSVLNPLWYAGALAIGVAAGTLGDKVSLGFMAETERQVESHLDGHLSDLPAGDTASRAI
FT                   VEQMRADEAKHGKAATDAGGIELPLPARMLMRAASKIMTRTAYYL"
FT   CDS_pept        423450..423878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="BMULJ_00393"
FT                   /product="MraZ protein"
FT                   /note="COG2001: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /note="KEGG, K03925"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00393"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42361"
FT                   /db_xref="GOA:A9AJ25"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJ25"
FT                   /protein_id="BAG42361.1"
FT                   /translation="MFQGASALTLDAKGRMSVPARYREALQGQAEGRVTVTKHPDGCLL
FT                   LFPRPEWEVFRAKIAALPMDAHWWRRIFLGNAMDVDLDSAGRILVSPELRMAAGLEKEV
FT                   MLLGMGSHFELWDSQTYIAKEQAAMAQGMPDALKNFTF"
FT   CDS_pept        423902..424843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="BMULJ_00394"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /note="COG0275: Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03438"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00394"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42362"
FT                   /db_xref="GOA:A9AJ24"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJ24"
FT                   /protein_id="BAG42362.1"
FT                   /translation="MGNELQHRTVLLDEAVESLVTRPDGIYVDGTFGRGGHSRAVLARL
FT                   GPAGRLIAFDKDPRAIETAQGIGDARFSIVHDSFASMRDALAARGIEKVSGVLLDLGVS
FT                   SPQVDDPARGFSFRADGPLDMRMDPTRGESAAEWLARASLQELTEVIRDYGEERFAFQI
FT                   AKALVARRAESDRLGPLDSTGELAQIVGHVVKTREKGKDPATRTFQAIRIHVNQELADL
FT                   QVVLDAALSLLEQGGRLVVISFHSLEDRIVKRFMQAHASAPAVDRRLPIRAVDLPSPPL
FT                   KIIGRQFPSEAEVAANPRARSAVMRIAERLTP"
FT   CDS_pept        424840..425181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="BMULJ_00395"
FT                   /product="cell division protein"
FT                   /note="COG3116: Cell division protein, Ralstonia
FT                   solanacearum"
FT                   /note="FtsL protein"
FT                   /note="KEGG, K03586"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00395"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42363"
FT                   /db_xref="GOA:A0A0H3KBZ1"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBZ1"
FT                   /protein_id="BAG42363.1"
FT                   /translation="MSRFNIFLLIIVMGCALSVVNSTNQQRQIFIQLQRAQSQERQLQQ
FT                   DYAQLQYQQSALSKTSRIEQLANDSLKMQPITTGRTQYLTLPPGAAKAVDAPIPASADS
FT                   AGKGKGGAR"
FT   CDS_pept        425178..427028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="BMULJ_00396"
FT                   /product="cell division protein"
FT                   /note="COG0768: Cell division protein
FT                   FtsI/penicillin-binding protein 2, Ralstonia solanacearum"
FT                   /note="FtsI protein"
FT                   /note="KEGG, K03587"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00396"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42364"
FT                   /db_xref="GOA:A0A0H3KKC5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKC5"
FT                   /protein_id="BAG42364.1"
FT                   /translation="MKKPPQKRHDVKFSSSPVLSVHLPMWRSKLVVFMLFMAFVALAAR
FT                   AFWIQGPGNAFYQKQGESRYQRTIELPATRGKILDRNGLVLATSLPVRAIWAIPDAVPD
FT                   DLDADKINQLGKLLGMTPKELRVKLSEDKGFVYVKRQVPIDVADKVAALDIPGIYQRNE
FT                   YKRFYPEGEITAHLIGFTNVEDEGQEGVELGDQKLLSGTSGMRRVIKDRLGHIVEDVAE
FT                   QIPPHNGTDVDLSIDSKIQYIAYANLKAAVEKFKAKAGAAMVVDVRTGEVLALVNYPTY
FT                   NPNDRSRLTGEQLRNRILTDVFEPGSIMKPFTVSLALDLHRVTPNTLVETGNGHFVLDG
FT                   APITDDAGFGTLTVGGVIQKSSNIGATKIAMTMRPEEMWNMYTSIGLGQAPKVGFPGAA
FT                   AGRLRPWKSWRRIEQATMSYGYGLSASLFQLARAYTAIAHDGELMPVTIFKTDPKQPVA
FT                   GTQVFTPTTAREVRAMLETVVAPGGTSPDAAVPGYRVGGKSGTAYKHEGHGYTRKYRAS
FT                   FVGMAPMPNPRIVVAVSVDEPTAGSHFGGQVSGPVFSAIAGDTLRALNVPPNMPIKQLV
FT                   VSDDSPAAAPSAGAQKLAAGGKAKHMIVSSTTRNSPGVVR"
FT   CDS_pept        427025..428566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="BMULJ_00397"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="COG0769: UDP-N-acetylmuramyl tripeptide synthase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01928"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00397"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42365"
FT                   /db_xref="GOA:A0A0H3KC09"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC09"
FT                   /protein_id="BAG42365.1"
FT                   /translation="MSAARSSHPAHQQIAAALAWLRQHVAPAAQLHADTRSLRAGDVFV
FT                   AYAVDGADNRAFIADALARGAAAVLYQPEGLAATPNAPVALAVPALDQLAGEIASGWYG
FT                   DPSDGLLAIGVTGTNGKTSCTQWIAAALTALHQPCAIIGTLGSGMPGHLVPTGFTTPDA
FT                   PQLQRSLAQLRDGGAQAVAMEVSSHALHQGRVNGTAFDIAVFTNLTQDHLDYHRTFEAY
FT                   EAAKAKLFAWRGLRAAVVNRDDAAGRRLLEKLAGRVRTIAYGIGDAQQAPDADRELVAI
FT                   DVRATATGTAFRLRSSWGDADVEVGTLGTFNVSNLLAVLGALLAADVPFDAALAEIARL
FT                   EPVNGRMQRLGGRLQNDEPLVVIDYAHTPDALEKTLDALRPIAVARGGRLICMFGCGGD
FT                   RDATKRPLMGAIAERLADDVVVTSDNPRSEDPQAIIDQIVAGMTAPDRARRIEDRASAI
FT                   LQAVRGAAREDVVVLAGKGHEATQEIMGKKRAFSDQDHARLALAARATHGKGGGE"
FT   CDS_pept        428563..429969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BMULJ_00398"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="COG0770: UDP-N-acetylmuramyl pentapeptide synthase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01929"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00398"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42366"
FT                   /db_xref="GOA:A0A0H3KBP7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBP7"
FT                   /protein_id="BAG42366.1"
FT                   /translation="MTMLSLDEAARLIPGATVHGDAHVTFERVSTDSRTVGAGDLFVAL
FT                   KGERFDAHDFLADVAARGAAAALVAQAPAGIALPMIVGGETRAALGALAHGWRKRFALP
FT                   VVAVTGSNGKTTVKEMIASIFAAAVGAHARLATAGNLNNDVGLPLTLLRLAAAHRLAVI
FT                   ELGMNHRGETEILARLTAPTVALVNNAQREHQEFMATVEAVALEHAAVIHALPPDGVAV
FT                   FPADDAYASIWRVAATGNRILDFALHDDERQTAAQVTGRLHGGELAIDTPSGTLTVRLR
FT                   ALGEHNARNALAATAAALAAGVALSAIKQGLESFEPVKGRLQVRRASAGSLAGATVVDD
FT                   TYNANPDSMRAAIDVLAAQPAPRVLVIGDMGEVGDEGPAFHREVGAYARERGIDALFAL
FT                   GDASRDACAAYGEAARHFDDVGTLVDALLAAGYGADASVLVKGSRYMKMERVVDALTNQ
FT                   PAAGTTPAAH"
FT   CDS_pept        429986..431155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="BMULJ_00399"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="COG0472: UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase, Ralstonia solanacearum"
FT                   /note="KEGG, K01000"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00399"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42367"
FT                   /db_xref="GOA:A9AJ19"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJ19"
FT                   /protein_id="BAG42367.1"
FT                   /translation="MLLALAQWLQGDASFLRLFTYLTFRAVMATITALGIGLVCGPWVI
FT                   RKLTEMKVGQAVRKDGPQTHLVKSGTPTMGGVLILIGIAVATLLWGDLTNRFIWIVMLV
FT                   TFGFGVIGWVDDYRKVVYKDPRGMSSREKYFWQSVIGLFAAVYLAFSVSEANNVRVFDL
FT                   FMAWVRSGLSMGLPARADLMLPFLKSISYPLGVWGFIALTYFVIVGASNAVNLTDGLDG
FT                   LVIMPVVLVGASLGVFAYVMGSAVYSKYLLFPHIPGAGELLIFCSAMGGAGLAFLWYNT
FT                   HPAQVFMGDVGALALGGALGTVAVIVRQEIVLFIMGGIFVAETLSVMLQVTWFKYTKKR
FT                   YGEGRRIFKMAPLHHHFELSGWKETQVVVRFWIITLMLCLFGLSTLKLR"
FT   CDS_pept        431184..432695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="BMULJ_00400"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="COG0771: UDP-N-acetylmuramoylalanine-D-glutamate
FT                   ligase, Ralstonia solanacearum"
FT                   /note="KEGG, K01925"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42368"
FT                   /db_xref="GOA:A9AJ18"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AJ18"
FT                   /protein_id="BAG42368.1"
FT                   /translation="MFGDRQRPMVLVLGLGESGLAIARWCARHGCRLRIADTREAPPNL
FT                   AALRAEGIDAEFVGGPFGPALLDGGVEIVGLSPGLSPLEPALATLLAAANERGVAVWGE
FT                   LEFFAQALRALGTSGYQPKVLAITGTNGKTTTTSLTGLLCQRAGKKVAVAGNISPAMLD
FT                   RLAAAIDDTALPDVWVLELSSFQLETARTFAPDAAAILNITQDHLDWHGSFDAYAAAKG
FT                   RIFGATTTRVLNRDDPVVMKFAPAAGAADAPRTITFGLNEPTQDGDYGLSRDNGIAWLV
FT                   EAIDRDAPDETAPTTRRRKRDAHTPDIAHKRLMPADALRIRGLHNAANALAAFALARAI
FT                   DLPAAPLLHALREYRGEAHRVEVIATIDDVDYVDDSKGTNVGATVAALDGLAQKTVLIA
FT                   GGDGKGQDFAPLVAPVARWCRAVMLIGRDAPAIRDTLAETGVPLVEHPTLEAAVHAAAA
FT                   LAEPGDAVLLSPACASLDMFRNYAHRADVFRAAVDELAIDKGATP"
FT   CDS_pept        432692..433975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="BMULJ_00401"
FT                   /product="cell division protein"
FT                   /note="COG0772: Bacterial cell division membrane protein,
FT                   Ralstonia solanacearum"
FT                   /note="FtsW protein"
FT                   /note="KEGG, K03588"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00401"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42369"
FT                   /db_xref="GOA:A0A0H3KGK5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGK5"
FT                   /protein_id="BAG42369.1"
FT                   /translation="MSWSDRLVSRFNDRRDAGGNAAGGRVASATRAATGGLASVVNGVR
FT                   PSRSRMLDFDYSLLWVAIALLGLGVVMVYSASIAMPDSPKYAQYHDYAFLMRHVVSLVV
FT                   AFIAAVIAFRVPVSTWDKYAPHLFLIALVGLVIVLIPHVGKGVNGARRWIPLGITNMQP
FT                   SEIMKLAVTIYAANYTVRKQEYMQSFAKGFLPMAFAVGLVGALLLLEPDMGAFMVVAAI
FT                   AMGVLFLGGVNGKLFGGLVATAIGTFTMLVWLSPWRRERIFAYLDPWDERYAQGKAYQL
FT                   THSLIAFGRGEWFGVGLGGSVEKLNYLPEAHTDFILAVIGEELGFVGVLVVILLFYWIV
FT                   RRAFEIGRQALALDRTFAGLMAKGIGIWFGAQAFINMGVNLGLLPTKGLTLPLVSYGGS
FT                   GILLNCVALAVLLRVDYENRVLMRGGKV"
FT   CDS_pept        433972..435075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="BMULJ_00402"
FT                   /product="UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /note="COG0707: UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase, Ralstonia solanacearum"
FT                   /note="KEGG, K02563"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00402"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42370"
FT                   /db_xref="GOA:A9AI96"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI96"
FT                   /protein_id="BAG42370.1"
FT                   /translation="MTASRRTLMVMAGGTGGHVFPGLAVAHRMEAAGWRVVWLGNPAGM
FT                   EATLVPKHGIPMEYVRFGGLRGKGLKTKLALPFNLLRACAQSLAALRRVRPDVVLGMGG
FT                   YITFPAGVMTALSGRPLVLHEQNSIAGLANKVLAKLAKRVLVAFPGALPHAEWTGNPIR
FT                   AELARTEPPKARYAARSGPLNVLVVGGSLGAAALNEVVPRALALLAPGERPRVVHQAGA
FT                   KHIDALKANYEAAGFAAGDDVRLVPFIDDMAAAYAAADLVICRSGAMTVSEIAAVGVAA
FT                   LFVPFPYAVDDHQTTNAAFLADAGAAVLVQQRDLSAELLADWLRGQSRASLAAMAERSR
FT                   SLAKPEATDEVARVCATVAGANLESLQ"
FT   CDS_pept        435072..436469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="BMULJ_00403"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="COG0773: UDP-N-acetylmuramate-alanine ligase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01924"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00403"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42371"
FT                   /db_xref="GOA:A9AI95"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI95"
FT                   /protein_id="BAG42371.1"
FT                   /translation="MKHIVKHIHFVGIGGAGMSGIAEVLVNLGYQVSGSDLARNAVTDR
FT                   LAALGARIAIGHDAANIEGANAVVVSTAVRSDNPEVLAARAQRVPIVQRAVMLAELMRL
FT                   KQGIAIAGTHGKTTTTSLVASVLAAGGLDPTFVIGGRLISAGANARLGTGDFIVAEADE
FT                   SDASFLNLYPVIEVITNIDADHMDTYGHDFARLKQAFIEFTQRLPFYGSAVVCVDDPNV
FT                   RQIIPFISKPVVRYGLSPDAQVRAEDIDARDGRMHFTVIREGRAPLAVVLNLPGLHNVQ
FT                   NALAAIAIATDLGVSDDAIQQALAEFNGVGRRFQRYGDVPTADGGRYTLIDDYGHHPVE
FT                   MAATIAAARGAFPGRRLVLAFQPHRYTRTRDCFDDFVNVLSTVDALVLTEVYAAGEAAI
FT                   ATANGDALSRALRAAGKVEPVFVETVDALPEALAKVAQDGDVVITMGAGSIGGVPAKIV
FT                   QNTQQKG"
FT   CDS_pept        436471..437412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="BMULJ_00404"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="COG1181: D-alanine-D-alanine ligase and related
FT                   ATP-grasp enzymes, Salmonella typhimurium LT2"
FT                   /note="KEGG, K01921"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00404"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42372"
FT                   /db_xref="GOA:A9AI94"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI94"
FT                   /protein_id="BAG42372.1"
FT                   /translation="MSGIDPKRFGKVAVLFGGESAEREVSLTSGRLVLQGLRDAGVDAH
FT                   PFDPAERPLSALKDEGFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDK
FT                   FRTKLVWQQTGVPTPPFETVMRDDDYAARATEIVAKLGLPLFVKPASEGSSVAVLKVKT
FT                   ADALPAALAEAATHDKIVIVEKSIEGGGEYTACIAGDLDLPLIKIVPAGEFYDYHAKYV
FT                   ADDTQYLIPCGLPADQEAQLKRLARRAFDVLGCTDWGRADFMLDAAGNAYFLEVNTAPG
FT                   MTDHSLPPKAARAIGISYSELVVKVLSLTLND"
FT   CDS_pept        437431..438183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="BMULJ_00405"
FT                   /product="cell division protein"
FT                   /note="COG1589: Cell division septal protein, Ralstonia
FT                   solanacearum"
FT                   /note="FtsQ protein"
FT                   /note="KEGG, K03589"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00405"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42373"
FT                   /db_xref="GOA:A0A0H3KBZ5"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBZ5"
FT                   /protein_id="BAG42373.1"
FT                   /translation="MWNNVRQLNLAASALYALLLLVLAAAGCYWLIQRPTFTLREIRID
FT                   GDTEHINTPTVRAGLVGRLKGNFFTVDLDTARAAFEQMPWVRHASVRRVWPNALAVTLE
FT                   EYKPLGTWGSSQLVSVDGELFTANQGELDRELPAFDGPEGSAKEVVARYRDFEKWFAPL
FT                   KAAPEEVTLSARYAWTVKLSNGMQVELGRERNNDTLHDRSQRLVAAWPAVTERWGNDIE
FT                   YADLRYPNGFAIRAASMRFLTDTDKRKK"
FT   CDS_pept        438210..439442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="BMULJ_00406"
FT                   /product="cell division protein"
FT                   /note="COG0849: Actin-like ATPase involved in cell
FT                   division, Ralstonia solanacearum"
FT                   /note="FtsA protein"
FT                   /note="KEGG, K03590"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00406"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42374"
FT                   /db_xref="GOA:A0A0H3KKD1"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKD1"
FT                   /protein_id="BAG42374.1"
FT                   /translation="MSKDYKDLLVSLDIGTSKVVAIVAELKGEGHYEVIGLGQSESKGL
FT                   KKGVVVNIEATVQSIQRALEEAELMADCKITNVFTGIAGSHIRSFNSSGMVAIKDKEVT
FT                   QTDVARVIETAKAINIPTDQQVLHILTQEFIIDGQEDVREPIGMSGIRLEVKVHIVTGA
FT                   VSAAQNIVKCVRRCGLEVNDLILQPLASSLAVLTEDEKDLGVVLVDIGGGTTDIAIFAE
FT                   GAIRHTAVIPIAGDQITSDIAMALRTPTPDAEDIKVGYGIAKQALADPDEMVEVPGLGE
FT                   RGPRTLSRQALAAVIEPRVEELFSLVQQVVRESGYEELLSSGVVITGGAAMMPGMVELG
FT                   EDIFLKPVRIGAPEYAGGLADVVRNPRYSTAMGLLVEGSAQRMRGRKVAVQSGNAGQIF
FT                   SRMKEWFLSNF"
FT   CDS_pept        439587..440783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="BMULJ_00407"
FT                   /product="cell division protein"
FT                   /note="COG0206: Cell division GTPase, Ralstonia
FT                   solanacearum"
FT                   /note="FtsZ protein"
FT                   /note="KEGG, K03531"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00407"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42375"
FT                   /db_xref="GOA:A0A0H3KC13"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC13"
FT                   /protein_id="BAG42375.1"
FT                   /translation="MEFEMLETETNGTIIKVVGVGGAGGNAVQHMINRGVQGVDFIVMN
FT                   TDAQALSRSRAPSVIQLGNTGLGAGAKPEMGRAAAEEARERIADALRGAHMVFITAGMG
FT                   GGTGTGAAPVVAQIAKEMGILTVGVVSKPFEFEGGKRMRVAEAGSQQLEDHVDSLIVVL
FT                   NDKLFDVMGDDAEMDKCFQCADDVLNNAVAGIAEIINVDGLVNVDFEDVKTVMGEQGKA
FT                   MMGTATVAGVDRARLAAEQAVASPLLEGVDLSGARGVLVNITSSRSLRLSETREVMNTI
FT                   KSYAAEDATVIFGAVYDDAMGDALRVTVVATGLGRAAKKQQSAPMTLLRTGTDNQPVNA
FT                   VSHGYAQPHHVSTADYGALDTPAVWRNSRETAASHVQALQEKGVDTYDIPAFLRKQAD"
FT   CDS_pept        440971..441477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00408"
FT                   /product="putative redoxin"
FT                   /note="COG0678: Peroxiredoxin, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00408"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42376"
FT                   /db_xref="GOA:A0A0H3KBQ0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBQ0"
FT                   /protein_id="BAG42376.1"
FT                   /translation="MIQVGDALPDAQLFEFVDDAREGCTLGPNAYSVREQVAGKRVVIF
FT                   GLPGAFTPTCSAQHVPGYVEHAERLRAAGIDEIWCVSVNDAFVMGAWGRDLHTAGKVRM
FT                   MADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVEAPGKFEVSDAASVL
FT                   ATLTS"
FT   CDS_pept        441718..442635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="BMULJ_00409"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /note="COG0774: UDP-3-O-acyl-N-acetylglucosamine
FT                   deacetylase, Ralstonia solanacearum"
FT                   /note="KEGG, K02535"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00409"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42377"
FT                   /db_xref="GOA:A9AI89"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI89"
FT                   /protein_id="BAG42377.1"
FT                   /translation="MLKQRTIKSIVKTVGIGLHSGRKVELTLRPAAPGTGIVFSRVDLP
FT                   TPVDIPASAMSIGDTRLASVLQKDGARVSTIEHLMSACAGLGIDNLYVDVTAEEIPIMD
FT                   GSAASFVFLIQSAGIEEQNAPKRFIKVKKPVEVRDGDKFARLDPFFGFKLKFTIDFRHP
FT                   AVDKTGQALEVDFANTSYVREIARARTFGFAHEVEMMRELGLARGGSMDNAIVLDEYRI
FT                   LNNDGLRYDDEFVKHKMLDAIGDLYVVGHPLLASYTAYKSGHGLNNALLRELLAHEDAY
FT                   EIVTFDDPQAAPSGFAFDTQTAFA"
FT   CDS_pept        complement(442712..443194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42378"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGK8"
FT                   /protein_id="BAG42378.1"
FT                   /translation="MTRFSNRFGPLPAYRPQPVSEVLGRADAFAALRAGVEQVASLQRD
FT                   LAALLPDYLAAHVEPGFVKDGTLTLFAAHNALAARLRQVEPRLLADLQKRGWPVSTLRV
FT                   RVRPKDAPEPAPQKQARMTPAGAAALRDLADHLAPSPLQAALARMAARHGAKKTPR"
FT   CDS_pept        443451..446249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="BMULJ_00411"
FT                   /product="preprotein translocase SecA subunit"
FT                   /note="COG0653: Preprotein translocase subunit SecA
FT                   (ATPase, RNA helicase), Ralstonia solanacearum"
FT                   /note="KEGG, K03070"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00411"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42379"
FT                   /db_xref="GOA:A9AI87"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI87"
FT                   /protein_id="BAG42379.1"
FT                   /translation="MTTGFLQKIFGSRNQRLVKQYQKTVAAINALETQIEKLTDDQLRG
FT                   KTDEFRQRVAAGESLDKLLPEAFAVCREASRRVLKMRHFDVQLIGGMVLHYGKIAEMRT
FT                   GEGKTLVATLPVYLNALSGRGVHVVTVNDYLAQRDAEWMARLYNFLGLSVGINLSGMEH
FT                   DQKQQAYAADITYGTNNEFGFDYLRDNMVYETGARVQRALNFAVVDEVDSILIDEARTP
FT                   LIISGQAEDHTELYVRMNALPPLLERQIGEEKADGTGVEKPGDYTLDEKSRQVFLTESG
FT                   HEKAERLLAEWGLIGEGESLYAPQNITLMHHVYAALRAHTLFHKDQHYVVQNGEVVIVD
FT                   EFTGRLMAGRRWSDGLHQAVEAKEHVKIQSENQTLASITFQNYFRMYAKLAGMTGTADT
FT                   EAYEFNEIYGLETVVIPTNRPPKRIDKQDQIYKTAKERYDAVIRDIRDCYERGQPVLVG
FT                   TTSIENSELLSHLLKQAGLPHEVLNAKQHEREAAIVAEAGRPRAITIATNMAGRGTDIV
FT                   LGGNVEKQAAFIEADESIPADEKARRIQQLHDEWESLHEQVKAAGGLHIIGTERHESRR
FT                   IDNQLRGRAGRQGDPGSSRFYLSLDDPLLRIFAGDRVRAIMDRLKMPEGEAIEAGIVTR
FT                   SIESAQRKVEARNFDIRKQLLEYDDVANDQRKVIYQQRNELLEAHDITETITAMRHSVI
FT                   ADVVRQFVPEGSIEEQWDVPELEEALRNDWQLDLAIQEMVNESSSITADEILDAVTTAA
FT                   DEQYEAKVALVGRESFSAFERSVMLQTVDRLWREHLAALDHLRQGIHLRGYAQKNPKQE
FT                   YKREAFELFAAMLEAIKQEVTRIVMNVQIQSPEQLEEAAEQIEERSSHLENVEYQHAEF
FT                   AEAGAPAAGGAAVAAATATADMVGSAMAHSGPGGEMPKVGRNDPCPCGSGKKYKHCHGK
FT                   LS"
FT   CDS_pept        446393..447634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="BMULJ_00412"
FT                   /product="glutamate N-acetyltransferase"
FT                   /EC_number="2.3.1.35"
FT                   /note="COG1364: N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase), Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00642"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00412"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42380"
FT                   /db_xref="GOA:A0A0H3KC00"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC00"
FT                   /protein_id="BAG42380.1"
FT                   /translation="MAVNFPSIDPAQLHPVAGVTLGWAEANIRKPNRKDVLVISVDEGA
FT                   TVAGVFTENRFCAAPVTVCREHLAKVRAGGAGIRALVVNTGNANAGTGEPGLANARETC
FT                   AELARLAGIEPSQVLPFSTGVILEPLPIDRLKAGLPAALANRAAANWYDAAQAIMTTDT
FT                   LPKAASQRVTIDGHTVTLTGISKGAGMIKPNMATMLGFLAFDAAVAQPVLDTLVKEVAD
FT                   RSFNCITIDGDTSTNDSFMLIASGKSTLPAITSTDSPAYAALRDAVTALAQALSQLIVR
FT                   DGEGATKFITVQVEGGRSVAECRQIAYAIGHSPLVKTAFYASDPNLGRILAAIGYAGVA
FT                   DLDVDKIDLYLDDVLVAKAGGRNPAYREEDGQRVMKQSEITIRVLLGRGDAQATIWTCD
FT                   LSHDYVSINADYRS"
FT   CDS_pept        447654..448523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00413"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2607: Predicted ATPase (AAA+ superfamily),
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K06923"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00413"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42381"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKD6"
FT                   /protein_id="BAG42381.1"
FT                   /translation="MDKLEQFLTRAEALLGRLESMLPPAPAAVDWNAAHAFRWRKRQGR
FT                   GYLQPVPAVSTITLDDLHNIDRQKGLIEQNTRQFVQKKPANNVLLTGARGTGKSSLIKA
FT                   CLNAFAKDGLRLIEVDKDDLHDLGDIVELISPRPERFIVFCDDLSFEDGESGYKALKVA
FT                   LDGSIAAQSDNVLIYATSNRRHLLPEYMSDNETYKHLPDGEIHPGEVVEEKISLSERFG
FT                   LWVSFYPFKQDDYLDIVAHWLRHFGCPEAEIETARGDALVWALERGSRSGRVAWQFARD
FT                   WSGRKEQA"
FT   CDS_pept        448520..448981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="BMULJ_00414"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /note="COG0494: NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes, Ralstonia solanacearum"
FT                   /note="KEGG, K03574"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00414"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42382"
FT                   /db_xref="GOA:A0A0H3KC17"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC17"
FT                   /protein_id="BAG42382.1"
FT                   /translation="MSGVDRVASAAHAPDGRKVTEVAVGVMVQSDEATGRSRYLLAQRL
FT                   QGKPYEGYWEFPGGKLEAGESVEDALARELHEELGIVVTASHRWHTLEHDYPHAYVRLY
FT                   FCKVTGWTGEPHSKEGQAFVWQPLPVDVAPLLPAALPVLALLEQEAASR"
FT   CDS_pept        complement(449043..449240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00415"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42383"
FT                   /db_xref="GOA:A0A0H3KBQ4"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBQ4"
FT                   /protein_id="BAG42383.1"
FT                   /translation="MVTVVKCPSCGVAVRWTPENQFRPFCSARCKQLDLGAWASEKYRI
FT                   GGSDDAPLSDEDGTDERRDN"
FT   CDS_pept        complement(449268..450023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00416"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4582: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00416"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42384"
FT                   /db_xref="GOA:A9AI82"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI82"
FT                   /protein_id="BAG42384.1"
FT                   /translation="MILYEYPFNERIRTLLRLEDLFERFAFFLAQEDPREHHVALTTLF
FT                   EIAEVTGRADLKSDLMKELERQRQTLAPFRGNPGIEQNALEAVLGEIEQTLANLAQMQG
FT                   KTGQHLVDNEWLASIRSRAVIPGGTCKFDLPSYYAWQQWPAEQRRQDIAKWIMPLLPLR
FT                   DAATIVLRLARESGQASKVMAMQGSYQQMLSGRSYQLMQVRVPRELHVIPEASANKYML
FT                   WVRFTMQDGDVRPRAVDIDVPFQLTLCNL"
FT   CDS_pept        complement(450130..450738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="BMULJ_00417"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COG0237: Dephospho-CoA kinase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00859"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00417"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42385"
FT                   /db_xref="GOA:A0A0H3KGL1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGL1"
FT                   /protein_id="BAG42385.1"
FT                   /translation="MFSVGLTGGIGSGKTTVADLFAARGASIVDTDVIAHRITAPGGLA
FT                   MREIERTFGPDFVAADGSLDRAKMRAIVFSDDAARRRLEAITHPLIRAETDREAREAQG
FT                   AYVIYVVPLLVESGNWKARADRILVVDCPVETQIARVMRRNDFTREQVEAIIARQATRE
FT                   ARLAAADDVIVNDAATPAALAAQVDALHQRYLQHAATMR"
FT   CDS_pept        complement(450742..451653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="BMULJ_00418"
FT                   /product="leader peptidase"
FT                   /note="COG1989: Type II secretory pathway, prepilin signal
FT                   peptidase PulO and related peptidases, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02654"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00418"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42386"
FT                   /db_xref="GOA:A0A0H3KC03"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC03"
FT                   /protein_id="BAG42386.1"
FT                   /translation="MTPAPLYAASSAPESTLLALAMLPPVVQYAFAVVLGLCVGSFVNV
FT                   VVHRLPVMMQRAWQREIADAIGNAAAAPDDGYPLRYDLCRPRSACPHCGHVLRAWENIP
FT                   LVSYLLLRGRCRQCSHPIGARYPLVELAGGLLAAGSLAAFGMTGTALAAFGLCAALLAM
FT                   SAIDMRTGYLPDSMTLPLLWAGLALNLGGTFASLRSAVIGAMAGYLFLWSIYWLFKWLR
FT                   GIEGIGFGDLKLLAALGAWLGWTALPQVVLFAAVTGALVGLVATWRGRMRFEEPIPFGP
FT                   FLAAGGAATLFFGTPFYSALGG"
FT   CDS_pept        complement(451699..452910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="BMULJ_00419"
FT                   /product="type IV pilus assembly protein"
FT                   /note="COG1459: Type II secretory pathway, component PulF,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K02653"
FT                   /note="PilC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00419"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42387"
FT                   /db_xref="GOA:A0A0H3KKE0"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKE0"
FT                   /protein_id="BAG42387.1"
FT                   /translation="MTMRARPREMRFAWRGRRRDGTPRSGTVVAFDAAAARAALARDGI
FT                   AVLSLDARGPAKPPTARARDVTRFTRQLASLLQAGLPLAPALDMLSRTRTHGGLPRIAA
FT                   GLAREIVDGQRFAAALALYPSQFGTLYRQLIEVGEASGALGTVLMRIAEHRERADAQWR
FT                   KLRAALAYPAVVILFALAIAAALMVWVVPTFRQIFDGFGTALPAPTRALLALSSALSAS
FT                   GGALAAGAAAAALAAHHALRRSPTLRYALARQALRAPLIGDTLTRYAAARWCRSLATLL
FT                   GAGVPLADAFATLERTAGHHVFERASTQIAARVLRGARLADAMQASGCFPDDIVQPIAV
FT                   AEETGALDTMLADIATLSEHQLDARIDTLAALGEPLIVIVLGALVGGLVIAMYLPILQL
FT                   GNVV"
FT   CDS_pept        complement(452913..454178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="BMULJ_00420"
FT                   /product="type IV pilus assembly protein"
FT                   /note="COG2804: Type II secretory pathway, ATPase PulE/Tfp
FT                   pilus assembly pathway, ATPase PilB, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02652"
FT                   /note="PilB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42388"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC21"
FT                   /protein_id="BAG42388.1"
FT                   /translation="MNFPASRAAPRAPAPSDAAAAAPRSLDAAQLDDAPAVRLLTDTLH
FT                   AAHARDASDIHIEPFEGGWRIRLRIDGVLHEHGRPPVHLRDALVTRIKVLARMDIAERR
FT                   LPQDGRLRIALGGGTRGDYRVSSLPTLFGEKLVLRRLETLPPDLTLAALGFDAQQARAM
FT                   EAAIRAPHGLVLVTGPTGSGKTLSLYCALQMLDRDAHNVCTVEDPAEIQLDGINQVGVA
FT                   EKAGLTFATALRALLRQDPDVIMVGEIRDAETADVAIKAAQTGHLVLSTLHTNDAPAAI
FT                   ARLLDIGVAPYNLAAALRLVTAQRLVRRLCIGCLEPSDAPAALLRDAGCDAPALESGWR
FT                   PFVARGCAACHGIGYRGRIGLHQTMPVSSRLAECIVARASVGELARCAAAEGVRTLRDA
FT                   ALARVRDGTTSVAEALAATPNA"
FT   CDS_pept        complement(454398..455696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00421"
FT                   /product="putative Mg2+ and Co2+ transporter"
FT                   /note="COG4536: Putative Mg2+ and Co2+ transporter CorB,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00421"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42389"
FT                   /db_xref="GOA:A0A0H3KBQ8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBQ8"
FT                   /protein_id="BAG42389.1"
FT                   /translation="MDQIPLWAQIGAVFLLLLCSSFFSISETAMMALNRHRLKHLVGQG
FT                   ALGAKATQGLLTRTDLLLSVILIGNNLFNTIIPVLTTSIALHTFGRNNLALSIATGIVA
FT                   FLIIVFAEIAPKIVGATFPERIALPASLVIAPLMRVFKPVVWFVNALANGVLWALRINT
FT                   KKGRDQRMSADELRAIVLESSSFMPTKHRSILLNLFDLENITVDDVMVPRRQIESLNFH
FT                   APLDDILHQLETCYHNRLVVYEGDIDKVLGVLHVRKTLTALHNQDFDRETLRALLAEPY
FT                   YVPSGTPVVQQLQYFQESRQRTALVVNEYGELEGLVTPEDIIEELIGEFTTSMPRSERA
FT                   GGWDENGECIVAASMPLRELNRWLHLKLPTDGPKTLNGLILEILEEIPEDDVCLKIGDV
FT                   MLEVMRSDDQAVRTVKLFRPRGAGSRAKGGVRR"
FT   CDS_pept        456037..456183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00422"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00422"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGL5"
FT                   /protein_id="BAG42390.1"
FT                   /translation="MQFFSNEALFDCVRTGLVFFANIGSTDNLPDAGQIGFALRSESCF
FT                   CSF"
FT   CDS_pept        456489..456947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00423"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC07"
FT                   /protein_id="BAG42391.1"
FT                   /translation="MTDPREEALAVVAAHLAREEERWRRENPDKVRFYLLSAPDDPPIF
FT                   SADGQSILRTVVAALRENRIDADTPFMTLDAVDAVGGYTGEIAVLIQAVSPVLTGILGA
FT                   WLQSKAGRKVRLKIGDIEVEAGTVQEAEQLLRHAQALQTSQGGTKNEA"
FT   CDS_pept        456937..457317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00424"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42392"
FT                   /db_xref="InterPro:IPR019650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKE4"
FT                   /protein_id="BAG42392.1"
FT                   /translation="MKRDMDLIRELMLKLESLPMEYGDNVHIAPNSSEVHVDGYSFDQI
FT                   GYHLDLIVQAGFTERSKSHPAIGFMFRGLSWSGHDFLDSVRSPDVWGRTKQIASEAGGF
FT                   TVDLLVLAAKSFLEAKIKGLIG"
FT   CDS_pept        457401..458279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00425"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42393"
FT                   /db_xref="GOA:A0A0H3KC26"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC26"
FT                   /protein_id="BAG42393.1"
FT                   /translation="MHAFAIIVTAVLDWLKLVPNVVWSGIVGSLVTVVGVLFTNLGLSK
FT                   RHREQLAHSARESAVEREMDLRRDIYIPAIEATVVAFSAIGSMSDPTVKQSDVNEKFSD
FT                   ALAKIGKANAIATAETVHAIGDLTDGIRELFTRLIITRQPILALHGRMAAENGVVDRAV
FT                   GDHGRWVQIQTELLFQGPLDPQKAAFLAGQINFTQGQIDQWSDKRSVSALELNLAQVEF
FT                   LKTLLQLQPSVSRKVNVACVSIRRELALAGDDLESVGQVFTRNAEQAQEFLRRMIADFE
FT                   AQLQATRNAAR"
FT   CDS_pept        complement(458332..458778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00426"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBR2"
FT                   /protein_id="BAG42394.1"
FT                   /translation="MSAIANLKIVAAKRPGALPQIVQRRNRLIAQIWEQTELAKAQQAG
FT                   TSFAPTKFRSVKDAETGERRNVEVQKRVRAWWWTAENGRVHMVVKYGAKTLELAKGKQA
FT                   IEVGMLEDLIPTLDTLKAAVAAGELDAQIEGASNLMRSGFVSKK"
FT   CDS_pept        458813..459391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00427"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00427"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGL9"
FT                   /protein_id="BAG42395.1"
FT                   /translation="MYSATGEINKISELYRTFCLAVINTAMTKNEEIKKSTQEWMLLHA
FT                   SHFTHAVTLTLKPYREVMTCKGLTIQRLTAIEAKENFRQFMRRLNTVVYGNATKRFGAG
FT                   VHVIPVIEGVVTEKLLHYHCMMGNFRAGADDALIASAIRAAWLQTDFGNMQIDIQPLTA
FT                   DGWIDYITKEVGIGDADNVDYDNVHIPKD"
FT   CDS_pept        459912..460478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00428"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00428"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42396"
FT                   /db_xref="GOA:A0A0H3KC10"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC10"
FT                   /protein_id="BAG42396.1"
FT                   /translation="MKQAKTFTEKELKQVLTYISLRRHALRNRAMVLLTHWAGMRVGEV
FT                   AALLVGDVLDADGSLKSEIRLAPEQTKGRHARTVFLGQKLRRELAAYVASLKNPQPEQP
FT                   LFYTQKRAGFTANTLCQYFHWLYKGAGIQGASSHSGRRSFITNLASKGVGVRVLMSLAG
FT                   HRDISTTQRYIDVNDDMQRKAVDLV"
FT   CDS_pept        complement(460975..461322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00429"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42397"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKE8"
FT                   /protein_id="BAG42397.1"
FT                   /translation="MTRPADIYLRFLQLTEALRGLPSLPALDPLEEKILEFVARMTQKN
FT                   ERLSVRDMMAQSDLGSPATLHARLKSMREKGWLTLGDTDDSRRKQIELTPAALKHFDKL
FT                   AEAFARAAKGT"
FT   CDS_pept        461424..462026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42398"
FT                   /db_xref="GOA:A0A0H3KC31"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC31"
FT                   /protein_id="BAG42398.1"
FT                   /translation="MSNWRLRLASVIGTALVFVVSLWVNQEVFTHSEFVRGVNWIYLPS
FT                   GVRLLATLLLGSDGAIGLLVASWLVDFLYFFPNDPIRSIAGGIIATVAPYATYRLAREH
FT                   YGLHASLTNLTPKRLLILALAFSVANPLLTNIWLALRGQTTNIGERFFAMFVGDLSGTL
FT                   IILYTIKILLSVLPGPAERRNMTRKDRADGDKRIVSG"
FT   CDS_pept        complement(464013..464837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00431"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00431"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42399"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBR6"
FT                   /protein_id="BAG42399.1"
FT                   /translation="MSNTNQQTEIINISEHQSPASLAQTITALKTRYMGAHTALYEALR
FT                   DIYAAYHVYILNATQAEREKNRAVLDQKCKDNDIGTNDQTTDLHKLVKLVVTVSPQLTS
FT                   GYVHVFSVARELQKTPDEFPGWLKDAGGIETVRKKFLTDGKLNPNYESGSKREKNRLDK
FT                   IASARNALQATCCTIGAPVFAGASLDPVDKPTECIAIAVRNPDGSIGIKGFISSKSLID
FT                   SAYLEHATEQNRKAMPAACAKSAATVGHNVGHTPAQSPAEDLATIADRLIAD"
FT   CDS_pept        complement(465904..467343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00432"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42400"
FT                   /db_xref="GOA:A0A0H3KGM2"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGM2"
FT                   /protein_id="BAG42400.1"
FT                   /translation="MSITTTNTTLPQATSANRTVPLKDTLQSIKGYPDKLKIYLMPAST
FT                   YWQVRYFDGFKTLKRSTKTSDKREAITFAKTFYEQIIAGKFTSASQAQQTSFEYWTQKM
FT                   LESQRGRVDRGEFSEQAHRNDQYMLDAKILPELRGRHVKDVTFDALDQFVIKLSAEKLD
FT                   GSTIQRYLGIAHKVLEHSLNRGAIDALPRFPKIKKQDKPRAWFNLSEYKQLYTRAKALV
FT                   GTEHVIASPNGSSRQNETRKIKVTSDLPNMIVFMVNGFIRPTDLKNMQHKHVEIIRDEH
FT                   TYLRLSLPESKGHDKPIATMERAVDVYERQCQLYESDGLTTPDDYVFMPQYANRNTALK
FT                   RLQHQFNFLLDDLGMKTDARGNERTIYSLRHTCIMLRLLNANGMDMLTLARNARTSVEM
FT                   IERFYASELTGEMNIDVIQSQRKSKQKPVSKTEAADAETAEKSRAKSKPKATPVRSPVI
FT                   AGSSSEILSLPTSSVPPLSLS"
FT   tRNA            complement(467482..467558)
FT                   /locus_tag="BMULJ_00433"
FT                   /product="tRNA-Pro"
FT                   /note="anticodon CGG"
FT   CDS_pept        complement(467728..468723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerC"
FT                   /locus_tag="BMULJ_00434"
FT                   /product="heptaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.30"
FT                   /note="COG0142: Geranylgeranyl pyrophosphate synthase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00805"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00434"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42401"
FT                   /db_xref="GOA:A0A0H3KC14"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC14"
FT                   /protein_id="BAG42401.1"
FT                   /translation="MSSSTASPSLSAAHLLAPIASDMEQVNRVIRQSLASDVLLINQIA
FT                   EYIIGAGGKRLRPALLLLVAGALGETSHQRHVLAAVVEFIHTATLLHDDVVDESELRRG
FT                   RETANALFGNAASVLVGDYLYSRSFEMMVGVGKMRVMEILSEATTIISEGEVLQLLNMH
FT                   DADVDETRYMQVIRYKTAKLFEASARLGAVLAGADAPTEAAAAEYGRRIGTAFQIMDDW
FT                   LDYAGTAEAMGKNAGDDLREGKPTLPLIYLIERGTPEQAALAREAIEQGGTDRFDTIFD
FT                   AITRSGALDHTLECARQEALAAAAAITAFPDSTYKESLLALCSYSTSRQS"
FT   CDS_pept        468933..469244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BMULJ_00435"
FT                   /product="large subunit ribosomal protein L21"
FT                   /note="COG0261: Ribosomal protein L21, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02888"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00435"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42402"
FT                   /db_xref="GOA:A9AI62"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI62"
FT                   /protein_id="BAG42402.1"
FT                   /translation="MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGEGE
FT                   SIKFGTPLVSGASVKATVVSHGRHAKVTIFKMRRRKHYQKHGGHRQNYTELRIDAINA"
FT   CDS_pept        469269..469532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BMULJ_00436"
FT                   /product="large subunit ribosomal protein L27"
FT                   /note="COG0211: Ribosomal protein L27, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02899"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00436"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42403"
FT                   /db_xref="GOA:A9AI61"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI61"
FT                   /protein_id="BAG42403.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKVYGGQAINAGGIIVRQRGTRM
FT                   HAGENVGMGKDHTLFALVDGHVKFATKGADKKHTVIVVPAAA"
FT   CDS_pept        469719..470828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="BMULJ_00437"
FT                   /product="GTP-binding protein"
FT                   /note="COG0536: Predicted GTPase, Ralstonia solanacearum"
FT                   /note="KEGG, K03979"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00437"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42404"
FT                   /db_xref="GOA:A9AI60"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI60"
FT                   /protein_id="BAG42404.1"
FT                   /translation="MKFIDEARIEVIAGDGGDGSASMRREKFVPFGGPDGGDGGRGGSV
FT                   YAIADRNINTLIDYRYAKKHLARNGENGRGSDCYGKGGDDITLRMPVGTVITDMDTGEL
FT                   IADLTEHDQQVLLAKGGAGGLGNLHFKSSTNRAPRQKTDGKPGERRMLKLELKVLADVG
FT                   LLGMPNAGKSTFISSVSNAKPKIADYPFTTLAPNLGVVRVGPSKSFVIADIPGLIEGAA
FT                   EGAGLGHQFLRHLQRTGLLLHLVDIAPFDEGVDPVAEATAIVGELRKYDEALYEKPRWL
FT                   VLNKLDMVPEDERAARVADFLERFDWHGPVFEISALTGQGCEALCYAIYDYLAEHSDAH
FT                   RAAEAEDLAADVRFRDAPPAANAAPGDDA"
FT   CDS_pept        470921..472039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BMULJ_00438"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="COG0263: Glutamate 5-kinase, Ralstonia solanacearum"
FT                   /note="KEGG, K00931"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00438"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42405"
FT                   /db_xref="GOA:A9AI59"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI59"
FT                   /protein_id="BAG42405.1"
FT                   /translation="MRSIIADSKRLVVKVGSSLVTNDGKGLDHAAIGRWAAQIAALRAQ
FT                   GKEVVLVSSGAIAEGMQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFTEHGIRTAQ
FT                   ILLTHADLADRERYLNARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANL
FT                   IEGDALIILTDQSGLFTADPRKDPAATLVAEANAGAPELEAMAGGAGSSLGRGGMLTKI
FT                   LAAKRAAHSGANTVIASGREPDVLVRLAGGEAIGTQLIARTARMAARKQWMADHLQVRG
FT                   HVVIDAGAVEKLTAGGKSLLPIGVTDVQGAFARGEVIACVGPDGREVARGLTNYSSAET
FT                   KLIHRKPSGEIESVLGYMLEPELIHRDNLVLV"
FT   CDS_pept        complement(472149..472757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00439"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00439"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42406"
FT                   /db_xref="GOA:A0A0H3KKF2"
FT                   /db_xref="InterPro:IPR014861"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKF2"
FT                   /protein_id="BAG42406.1"
FT                   /translation="MTGRDLGVAPFFYEECILKAIALALASIAAAAALAGCANSKTPTN
FT                   KDDSAFVYLLDRQGNWKENPVDTLPALPQTADLLPFNVSQNTPLKFFVDAKSLTVGSDG
FT                   VVRYTVVVTSPAGARNVNYEGIRCDTYEWRQYAGLNSDHDGWDRTVENDWRRIENGELN
FT                   AYHAALYQDYLCANKMPQGTAQQIVENIRFHRTAMSQLR"
FT   CDS_pept        complement(472771..473418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="BMULJ_00440"
FT                   /product="putative (di)nucleoside polyphosphate hydrolase"
FT                   /note="COG0494: NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes, Ralstonia solanacearum"
FT                   /note="KEGG, K08311"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42407"
FT                   /db_xref="GOA:A9AI57"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI57"
FT                   /protein_id="BAG42407.1"
FT                   /translation="MLDREGFRPNVGIILLNARNEVFWGKRLREHSWQFPQGGIKYGET
FT                   PMQAMYRELHEETGLLPEHVKIIGRTRDWLRYEVPDKFIKREVRGHYRGQKQIWFLLRM
FT                   LGRDCDICLRATDHPEFDAWRWNEYWVPLDAVIEFKRDVYQLALTELSRFLRRPAQRAD
FT                   KPRGPRLPRYPRVIAAQPAETLTIVDTSVVCSEVEVEASTLDEMPPRVIVGK"
FT   CDS_pept        473637..475373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="BMULJ_00441"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COG0442: Prolyl-tRNA synthetase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01881"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00441"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42408"
FT                   /db_xref="GOA:A9AI56"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI56"
FT                   /protein_id="BAG42408.1"
FT                   /translation="MKASRFFIGTLKEAPADAEIVSHKLMVRAGMIRRVAGGIYNYLPI
FT                   GLRSIRKVEAIVREEMNRAGAVELLMPAVQPAELWQESGRWEQYGPELLRFKDRKDNDF
FT                   VIGPTHEEVVTDIARNQIKSYRQMPVNFYQIQTKFRDEIRPRFGVMRGREFIMKDAYSF
FT                   DKDAEGLRESYRKMYDAYVRIFTRLGLEFRAVAADSGSIGGNFSHEFHVIADTGEDAIA
FT                   YCPSSEFAANVEAAEALPLIAERAAPAEALTKVATPGKAKCEAVAELLNIPLERTIKSI
FT                   VLATDNEGAEPTIWLVMLRGDHDLNEIKVSKLPGLKNHRFATEQEIVEWFGTPPGYLGP
FT                   IGTKKPVKVIADRTVANMSDFVVGANEVDYHIAGVNWGRDLPEPEVADVRNVKKGDPSP
FT                   DGKGAIDICRGIEVGHVFQLGTKYSEAMGATFLDESGKPQPMLMGCYGIGVTRILGAAI
FT                   EQNFDDKGIIWPESIAPFEVVLCPMGYDRSDAVREAADKLYAELTAAGIDVILDDRGER
FT                   PGVMFADWELIGVPHRLVIGERGLKDGKIEYQGRRDTEATLLPAGEAAATVAEKVRAAL
FT                   AH"
FT   CDS_pept        475395..476003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00442"
FT                   /product="MarC family integral membrane protein"
FT                   /note="COG2095: Multiple antibiotic transporter, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00442"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42409"
FT                   /db_xref="GOA:A0A0H3KC35"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC35"
FT                   /protein_id="BAG42409.1"
FT                   /translation="MEYTFLSATVLLVLITDPLGNIPLFISAMRDVPRERRVKLILREV
FT                   GIAFVILLFFMVVGDRFLRMMSLTDLSLRLGGGIVLFLIALRMIFPHPDGALGSDPRAG
FT                   GEPFIVPLAIPALAGPSALATVMLLTSQAPGKMFEWVGALTVTMILCAITLVLAERIQQ
FT                   WLGERTVAAFERLMGLVLVAISVEMLLAGIRAFVHQLQT"
FT   CDS_pept        complement(476098..476649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="BMULJ_00443"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="COG0634: Hypoxanthine-guanine
FT                   phosphoribosyltransferase, Ralstonia solanacearum"
FT                   /note="KEGG, K00760"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00443"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42410"
FT                   /db_xref="GOA:A0A0H3KBS0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBS0"
FT                   /protein_id="BAG42410.1"
FT                   /translation="MNREEALHIFEHSEEIVSADAVNASIVRMADAIRAEIGDAFPLVL
FT                   SVMGGAAVFTGMLLPHLDFPLEFDYIHLTRYRNTTQGSPEMHWRVAPRESVKDRIVLVL
FT                   DDILDEGETMAAIRDRILDMGAKRFMSAVLCEKTLAKAKPLHPDFCGFSVPDRYVFGCG
FT                   MDAKGYWRNLPTIRALTANV"
FT   CDS_pept        complement(476744..478111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BMULJ_00444"
FT                   /product="signal recognition particle subunit SRP54"
FT                   /note="COG0541: Signal recognition particle GTPase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03106"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00444"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42411"
FT                   /db_xref="GOA:A0A0H3KGM6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGM6"
FT                   /protein_id="BAG42411.1"
FT                   /translation="MLDNLTQRMARVVKTLRGEARLTEANTQEMLREVRLALLEADVAL
FT                   PVVREFIAKVKEKALGEEVISSLSPGQALVGVVQKELTAVIGGDYEGKAAELNLAVSPP
FT                   AVILMAGLQGAGKTTTAGKLAKLLREKYKKKVLTVSCDVYRPAAIMQLKTVSEQVGADF
FT                   FPSTPDQKPVDIAVAAVDWAKRHYHDVLIVDTAGRLGIDEAMMQEIAALHGVLKPAETL
FT                   FVVDAMLGQDAVNTAKAFNDTLPLTGVVLTKLDGDSRGGAALSVRHVTGKPIKFVGVAE
FT                   KLDGLEVFHPDRMANRILGMGDILALVEEAQRGVDVQAAQKLADKVKKGGDFDLNDFRA
FT                   QISQMKNMGGLSSLMDKLPAQFQQAAAGADMGQAEKQIRRMEGIINSMTPAERAKPEII
FT                   KATRKRRIAAGAGVPVQEVNRMLNQYDQMRTMMKKLKGGNMQKMMRGLKGMMPGLR"
FT   CDS_pept        478201..479097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00445"
FT                   /product="ABC-type uncharacterized transport system
FT                   permease component"
FT                   /note="COG4137: ABC-type uncharacterized transport system,
FT                   permease component, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00445"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42412"
FT                   /db_xref="GOA:A0A0H3KC20"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC20"
FT                   /protein_id="BAG42412.1"
FT                   /translation="MDIVLYALTAFLYGGLAVAGWRTHRQGAASPLVASVPAVPVPASA
FT                   ASGVSGVGRALLFAALVAHGVLLHMTIFPHDAMIFGFAFALSAMFWLGAGIYWIESFFF
FT                   PLDSLRLLVLPLACGASLLPLVFGGVRVLPYAAAPLFKLHFLIANIAYGLFAIAALHAV
FT                   LMLMVERRLQSLRSGGRDGSTGWIASWLETLPPLLTLEKLLFRLIGAGFVLLTLTLASG
FT                   ILFSEQVDARALRLDHKTVFAILSWLMFGGLLIARKTSGWRGRGAARWVLVSFGALLLA
FT                   YVGSRFVFEVLLHRSVV"
FT   CDS_pept        479111..479419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG, K06950"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00446"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKF6"
FT                   /protein_id="BAG42413.1"
FT                   /translation="MRQILLLILLFFAGSWLARKLRHAQEQARAGRGADASSGAPGYGA
FT                   GAARPNGDARSLPEPMVRCAECGVHAPKGDAIAAASGEYFCSTEHAQRHAARAGGAR"
FT   CDS_pept        479416..480006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="BMULJ_00447"
FT                   /product="AmpD protein"
FT                   /note="COG3023: Negative regulator of beta-lactamase
FT                   expression, Ralstonia solanacearum"
FT                   /note="KEGG, K03806"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00447"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42414"
FT                   /db_xref="GOA:A0A0H3KC40"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC40"
FT                   /protein_id="BAG42414.1"
FT                   /translation="MTDARRLSVDAAGWVREARHARSPNFEARPAGAVPSLVIVHNISL
FT                   PPGEFGGDAIEALFLNRLDCDAHPYYQRHLRDVRVSAHFLIRRDGELVQFVSCDERAWH
FT                   AGASEFFGRPRCNDFSIGIELEGADDVPFDDAQYATLAVLARTLAARYPVDAFAGHSDV
FT                   APGRKTDPGPHFDWQRFARDAGFGAEYFPFRQQ"
FT   CDS_pept        480450..483443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="BMULJ_00448"
FT                   /product="ribonucleoside-diphosphate reductase alpha chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0209: Ribonucleotide reductase, alpha subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00525"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00448"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42415"
FT                   /db_xref="GOA:A0A0H3KBS4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBS4"
FT                   /protein_id="BAG42415.1"
FT                   /translation="MHMQTTDNATSQYESASSRPLGGAEQGAPALAPQATFADYKVIRR
FT                   NGSVVAFEPSKIAIAVTKAFLAVNGGQGAASARVRELVDQLTRNVVRALVRSRPNGGTF
FT                   HIEDIQDQVELALMRGGEHNVARAYVLYREKRHLERQHAGEETAAVRETTGGINVVDNG
FT                   VTRPLDMNALRALIVSACDGLGAAVNPDPIVAETVKNLYDGVPMSQVYDSAILAARTMI
FT                   EKDPAYSQVTARILLHTIRREILGEEVVQADMSTRYAEYFPQFLKRGVEAGLLDDKLLQ
FT                   FDLKRLGEALDASRDLQFGYLGLQTLYDRYFLHVDGTRIEMPQAFFMRVAMGLSLNEID
FT                   REARAIEFYNVLSSFDFMSSTPTLFNSGTHRSQLSSCYLTTVADDLDGIYEALKENALL
FT                   SKFAGGLGNDWTRVRALGSHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYL
FT                   ESWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGEWTLFSPSTCPDLH
FT                   DKFGADFEAAYTAYEEKVARGEIKLFKKIPAQQLWRKMLGMLFETGHPWITFKDPCNVR
FT                   SPQQHVGVVHSSNLCTEITLNTSDTEIAVCNLGSVNLVAHLVKQPDGTYALDHDKLKRT
FT                   ISVAMRMLDNVIDINYYAVPKARNSNLKHRPVGLGIMGFQDCLHLLRTPYASEAAVEFA
FT                   DRSMEAVCYYAYYASTELAEERGRYSSYRGSLWDRGILPQDTLKLLAEARGGYVEVDSS
FT                   ESLDWATLRARIATHGMRNSNCVAIAPTATISNIIGVSACIEPTFQNLYVKSNLSGEFT
FT                   VVNEYLVRDLKERGLWDEVMVADLKYFDGMLSRIDRIPADLRAIYATAFEVDPKWLVEA
FT                   ASRRQKWIDQAQSLNIYMAGASGKKLDEVYKLAWLRGLKTTYYLRTMAATHVEKSTVAH
FT                   GALNAVPTSGGGAAGGAQGAAGGFGAAGGDVSSGALDAAALAPVEAEGPVCTMRPGDPG
FT                   FDECEACQ"
FT   CDS_pept        483807..485018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="BMULJ_00449"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0208: Ribonucleotide reductase, beta subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00526"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00449"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42416"
FT                   /db_xref="GOA:A0A0H3KGN0"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGN0"
FT                   /protein_id="BAG42416.1"
FT                   /translation="MLNWDDEMTAVTPASGAQQNAMRTSAGMAVGMQAASPAAHQVRDI
FT                   FEGDLAVPPQASAVPAGGSEARVNVADKRIINGQTDVNQLVPFKYKWAWEKYLAGCANH
FT                   WMPQEINMSRDIALWKDPNGLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPE
FT                   CRQFLLRQAFEEAIHTHAYQYIVESLGLDEGEIFNAYHEVPSIRAKDEFLIPFIHTLTD
FT                   PAFKTGTLEADQKLLKSLIVFACIMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRD
FT                   ESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYAEDTMPRGVLGLNA
FT                   SMFKSYLRFICNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGA
FT                   LSWE"
FT   CDS_pept        485101..485427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC23"
FT                   /protein_id="BAG42417.1"
FT                   /translation="MQSMPGALTAQRHDRHFANPSVGWANFPPEKADGRVAVRLIKRLG
FT                   AAAQRAPAADLIWRAKPGGLARHTVFISVSVRYPRTPMNSPLRSARAEQRPREAGFDEG
FT                   CSLN"
FT   CDS_pept        485456..486070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00451"
FT                   /product="histone H1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00451"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42418"
FT                   /db_xref="GOA:A0A0H3KKG0"
FT                   /db_xref="InterPro:IPR005819"
FT                   /db_xref="InterPro:IPR009970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKG0"
FT                   /protein_id="BAG42418.1"
FT                   /translation="MATAKKKPAAKKAAAKKTVAKKAAAPAKKAAAVKKVAAKKVAVKK
FT                   VAAKKAAPAKKAAAKKVAAKKAAPAKKAAAKKVATKKVAAKKVATKKVAAKKAAPAKKA
FT                   AAKKVAAKKVATKKVAAKKAAPAKKAAAKKAAPAKKAAAKKAAPAKKAAPAKKAAAPKK
FT                   AVVKKAAPATTASTASVAPASGVKTALNPAAAWPFPTGSRP"
FT   CDS_pept        complement(486285..486758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyB"
FT                   /locus_tag="BMULJ_00452"
FT                   /product="outer membrane lipoprotein"
FT                   /note="COG3133: Outer membrane lipoprotein, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06077"
FT                   /note="SlyB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00452"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42419"
FT                   /db_xref="GOA:A0A0H3KC43"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC43"
FT                   /protein_id="BAG42419.1"
FT                   /translation="MLTKKTLTLAAMVTTTVTLAGCFTPPGSADVYSVGQAQREQTVRM
FT                   GTVESVRAVRIQSDGGGSAIGTLGGGALGAVAGSAIGGGRGSILTAIAGGLAGAVAGNA
FT                   IGENMSTANGVEITVRLDNGDLRSITQAATGEVFRAGERVRLLSSGGVTRVTH"
FT   CDS_pept        complement(486778..487674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BMULJ_00453"
FT                   /product="adenosine kinase"
FT                   /EC_number="2.7.1.20"
FT                   /note="COG0524: Sugar kinases, ribokinase family, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00856"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00453"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42420"
FT                   /db_xref="GOA:A0A0H3KBS9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBS9"
FT                   /protein_id="BAG42420.1"
FT                   /translation="MTFEGRFREHILPDQVHLLNVSFLVPTMRREFGGCAGNIAYALHM
FT                   LGGDARIMATVGANDADRYLERLDSLGLSKANVRVVPDAHTAQAMITTDLDNNQITAFH
FT                   PGAMMLSHLNRADEVPGVKLGIVAPDGFDGMVQHAEQFAKAGIPFIFDPGQGLPLFDGA
FT                   TLRRIIELATFVAVNDYEGKLVSDKTGWSEQEIASRVQALIITRGEHGSTILHKNGEEQ
FT                   IPVVRAERVVDPTGCGDAFRGGLLYGIENGLDWATTGRLASLMGSLKIAYQGPQTYALT
FT                   RAEIDARFEAAFGYSLK"
FT   CDS_pept        complement(487784..488287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="BMULJ_00454"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.-"
FT                   /note="COG2077: Peroxiredoxin, Ralstonia solanacearum"
FT                   /note="KEGG, K00435"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00454"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42421"
FT                   /db_xref="GOA:A0A0H3KGN4"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGN4"
FT                   /protein_id="BAG42421.1"
FT                   /translation="MSKVTLGGNPIDLAGTFPTVGSQAPDFKLVGKDLADLTLASFAGK
FT                   RKVLNIVPSLDTPTCATSTRKFNEAASSLDNTVVIVVSADLPFAATRFCTTEGLENVVT
FT                   ASTFRTGRAFANAYGVDVTSGPLNGLTARAVVVLDAQDKVIHAQLVSEIKDEPNYDAAL
FT                   AALK"
FT   CDS_pept        complement(488361..489800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00455"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00455"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42422"
FT                   /db_xref="GOA:A0A0H3KC28"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC28"
FT                   /protein_id="BAG42422.1"
FT                   /translation="MFLATRCPHCETVFRLQPEQLSLHQGLVRCGHCRQVFNAAQSLVP
FT                   EHAQPPASPASEPTPVEPKPSDAVPPANLHDIDDAGNAAHADAPPRLFADAPRDVPPSA
FT                   DYKPEGWDMWAPWLDGSIDPALQHNGKTVRIEPLVPVALPSIEAGVVRLTGTPERAPRT
FT                   REAEAAWHAGDADGALSASSTSPHETDAALPPVAASAASSAETDATLPPLTASADATAP
FT                   VPPFAPSADTDAREPRFIAPVPTDAGNDADVPARPPHFAVPDDIDTPREPRFAAAPATA
FT                   AFAAADTRAPADEPFAAVPSDDDRPPFAVTREAREPQRRGVLGGFVGGLVAAALAVLLV
FT                   AQLAWWQREPLMIHWPATQGWFRQLCAPLGCTVAPPRAIDGLRLDATDLRQLDGPRVLE
FT                   LKAPLTNRYRVALAYPSLELTLLDDSNHVTVRRVLAPREYVRPGTPIDAGLPPGTTQTM
FT                   IVRLDTNGAPASNFRVQIFYP"
FT   CDS_pept        complement(489846..490748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="BMULJ_00456"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="COG2264: Ribosomal protein L11 methylase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02687"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00456"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42423"
FT                   /db_xref="GOA:A9AI41"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI41"
FT                   /protein_id="BAG42423.1"
FT                   /translation="MSYRELVVELAREHAEALSDALLELGALSVSVEDADADTPDEQPL
FT                   FGEPGLVPERTAWQHSRVIALLSPDHEPAVLLAAAANEIGLDATPKFDVREVEEQDWVR
FT                   LTQSQFEPIPIGERIWVVPSWHDAPDPDALVLELDPGLAFGTGSHPTTRLCMEWLEQSV
FT                   QPGQSVLDYGCGSGILAILAKKCGANPVVGIDIDPQAVESARQNSERNRAEVTYGLPDA
FT                   CPAGEFDIVVANILSNPLKLMASMLASKVKPGGRIALSGVLARQADEVAAVYARYVDIS
FT                   VWREHEGWVCLAGTRRESH"
FT   CDS_pept        complement(490751..492118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="BMULJ_00457"
FT                   /product="acetyl-CoA carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="COG0439: Biotin carboxylase, Ralstonia solanacearum"
FT                   /note="KEGG, K01961"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00457"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42424"
FT                   /db_xref="GOA:A0A0H3KKG4"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKG4"
FT                   /protein_id="BAG42424.1"
FT                   /translation="MFEKILIANRGEIALRIQRACRELGVKTVVVYSEADKEAKYVRLA
FT                   DEAVCIGPAPSNLSYLNMPALISAAEVTDAEAIHPGYGFLSENADFAERVEQSGFTFIG
FT                   PRPETIRLMGDKVTAKQTMIKTGVPCVPGSEGALPEDPKEIVKIARAIGYPVIIKAAGG
FT                   GGGRGMRVVHTEAALVNAVNMTREEAGRAFGNPQVYMEKFLENPRHIEIQVLSDAHKNA
FT                   IWLGERDCSMQRRHQKVIEEAPAPGIPRRLIDRIGDRCADACKKMGYLGAGTFEFLYEN
FT                   GEFYFIEMNTRVQVEHPVSEMITGVDIVQEQIRIAAGEKLTLRQRDIQFRGHAIECRIN
FT                   AEDPFKFTPSPGRITSWHTPGGPGVRVDSHAYNGYFVPPNYDSMIGKLITYGATREQAI
FT                   RRMRIALSEMVVEGIQTNIPLHRELMIDSKFVEGGTSIHYLENRLAQKQAVAPEEA"
FT   CDS_pept        complement(492203..492685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bccP"
FT                   /locus_tag="BMULJ_00458"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein"
FT                   /note="COG0511: Biotin carboxyl carrier protein, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02160"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00458"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42425"
FT                   /db_xref="GOA:A0A0H3KC47"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC47"
FT                   /protein_id="BAG42425.1"
FT                   /translation="MDLRKLKTLIDLVSESGISELEVTEGEGKVRIVKNAPPVYVQPTG
FT                   GFAPQVSVAASAAPTSAEASAAAPAAAAAAAPAPAAPQGHVVTSPMVGTFYRAPSPGAD
FT                   PFVQVGDSVKEGQTLCIIEAMKLLNEIESDKAGVIKEILVENGQAVEYGQPLFVIG"
FT   CDS_pept        complement(492751..493203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="BMULJ_00459"
FT                   /product="3-dehydroquinate dehydratase II"
FT                   /note="COG0757: 3-dehydroquinate dehydratase II, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03786"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00459"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42426"
FT                   /db_xref="GOA:A0A0H3KBT4"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBT4"
FT                   /protein_id="BAG42426.1"
FT                   /translation="MTRLLVLHGPNLNLLGTREPEVYGRVTLAQIDQALAARAQEAGAE
FT                   LSSFQSNHEGALVDRIQAAREEQTDFILINPAAYTHTSVAIRDALAGVGIPFVEVHLSN
FT                   VHRREAFRHHSYFSDQAEGVICGLGWKGYLYALEYALDKLQGASRG"
FT   CDS_pept        complement(493398..493940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00460"
FT                   /product="thiol-disulfide isomerase"
FT                   /note="COG0526: Thiol-disulfide isomerase and thioredoxins,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42427"
FT                   /db_xref="GOA:A0A0H3KGN9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGN9"
FT                   /protein_id="BAG42427.1"
FT                   /translation="MKRMLALAVVAAAAVAGGIAAGRWFHGSTDDGVAVAAAAQGNPVE
FT                   QLWAAPLTGIDGKPATLAAFKGQKVVVNFWASWCGPCVEEMPELVALSHQYGQKGIRFV
FT                   GIGVDSEQNVKNFLQKVKVDYPVFVSGYAGADLARNFGNTAGALPFTVVIDATGKIRET
FT                   KLGQIQPAELKKTLDAL"
FT   CDS_pept        complement(493954..494598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00461"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC32"
FT                   /protein_id="BAG42428.1"
FT                   /translation="MSRKPLVDPRRVREEIAQSAARLIAEDGLDYAGAKRKAARQLLGD
FT                   TRVAGEWLPDNDLIEEELREYLALFQSDTQPDELRRLREIALDWMRRLAEFNPYVTGAV
FT                   LNGTANAHSDIHLQTFTDNPKDVAIYLLNQNVQYDVSETRHFAGRGDVETLSFLWRPRR
FT                   DMDAIGIHVALYASDDLRGAVKADARGRVARADAAALRALVGAGVAPSEPE"
FT   CDS_pept        494813..496198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="BMULJ_00462"
FT                   /product="UDP-N-acetylmuramate:
FT                   L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase"
FT                   /note="COG0773: UDP-N-acetylmuramate-alanine ligase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K02558"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00462"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42429"
FT                   /db_xref="GOA:A0A0H3KKG9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKG9"
FT                   /protein_id="BAG42429.1"
FT                   /translation="MHIHILGICGTFMGGLAVLARAAGHTVTGCDAGVYPPMSTQLEAQ
FT                   GITLIEGYGADQIDLKPDLFVIGNVVTRGNPLMEAILDRGLPYVSGPQWLGEHVLAGKW
FT                   VLAVAGTHGKTTTSSMLAWLLEDAGLNPGFLIGGVPLNFGVSARLTDSSFFVIEADEYD
FT                   TAFFDKRSKFVHYRPRTAVLNNLEFDHADIFPDLAAIETQFHHLVRTVPGVGRIVTNGR
FT                   SDALERVLARGCWSEVERFGVDGGWQALPAEDGVPVDERFAVYSHAERVGEVAWQVQGE
FT                   HNRMNALAAIAAARHVGVPPAQAAASLASFRNVKRRMEVRGSVDGVTVYDDFAHHPTAI
FT                   ETTIAGLRARIGRQNSRILAVLEPRSNTMKLGVMKAQLPASLADADLVFGYGAPSGRDA
FT                   LGWNLGDALSPLGDKARAFDDLHLLVKAVAQAARPGDHVLVMSNGGFGGVHQKLLDALG
FT                   SRA"
FT   CDS_pept        496195..496764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00463"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3150: Predicted esterase, Ralstonia solanacearum"
FT                   /note="KEGG, K07000"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00463"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42430"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC50"
FT                   /protein_id="BAG42430.1"
FT                   /translation="MILYLHGFRSSPASQKSRLLAARMAELGRLDEWRCPSLSVSPLEA
FT                   VALAEAEAAGARDVTVIGSSLGGYYATWLAEKHGWKAVLLNPAIVPQRDLEQYLGEQPL
FT                   YHGGGTIVVERRHLQELDALRVPAITRPERYYLFAATGDEVLDYREMLAHYRGAKTRVI
FT                   EGSDHGISEFADYVDDVLAFCDEKAT"
FT   CDS_pept        496846..498918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnb"
FT                   /locus_tag="BMULJ_00464"
FT                   /product="exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /note="COG0557: Exoribonuclease R, Ralstonia solanacearum"
FT                   /note="KEGG, K01147"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00464"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42431"
FT                   /db_xref="GOA:A0A0H3KBT8"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBT8"
FT                   /protein_id="BAG42431.1"
FT                   /translation="MNVFFEESGSFKAGSVLSRQGDAFQVELPGGRRAKVRAKDVLIEF
FT                   EKPAASELMQEADAAAQQIDLDFLWECAPAEEFAYTALAEEYFGATYGPVERAALVLRL
FT                   HGAPVYFRRKGRGQYQRAPEEQLKMALASLERKRQQALVQAQYEEELKAGKLPDAFAGK
FT                   VLGLLTRPDKNSIEYKALEAAAGARGVSPARLMLDCGGIASARALHEARFLAEFFPHGT
FT                   GFPPVTVGSLPDDLPRADVQAFSIDDITTTEIDDAFSVEHLSDGRVRVGVHIAAPALGI
FT                   VRGDAVDAIARARLSTVYMPGDKITMLPDDVVDVFTLKEGDYRPALSLYIIVNRETQDI
FT                   VASETRAELVFVKSNLRHNTLDELVTEESLAAGTGDYPHKDDIAVLWPLAQALFEKRQV
FT                   ARAGYGLKREVQRNTDYNFYVEGEHVTITPRRRGSPLDLIVSELAILANSTWGAFLHDH
FT                   TVPGIYRTQRGFGAPGPKRTRMQTTAAPHEGLGVAQYAWSTSPLRRYVDLVNQWQLLAC
FT                   VQHGVTAKLAAPFKPKDADLYAVVQGFDDTYTAYADHQRRMEYFWCLRWLAQEQKKQVV
FT                   ATVVKGDLVRLEEIPLLLHVPALGVHARGTRVLLEVMALDELTIEASVRLLHVLDAPVV
FT                   TSGDAADEDDEAGDDTLLDAQEASAQTEAEALAESDDGAPGADADAGASQQERAS"
FT   CDS_pept        498915..499781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="BMULJ_00465"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="COG0169: Shikimate 5-dehydrogenase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00014"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00465"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42432"
FT                   /db_xref="GOA:A0A0H3KGP2"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGP2"
FT                   /protein_id="BAG42432.1"
FT                   /translation="MSATAPTRGADRYVVFGNPVAHSKSPFIHAQFAAQTGEAIDYTHR
FT                   LAPVDGFEAAVRAFIAEGGRGANVTVPFKLDAHALADTLSPRAAAAGAVNTLRFDADGR
FT                   IYGDNTDGVGLVRDIESNLGVSLAGARILLLGAGGAARGVVLPMLDRAPLSITIVNRTA
FT                   SKAEALVSQFMQAAHDAGCTLAGGGPGEVRAQPYDVIVNATAGSLDAALPECDAAAFGA
FT                   GTLAYDMMYGAQPTVFMQHASSLGARTADGLGMLVEQAAESFFVWRGVRPDGAPVLAAL
FT                   RRALAAN"
FT   CDS_pept        499798..500535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="BMULJ_00466"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="COG0744: Membrane carboxypeptidase
FT                   (penicillin-binding protein), Ralstonia solanacearum"
FT                   /note="KEGG, K03814"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00466"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42433"
FT                   /db_xref="GOA:A9AI31"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AI31"
FT                   /protein_id="BAG42433.1"
FT                   /translation="MVAVTGTQRTRVVSPTRWIVYAGAVFAAAWLATQLFYFVQIAMWS
FT                   FVNPGSTAFMRTDAWWLSHDTPPAQIQHQWVPYDKISRNLKRAIIASEDATFATNNGYD
FT                   VDAILQAWEKNKARGRIVAGGSTITQQLARNLFLSREKSYIRKGQELIITWMLETLLDK
FT                   ERIFEIYLNSVEWGRGVYGAEAAARYYYRIPASRLGAWQSARLAVMLPKPRWFDAHRGS
FT                   AYQAQRAAIIARRMGAAELPQSE"
FT   CDS_pept        500983..502590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00467"
FT                   /product="carboxypeptidase C"
FT                   /note="COG2939: Carboxypeptidase C (cathepsin A), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00467"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42434"
FT                   /db_xref="GOA:A0A0H3KC37"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC37"
FT                   /protein_id="BAG42434.1"
FT                   /translation="MPASQAKLWLGVVFSSLILTACNDDVTSSVASAGDSAQSAAQADK
FT                   PYADPNSYSSSANASLDASAAVEQAAVTHHRITLNGQTIRYTATAGHLVARDPRSGAPE
FT                   ASFFYVAYTADNQPAAKRPVTFLYNGGPGSASVWLHLGSFGPKRIQTGDPNANTSTFPF
FT                   VDNAESLLDTTDLVFVDAIGTGYSEAIAPNTNQTFWGVDQDAGAFRDFVTRYLSVNQRN
FT                   DSPKYLFGESYGTPRTDVLANLLETAGVKLDGIVLQSSILDYNTNCDMASDYVGNSNNG
FT                   ASAVSCAGFVPSYGTVGAYYQLDNPNPPSLPPYADQMRLLTAGSYAPAVNAYLANHTPP
FT                   SPSLVTTMTNATGVKASLWNADFNVVPTFFDNSFQLSLLPGTLIGRYDARVNVPISSAL
FT                   AADGDPSSTFITKPFTDTIASYLPNELKYTAKTAYAVSSNAINTWDWSHDGLAMPDTIP
FT                   DLAAALTLNPALKVLSLNGYHDIATPFYQTELDLARLGTQPNLTIKDYQGGHMVYLDDT
FT                   SRPQEKADLAAFYRTAAH"
FT   CDS_pept        502684..503085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00468"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42435"
FT                   /db_xref="GOA:A0A0H3KKH5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKH5"
FT                   /protein_id="BAG42435.1"
FT                   /translation="MQKRLIVIAAALAAAGVALSAAAFAQASDAAPPARARQAQLGDPY
FT                   VPPAARRPTAGTQTTGAALHAQVVRKLARQFSAADTQNTGSITEAQARAAGLGYVANHF
FT                   RQIDASGSGRVSFSDVQRYMQTRSASGQQ"
FT   CDS_pept        503453..504352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00469"
FT                   /product="IclR family transcriptional regulator"
FT                   /note="COG1414: Transcriptional regulator, Bacillus
FT                   halodurans"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00469"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42436"
FT                   /db_xref="GOA:A0A0H3KC52"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC52"
FT                   /protein_id="BAG42436.1"
FT                   /translation="MTKMPDSLALDARRATPDDAPLSDSIGATSTPLDLAAQQAGTQTL
FT                   LRGLAILEAIANGARDMRAIGAALGTTRSTTHRLVSSLVQARYLRQVQGGYLLGPKLIE
FT                   LGTIALEQMPLTAVARPHLEALAEATLDTIHLGVRDGDDVLYIDKIPGTRGLEMRSRVG
FT                   HRMPLASTGIGKAMMLDLAPETWRTLFDAARRALAGVSFKPDNRPDSAAFLQRMAHYAA
FT                   GGYTFDLEENEASIRCVAAPIRDASGAIVAAVSVASTIPYMPHDRMDELIPLVQREARA
FT                   ISAELGWSPPQGTRRIKR"
FT   CDS_pept        504349..505374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgoK"
FT                   /locus_tag="BMULJ_00470"
FT                   /product="2-dehydro-3-deoxygalactonokinase"
FT                   /EC_number="2.7.1.58"
FT                   /note="COG3734: 2-keto-3-deoxy-galactonokinase,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K00883"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42437"
FT                   /db_xref="GOA:A0A0H3KBU1"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBU1"
FT                   /protein_id="BAG42437.1"
FT                   /translation="MTNPTRTVPDAAGAAASLIALDWGTTSLRAYLYDARGALLDTRSR
FT                   AAGVMHVPGGSAHAFDAAFEDACGDWLDRAGAVPVLAAGMVGSAQGWREAPYVAVPAGA
FT                   DALVAGLVTVTTARGATVSIVPGVIATGELPDVMRGEETQIVGALAADPTLDADRSGIL
FT                   IGLPGTHAKWAWVNGGLIERFQTFMTGELFAALRDHTILGRTMRAPASPDRAAFERGVA
FT                   VARDAQHTGLLATIFSTRTLGLTERLAPDAQGDYLSGLLIGHELNALDAMLAERGATLA
FT                   NQPLLLIGDDRLCARYVDALHVFGCMHARVVAHATERGLWQIASRAGLVHTDGEPVCAG
FT                   H"
FT   CDS_pept        505403..506080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="BMULJ_00471"
FT                   /product="2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="COG0800: 2-keto-3-deoxy-6-phosphogluconate aldolase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01625"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00471"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42438"
FT                   /db_xref="GOA:A0A0H3KGP8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGP8"
FT                   /protein_id="BAG42438.1"
FT                   /translation="MSSDLTLPAPYTPHAGLMRAFDACPLIAILRGITPAEAAEHGRAL
FT                   YDAGFRLVEVPLNSPAPFDSIAALRRALPDDAIVGAGTVLRAEYVDRVQDAGGALIVMP
FT                   HADTAVIRRARERGLACAPGVATPTEAFAALANGADVLKMFPAEQLGTAVVKAWRAVID
FT                   RAVPLVPVGGIAPDNMQPFLAAGANGFGLGSALYRPGQSVDTTAAHARAFQAGLRAARG
FT                   GAA"
FT   CDS_pept        506080..506859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BMULJ_00472"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K00059"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00472"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42439"
FT                   /db_xref="GOA:A0A0H3KC42"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC42"
FT                   /protein_id="BAG42439.1"
FT                   /translation="MNRLAGKVAMVTGAARGIGAAIARAFAGEGARVALVDVDFAQAEQ
FT                   TAAAIARDVDGARVLPLHADVTQQGSVRDALAQTEAALGALDVLVNNAGINVFADPLTM
FT                   TDDDWRRCFAVDLDGVWHGCRAALPGMVERGRGSIVNIASTHAFRIIPGCFPYPVAKHG
FT                   VLGLTRALGIEYAARNVRVNAIAPGYIETQLTRDWWDAQPDPAAARAETLALQPMKRIG
FT                   RPEEVAMTAVFLASDEAPFINAACITVDGGRAALYHD"
FT   CDS_pept        506967..507962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00473"
FT                   /product="simple sugar transport system substrate-binding
FT                   protein"
FT                   /note="COG1879: ABC-type sugar transport system,
FT                   periplasmic component, Ralstonia solanacearum"
FT                   /note="KEGG, K02058"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00473"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42440"
FT                   /db_xref="GOA:A0A0H3KKI0"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR026266"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKI0"
FT                   /protein_id="BAG42440.1"
FT                   /translation="MKRRTFVTLAAAAAVVMGSPIAHAADPMKIGFLVKQPEEPWFQDE
FT                   WKFAEIAAKDKGFTLVKIGAPSGEKVMSAIDNLAAQKAQGFIICTPDVKLGPGIVAKAK
FT                   SHNLKMMTVDDRLVDGAGKPIEAVPHMGISAYNIGKQVGEGIAAEIKKRGWDMKDVGAI
FT                   DITYEQLPTAHDRTSGATDALVAAGFPKANVIAAPQAKTDTENAFNAANIALTKNPQFK
FT                   HWVAYGLNDEAVLGAVRAAEGRGFKADNMIGIGIGGSDSALNEFKKPQPTGFFGTVIIS
FT                   PKRHGEETSELMYTWITQGKAPPPLTLTTGMLATRDNVTKVREQMGLASK"
FT   CDS_pept        508039..509550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00474"
FT                   /product="simple sugar transport system ATP-binding
FT                   protein"
FT                   /note="COG1129: ABC-type sugar transport system, ATPase
FT                   component, Ralstonia solanacearum"
FT                   /note="KEGG, K02056"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00474"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42441"
FT                   /db_xref="GOA:A0A0H3KC57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017917"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC57"
FT                   /protein_id="BAG42441.1"
FT                   /translation="MPAALRFDNIGKVFPGVRALDGISFDVHAGEVHGLMGENGAGKST
FT                   LLKILGGEYQPDAGSVLVDGRPVHFPNAAASIAAGIAVIHQELQYVPDLTVAENLLLGR
FT                   LPNAFGWVRKGDAKRYVRERLAAMGVDLDPAAKLGRLSIAQRQMVEICKALMRNARVIA
FT                   LDEPTSSLSHRETEVLFKLVDDLRAQGRALIYISHRMDEIYRLCDACTIFRDGRKIASH
FT                   ASLADVPRERLVAEMVGREISDIYHYAPRALGDVRFSAEGIEGPALREPASFSVRAGEI
FT                   VGFFGLVGAGRSELMRLVYGADRRRAGALTLDGKRIDVKRTGDAIRHGIVLCPEDRKEE
FT                   GIIAMASVAENINISCRRHSLRAGLFIDRKTENDTADRFIQRLKIKTPNRRQKIRFLSG
FT                   GNQQKAILSRWLAEPDLKVVILDEPTRGIDVGAKHEIYDVIYRLAERGCAIVMVSSELP
FT                   EVLGVSDRIVVMREGRIAGELPRAQANEHAVLSLALPQASAVQAA"
FT   CDS_pept        509625..510641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00475"
FT                   /product="simple sugar transport system permease protein"
FT                   /note="COG1172: Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems, permease components, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02057"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00475"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42442"
FT                   /db_xref="GOA:A0A0H3KBU4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBU4"
FT                   /protein_id="BAG42442.1"
FT                   /translation="MQVNENLASAAVKPSADALVPQQSDRQKWWQQLTEYSLIAIFAVM
FT                   FITMSLTVDHFFSIDNMLGLALSISQIGMVACTMMFCLASRDFDLSIGSTVAFSGVLCA
FT                   MVLNATDNTFVAIVAAVAAGAAIGFVNGAVIAYLRINALITTLATMEIVRGLGFIVSKG
FT                   QAVGVSSDTFIALGGLTLFGVSLPIWVTLLCFIVFGVLLNQTVYGRNTLAIGGNPEASR
FT                   LAGINVERTRVYIFLIQGAVTALAGVILASRITSGQPNAAQGFELNVISACVLGGVSLM
FT                   GGRATISGVVIGVLIMGTVENVMNLLNIDAFYQYLVRGAILLAAVLLDQLKNRGARD"
FT   CDS_pept        510664..511458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00476"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /EC_number="1.1.-.-"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K00120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00476"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42443"
FT                   /db_xref="GOA:A0A0H3KGQ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGQ3"
FT                   /protein_id="BAG42443.1"
FT                   /translation="MTTDSSARDAHANYAHYPSLVDRAVLITGGATGIGASFVEHFAQQ
FT                   GARVAFVDLDADAGRALADRLGGARHAPLFVPCDLTDIEALRRAIDTIRTQIGAIAVLV
FT                   NNAANDVRHAIADVTPASFDAGIAVNLRHQFFAAQAVIDDMKRLGGGAIINLGSISWML
FT                   KNGGYPVYVMAKAAVQGLTRGLARDLGPFGIRVNSLVPGWVMTDKQRRLWLDDAGRAAI
FT                   KAGQCLDAELLPADLARMALFLAADDSRMITAQDVIVDGGWA"
FT   CDS_pept        511529..512590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00477"
FT                   /product="putative glyoxalase/bleomycin resistance protein
FT                   /dioxygenase"
FT                   /note="COG2017: Galactose mutarotase and related enzymes,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00477"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42444"
FT                   /db_xref="GOA:A0A0H3KC46"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC46"
FT                   /protein_id="BAG42444.1"
FT                   /translation="MTATSSRASSSTSQSRRARLAAAAQPVSAGPQTAVFARGVGAAHA
FT                   AAVTLSNAALRVDVLPHLGGGLARFDWRRDDGALVPVFRRCAQPETATDPNELACYPLL
FT                   PYSNRIGGARFECDGRSIAVPRNRLDEPLPIHGDGWLACWQVDEATDTSLRLSLDRRNG
FT                   APYAFRAVQSFELDDATLTIALTIENAGRTRLPFGLGVHPFIVRDDATELAAAAGGLWL
FT                   SGADFLPVRHVSVPPAWQFGVAYPLPATLVNHAFTGWGGHATVSWPRRGITLTVAADAD
FT                   AYVLYTPPGADFFCFEPVDHPINAVNLPGGAAAHGMTLLAPGERLTRRFAFSVARSDAR
FT                   TGAVAREGGRRRG"
FT   CDS_pept        512631..513458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="BMULJ_00478"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="COG0284: Orotidine-5'-phosphate decarboxylase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01591"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00478"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42445"
FT                   /db_xref="GOA:A0A0H3KKI7"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKI7"
FT                   /protein_id="BAG42445.1"
FT                   /translation="MSSPLTFIDSLRAAWQRTNSLLCVGLDPEPSRFPAQFDGQPDAIF
FT                   EFCRQIVDATAPYASAFKPQIAYFAAHRAEDQLERLIAHIHLQHPGLPVILDAKRGDIG
FT                   STAEQYAREAFERYRADAVTVNPYMGFDSVEPYFEHEGKGVIVLCRTSNPGGSDLQFLD
FT                   TDGRPLYQVVADLAANRWNAKSGQLGLVVGATFPKEIEIVRGIVGDMPLLIPGIGAQGG
FT                   DVQATVNAGRTADGTGMMINSSRAILYASSGDDFAEAAALAAQKTRDAINAYR"
FT   CDS_pept        513678..514736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00479"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00479"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42446"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC62"
FT                   /protein_id="BAG42446.1"
FT                   /translation="MPKLYRRLLTALAASLCMTFAHAADLAHWPADSAKALNAMIAAHA
FT                   HRGDYAVFDADNTTYRYDLEESLLPYLEHRGVLTRDTLDASLKLIPFKDSADYKESLTS
FT                   YYYRLCEIDDLVCYPWIAQAFAGLSLADLKRHIDAMLADGKPIPIRYWQGDKVVDGTAN
FT                   PPRFFRGMQELYNALRENGIEVYVMTAAHEELARLVLSDPKYGYNVKPENVIGVTTLLR
FT                   NPATGTLTTSRLQIKAGKYDEAANRNLVITPFLMNPMTWYEGKLGSIVGWIDQWKKPVL
FT                   VAGDTPASDGYMLLNATDVARGGVRVWIDKKDKQMAQIRAWSDESAAKQKALGLPVTAD
FT                   RNWIVVKPDAIQ"
FT   CDS_pept        complement(514771..515271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="BMULJ_00480"
FT                   /product="competence/damage-inducible protein"
FT                   /note="C-terminal domain"
FT                   /note="COG1546: Uncharacterized protein (competence- and
FT                   mitomycin-induced), Ralstonia solanacearum"
FT                   /note="CinA protein"
FT                   /note="KEGG, K03743"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42447"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBU9"
FT                   /protein_id="BAG42447.1"
FT                   /translation="MPTDSVVHQLAIRAGNKLRDEHLMLATAESCTGGLIAAAITDISG
FT                   SSQWFERGFVTYSNQAKSEMIGVPPDLIEKHGAVSEPVARAMAEGALRNSRAQVALSVT
FT                   GIAGPAGGSEKKPVGTVSFAWSNRLHTDVETLVFKGDREQIRTQAAAHALRGLLKLLDE
FT                   REG"
FT   CDS_pept        complement(515302..515763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="BMULJ_00481"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /note="COG1267: Phosphatidylglycerophosphatase A and
FT                   related proteins, Ralstonia solanacearum"
FT                   /note="KEGG, K01095"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00481"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42448"
FT                   /db_xref="GOA:A0A0H3KGQ7"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGQ7"
FT                   /protein_id="BAG42448.1"
FT                   /translation="MLSHPAHIVSLGFGSGLAPFMPGTFGSLFGWLAFVALNRYLTVPE
FT                   WWVLIALAFVAGIAITGFTARRMGVGDPGAVVWDEIVAIWLVMLFVTPATFVGQLWAFV
FT                   VFRSFDMVKPPPIRHFDRRLSGGLGIMVDDLVAAFMTLLVIALWRSLVG"
FT   CDS_pept        complement(515840..516838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="BMULJ_00482"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="COG0611: Thiamine monophosphate kinase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00946"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00482"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42449"
FT                   /db_xref="GOA:A0A0H3KC49"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC49"
FT                   /protein_id="BAG42449.1"
FT                   /translation="MPDALSEFSLIDRFFARRAARGARASTLGIGDDCALIAPRSGKLL
FT                   AISTDMLVEGRHFFPDVAPEALGHKTLAVNLSDLAAMGAEPRAFTLACALPRADAAWLE
FT                   AFSNGLFALAERYGCELIGGDTTSGPLNLCVTVFGEVAPDAALRRDAARDGDDVWVSGT
FT                   LGDARAGLGVARGEWTADADAATAFRQALERPEPRVALGVALAGVAHAALDISDGLAGD
FT                   LQHILTRSNVCADIDADAVPRSAALATLPADVQRRCTLAGGDDYELCFTAPASARAAVA
FT                   AAGAKAGVAVTRIGTIRALSAPSARPAIAWHDAAGAPLALTLHGFDHFHAD"
FT   CDS_pept        517017..519317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="BMULJ_00483"
FT                   /product="NADP-dependent oxaloacetate-decarboxylating
FT                   malate dehydrogenase"
FT                   /EC_number="1.1.1.40"
FT                   /note="COG0281: Malic enzyme, Ralstonia solanacearum"
FT                   /note="KEGG, K00029"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00483"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42450"
FT                   /db_xref="GOA:A0A0H3KKJ3"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR032683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKJ3"
FT                   /protein_id="BAG42450.1"
FT                   /translation="MSTQASSKAKLREAALDYHEFPTPGKVAIAPTKQMINQRDLALAY
FT                   SPGVAFACEEIVENPLNAARFTARSNLVGVVTNGTAVLGLGNIGPLASKPVMEGKAVLF
FT                   KKFAGIDVFDIELNESDPHKLVDVIAALEPTFGGINLEDIKAPDCFIVEREARKRMKIP
FT                   VFHDDQHGTAIVVAAAVTNGLKVVGKDIKKVKLVASGAGAAALACLDLLVDIGLPIENI
FT                   TVTDLAGVVYKGRTELMDPDKERFARETDARTLAEVIDGADIFLGLSAAGVLKQEMVKG
FT                   MAERPLILALANPTPEILPEVALEVRPDAVLATGRTDYPNQVNNVLCFPFIFRGALDVG
FT                   ATTITREMEIAAVNAIAELAQQEQSDIVATAYGIQDLSFGPEYLIPKPFDPRLIVKIAP
FT                   AVAQAAMDGGVATRPIEDMEAYKQHLQQFVYHSGTTMKPIFQIARAAPEEKKRVVFAEG
FT                   EEERVLRAVQIIVDEKLAKPILIGRPAVIEHRIQRYGLRLTPGTDFTVVNTEHDERYRD
FT                   FWQTYYKMMARKGISEQLARVEMRRRTTLIGSMLVKKGEADGMICGTISTTHRHLHFID
FT                   QVIGKRPGCSVYAAMNGLVLPGRQIFLVDTHVNVDPTPEQLAEITIMAAEEVRRFGIEP
FT                   KVALLSHSNFGTSNAPSAQKMRDTLAILKERAPDLTVDGEMHGDVALDAALRKEILPES
FT                   TLEGDANLLVLPNIDAANIAYNLLKTAAGNNIAIGPILLGAAQPVHVLTESATVRRIVN
FT                   MAALLVADVNAAR"
FT   CDS_pept        519690..520121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00484"
FT                   /product="ribonuclease T1"
FT                   /EC_number="3.1.27.3"
FT                   /note="COG4290: Guanyl-specific ribonuclease Sa, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01167"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00484"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42451"
FT                   /db_xref="GOA:A0A0H3KC66"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC66"
FT                   /protein_id="BAG42451.1"
FT                   /translation="MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYARQTVSADVA
FT                   AGGFDTIPTARLPREAVTTLGLIAAGGPYPYEKDGIVFGNRERILPKAKRGYYHEYTVP
FT                   TPRARNRGARRIVCGGPLRRIDNCYYTDDHYNSFKRIVE"
FT   CDS_pept        520138..520704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00485"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42452"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBV4"
FT                   /protein_id="BAG42452.1"
FT                   /translation="MSDSIYAHDTAAAELFAAGDGNLFQRVMQLRATAQAGAAPVQQES
FT                   ADPGLSSNEEPMSLFTTVRPNLVQSIRAFRVQDLADEAARLGQHFLYAYCGAAQSKQEV
FT                   METIATSFLFPKHFGKNYDALYDCLTDLVAKAGAQPGFVIVLEGLPIAQKFDKEGRETL
FT                   LDVFREAAEFWAERKVAFRVFYSFA"
FT   CDS_pept        complement(520808..521572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00486"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1385: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /note="conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00486"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42453"
FT                   /db_xref="GOA:A0A0H3KGR1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGR1"
FT                   /protein_id="BAG42453.1"
FT                   /translation="MSEASTTAAVPRFFVDTALRADATLALPADVARHAQVLRLQPGDP
FT                   LALFDGTGGQYRARLVEIDKRSALAQIDAFDPAEAEPPYRVTLAQGIAGGDKMDWVIEK
FT                   AVELGVAAVVPLSTARGVVKLSGERAEKRVAHWRGVVRASCEQCGRNRVPDVAAVRAFA
FT                   AWLDGLPPPADGELRLLLSPRASIPFASLPDAPPAAPVTLLIGPEGGLSPDEEAAARAR
FT                   GFTALSLGPRVLRTETAGAAVLAALAARWGGW"
FT   CDS_pept        complement(521569..521985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00487"
FT                   /product="glyoxalase/Bleomycin resistance protein"
FT                   /note="COG2764: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00487"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42454"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC55"
FT                   /protein_id="BAG42454.1"
FT                   /translation="MTDPRPADVPWLTPYLTVRNARASIDFFQAAFGFALRDVLDEDGA
FT                   IMHVEMVYRGQLIVMFAPEGAFGSTARTPKSANAIAPQSFYLYVDDVDATWQRALDAGA
FT                   KSLTAPQDQFWGDRFAQIEDLDGYRWALARRLEA"
FT   CDS_pept        complement(522098..522955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="BMULJ_00488"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="COG0421: Spermidine synthase, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K00797"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00488"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42455"
FT                   /db_xref="GOA:A0A0H3KKJ8"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKJ8"
FT                   /protein_id="BAG42455.1"
FT                   /translation="MSTTLLFHPTPDATYGFPNARRLARVASAHQQIEVWETAQLGRLF
FT                   TLDGRPMTSVGDEYVYHECMTHPAALAHPAPKKALVLGGGDGGAARQLLKHACIERIVV
FT                   AELDDEVVGMARRYLDDVHQGALDDPRVELVIGDAAHFVESTVEHFDLVVFDLTPPDSP
FT                   AAGLYTRAFYARLKRILTPRGAVSMHLGSPLFHATRIAALLEDLRASFAVVDPLSAHVP
FT                   LYGSQWLMAIASDTLDAAALFAHDIDERLAARRIEGLRYYDARLHAALFALPRALRDTL
FT                   GARR"
FT   CDS_pept        523171..525243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="BMULJ_00489"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="COG0021: Transketolase, Ralstonia solanacearum"
FT                   /note="KEGG, K00615"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00489"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42456"
FT                   /db_xref="GOA:A0A0H3KC72"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC72"
FT                   /protein_id="BAG42456.1"
FT                   /translation="MPPCSRFLDSFSGLDMTTSSPASTTLMANAIRALAMDAVQQANSG
FT                   HPGMPMGMAEIGVALWSRHLKHNPTNPHWADRDRFVLSNGHGSMLLYSLLHLTGYDLPI
FT                   EELKNFRQLHSKTPGHPEYGITPGVETTTGPLGQGLANAVGMALGEALMADEFNRPDAK
FT                   IVDHYTYVFLGDGCLMEGISHEACSLAGTLKLNKLIALYDDNGISIDGDVVNWFHDDTP
FT                   KRFEAYGWNVIANVNGHDVDAVDAAIAKAKQSDKPTLICCKTVIGKGAATKAGGHDVHG
FT                   AALGAEEIAKTREALGWKWEPFVIPQEVYAAWDAKEAGKRAEAAWNDAFAQYRAKYPQE
FT                   AAEFERRMANQLPADWAEKAKAIVAGANERAETVATRKASQQAIEGLAAVLPELLGGSA
FT                   DLTGSNLTNWKASKAVRANPEGAGVLLGNHINYGVREFGMSAAINGLALHGGHKPFGGT
FT                   FLTFSDYSRNALRVAALMKVPSIFVFTHDSIGLGEDGPTHQSVEHVSSLRLIPHLDVWR
FT                   PADTVETAVAWTHAVAAHRPSALIFSRQNLAFNPRTDAQIANIEKGGYVLKDWDEEVVA
FT                   RKIILIATGSEVELAMKAVEPLAQQGIAARVVSMPATTVFDRQDAEYKERVLPHGVRRV
FT                   AIEAGVTDFWRKYVGLEGGVVGIDTFGESAPAGVLFKYFGFTVDHVVDTVKAVLA"
FT   CDS_pept        525337..526347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapD"
FT                   /locus_tag="BMULJ_00490"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="COG0057: Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K00134"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42457"
FT                   /db_xref="GOA:A0A0H3KBV8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBV8"
FT                   /protein_id="BAG42457.1"
FT                   /translation="MTIRVAINGYGRIGRNTLRAFYENGKKHDLEIVAINDLGDAKTNA
FT                   HLTQYDTAHGKFPGEVSVDGDYLVVNGDKIRVLANRNPAELPWGELGVDVVMECTGFFT
FT                   SKEKASAHLKGGAKKVIISAPGGKDVDATIVYGVNHNVLKAEHTVISNASCTTNCLAPL
FT                   VKPLNDKIGLETGLMTTIHAYTNDQVLTDVYHEDLRRARSATHSQIPTKTGAASAVGLV
FT                   LPELNGKLDGYAIRVPTINVSIVDLSFIAKRDTTVEEVNAIMKEASEGALKGILGYNDA
FT                   PLVSVDFNHNPASSTFDATLTKVSGRLVKVSSWYDNEWGFSNRMLDTAVAFANAK"
FT   CDS_pept        526510..526995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00491"
FT                   /product="MarR family transcriptional regulator"
FT                   /note="COG1846: Transcriptional regulators, Caulobacter
FT                   vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00491"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42458"
FT                   /db_xref="GOA:A0A0H3KGR5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGR5"
FT                   /protein_id="BAG42458.1"
FT                   /translation="MIQFARELTPSADICSSMKHRLVYLLNVGQRRLQRWSQMRAAAGG
FT                   VTAAQAGLLFFLGEHNGALMSEAAAALDLGAPGMSGLADRTEKAGLIERRADETDGRAS
FT                   RLWLTEAGRAARQRSKLRMKDLNAKLTEGFTEAEIDVVARWLTSLQTKFPLAEEGDT"
FT   CDS_pept        complement(527027..527803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="BMULJ_00492"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="COG1024: Enoyl-CoA hydratase/carnithine racemase,
FT                   Caulobacter vibrioides"
FT                   /note="KEGG, K01692"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00492"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42459"
FT                   /db_xref="GOA:A0A0H3KC59"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC59"
FT                   /protein_id="BAG42459.1"
FT                   /translation="MTAQIHVDQADGILTMTLARPDKKNALTNEMYGRLADVIEHAEHD
FT                   GQTRVLLLQADGDMFTAGNDVGEFAAIASGKGPSERHVHRFLHALAKSNLPVIAAVQGK
FT                   AVGIGTTMLLHCDYVLLAPEAELITPFVNLALVPEAASSYLLPLRVGHLRAFEMFALGE
FT                   PLDAQTAVAWGLANKVCAKEQLRLDARRMAERIAAKPAGSLSATKKLMREAQKLIAQMD
FT                   SESAMFQERLTSAEAREAFAAFAEKRKPNFAAVTQQ"
FT   CDS_pept        527853..528440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00493"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00493"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKK4"
FT                   /protein_id="BAG42460.1"
FT                   /translation="MRSKPEIRRPEFRWNFVGLPWRRRAACSPGSCVARWAKYGKLRCA
FT                   ATACSTSTPRSTRIAVGRRSDEVIRHAPYTMSHEYLVIFQYHEPEPLQLFERGVIEDYE
FT                   STTGVFITAASEEEALNWCKAIAQALLCHCNDDRSLDWTRFGHSCWIEPDPGKSTWGHC
FT                   LDFFQHVQVGEMPDVDAMSTAAYTRWQSKRGA"
FT   CDS_pept        complement(528596..529795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00494"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Yersinia pestis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00494"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42461"
FT                   /db_xref="GOA:A0A0H3KC78"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC78"
FT                   /protein_id="BAG42461.1"
FT                   /translation="MKPSSDSHPPLTRGMTLLFACACGIVIGNIYYAQPLLAAIAHSFG
FT                   RAPAELGYLVTLTQIGYAASLLLIVPLGDALNRHTLIVRLLALNVVALLGVALSTQFAM
FT                   FVAANVALGFVTCSTQLLVPFAASLADARTRGRAVGTVMSGLLLGILLARVAAGAIADW
FT                   FGWRAVYAIAAAMVLALTVVLAVKLPKDRRDARLDYPALMKSLAALVRAQPLIALRSAY
FT                   GALVFACFSLLWTGLTFLLSQPPYGYSEGRIGLFGIVGAVGALAATSAGRLVDRGHGNA
FT                   ATGLFAAAVLASFAPIAAGAHSLAALIAGILLLDVGVQGMHISNQSVIYALAGDARSRV
FT                   TTIYLTSYFVGGALGSFAASVAYGLDGWRGVCAAGGVLGGVLVAVWLASQRVGTREVAQ
FT                   "
FT   CDS_pept        530089..530988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynR"
FT                   /locus_tag="BMULJ_00495"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Escherichia coli
FT                   O157:H7"
FT                   /note="CynR protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00495"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42462"
FT                   /db_xref="GOA:A0A0H3KBW3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBW3"
FT                   /protein_id="BAG42462.1"
FT                   /translation="MLLRHIRYFLAVAEQGSFTRAADALHVSQPTLSQQIRQLEETLGV
FT                   PLFDRSGRTVRLTEFGDVYAKHARAALHALDAGARALHDAADLATGSLRLAMMPTFAAY
FT                   LSGSLVDAFHAAYPNVVLTIDAMPQARMESLLVEDRLDAGFAFVPARAPEIDALPLWDE
FT                   SLAFVTARTHRLARRRRALTPDELSGEPLVLLSRAFATRERIDRYFVEHRAQPRIAIET
FT                   NTVSAVLELVRRGRLATVLPDAVARGSDELCALPVDPPLPTRTAALLTRKGAYRSVAAR
FT                   AFIECALAYRVPSAASRT"
FT   CDS_pept        complement(530995..531687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="BMULJ_00496"
FT                   /product="GntR family transcriptional repressor for
FT                   pyruvate dehydrogenase complex"
FT                   /note="COG2186: Transcriptional regulators, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K05799"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00496"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42463"
FT                   /db_xref="GOA:A0A0H3KGU0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGU0"
FT                   /protein_id="BAG42463.1"
FT                   /translation="MKNVPHTVTDAAIATIRDRIEAGVYPVGSLLPAQRQLSEELEISR
FT                   ASLREALSTLEALGMLRIRAGKGVYVESARATTAHAWQFAEQSSPPDTYQMRYALEGFA
FT                   ARMAARVVSDDDIAWFEDNLADLHVALTENALEDASQLDFDFHMRIIHLAGNAAIESVL
FT                   RSSADIMKESQRMPFYRRELLLSTWHEHRAIVDALSARDAAAAGTAIETHISNAAQRAG
FT                   IFFPTPGA"
FT   CDS_pept        531927..533246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00497"
FT                   /product="DAACS family dicarboxylate/amino acid:cation (Na+
FT                   or H+) symporter"
FT                   /note="COG1301: Na+/H+-dicarboxylate symporters, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03309"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00497"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42464"
FT                   /db_xref="GOA:A0A0H3KC63"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC63"
FT                   /protein_id="BAG42464.1"
FT                   /translation="MSKFLNSLFGRVVIALILGVALGAFFPHFAESLKPLGDGFLKLIK
FT                   MVIGPIVFCVVVSGMANAGDLKKVGRVGLKAVVYFEVMTTLALGIGLVLAWLTRPGEGM
FT                   NINLHSLDASSLASYAKNAESLKDTAGFLMKIIPDTAIDAFAKGDILQILVFAVLFGSA
FT                   LSLLGDKAKRVNGLIEELSHVFFRVIGFIIKLAPLGVLGAIAFTTGKYGVASLKQLGYL
FT                   VAVFYVSCAVFVTVVLGIVMRLAGFSVFKLIRYLREELSIVLGTASSDAVLPQVMRKLE
FT                   YMGVKDSTVGLVIPTGYSFNLDGFSIYLTLAVLFIAQATNTPLSAHDLIVVLIVSMITS
FT                   KGAHGIPGSAIVILAATLSAIPAIPVLGLVLILPVDWFVGIARALTNLIGNCVATVVVA
FT                   VWENDIDRARAKRVLNRELRYVPAEEDGATPVAGDQAHAL"
FT   CDS_pept        533435..534442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alc"
FT                   /locus_tag="BMULJ_00498"
FT                   /product="allantoicase"
FT                   /EC_number="3.5.3.4"
FT                   /note="COG4266: Allantoicase, Ralstonia solanacearum"
FT                   /note="KEGG, K01477"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00498"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42465"
FT                   /db_xref="GOA:A0A0H3KKK8"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKK8"
FT                   /protein_id="BAG42465.1"
FT                   /translation="MAAPILDPNAPAFTRRYMNLADPRLGAAALFASDEFFAPKERMLN
FT                   PEPAVFIPGKYDDHGKWMDGWETRRKRTTGHDFCVVRLARPGVIHGVDLDTSHFTGNFP
FT                   PAASIDACFADGDTPSDDAEWHTIVAATTLQGNAHHYVEVADARPYTHLRVNLYPDGGL
FT                   ARLRVYGQPQRDWSRVPAGEPVDLAAIENGAYLVAANNQHFGAASQMLMPGRGANMGDG
FT                   WETRRRREPGNDWAIVALARPGIIRRVEVDTAFFKGNFPDRCSLQAAHVTGGTDDSLIT
FT                   QAMFWPELLGEQKLSMDSVHTFDDLAALGPVTHVRFNIFPDGGVSRLRLWGEPA"
FT   CDS_pept        534456..534980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="BMULJ_00499"
FT                   /product="ureidoglycolate hydrolase"
FT                   /EC_number="3.5.1.116"
FT                   /note="COG3194: Ureidoglycolate hydrolase, Sinorhizobium
FT                   meliloti"
FT                   /note="KEGG, K01483"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00499"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42466"
FT                   /db_xref="GOA:A0A0H3KC81"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC81"
FT                   /protein_id="BAG42466.1"
FT                   /translation="MTSLHTLRVERLTREAFAPFGDVIALEGARHFPINGGTTERFHDL
FT                   ANIDVCADGGRPLVSVFRAQPRGLPVALTLMERHPHGSQAFIPLAAVSRYAIVVAPAGE
FT                   FRPDAMRAFLAEGWQGVNYAKGVWHHPLLALDAVSDFVIVDRGGPQPNCDEIPLDGAWA
FT                   LEFEPACAGAL"
FT   CDS_pept        complement(535072..535500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="BMULJ_00500"
FT                   /product="Fur family ferric uptake regulator"
FT                   /note="COG0735: Fe2+/Zn2+ uptake regulation proteins,
FT                   Ralstonia solanacearum"
FT                   /note="Fur protein"
FT                   /note="KEGG, K03711"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42467"
FT                   /db_xref="GOA:A9AHB4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9AHB4"
FT                   /protein_id="BAG42467.1"
FT                   /translation="MTNPTDLKNIGLKATLPRLKILEIFQQSPVRHLTAEDVYRNLLNE
FT                   QLDIGLATVYRVLTQFEQAGLLSRSNFESGKAVFELNEGSHHDHLVCLDCGRVEEFFDA
FT                   EIESRQQAIAKERGFRLQEHSLAMYGSCTTENCPHRKH"
FT   CDS_pept        535604..536425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /locus_tag="BMULJ_00501"
FT                   /product="small protein A"
FT                   /note="COG2913: Small protein A (tmRNA-binding), Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06186"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00501"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42468"
FT                   /db_xref="GOA:A0A0H3KGU4"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGU4"
FT                   /protein_id="BAG42468.1"
FT                   /translation="MIPESLSHFQRSRMRSAIIAAAAVAALAGCSSYDSVTQRIAQSIT
FT                   PYRITVVQGNFVSQEKAAQLQTGMTREQVRALLGTPLLTDMFHADRWDYLFYFKRGSTS
FT                   VVQQRDLVLTFSGDRLASWTGAENLPSELDLLADIDGDRRGKKAAKDKAAAAAAASGAS
FT                   AVTTASAPTSVGEVVDQDANARAARAANRATNQVSGQGSATRHFTPSAQASGGAPVPGG
FT                   QPPGAVPAIQPQFQFHRPPQPNVSNEAAPPVGPQGSDTLQNQPLTAPAQSQ"
FT   CDS_pept        536491..537288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="BMULJ_00502"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COG0289: Dihydrodipicolinate reductase, Neisseria
FT                   meningitidis MC58"
FT                   /note="KEGG, K00215"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00502"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42469"
FT                   /db_xref="GOA:A9AHB2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AHB2"
FT                   /protein_id="BAG42469.1"
FT                   /translation="MKIAIAGASGRMGRMLIEAVLNDADAQLVGALDRAGSPSLGQDAG
FT                   AFLGKDTGVKLTDDIDAVFAQADYLIDFTRPEGTLAHVEAALRHDVKLVIGTTGFTAEQ
FT                   KAVLHAAAEKVAIVFAANMSVGVNVTLKLLEFAAKHFSHGYDIEIIEAHHRHKVDAPSG
FT                   TALMMGEAVAGALGRSLDDCAVYGRHGVTGERDPSTIGFAAVRGGDIVGDHTVLFAGIG
FT                   ERIEITHKSSSRVSYAQGALRAVRFLSARDTGLFDMQDVLGLR"
FT   CDS_pept        537306..537974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB"
FT                   /locus_tag="BMULJ_00503"
FT                   /product="biopolymer transport protein"
FT                   /note="COG0811: Biopolymer transport proteins, Ralstonia
FT                   solanacearum"
FT                   /note="ExbB protein"
FT                   /note="KEGG, K03561"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00503"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42470"
FT                   /db_xref="GOA:A0A0H3KC67"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC67"
FT                   /protein_id="BAG42470.1"
FT                   /translation="MAIPTGVVHYLESGDAITHAVAYVLLAMSVASWCFLLMKAWLLVR
FT                   AKRQGPRALAAFWRASSLEAGIAALAGADRERVFVPLAEAARDAADEHEPAALAARVER
FT                   SERVLRALRHAMLRSQRRLEFGQVLLASIGSTAPFVGLLGTVWGIYHALGSIAASGQAQ
FT                   IENVAGPVGEALIMTAFGLVVAIPAVLAYNILGRLVRQLAEELDGFARDLHVFVCAQPA
FT                   "
FT   CDS_pept        537999..538460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD"
FT                   /locus_tag="BMULJ_00504"
FT                   /product="biopolymer transport protein"
FT                   /note="COG0848: Biopolymer transport protein, Ralstonia
FT                   solanacearum"
FT                   /note="ExbD protein"
FT                   /note="KEGG, K03559"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00504"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42471"
FT                   /db_xref="GOA:A0A0H3KKL6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKL6"
FT                   /protein_id="BAG42471.1"
FT                   /translation="MAFGGLEHHKTSAPMAEINMTPLIDVMLVLLVIFIITAPLMTHAI
FT                   RLDLPKVAASVARDTPQSVTLSIDDAGKLYWNDTPIALEALPARFRQAAASGAPPELRL
FT                   RASRATRYDVIAQVMGAAQAAGLTRIGFVTDMPPAGTAGPAAPAAPAAH"
FT   CDS_pept        538735..541329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="BMULJ_00505"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="COG0495: Leucyl-tRNA synthetase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01869"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00505"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42472"
FT                   /db_xref="GOA:A9AHA9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AHA9"
FT                   /protein_id="BAG42472.1"
FT                   /translation="MHERYVPADVEAAAQGDWRAADAYKTQEDAQKPKFYCVSMLPYPS
FT                   GKLHMGHVRNYTINDVMYRYLRMNGYNVLMPMGWDAFGMPAENAAMANGVPPAKWTYDN
FT                   IDYMKGQMQSMGLAIDWSREIATCKPDYYKWNQWLFLKMLEKGIAYKKTGTVNWDPVDQ
FT                   TVLANEQVIDGRGWRSGALVEKREIPMYYLRITQYADELLNDLDGLGWPERVKIMQQNW
FT                   IGKSFGVNFGFPYELDGEKQLLRVFTTRADTIMGVTFCAIAAEHPLATRLAQGKPELQA
FT                   FIDECKRGGVAEADMATMEKKGVATGFSVTHPLTGEPVEVWIGNYVLMSYGEGAVMGVP
FT                   GHDERDFAFAKKYGLPIKQVIAAEGHTYSLDAWQEWYGDKDIAVCINSGKYDGLGYAAA
FT                   VDAVAADLKAGGFGDKQVTWRLRDWGISRQRYWGTPIPIIHCPSCGDVPVPEKDLPVVL
FT                   PEDLVPDGSGNPLAKSEAFLNCTCPKCGAAAKRETDTMDTFVDSSWYFSRYTAPDAETM
FT                   VDARTDYWMPMDQYIGGIEHAILHLLYSRFWTKVMRDLGLVKFGEPAKNLLTQGMVLNE
FT                   TYYREDAAGKKTWYNPADVTVTHDDKGRPVGATLNADGQPVVLGGIEKMSKSKNNGVDP
FT                   QVLIDQYGADTARLFTMFAAPPEQQLEWSGAGVEGASRFLRRVWSFGYANREALASRAG
FT                   FDAAALGDADKALRREIYSVLKQADFDYQRLQYNTVVSAAMKMLNAIDGAKGATPGVLR
FT                   EAYGVLLRVLYPVVPHVTYELWKALGYADEFGPLLDAPWPKVDEAALEQAEIELVLQVN
FT                   GKVRGALKVAKDASREAIEAAALADDAFAKFGEGKPAKKIVVVPGRLVNIVV"
FT   CDS_pept        541368..541919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpB"
FT                   /locus_tag="BMULJ_00506"
FT                   /product="rare lipoprotein B"
FT                   /note="COG2980: Rare lipoprotein B, Ralstonia solanacearum"
FT                   /note="KEGG, K03643"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00506"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42473"
FT                   /db_xref="GOA:A0A0H3KC89"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC89"
FT                   /protein_id="BAG42473.1"
FT                   /translation="MIRRSFLMLVGSAVALSACGFQLRGQQDYAFKHLLIAGAPAPVSA
FT                   RLTRLVEGGSDTKIVKSIDDADAVLRMWESRGQNTLTLNQYGSAQEYALFYTLNYTLTS
FT                   KDGTVLIPPSAIALNRAMTYSDQYTNAKAQEADILYADMQNDAVDQLMRRLAIVHSLTP
FT                   RPEDVVPGVAPRAPLPPPPL"
FT   CDS_pept        541938..543032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="BMULJ_00507"
FT                   /product="DNA polymerase III delta subunit"
FT                   /note="COG1466: DNA polymerase III, delta subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K02340"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00507"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42474"
FT                   /db_xref="GOA:A0A0H3KBX0"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBX0"
FT                   /protein_id="BAG42474.1"
FT                   /translation="MQLRLDALEPHLAKGLAGLYTVYGDEPLLAQEACDRIRAAARAAG
FT                   FTERSVHTVERGFDWSVLLGATQAMSLFGERQLIELRIPSGKPGKEGADALKALAAADN
FT                   PDALMLVTLPRLDAATQKSAWFTALQNGGVALKIDPVDRAQLPNWIGQRLAMQGQRVAP
FT                   GDDGRRALQFIAERVEGNLLAAHQEIQKLGLLYPQGVLSFEQVHDAVLNVARYDVFKLN
FT                   EAMLAGDAARLARMIDGLKGEGEAIVLVMWAVVEELRTLLRIKRGTAAGKPLATLLREN
FT                   RVWGPRERLIGPALNRVSEAVLEKALAFAAKLDRQVKGLAAVTPGRRTHDDPPPDPWDG
FT                   LFQLAMTVAGPQHERPPTAGRVRR"
FT   CDS_pept        543186..544457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="BMULJ_00508"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="COG0014: Gamma-glutamyl phosphate reductase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00147"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00508"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42475"
FT                   /db_xref="GOA:A0A0H3KGU8"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGU8"
FT                   /protein_id="BAG42475.1"
FT                   /translation="MDIDQYMTDLGRRARHASRAMARASTAAKNAALDAVARAIERDAQ
FT                   ALKDANARDVARAREKGLDAAFVDRLTLSDKALNTMVEGLRQVASLPDPIGEIGNLKYR
FT                   PSGIQVGQMRVPLGVIGIIYESRPNVTIDAAALCLKSGNATILRGGSEALESNTALAKL
FT                   IGEGLAAAGLPQDAVQVVETADRAAVGKLITMTEYVDVIVPRGGKSLIERLINEARVPM
FT                   IKHLDGICHVYVDDRADLDKALTVCDNAKTHRYGTCNTMETLLVASGIAAKVLPPLGKL
FT                   YRDKQVELRVDAAARAVLADAGVGPLVDATEEDWHTEYLAPVLAIKIVDGLDAAIEHIN
FT                   HYGSHHTDAIVTEDHDRAMRFLREVDSASVMVNASTRFADGFEFGLGAEIGISNDKLHA
FT                   RGPVGLEGLTSLKYVVLGHGEGRQ"
FT   CDS_pept        544479..544901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00509"
FT                   /product="putative membrane protein"
FT                   /note="COG1981: Predicted membrane protein, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K08973"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00509"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42476"
FT                   /db_xref="GOA:A0A0H3KC73"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC73"
FT                   /protein_id="BAG42476.1"
FT                   /translation="MAMLWIKTFHIVLIAAWFAGLFYLPRIYVNLAMETDPAAVRRLLL
FT                   MARKLFRFMTFIAVPALACGLWLWLVIGIGQGQGWIHAKVTVVLLLIVYHAYCGHLLKV
FT                   FERGENRRTDKWYRVFNELPVLGMLAAVALVVIKPF"
FT   mobile_element  complement(544944..546350)
FT                   /mobile_element_type="insertion sequence: ISBmu5b"
FT                   /note="IS3 family, this insertion sequence seems to be a
FT                   derivative of ISBmu5, which has lost internal 40
FT                   nucleotides."
FT   repeat_region   complement(544944..544956)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu5b, terminal inverted repeat"
FT   CDS_pept        complement(544977..545723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00510"
FT                   /product="ISBmu5b transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42477"
FT                   /db_xref="GOA:A0A0H3KKM0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKM0"
FT                   /protein_id="BAG42477.1"
FT                   /translation="MDAGDRYADLKVKIRSVYDHHKGRYGYRRITTVIRQAGHAINHKT
FT                   VQRLMGQLQLKSLVRPKRYRSWRGEVGRVAPNLLRRQFDAERPNQKWVTDVTEFNVGGQ
FT                   KLYLSPVMDLYNGEIVAYQMDERPSFELVSGMLKKAVAKLDDEGRPLLHSDQGWQYQMP
FT                   AYRRLLKQHALTQSMSRRGNCLDNAAMESFFGTLKSECYRLARFANVEQLRDALSRYIH
FT                   YYNHERIKLKLNGLSPVQYRTQPSAA"
FT   CDS_pept        complement(545816..546184)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00511"
FT                   /note="inactivated ISBmu5b transposase OrfA"
FT                   /note="inactivated by internal deletion"
FT   misc_feature    complement(545816..546073)
FT                   /note="ISBmu5b transposase, OrfA remnant, C-terminal part"
FT   CDS_pept        complement(546025..546300)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00512"
FT                   /note="inactivated ISBmu5b transposase OrfA"
FT                   /note="inactivated by internal deletion"
FT   misc_feature    complement(546073..546300)
FT                   /note="ISBmu5b transposase, OrfA remnant, N-terminal part"
FT   repeat_region   complement(546336..546337)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   repeat_region   complement(546337..546350)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu5b, terminal inverted repeat"
FT   repeat_region   complement(546350..546351)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(546393..547241)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00513"
FT                   /note="COG1737: Transcriptional regulators, Pseudomonas
FT                   aeruginosa"
FT                   /note="truncated RpiR family transcriptional regulator"
FT   CDS_pept        547533..549389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="BMULJ_00514"
FT                   /product="phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="COG0129: Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase, Ralstonia solanacearum"
FT                   /note="KEGG, K01690"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00514"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42478"
FT                   /db_xref="GOA:A0A0H3KC92"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC92"
FT                   /protein_id="BAG42478.1"
FT                   /translation="MTSLHPTLAKVTERVIARSQSTRSAYLQRIDGAQGKFPARGALSC
FT                   ANLAHGFAGLEGSDKFAIKAIREPNIGIVSSYNEMLSAHAPYKNFPDIIKAAARENGGV
FT                   AQFAGGVPAMCDGITQGNPGMELSLFSREAIAMGTAIALTHNMFDAALCLGICDKIVPG
FT                   LLIGALQFGHLPTIFVPAGPMTSGLSNDDKAKIRQQFATGQVGRDALLEAESAAYHGHG
FT                   TCTFYGTANSNQMLMELMGLHLPGAAFIHPHTPLRDALTAEAARRVLDLTVERGQYTPI
FT                   GHVIDEKAIVNGIVALLATGGSTNHTLHLVAIARAAGVLIDWNDFDELSAVVPLLAKIY
FT                   PNGKADVNHFHAAGGVAFLVRNLLEGGLLHEDVTTVAGKGLSHYTKEPKLIDGKLTWVD
FT                   GAAESHDTKVLRSIRDPFQPDGGLRLMQGRLGRGVIKISAVAPEHRKVKAPAIVFDSQE
FT                   AVQEAFDRGELKRDFVAVVRFQGARANGMPELHRLTPLLGVLQDQGFHVALVTDGRMSG
FT                   ASGKVPAVIHLSPEALLGGPIGKVKTGDLLVIDAEAGVLDIEVDAAEWEARPVAQPQHQ
FT                   ADNEVGFGRELFGVFRAAAAPAEQGASVFGTLVGETAARVAA"
FT   CDS_pept        549415..550041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="BMULJ_00515"
FT                   /product="2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="COG0800: 2-keto-3-deoxy-6-phosphogluconate aldolase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01625"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00515"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42479"
FT                   /db_xref="GOA:A0A0H3KBX2"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBX2"
FT                   /protein_id="BAG42479.1"
FT                   /translation="MKTIAEIVKLGPVIPVLAFDSVEQGEHVSRALHAGGVKVLEITLR
FT                   TPAGLEAIQRASQLADDIVVGVGTITKPEHCAQAKRAGAKFGVSPGLTKELHLASLDAD
FT                   LPLLPGVMTPSDIIQALEFGYEIVKFFPAQQAGGVPMLQAFHGPFPTLKFCPTGGITAD
FT                   TAPTFLKQPNVVCVGGSWLTPKAALAAQDWAEVTRLAQAASQLPR"
FT   CDS_pept        550262..551623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00516"
FT                   /product="GntP family gluconate:H+ symporter"
FT                   /note="COG2610: H+/gluconate symporter and related
FT                   permeases, Ralstonia solanacearum"
FT                   /note="KEGG, K03299"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00516"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42480"
FT                   /db_xref="GOA:A0A0H3KGV3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGV3"
FT                   /protein_id="BAG42480.1"
FT                   /translation="MGAVQGSMLLVFTLIAIAALILMIARFKIYPFLVLIIVSLGLGLA
FT                   VGMPMDKIVKSFETGTGGTLGHIAIVVGLGTMLGKMMAESGGAERIATTLIDWFGEKNI
FT                   HWAMMFVAIIVGLPVFFEVGFVLLIPIAFNVAKRTGKSLLVVGLPMVAGLSVVHGLIPP
FT                   HPAALLAVQQYGADIGKTIAFGLIVGVPTAIIAGPLFALTISKFVKLAENNPLASQFVD
FT                   TRAGGRERPLPGFGITLFTILLPVVLMLVGSWADLVFAPKSLPNNLLRFAGNSDVALLI
FT                   AVLVSFFTFGKLQGFNRDQIQKFCGECLAPIAGITLIVGAGGGFGGVLRDSGISQQIVE
FT                   TAKHAHLSPLLLGWFVAALMRLATGSATVAMTTACGIVAPIAAAAGTTVSPELLVLATG
FT                   SGSLIFSHVNDGGFWLIKEYFGMTVGQTFKTWSLLETIISVLGLGFTLLLSMVL"
FT   CDS_pept        551637..552140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="BMULJ_00517"
FT                   /product="gluconokinase"
FT                   /EC_number="2.7.1.12"
FT                   /note="COG3265: Gluconate kinase, Ralstonia solanacearum"
FT                   /note="KEGG, K00851"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00517"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42481"
FT                   /db_xref="GOA:A0A0H3KC77"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC77"
FT                   /protein_id="BAG42481.1"
FT                   /translation="MILIAMGVSGAGKSRIGEMLAQRLSCSYTDGDAFHSAANKEKMHH
FT                   GIPLTDDDRWPWLRAIRAAIEEKQRAGETAVFTCSSLKRSYRDVLRGHDTDVRFVYLKG
FT                   SFEVLRERLKTRTGHFFDPSLLQSQLDTLEEPGPDEAIEVSIELTPEQIVDQVIAKMGI
FT                   AQQH"
FT   CDS_pept        complement(552345..553013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00518"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00518"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42482"
FT                   /db_xref="GOA:A0A0H3KKM5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKM5"
FT                   /protein_id="BAG42482.1"
FT                   /translation="MDKSAPGPRGLDKEAIVAAALALLETVGEAAFSVRKLAQSIGCDP
FT                   MSVLYHFKSKEGLNRAIANALSRALVPLDDAQPWRDRLRDLARQYRALALRHPVAFGLL
FT                   QRHMSTGPADLAHVEAVHRALADAGVAANARPTVCVGWYASVIGLAAAEAGGLTRPAND
FT                   IELAEMDALSDTGYPLVKAAAPLYAALDPAVVHETMVEVLLDGIARQVGGGAAGKGEAV
FT                   "
FT   CDS_pept        553294..554712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00519"
FT                   /product="glycine/D-amino acid oxidase"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Escherichia coli K12"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00519"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42483"
FT                   /db_xref="GOA:A0A0H3KC96"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC96"
FT                   /protein_id="BAG42483.1"
FT                   /translation="MTSIPSLLERESRFEATQLNIEKDNWNWCDPVRYDGERPANWYEA
FT                   SLSRWDNAAPLAHDAVCDVLVIGAGLLGASAALHLAEAGVDTILVDKHHVGSAASGRNG
FT                   GQLTPGLARWEAADMIERLAHEDAKRLWRFASSESMALIDAIAARYALDLDRGRGHVTA
FT                   AVHPGHMSALLDGADARRHLGDASVTLVGKHQLHDEYVRSPLYHGAAIDALGGQLHPLA
FT                   LVRGLVYGFRANDGALYECTEVLELDETPAGVVATTPGGTITARKGVVLALHNTTFRLF
FT                   DDGAATTVPFFTYVSVTAPLDVDVASLMPAGMPVYDTQFQIDYYRPVRGNRLLFGGQGT
FT                   GTCWPQHDANAYLLTRLNAVFPQYDGRFALDYSWSGVSDFTLNGATDSRKTDGRVPVYM
FT                   VQGWSGHGVAQTVRIGKAICDDFVGRNDDFSMLTGIDHREIPLGRQLSPVAIPAAKAAM
FT                   SVMTALNPGKMISF"
FT   CDS_pept        complement(554841..556229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BMULJ_00520"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="COG0015: Adenylosuccinate lyase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01756"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42484"
FT                   /db_xref="GOA:A0A0H3KBX6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBX6"
FT                   /protein_id="BAG42484.1"
FT                   /translation="MSDTRPDTLFALTALSPIDGRYASKTEALRDWLSEAAFMRHRVTV
FT                   EVHWLIALSRAGFAEVPRFSEAAEQFLLQLVERFTAHDAARIKEIERVTNHDVKAVEYW
FT                   LKESVKGQPELEKASEFIHFACTSEDINNTSHGMMLAGAREHVILPALRTVHQRLVALA
FT                   HAHAEQPMLSRTHGQPASPTTLGKELANVAARLARAIARIEKVEILGKMNGAVGNFNAH
FT                   LSAYPEFDWEAFSRDVIENRLKLTFNPYTIQIEPHDYMAELFDAVARANTILLDLDRDV
FT                   WGYIALGYFKQKTKAGEIGSSTMPHKVNPIDFENSEGNLGLANATLRHLADKLPVSRWQ
FT                   RDLTDSTVLRNMGVALGYSLLAYDALIRGLDKLEVNPQRLNEDLDNCWEVLAEPVQTVM
FT                   RRYGIENPYEQLKELTRGKGITREALQQFIGTLAIPQDAKDRLLAMTPASYIGKAVELA
FT                   KRIA"
FT   CDS_pept        556392..557345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00521"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00521"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42485"
FT                   /db_xref="GOA:A0A0H3KGV6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGV6"
FT                   /protein_id="BAG42485.1"
FT                   /translation="MELKWLEDFVSLAETRSFSRSAELRHVSQPAFSRRIQALEAWLAT
FT                   ELIDRSVYPTRLTQAGQIFYEQALTMLSQAHEARTLLRGHVGAPVPTIEFAVPHTLSLT
FT                   YFPRWLQRIEAKMGQVHTRLRALNVHDAVLSLVEGGCDLVMGYHHPSHPVALDPARYDM
FT                   LILGSEPISAFSAPGRAGRPRYTLPGTPDARVPYLSYTPNAYLGRMTEVIIANAPTPLF
FT                   LDRVYETDMAEGLKAMALAGHGVAFLPHSAVEDAVAGGRLIRLDRAVRGGAQPFTLTME
FT                   IRLYCDKLALQGEEPRQKLVRALWEVVRDELREAGG"
FT   CDS_pept        557594..558880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00522"
FT                   /product="NAD(P)-dependent glutamate dehydrogenase"
FT                   /EC_number="1.4.1.3"
FT                   /note="COG0334: Glutamate dehydrogenase/leucine
FT                   dehydrogenase, Ralstonia solanacearum"
FT                   /note="KEGG, K00261"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00522"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42486"
FT                   /db_xref="GOA:A0A0H3KC82"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC82"
FT                   /protein_id="BAG42486.1"
FT                   /translation="MSSQLQSIPSYLHADDLGPWGNYLQQVDRVAPYLGSLSRWLETLK
FT                   RPKRILIVDVPIELDNGTVAHFEGYRVQHNVSRGPGKGGVRYHQDVTLSEVMALSAWMS
FT                   VKNAAVNVPYGGAKGGIRVDPRKLSRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNE
FT                   QVMAWMMDTFSMNQGQTSTGVVTGKPISLGGSLGRKEATGRGVFVVGCEAAKKKGLEIE
FT                   GARIAVQGFGNVGGIAAKLFQEAGSKVIAVQDHTGTIYQPAGLDANKLLDHVARTGGVA
FT                   GFEGAEPMANDEFWTVETDILIPAALENQITEKNASKIRTKIIVEGANGPTTTAADDIL
FT                   SANGVLVIPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINHRLERVMREAFAGVWAVAE
FT                   EHKVSVRTAAFIVACKRILMAREMRGLYP"
FT   CDS_pept        559123..560016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00523"
FT                   /product="polar amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0834: ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain,
FT                   Escherichia coli O157:H7"
FT                   /note="KEGG, K02030"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00523"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42487"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKM9"
FT                   /protein_id="BAG42487.1"
FT                   /translation="MKYHKAVLMVAALCAFASGAQAQETGTLKKIKDTGVIALGHRESS
FT                   IPFSYYDQNQQVVGYSREFQLKVVDAVKKKLNLPNLQVKNIPVTSQNRIPLVQNGTVDI
FT                   ECGSTTNNAERQQQAAFSNTIFVIGTRLMTKKDSGVKDFADLKGKTVVTTAGTTSERLL
FT                   RKMNNDKQMGMNIISAKDHGDSFNTLESGRAVAFMMDDALLAGERAKAKQPGEWVIVGT
FT                   PQSEEAYGCMMRKGDPEFKKVVDDAIAQVEKSGEAAKIYAKWFENPIPPKNLNLNFPLS
FT                   DSMKKLYANPNDKALD"
FT   CDS_pept        560178..560918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00524"
FT                   /product="polar amino acid transport system permease
FT                   protein"
FT                   /note="COG0765: ABC-type amino acid transport system,
FT                   permease component, Ralstonia solanacearum"
FT                   /note="KEGG, K02029"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00524"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42488"
FT                   /db_xref="GOA:A0A0H3KC99"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC99"
FT                   /protein_id="BAG42488.1"
FT                   /translation="MSYHWNWGIFLSPVSTGEPTTYFGWLMSGFWVTIEVSLVAWVIAL
FT                   IVGSLFGVLRTVPNKWLAAIGTVYVSIFRNIPLIVQFFIWYLVVPELLPASIGTWIKQL
FT                   PPGTQFFTASIVCLGLFTGARVCEQVRSGINALPKGQRAAGLAMGFTQWQTYRYVLLPV
FT                   AYRIIVPPLTSEFLNIFKNSAVASTIGLLDLSAQARQLVDYTAQTYESFIAVTLAYVLI
FT                   NLVVMGLMRWIEGRTRLPGYIGGK"
FT   CDS_pept        560918..561595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00525"
FT                   /product="polar amino acid transport system permease
FT                   protein"
FT                   /note="COG0765: ABC-type amino acid transport system,
FT                   permease component, Salmonella typhimurium LT2"
FT                   /note="KEGG, K02029"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00525"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42489"
FT                   /db_xref="GOA:A0A0H3KBY1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBY1"
FT                   /protein_id="BAG42489.1"
FT                   /translation="MHQFDWSSIPGALPTLWTGAIVTFKITLIAIVVGIVWGTLLALMR
FT                   LSGVKPLAWFAKAYVTVFRSIPLVMVLLWFFLIVPQVLQGVLGLSPTIDIRLASAMVAF
FT                   SLFEAAYYSEIIRAGIQAVPRGQVNAAFALGMNYAQAMRLVILPQAFRAMVPLLLTQAI
FT                   VLFQDTSLVYVISLADFFRTAANIGDRDGTTVEMVLFAGACYFVICSVASALVKGLQKK
FT                   VTR"
FT   CDS_pept        561592..562317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00526"
FT                   /product="polar amino acid transport system ATP-binding
FT                   protein"
FT                   /note="COG1126: ABC-type polar amino acid transport system,
FT                   ATPase component, Yersinia pestis"
FT                   /note="KEGG, K02028"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00526"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42490"
FT                   /db_xref="GOA:A0A0H3KGW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGW1"
FT                   /protein_id="BAG42490.1"
FT                   /translation="MISIKNVSKWYGQFQVLTDCTTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPFQQGEILVNGQSVGDKKTNLSKLRSKVGMVFQHFELFPHLSITENLTLAQIK
FT                   VLGRGKDEATEKGLKLLDRVGLKAHAHKYPGQLSGGQQQRVAIARALSMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELAQEGMTMMVVTHEMGFAKKVAHRVIFMDKGAIVEDDRKED
FT                   FFSNPKSDRAKDFLAKILH"
FT   CDS_pept        complement(562396..567642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00527"
FT                   /product="outer membrane autotransporter barrel"
FT                   /note="COG3468: Type V secretory pathway, adhesin AidA,
FT                   Yersinia pestis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00527"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42491"
FT                   /db_xref="GOA:A0A0H3KC87"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC87"
FT                   /protein_id="BAG42491.1"
FT                   /translation="MNHSFRSIWSDTSGCWIAVAETARARGKQARSATDRACRLARRAA
FT                   GRSPLRIAALGAALAALAAGNAYASTCGDGTSVASGGSCALGTFSPTVNDNLVGSATVS
FT                   GGDTVAVTGAWSGAAGDSGYAELPFGSTTIVSGNPNQPLLSLGGKTQSVATPDTITSAH
FT                   TSVATYDSSAFVGSTAGAHEVPVFHDVNGNQYVNARIGTVERSGGTLDVSIGDPAAAPS
FT                   APGNLISIAPKQTDLTLADGTGTASSTINWHSRNQIQFTTGDYLANGGPLGSVALDVPT
FT                   YAGTFTAFDGSRWTVNDATSLAAYNDFLVRSIQSGALGSQAAYDAAFGQAVTMSTQTFE
FT                   YANHVSPGDENALPTDHLSVMHGTGANATVQIGKDGQIDFRGTNLVESSSAVLADNGAH
FT                   FVNDGRLSGDFTLVRLLSGASGVNNGAISSGYASGDNFDTGGSAQPDNFGFHAYTEGNG
FT                   VYANGAGTTFVNNGVMNVGAWTYGRNRPDLQNYAVAVTDGAAASNAGTINVGVNATTLD
FT                   SQVIGGFAAGGSFTNEAGGTIYLGRAAQYDGAAPEAVNDVASSAHAYGVLLGASGTATN
FT                   RGTIVIGSLTQNGAAMASIGSNAGTLTNAGTIAVNGAAPGTPLANVGMLAADTAATVTN
FT                   TGTITLNGVNGIGIMVVGNGATATSATSTGTIDVAGAIDPASDMRNYGIWAEGANAAAK
FT                   LDGTLNLTGNGAIGVHARSGATIDVGANAVPHFVSGTNQIGFYAYGAGSKINVGAQNLS
FT                   VGTDDSTLFRVAGGAAYTGRSAAGTLTTNVDGARARGVVATDAGTTLSTGNAVYNVNGA
FT                   NGIAIAVEGGATGTIDAGATINLNANGATAGIVDGQPHDLSGAPAGTAVATRLTNDAAV
FT                   TSSTAGVTGFVAQQLGTLDNRNTVLLTGAGSTGVVAGALGTVNNTSTIRVANGTGARIE
FT                   GASATLANAGTIEADDGVAGVHLTGAGASVALSGAGSVVANGSADGVLIDATVSGGGIA
FT                   AGATSIAVGGAGKGIDNVGTDSTIVLTGMQIGTTGSGADGIHSTGDGAHIATDAATVVR
FT                   TGGDGARGLFVSGAGSTLDATGSTVATAGAGAHAIVVDGGTTALLSGTKLSTSGIAADG
FT                   IVAQRGGRLADVGSSIASAAGNGATVDGGSALALTGTTLKGATSGVTTSDTLASGAASS
FT                   VLIDGGSITAVGGPAFAARGGSAEIAVRNGTVVTTGNGTLLDLANGSRTTFTASAVNLS
FT                   GDIVSDASSIGNVFLTERTTLTGRIDPVALTVDGTSTWNMTASSVLSSLTNAGTVAFAA
FT                   PTGSPALTGSYKTLTTGSYVGNGGTIALNTFLGADASPTDRVVVDGGSATGTTGLKIAN
FT                   TAGTGAQTTGDGIPVVVTANGGTTSASAFHLAGPVQAGAYEYRLFRGGQRDANGWYLRS
FT                   QLDPADPGDPVGPSAGGDGGGSHLAYRPGVAGYALTPLLNVDYGFSTLGKLHERVGDVY
FT                   NVEKRQPGNRDGVWGRIGGQSLDANAGRFAADERTFFAQLGKDWTLEQTPNGGSTHAGV
FT                   TATIGTSHASFSDRARADAADLSTSTGSVQMHAQSIGGYWTRYLSDGTYFDTVGQVTHY
FT                   GNRYRDSYGNEASQNGFGVALSQEVGKPFVIAGTPIAIEPQAQLMYQYLKLNGFGDNVS
FT                   AVSGTTSNALRGRVGVRIFRPNLEAGTGDGAATPYFTADVLRDFLSPGQTVVGGTPFAT
FT                   HLGRTWYELGLGVTAGFGKSGALYANVKYARNIGGDYRRGIVGQVGYRYSW"
FT   CDS_pept        complement(568209..569123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00528"
FT                   /product="glutamine amidotransferase-like protein"
FT                   /note="COG0121: Predicted glutamine amidotransferase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K07008"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00528"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42492"
FT                   /db_xref="GOA:A0A0H3KKN5"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKN5"
FT                   /protein_id="BAG42492.1"
FT                   /translation="MCQLLGMNCAAPTDVTFSFTGFAARGGLTDHHADGWGIAFFEDKA
FT                   CRLFIDQQASATSPIAEMVKRYPIKSKNTIAHIRKATQGHIVLENSHPFMRELWGRHWI
FT                   FAHNGDLQDFEPELERSVYQPVGTTDSEKAFCVLMQGLREAFPGAQPPLPELFERVGEL
FT                   TRGITDHGVFNFLMSNGQALFAHCSTRLHYLVRRWPFSTAHLVDEDLSIDFAKYTTPED
FT                   RVAVIATQPLTDNEVWTAFEPGELIMFQCGDVAARMQIPVPERVLEKLRNPSLDPSASA
FT                   PCTTRTAALATAADGDPDDTIDF"
FT   CDS_pept        569328..570392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="BMULJ_00529"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="COG0418: Dihydroorotase, Ralstonia solanacearum"
FT                   /note="KEGG, K01465"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00529"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42493"
FT                   /db_xref="GOA:A0A0H3KCA2"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCA2"
FT                   /protein_id="BAG42493.1"
FT                   /translation="MTASNASSPATLSLARPDDMHLHLRDGEMLAAVLPHTARQFARAI
FT                   VMPNLKPPVTTTAHAQAYRDRILAALPAGMAFEPLMTLYLTDNTSPDEIRRARESGFVH
FT                   GVKLYPAGATTNSDHGVTDLAKCAKTLEAMQETGMPLLVHGEVTDASIDLFDREKVFID
FT                   RVMTPLRRDFPGLKVVFEHITTKDAADYVRDADAAPGLLGATITAHHLLYNRNALFVGG
FT                   IRPHYYCLPVLKRETHRVALVEAATSGNPRFFLGTDSAPHARGAKEAACGCAGCYTALH
FT                   ALELYAEAFDQAGALDKLEGFASFYGADFYGLPRSAETVTLRRETWELPREVLAGDTPV
FT                   VPLRAGETLGWKLA"
FT   CDS_pept        570389..571270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42494"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBY3"
FT                   /protein_id="BAG42494.1"
FT                   /translation="MTHAPPRAAAQAGGDGAAAFARIDWSAPWLARFAQPGRTVQAAAT
FT                   VGDTALLEALNDALRDGARVTGRGKPLRFVPQAELPPGIAYETHIAETGRVPTRHNLHD
FT                   FFNALVWLAYPRIKAALNARQAAAIDAAGGVGPVRGTLRDALTLFDENAALFVTADRTL
FT                   ADALRAFDWQRLLVAARDAWGARCEARLVGHALLEKLVAPYKSCTAHVWIVEVDADYFS
FT                   WPDARRAEHVDAQVAAMLATRALTSRDFSPLPVLGVPGWCAANADPAFYADPAVFRSGR
FT                   RTREAAGGGAQC"
FT   CDS_pept        complement(571267..571665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00531"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42495"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGW7"
FT                   /protein_id="BAG42495.1"
FT                   /translation="MHTARRSARCVAAIPLGAPLLTRSSFLPADETGAPSCIRRCAPAY
FT                   LELLRVEVTVPADVAVAAVRSYRTVSPLPDPGLRRAIGGLLSVALFRVSPRMAVSHHPA
FT                   LWSPDFPRPRQPEGGEAATAWPALRRAF"
FT   CDS_pept        complement(571759..572181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhfA"
FT                   /locus_tag="BMULJ_00532"
FT                   /product="putative redox protein"
FT                   /note="COG1765: Predicted redox protein, regulator of
FT                   disulfide bond formation, Ralstonia solanacearum"
FT                   /note="KEGG, K07397"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00532"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42496"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC93"
FT                   /protein_id="BAG42496.1"
FT                   /translation="MECKVSWMGQDGMAFSAQTGSGHLVAMDGAPEGGGHNLAPRPMEM
FT                   VLVGTGGCTAYDVVLILKKSRQDVTGCSVTLKAERASEDPKVFTKVHFHFTVTGRNLNP
FT                   ATVERAINLSHDKYCSASIMIAKTAELTHSFDIVAA"
FT   CDS_pept        complement(572643..572948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00533"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42497"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKP2"
FT                   /protein_id="BAG42497.1"
FT                   /translation="MMKQRSIYLFAAALLAAAAPAALARTGCDAKLDALDARIAEARAA
FT                   HAEDRIARLRAVRERVRHFCAHGRAHASAAHASTPAAPTSSAPPDAASQPRARQPA"
FT   CDS_pept        573260..573688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BMULJ_00534"
FT                   /product="large subunit ribosomal protein L13"
FT                   /note="COG0102: Ribosomal protein L13, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02871"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00534"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42498"
FT                   /db_xref="GOA:A0A0H3KCA6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCA6"
FT                   /protein_id="BAG42498.1"
FT                   /translation="MKTFSAKAHEVTREWYVIDATDKVLGRVASEVARRLRGKHKPEFT
FT                   PHVDTGDFIIVINASKLKVTGNKTLDKKYYRHSGYPGGIYETTFGKMQERFPGRALEKA
FT                   VKGMLPKGPLGYAMIKKLKVYAEATHPHSAQQPKALEI"
FT   CDS_pept        573700..574092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BMULJ_00535"
FT                   /product="small subunit ribosomal protein S9"
FT                   /note="COG0103: Ribosomal protein S9, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02996"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00535"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42499"
FT                   /db_xref="GOA:A9AH80"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AH80"
FT                   /protein_id="BAG42499.1"
FT                   /translation="MIGNWNYGTGRRKSAVARVFIKAGKGDIIVNGKPIADYFARETSL
FT                   MIVRQPLELTNHAQTFDIKVNVSGGGETGQAGAVRHGITRALIDYDATLKPALSNAGFV
FT                   TRDAREVERKKVGLHKARRAKQFSKR"
FT   CDS_pept        574314..574685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00536"
FT                   /product="HesB-like protein"
FT                   /note="COG0316: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00536"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42500"
FT                   /db_xref="GOA:A9AH79"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AH79"
FT                   /protein_id="BAG42500.1"
FT                   /translation="MNAVTESAATTTEMPAPFVFTDAAADKVKQLIDEEGNPDLKLRVF
FT                   VQGGGCSGFQYGFTFDEEVNEDDTVMNKNGVQLLIDSMSYQYLVGAEIDYKDDLNGAQF
FT                   VIKNPNATTTCGCGSSFSV"
FT   CDS_pept        complement(574777..575925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="anmK"
FT                   /locus_tag="BMULJ_00537"
FT                   /product="anhydro-N-acetylmuramic acid kinase"
FT                   /note="COG2377: Predicted molecular chaperone distantly
FT                   related to HSP70-fold metalloproteases, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K09001"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00537"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42501"
FT                   /db_xref="GOA:A0A0H3KBY7"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBY7"
FT                   /protein_id="BAG42501.1"
FT                   /translation="MPQRHPPTAHPADGIYFGLMSGTSMDGVDGVAVRFAAGSAPVVLA
FT                   QACVGFAQSLRDALFALQQPGDNEIERESLAANAIVARYAVCCHELLRSAGLAPDDVRA
FT                   IGVHGQTVRHRPERGYTRQLNNPALLAELAHIDVIADFRSRDVAAGGHGAPLAPAFHAK
FT                   VFGAPGETRVVCNLGGISNITILPADGGDVRGFDCGPANALIDAWAMRHLGKPYDDGGK
FT                   FAARGAVHAALLDTLLDEPYFTAPPPKSTGRDLFNPAWLDAKLAAFAHVAPEDVQATLT
FT                   ALTAVSVSREIARHAPDCRAVFVCGGGARNPVLLDALSRALRDAGVPAAVDTTATLGVP
FT                   PQQVEALAFAWLAYRFVAREPGNLPAVTGAAGERVLGALYPR"
FT   CDS_pept        576068..577309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="BMULJ_00538"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="COG0162: Tyrosyl-tRNA synthetase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01866"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00538"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42502"
FT                   /db_xref="GOA:A0A0H3KGX1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGX1"
FT                   /protein_id="BAG42502.1"
FT                   /translation="MSTEPSSKPVFPITDEVRHALAVTKRGVDELLIEEEFAQKLARSA
FT                   ATGKPLRIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNA
FT                   TRPPLTREQIEANAKTYFEQAALVLDRDKTEIRYNSEWSMPLGADGMIKLASRYTVARI
FT                   LEREDFTKRFQGGVPISIHEFLYPLMQGYDSVALNADLELGGTDQKFNLLVGRELQKQY
FT                   GQEQQCILTMPLLEGLDGVEKMSKSKGNYVGISEKPTDMFGKLMSISDTLMWRYFELLS
FT                   FRSMDEIAGFKREAEGGRNPRDFKVMLAQEIVARFHSQADAERALEDFNHRAKGGVPDD
FT                   IPSVSLAGAPLAIGQLLKQAGLVPSTSEALRNIEQGGVKIDGTTVSDKGLKVDAGEYVV
FT                   QVGKRRFARVTLAA"
FT   CDS_pept        577306..577764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="BMULJ_00539"
FT                   /product="D-tyrosyl-tRNA deacylase"
FT                   /note="COG1490: D-Tyr-tRNAtyr deacylase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K07560"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00539"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42503"
FT                   /db_xref="GOA:A9AH76"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AH76"
FT                   /protein_id="BAG42503.1"
FT                   /translation="MIALIQRVKRADVRVGERVTGEIGAGLLALVCAERGDTEAAADKL
FT                   LAKVLGYRVFSDAAGKMNLPVSNIDGAGRAGGLLLVSQFTLAADTNSGLRPSFTPAAPP
FT                   DEGARLFDYFVAAARARHPIVETGEFGADMQVSLVNDGPVTFWLQVRP"
FT   CDS_pept        577788..578450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm"
FT                   /locus_tag="BMULJ_00540"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG0406: Fructose-2,6-bisphosphatase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01834"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42504"
FT                   /db_xref="GOA:A0A0H3KC97"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC97"
FT                   /protein_id="BAG42504.1"
FT                   /translation="MATTQILFIRHGETAWNRIKRIQGHIDIPLADTGLAQAQRLAARL
FT                   MREARDGARIDAVYSSDLMRAQQTAQPFAAALGLPLLLREGLRERAYGVFQGHDSAEIE
FT                   TLFPDAYAEWQTRDPGFAPEGGESQRAFYHRVLHALEPIVAAHPGGRIACVAHGGVLDC
FT                   VYRFANGLDLSAPRNYPLLNTSINVVDYVDGRAHVVRWGDIAHLDAPSDDDGYRKVL"
FT   CDS_pept        complement(578749..579711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00541"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3662: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00541"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42505"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKP6"
FT                   /protein_id="BAG42505.1"
FT                   /translation="MTTPHSAPPSTAGSSRWIEQIRKRVAAGVTHLTTGSGPTLDYSSP
FT                   PGDPGLFGPDAVCWRVHADFTSMMTGGICALLLQALHPLALAGVWDHSSFRTDILGRLR
FT                   RTATFISGTTFGNRRDALALIERVKAIHARVAGTAPDGRPYRADDPALLTWVHVAEVSS
FT                   FLAAHLRYVNPALPGELQDRYYAETAQVAERLGATDIPRSRAEIDAYLARMRPELEAGP
FT                   RTFEVMRILLNAPLASPMLRPAATLVMQAGVDLLPPWAQQMLGVSTFAPLRRAVVRPGV
FT                   RAVAPVLRWALVNGVSKRARRRATAATAVPPDRPSSNRG"
FT   CDS_pept        complement(579737..580804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="BMULJ_00542"
FT                   /product="holliday junction DNA helicase"
FT                   /note="COG2255: Holliday junction resolvasome, helicase
FT                   subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K03551"
FT                   /note="RuvB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00542"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42506"
FT                   /db_xref="GOA:A9AH73"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AH73"
FT                   /protein_id="BAG42506.1"
FT                   /translation="MIETDKLAAERIIAATPASSHEEVFERALRPRQLDDYVGQEKVRG
FT                   QLEIFIEAAKRRREPLDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSGPVLERAGDLA
FT                   ALLTNLEANDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVKLDLQPFTL
FT                   VGATTRAGMLTNPLRDRFGIVARLEFYDADQLSRIVQRSASLLNAQIDPNGALEIAKRS
FT                   RGTPRIANRLLRRVRDYAEVKADGQITAAIADAALAMLDVDPVGFDLMDRKLLEAILHK
FT                   FDGGPVGIDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRVATLLTYRHFGLAAPD
FT                   AGSPVQSIWDTPDAQ"
FT   CDS_pept        complement(580901..581482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="BMULJ_00543"
FT                   /product="holliday junction DNA helicase"
FT                   /note="COG0632: Holliday junction resolvasome, DNA-binding
FT                   subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K03550"
FT                   /note="RuvA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00543"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42507"
FT                   /db_xref="GOA:A9AH72"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AH72"
FT                   /protein_id="BAG42507.1"
FT                   /translation="MIGRIAGILLEKNPPHLLVDCNGVGYEIDVPMSTFYNLPQTGERV
FT                   VLLTQQIVREDAHLLYGFLTPQERTTFRELLKITGIGARMALAVLSGMSVQELAQAVTM
FT                   QDAARLTRLPGIGKKTAERLLLELKGKLGADLGALAGAASASDHATDILNALLALGYSE
FT                   KEGLAAIKNVPAGTGVSEGIKLALKALSKA"
FT   CDS_pept        complement(581672..582214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="BMULJ_00544"
FT                   /product="crossover junction endodeoxyribonuclease"
FT                   /note="COG0817: Holliday junction resolvasome, endonuclease
FT                   subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K01159"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00544"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42508"
FT                   /db_xref="GOA:A9AH71"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AH71"
FT                   /protein_id="BAG42508.1"
FT                   /translation="MRILGIDPGLRVTGFGVIDVSGHQLAYVASGVIRTPTADLATRLG
FT                   TIFAGVSTLVREHAPDQAAIEKVFVNVNPQSTLLLGQARGAAICGLVSGGLPVAEYTAL
FT                   QLKQAIVGYGRATKAQMQEMVTRLLSLSGQPGSDAADALGIAICHAHGGNTLSTLGGLA
FT                   PALAQKGLRLRRGRLVG"
FT   CDS_pept        complement(582432..583997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BMULJ_00545"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /note="COG0138: AICAR transformylase/IMP cyclohydrolase
FT                   PurH (only IMP cyclohydrolase domain in Aful), Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00602"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00545"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42509"
FT                   /db_xref="GOA:A9AH70"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AH70"
FT                   /protein_id="BAG42509.1"
FT                   /translation="MIKQALISVSDKTGIVDFAKSLSDLGVKLLSTGGTAKLLADAGLP
FT                   VTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMQALEAHDIPTIDLLVVNLYP
FT                   FVATIAKDDCTLADAIENIDIGGPTMLRSAAKNHRDVTVIVDPADYAVVLDEMKANGNT
FT                   VGYATNFRLATKVFAHTAQYDGAITNYLTSLTDELKHGSRNPYPATLNMAFEKVQDLRY
FT                   GENPHQSAAFYRDIVTPAGALANYRQLQGKELSYNNIADSDAAWECVKTFDAPACVIIK
FT                   HANPCGVAVGNDSADAYAKAFQTDPTSAFGGIIAFNREVDEAAAQAVAKQFVEVLIAPS
FT                   FTDAAKQVFAAKQNVRLLEIALGEGHNAFDLKRVGGGLLVQSLDAKNVQPHELRVVTKR
FT                   HPTPKEMDDLLFAWRVAKYVKSNAIVFCGNGMTLGVGAGQMSRVDSARIASIKAQNAGL
FT                   TLAGSAVASDAFFPFRDGLDVVVAAGATCVIQPGGSVRDDEVIAAADEHNIAMILTGVR
FT                   HFRH"
FT   CDS_pept        complement(584042..584275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="BMULJ_00546"
FT                   /product="factor for inversion stimulation protein"
FT                   /note="COG2901: Factor for inversion stimulation Fis,
FT                   transcriptional activator, Ralstonia solanacearum"
FT                   /note="Fis protein"
FT                   /note="KEGG, K03557"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00546"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42510"
FT                   /db_xref="GOA:A0A0H3KCA9"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCA9"
FT                   /protein_id="BAG42510.1"
FT                   /translation="MSKHNIEQCVRESLDVYFRDLDGSNPHDVYEMVMSCVEKPMLEVV
FT                   LEQAGGNQSLAAEYLGINRNTLRKKLQQHGLL"
FT   CDS_pept        complement(584272..585336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="BMULJ_00547"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /note="COG0042: tRNA-dihydrouridine synthase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K05540"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00547"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42511"
FT                   /db_xref="GOA:A0A0H3KBZ7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KBZ7"
FT                   /protein_id="BAG42511.1"
FT                   /translation="MPVIGSHVLRNNLFVAPMAGVTDRPFRQLCKKLGAGYAVSEMVAS
FT                   NAQLWKSAKTMRRANHAGEVEPIAVQIAGADPAMMAEAARYNVDNGAQIIDINMGCPAK
FT                   KVCNVAAGSALLQNEPLVQRIVEAVVAAVGTGPDAVPVTLKIRTGWDREHKNAITIARL
FT                   AEAAGISMLTVHGRTRADLYRGEAEYETIAAVKAAVRIPVVANGDITSPAKAKAVLEAT
FT                   GADALMIGRAAQGRPWLFREIDHFLQTGELLPPPRIDEIQQVMNEHLEDHYAFYGEFTG
FT                   VRTARKHIGWYTRGLSGANAFRHRMNTLDSTREQLAAVNAFFDAQKALSDHLVYVDDDE
FT                   NGQGEPDDHNQLAA"
FT   CDS_pept        complement(585484..586671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="BMULJ_00548"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /note="COG0654: 2-polyprenyl-6-methoxyphenol hydroxylase
FT                   and related FAD-dependent oxidoreductases, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03185"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00548"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42512"
FT                   /db_xref="GOA:A0A0H3KGX3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGX3"
FT                   /protein_id="BAG42512.1"
FT                   /translation="MTHASSPLPTDYDLAIVGAGPVGLALAGWLARRSATQHASIALID
FT                   AREPSASANDPRAIAVSHGSRVLLDTLAWPADATPIEHIHVSQRGHFGRTLIERDEHDL
FT                   AALGYVVRYGSLVQALAGAVRGSRVDWLTSTTARAPLQDADGVALTLDGPHGERVLRAR
FT                   IVVNAEGGLFHEQQADAGKHRRDYGQTAIVGTVTVSSPRPNVAWERFTHEGPLALLPLG
FT                   GPRQADYALVWCCAPDEAARRAALPDDAFLRELGTAFGERMGSFVAIAGRASFPLGLNA
FT                   AQTLVKGRIAIVGNAAQTLHPVAGQGLNLGLRDAHTLVDVLSTQGFDATALATFNARRA
FT                   LDRRLTIGATDTLARLFTIDAGPLPLLRGAALTALEFVPPLKKAIARQMMFGQRG"
FT   CDS_pept        complement(586717..588102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="BMULJ_00549"
FT                   /product="X-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /note="COG0006: Xaa-Pro aminopeptidase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01262"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00549"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42513"
FT                   /db_xref="GOA:A0A0H3KCA0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCA0"
FT                   /protein_id="BAG42513.1"
FT                   /translation="MNPPLDTAIAVDVYRQRRERVLAALRAAGGGVAIVPTAPEVLRNR
FT                   DTGYPYRHDSYFYYLTGFTEPDAVLVLNAAAPHGAPESILFCRAKNADREIWEGFHYGP
FT                   EAARDTFGFDAAYATDVLDTEIPRLLADAGTVHYRFGASAEFDRQLARWLDAVRGQARS
FT                   GVAAPDAMRDLTPLLDDMRLVKDEHELAIMTRAAHISALAHRRAMQACKPGIREYELEA
FT                   ELLYTFRLHGAQAPAYGSIVAAGANACVLHYPAGNAVAQDGDLILIDAACELDGYASDI
FT                   TRTFPANGRFSPAQRTLYDIVLAAQQAAIDATRAGVPFEAPHDAAVRVLAQGLLDTGII
FT                   AKTRFSNVDDVIAERAYTRFYMHRTGHWLGMDVHDCGDYRERHAERDANGALPWRTLKP
FT                   GMALTVEPGLYVRAADDVPSEYWNIGIRIEDDAIVREHGCELITRDVPVAAADIEALMR
FT                   ARA"
FT   CDS_pept        588285..588899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BMULJ_00550"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="COG0625: Glutathione S-transferase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00799"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42514"
FT                   /db_xref="GOA:A0A0H3KKQ1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKQ1"
FT                   /protein_id="BAG42514.1"
FT                   /translation="MMKLIGSLSSPYVRKARIVLAEKKIDYKLELENVWAPDTNIHASN
FT                   PLGKVPCLVMEDGAAVFDSRVICEYVDTLSPVGKLIPASGRERVEVRCWEALCDGVLDA
FT                   SVAIRLEYTLRDEAQRSASWIARQQRKIDDGLVAMSQGLGSKTWCVGNHYTLADISLGC
FT                   ALGYLDFRMPELNWRERHPNLDKHFVKLSQRQSFADTLPQG"
FT   CDS_pept        complement(589004..590623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00551"
FT                   /product="NADPH-dependent glutamate synthase"
FT                   /EC_number="1.4.1.13"
FT                   /note="COG0069: Glutamate synthase domain 2, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00264"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00551"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42515"
FT                   /db_xref="GOA:A0A0H3KCB4"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCB4"
FT                   /protein_id="BAG42515.1"
FT                   /translation="MLSRRYLAMWCAVLLLVAAAALASFHVLSGLWIAIPAALVALGLY
FT                   DLNQDRHAILRNYPLWGHFRFLFEFIRPEIRQYFVEDDTDEKPFSRAQRSLVYQRAKNV
FT                   ADNRPYGTELNVKAVAHEWISHSLAPTRLPNHDFRIRVGATRAQPYDISIFNISAMSFG
FT                   SLSANAIRALNLGAKKGGFAHDTGEGSLSKYHREHGGDIIWEIASGYFGCRNDDGTFNP
FT                   DKFAKQAADPQVKMIEIKLSQGAKPGHGGVLPAAKITPEIAETRGVPMGKDCISPATHS
FT                   EFSTPRGLLEFVERLRTLSGGKPTGFKLCIGHPWEFFGIAKAMLETGIVPDFIVVDGAE
FT                   GGTGAAPLEFTDHVGVPLQEGLLLVHNTLVGIGLRDRVKLGASGKIITAFDIARTLAIG
FT                   ADWVNSARGFMFAVGCIQAQHCHTDRCPTGVATQDPVRQRALVVPDKAERVYNFHRNTL
FT                   HALQELVQAAGLSHPSELRAHHIVQRVSPHEVRLMSQLLKYLKPGALLDGNTCGYTLYD
FT                   KWWPIARSDSFTLGETVYASID"
FT   CDS_pept        complement(590739..591884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="BMULJ_00552"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="COG0482: Predicted
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)
FT                   methyltransferase, contains the PP-loop ATPase domain,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00566"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00552"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42516"
FT                   /db_xref="GOA:A9AH63"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AH63"
FT                   /protein_id="BAG42516.1"
FT                   /translation="MSKRRVVVGMSGGVDSSVTAWLLKEQGYDVVGLFMKNWEDDDDGE
FT                   YCSTRQDWIDVVSVADLIGIDVEAVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEI
FT                   KFKAFLDHAMSLGAETIATGHYARVRERDGRFELLKAFDHTKDQSYFLHRLNQAQLSKT
FT                   MFPLGEIPKTKVREIAAQIGLPNAKKKDSTGICFIGERPFRDFLNRYLPTKPGPMKTPD
FT                   GKLVGEHIGLAFYTFGQRKGIGLGGSKDGSGEPWFVAAKDIASNTLYVVQGHDHPWLLS
FT                   RELVAGNVSWVAGEPPAEGFACGAKTRYRQADAACTFARAGGERFSLAFADAQWAVTPG
FT                   QSAVLYDGEICLGGGIIEFAATGQPGHAPAPAAAPALAEAR"
FT   CDS_pept        complement(591881..592390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00553"
FT                   /product="putative NTP pyrophosphohydrolase"
FT                   /EC_number="3.6.-.-"
FT                   /note="COG0494: NTP pyrophosphohydrolases including
FT                   oxidative damage repair enzymes, Ralstonia solanacearum"
FT                   /note="KEGG, K01554"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00553"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42517"
FT                   /db_xref="GOA:A0A0H3KC15"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC15"
FT                   /protein_id="BAG42517.1"
FT                   /translation="MKPEIWTPHVTVAALVERDGRFLVIEEETSTGLRINQPAGHLEAG
FT                   ETLADAVIRETLEETAHPFVPTALVGVYLAHYERPGSAGATYLRFTFCGTAGERIVGQR
FT                   LDDGIVRTLWMTAGELRACIERHRSPAVMRCVDDYLAGRRVPLDFVHTHSVAPRPDAFD
FT                   RQAVNK"
FT   CDS_pept        592669..593808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="BMULJ_00554"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /note="COG3288: NAD/NADP transhydrogenase alpha subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00324"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00554"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42518"
FT                   /db_xref="GOA:A0A0H3KGX5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGX5"
FT                   /protein_id="BAG42518.1"
FT                   /translation="MHIGVPAETRANEARVAATPETVKKYAAAGHRVSVAKGAGTAASY
FT                   PDEAYAAAGAELTDQSAAFGADIVLKVQAPTDAELPSLKRGAVLVGMLEPFNAEQAAKL
FT                   AATGVTGFALEAAPRTTRAQSLDVLSSQANIAGYKAVLVAASLYPRFLPMLMTAAGTVK
FT                   AARVLVLGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFLDVPYETDEERD
FT                   AAQGVGGYARPMPPSWLARQAALVHERAKQADIVITTALIPGRPAPTLISAETVQAMKP
FT                   GSVLVDLAAGRGPEVDGRKGGNCPLTVADQVIVHNGVTIAGHTNLASMVASDASALYAR
FT                   NLLDFMKLIVTKEGVLNIDLADDIVAATLLCRDGEVTRK"
FT   CDS_pept        593820..594146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="BMULJ_00555"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /note="COG3288: NAD/NADP transhydrogenase alpha subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00324"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00555"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42519"
FT                   /db_xref="GOA:A0A0H3KCA4"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCA4"
FT                   /protein_id="BAG42519.1"
FT                   /translation="MEVINHTVINVIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTVGATGKVFGTLAVALAAVNVFGGFLVTRRMLEMFRKKEPKRVEGGK
FT                   EGAR"
FT   CDS_pept        594143..595597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="BMULJ_00556"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /EC_number="1.6.1.2"
FT                   /note="COG1282: NAD/NADP transhydrogenase beta subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00325"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00556"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42520"
FT                   /db_xref="GOA:A0A0H3KKQ6"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKQ6"
FT                   /protein_id="BAG42520.1"
FT                   /translation="MSMNVVTLLYLVASVCFIQALKGLSNPKSARRGNLFGMVGMAIAI
FT                   LTTIALIVKQAAWLGANLPLGLALVLGALVVGGAVGAFVAARVEMTKMPELVAAMHSLI
FT                   GLAAVCIAYAVVSEPEAFGLVPQDAVSSNFIPYGNRVELFIGTFVGAITFSGSVIAFGK
FT                   LSGKYKFRLFQGAPVVYAGQHLINLMLAIAMLGFGILFFITQAWLPFIIMTAIAFVLGV
FT                   LIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNAMLIIAGSLVGSSGAILSYIMCHA
FT                   MNRSFFNVILGGFGGEAAAGGAAGAQEQRPVKSGSADDAAFMLGNAESVVIVPGYGLAV
FT                   ARAQHALKELTDKLIEKGVDVRYAIHPVAGRMPGHMNVLLAEAEVPYDIVFEMEDINGE
FT                   MGQADVVLVLGANDVVNPAAKNDPKSPIAGMPIIEAYKARTVIVNKRSMAAGYAGLDND
FT                   LFYMDKTMMVFGDAKKVIEDMVKAVE"
FT   CDS_pept        complement(595686..596606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00557"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00557"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42521"
FT                   /db_xref="GOA:A0A0H3KCC0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCC0"
FT                   /protein_id="BAG42521.1"
FT                   /translation="MNADDIAGLDLNLLKVFEALYEEGGASRAALRLELTQSAVSAALA
FT                   RLRVVYADPLFVRTGRGLAPTPRADELKPILSDALDRCRASLAIAADGGERVGRTISIG
FT                   LSDDFEIALGRALIDAVARDAAGIRLIFRQTHSGIAGDALLRHGVDIAIASGGFSANGL
FT                   SRRAVATGGYACVIDPAGRARTPRTLTLDDYLRREHLLVSSGGVIGIVDEALAALGRTR
FT                   RVAASTTHFAALPYLLAGADAVATIPAHAARAIAQATSLRCVGCPLELPRYPVEIGWRT
FT                   STQRDPAIVRVRDTIAACVERIVRP"
FT   CDS_pept        596691..597614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00558"
FT                   /product="nitrilase"
FT                   /EC_number="3.5.5.1"
FT                   /note="COG0388: Predicted amidohydrolase, Saccharomyces
FT                   cerevisiae"
FT                   /note="KEGG, K01501"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00558"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42522"
FT                   /db_xref="GOA:A0A0H3KC18"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC18"
FT                   /protein_id="BAG42522.1"
FT                   /translation="MSTSVIAALQLGASPAGTRATLDTILGYETAIRDSGASLVVLPEA
FT                   VLGGYPKGEIFGTRLGYRLPEGRDAYARYAAQAIDVPGPETDELAALSQRTGASLVVGV
FT                   IERGGSTLYCTALFFDPRDGLVAKHRKLMPTGTERLIWGQGDGSTLPVVETAAGRAGAA
FT                   ICWENHMPLLRCAMYAKGVQIWCAPTVDERDVWQSSMRHIAHEGRCFVVSACQVQPSPR
FT                   ALGIEVPGWDPERPLIRGGSVIVGPLGDLLTEPLVGEAGLVSARIDTDELVRARYDFDV
FT                   VGHYARADVFSLQVDERPKRPVVFAG"
FT   CDS_pept        complement(597669..598355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00559"
FT                   /product="predicted transcriptional regulator"
FT                   /note="COG2378: Predicted transcriptional regulator,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00559"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42523"
FT                   /db_xref="GOA:A0A0H3KGX7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGX7"
FT                   /protein_id="BAG42523.1"
FT                   /translation="MTRRADRLFQIAELLRGRRLTTAQQLADWLSVSPRTVYRDVRDLQ
FT                   LSGVPIEGEAGIGYRLNRNASLPPLTFTAEELAALAAGARMLETWGGARFAGGARSALA
FT                   KIASAMPADKRTALDRLPVFAPSFHIDEAFFAKVDAIHQAVDTRHIVSFTYRDRLGAHT
FT                   KRRVWPLGLVYWGGRWTIGAWCELRGDFRTFDIARMGDITVHEQFPDMEGRRIADYMRI
FT                   AETPMR"
FT   CDS_pept        complement(598435..598869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00560"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="KEGG, K06996"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42524"
FT                   /db_xref="GOA:A0A0H3KCA7"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCA7"
FT                   /protein_id="BAG42524.1"
FT                   /translation="MTSATATAPAPAKTAATAAPDRAIAWFDIPSLDFDRAIRFYEAVL
FT                   QTTLHREVIGGVPMAIFDHEASSTGGSIVFDPQQLKPSANGVLVYLNAGESVVAALDRA
FT                   KRAGGVVQGSVVELPNNYGYIGYLIDTEGNRVGLHAPKCH"
FT   CDS_pept        complement(599118..600416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00561"
FT                   /product="putative N6-adenine-specific DNA methylase"
FT                   /note="COG0116: Predicted N6-adenine-specific DNA
FT                   methylase, Ralstonia solanacearum"
FT                   /note="KEGG, K07444"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00561"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42525"
FT                   /db_xref="GOA:A0A0H3KKR1"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKR1"
FT                   /protein_id="BAG42525.1"
FT                   /translation="MSSPTLYDFFAPCPRGLEAALAAELAEIAGRHLDGAPFAAGAQVP
FT                   GGVHFRGGWAAGMAANLHSRIASRILLKIAHRPYRSEQDVYALALEQPWERWFAATQTL
FT                   RVDITAIKSPLKSLEFATLRVKDAICDRMRDKTGARPSIDTGAPDVRVFAFLTATDCTL
FT                   YLDTSGEPLFKRGWRLDKGAAPLRENLAAGILRLTGWTPGTPLYDPMCGSGTFLAEAAQ
FT                   MVLGVAPGVERRFGFEKLKQYDITAWQGLKVAALDAKRAARGRRDDLRVYGSDISGDML
FT                   EKARANLERAGVPSVWLKQVDARGMTPPCDGPGLIVANPPYGERIEVRGRSARGEVRET
FT                   GRNRGNDDAFRRTHTDAPDSEFFNALGDALKQRFAGWQAFLLTSDRALPGQLRLRESAK
FT                   TPLFNGALECRLFRFDLIAGSVKARPAAPDGDA"
FT   CDS_pept        complement(600533..602665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00562"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4389: Site-specific recombinase, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00562"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42526"
FT                   /db_xref="GOA:A0A0H3KCC4"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCC4"
FT                   /protein_id="BAG42526.1"
FT                   /translation="MFRSLTTLIKKWRASRSASHQLDALLAHANAEASYAERSEWLIEL
FT                   AHWLRRGGAMQTAQAAQDGAAERGDDARSYPAHARLRYLFHVLDRNPAWKSHAARIVRG
FT                   ILRECDGISLLCDAGMPVHSGFFGALFERIDASLIPPAPNRRELSALFTLMFPTPDDAQ
FT                   WIDALPDDLLARLADLLAFDVTDDERHEPGSFSRDLLAALHNLTCQISSTGLSQTVRSR
FT                   LSDDDARTPLEAQPFYRLTRAMLAVETAHAAVEDGGDPSKLLHEVNYLRVLLDECRVAV
FT                   DDVFSHLYRNGVSVDIVFQVERMRMRILRAETLLNAWMARDDLRGMARLTAELVDANQN
FT                   SQSVAHLMRSNFSLFARKLVETNADTGEHYISRSRAEYLKMLRMAAGGGLVTVATVCVK
FT                   FAITGAHLQSMLEGLLAGVNYAASFMLMHFLHFTLATKQPAMTAPTLARELDDTGHDEG
FT                   VKAFVASVIALIRTQAAAISGNVLVVLPVCLLVQLFAAGVLHVNVISPEKAHATLHSFS
FT                   LFGPTPFYAALTGVLLWASSLLAGWADNWFVLHRVGDALAYNRRLRLTLGAAGAAKFAH
FT                   FCRSNVAGVVANVGLGLMLGLIPAIVTVFLFPFEVRHVTLSAGSIGVALGVLGKGALGT
FT                   PELWWACAGVLSMAILNVLVSFALAFTMAVRSRSLRPTKVRALVAAIVRAVVAHPFGLL
FT                   WPAAGRDARAQQSGSH"
FT   CDS_pept        complement(603004..603735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00563"
FT                   /product="putative lipoprotein"
FT                   /note="COG3009: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00563"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42527"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC24"
FT                   /protein_id="BAG42527.1"
FT                   /translation="MTTTRVNVLASGAAAVLAALALAACSSPPARFYTLARADAAAPAR
FT                   TAPANPPFLIEVPSVDVPEQIAKNQLVVQKGGAQVDVLEQERWAAPPADEIRRALSDDL
FT                   AARLGTIDVADSAVPPGMPVYRISVNVQRFESWPGKRAAIDAVWSVRAVGSQAVMTCRT
FT                   SVAEPVGSGYDALVAGHRRALDAIAAQAAAGVRALAARRGTAAQPAGKTAAAAVPPLVP
FT                   CPPAPAAVPATDAGATGQPGA"
FT   CDS_pept        complement(603732..605351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="BMULJ_00564"
FT                   /product="paraquat-inducible protein B"
FT                   /note="COG3008: Paraquat-inducible protein B, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06192"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00564"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42528"
FT                   /db_xref="GOA:A0A0H3KGX9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGX9"
FT                   /protein_id="BAG42528.1"
FT                   /translation="MNSPQGPQHDESRPPDPTISTKSGWLPSLVWLVPLIAALIGIGLV
FT                   VRSVRERGPEITISFHSAEGLEPGKTQVKYKDVEIGMVKTIKLSKDLSRVLVEVQLKKE
FT                   AEDFAVKDSRFWIVRPRVGATGVSGLGTLLSGAYIGVDAGRSQDVQTDFTGLEKPPAVT
FT                   ADQKGTQYVLRGDSLGSVDIGSPVYYRRVQVGQVVGFSLDKDGTGVTFNVFVNAPYDQY
FT                   VGTNSRWWQASGVDLRLDSSGLKLNTQSLATVILGGIAFQTPPNQSSGALAPNNTTFRL
FT                   AADEGDAMRDPDGQPLQVVMNFNQSLRGLGIGAPVDFRGIVLGEVTNIGIDYDPKTKNF
FT                   TMPVTMNVYPERLGRRFRETIASKGEAARLEIVQRLVQHGLRGQLRTGNLLTSQLYVAL
FT                   DFFPKAPPAKVDVSHQPLELPTVPNTLDELQLQVADIAKKLDKVPFDQIGANLNSALSN
FT                   ADKLFKQLDTQVAPEARDTLSAAKQTFSTAEATLQQDSPLQSDVRGALKELTRTLQSLN
FT                   ALADYLERHPESLIKGKPGDQP"
FT   CDS_pept        complement(605344..605973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiA"
FT                   /locus_tag="BMULJ_00565"
FT                   /product="paraquat-inducible protein A"
FT                   /note="COG2995: Uncharacterized paraquat-inducible protein
FT                   A, Ralstonia solanacearum"
FT                   /note="KEGG, K03808"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00565"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42529"
FT                   /db_xref="GOA:A0A0H3KCB2"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCB2"
FT                   /protein_id="BAG42529.1"
FT                   /translation="MTTPTAAREGYVSCHACGLVQTLDRPHAHCARCGSALHFRTPNSI
FT                   ARTWALLIAAAILYIPANLLPIMRTSSLMGSQQDTIMSGVIYFWVSGDWPLAVVVFVAS
FT                   ILVPMLKLGVLLILVISAQRRTAWRPLQRTRLYRIVERIGRWSMLDIFVVTLTVALVHF
FT                   RSLAVITAGPGALAFGSVVILTMLASMQFDPRLIWDPVETSGKHHE"
FT   CDS_pept        complement(605970..606635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiA"
FT                   /locus_tag="BMULJ_00566"
FT                   /product="paraquat-inducible protein A"
FT                   /note="KEGG, K03808"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00566"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42530"
FT                   /db_xref="GOA:A0A0H3KKR7"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKR7"
FT                   /protein_id="BAG42530.1"
FT                   /translation="MQRNDLIACHECDALLHKPRLSGREVARCPRCDAMLYRNSASQIE
FT                   RICALALAALITFVIAQTFPILEMDVNGNRVQTTLIGAIDALWRQDMAIVGVMVFCSTV
FT                   LFPLVEMSALLYLLLPIRRGVIPPGFNAVLRAVQLVRPWGMIEVFMLGILVTIVKMVSL
FT                   ARVVPEAALFAFGALTLMLAVVLMFDPRTLWDIADDLRAGRMRTPRDGVAPLAEGARR"
FT   CDS_pept        606892..607452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00567"
FT                   /product="putative cytochrome b561"
FT                   /note="COG3038: Cytochrome B561, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00567"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42531"
FT                   /db_xref="GOA:A0A0H3KCD0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCD0"
FT                   /protein_id="BAG42531.1"
FT                   /translation="MTSNSLQPAPAGYTRTAIALHWLIALLIVCGFALGWVMTDIPGFT
FT                   PTKLKYFSWHKWIGVTVFALAIVRVLWRATHVPPALPAGMRAWQRTAAHVGHLLLYVLM
FT                   LVIPATGYLYSSASNIPVVYLGIVPLPRLIDPDPVLKETFKTLHVSLNYILLALVSLHV
FT                   LAALKHQLVDRDGLLSRMLPFAK"
FT   CDS_pept        607461..608021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00568"
FT                   /product="putative exported protein"
FT                   /note="COG2353: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00568"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42532"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC29"
FT                   /protein_id="BAG42532.1"
FT                   /translation="MKVSFSRSMLAALAAVSLAASGAALADVDLAKSKVSAVSKQMNVP
FT                   TEGVFKKFSAQVKFDPAKAAQGSAQMTIDVASFDLGDKMYNDQVAGKEWFDAKTYPQAT
FT                   FVSSAIAPAGGNKYNVTGKLTIKGKTENVTVPVTVTQSGATQTFDGVLPIKRSTFNVGT
FT                   GEWKDTSVVADEVQIKFHLVATK"
FT   CDS_pept        608086..608667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00569"
FT                   /product="putative exported protein"
FT                   /note="COG2353: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00569"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42533"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGY1"
FT                   /protein_id="BAG42533.1"
FT                   /translation="MKKHLMIAAGALAASLSFSAFAESATYQFDPSHTYPSFEADHFGG
FT                   LSVWRGKFDKSSGTVTLDRAAKTGTVEVTTDIASIHTGSAKLDEHLQTADFFDAAKYPQ
FT                   AVYKGTIKFDGDKPASVVGNLTLHGVTKPLTLKIDSFKCMPHPMLKREVCGVDAVGEFN
FT                   RDEFGLDYGKQYGFKMQTKLLITAEAVKQQ"
FT   CDS_pept        608846..610123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="BMULJ_00570"
FT                   /product="proline/betaine transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /note="KEGG, K03762"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42534"
FT                   /db_xref="GOA:A0A0H3KCB6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCB6"
FT                   /protein_id="BAG42534.1"
FT                   /translation="MHAVTPSRSIASSPRVWRAVVAASIGNALEWFDLVVYGFFAVTIS
FT                   RLFFPAGNDTVSLLLTLGTFGVSFFMRPLGAIVLGAYADRAGRKAALTLSILLMMAGTL
FT                   IIAVLPTYETIGIAAPLILVAARLMQGFSAGGEFGSATAFLAEHVPGRRGFFASWQVAS
FT                   QGLTTLLAAGFGTVLNAQLTAAQMAAWGWRVPFFFGLLLGPVAYYIRKKVDETPEFLAA
FT                   ESTASPLRDTFKSHKARLVAAIGAVVLGTVATYLVLFMPTYGVKQLGLAPSAAFAAILV
FT                   VGVIQMAFAPLVGHWSDRYGRVRVMLAPALGFLVLIYPAFAYLVAHPGFGTLIALQVLL
FT                   AVLMTGYFAALPGLLSEVFPVQTRTTGMSLAYNIAVTIFGGFGPFIIAWLIKATGMKTA
FT                   PSFYLMFAAVLSLAALVVLRRRFGFR"
FT   CDS_pept        complement(610341..611291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="BMULJ_00571"
FT                   /product="preprotein translocase SecF subunit"
FT                   /note="COG0341: Preprotein translocase subunit SecF,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03074"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00571"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42535"
FT                   /db_xref="GOA:A0A0H3KKS1"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKS1"
FT                   /protein_id="BAG42535.1"
FT                   /translation="MEFFRIRKDIPFMRHALVFNVISLVTFLAAVFFLFHRGLHLSVEF
FT                   TGGTVIEVQYQQAAQLEPVRATLGKLGYADAQVQNFGTSRNVLIRLQLKEGLTSAQQSD
FT                   QVMTALKAQSPDVTLQRVEFVGPQVGRELATDGLLALACVVIGIVIYLSIRFEWKYAVA
FT                   GIIANLHDVVIILGFFAFFQWEFSLAVLAAILAVLGYSVNESVVIFDRIRETFRRERKM
FT                   TVPEVINHAITTTMSRTIITHTSTEMMVLSMFFFGGPTLHYFALALTVGIMFGIYSSVF
FT                   VAGSLAMWLGIKREDLIKEKKVAHDPDDPNAGAQV"
FT   CDS_pept        complement(611310..613331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="BMULJ_00572"
FT                   /product="preprotein translocase SecD subunit"
FT                   /note="COG0342: Preprotein translocase subunit SecD,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03072"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00572"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42536"
FT                   /db_xref="GOA:A0A0H3KCD3"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCD3"
FT                   /protein_id="BAG42536.1"
FT                   /translation="MNRYPLWKYVVMVVALAIGFLYTLPNFFGEAPAVQVSSGKATVKL
FT                   DANTLTQVETALAAAQIKPDDVTFENTATNANIRVRLKDTDTQLRVKDLLQKTLNADPN
FT                   DPQYVVALNLQSASPRWLTALHALPMYLGLDLRGGVHFLLQVDMTGALTKKLDSDAADA
FT                   RSLLRDKNIRDGGVSRVDQSVVVNFSDAQTAEDARKVLASSITELQWATQPGGGGTQVV
FT                   GTFTPAVQKAVEDAALKQNLTTLHNRVNELGVSEPILQQQGNDRIVVELPGVQDTAKAK
FT                   DIIGRTATLEARLADPINTHPNPNDPVPPGEELFTQGNQVPVLLKKDVIFTGDRIIDAS
FT                   AGFDEHQRPSVNIRLDSAGGRAVRTVSRDNIGKPMAMVLFEKGKGEVLTVATIQSELGD
FT                   RFQITGQPTPQAAADLALLLRAGSLAAPMDIIEERTIGPSLGADNIKMGVHSVIWGFCA
FT                   IAVFMIAYYMLFGVISVIGLSVNLLLLVAVLSLMQATLTLPGIAAIALALGMAIDSNVL
FT                   INERVREELRAGQPPQLAIQAGYAHAWATILDSNVTTLIAGLALLAFGSGPVRAFAIVH
FT                   CLGILTSMFSAVFFSRGIVNLWYGSRKKLKSLAIGQVWRPEGAAAAASFAAADESTDTA
FT                   RAAKLAAPAKGNAPRAGKPQLRNRAQPGVSPKKPGSTQ"
FT   CDS_pept        complement(613438..613761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="BMULJ_00573"
FT                   /product="preprotein translocase YajC subunit"
FT                   /note="COG1862: Preprotein translocase subunit YajC,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03210"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00573"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42537"
FT                   /db_xref="GOA:A0A0H3KC33"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC33"
FT                   /protein_id="BAG42537.1"
FT                   /translation="MPFISNAFAQGAGGAESSLMSFLPLILMFAVLYFIMIRPQMKRQK
FT                   EHRNMLAAMAKGDEVVTSGGLVGKVTKVSEGYIGVEIAEGTEITVQKAAVTTILPKGTI
FT                   KSL"
FT   CDS_pept        complement(613991..615190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="BMULJ_00574"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="COG0343: Queuine/archaeosine
FT                   tRNA-ribosyltransferase, Ralstonia solanacearum"
FT                   /note="KEGG, K00773"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00574"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42538"
FT                   /db_xref="GOA:A0A0H3KGY5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGY5"
FT                   /protein_id="BAG42538.1"
FT                   /translation="MTEGSSHDTRAHAPEAAPARPANGLEFELLTTDGHARRGRVKLNH
FT                   GVVETPIFMPVGTYGTVKAIQPRELHEIKAQIILGNTFHLWLRPGLDTIDAHGGLHGFM
FT                   GWNKPILTDSGGFQVFSLGDLRKITEDGVTFASPINGDKLFLSPEVSMQIQKVLNSDIV
FT                   MQFDECTPYATNGVPTTHKEAADSMRMSLRWAKRSLDEFNRLGNPNALFGIVQGGMFED
FT                   LRDESLAGLSELGFHGLAIGGLSVGEPKEDMMRVLRHVGPKLPAHKPHYLMGVGTPEDL
FT                   VEGVANGVDMFDCVMPTRNARNGWLFTRFGDVKIRNATHKNSLKPLDPSCTCYTCSNFS
FT                   RGYLHHLHRVGEILGAQLNTIHNLHYYLQLMSEIRDAIESHTFDAFRQRFAEDRARGVD
FT                   "
FT   CDS_pept        complement(615371..616438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="BMULJ_00575"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="COG0809: S-adenosylmethionine:tRNA-
FT                   ribosyltransferase-isomerase (queuine synthetase),
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K07568"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00575"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42539"
FT                   /db_xref="GOA:A0A0H3KCC2"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCC2"
FT                   /protein_id="BAG42539.1"
FT                   /translation="MFTLSDFDFNLPPELIAQTALPDRTASRLLEVDATAEPARFVDRR
FT                   FAELPACIARGDLLVFNDTKVLKARFFGQKASGGRIEVLIERVTGSHTALAQIRASKSP
FT                   GAGTTLRLADAFDVTVGERVEPFFTLHFPQPCLELIEQYGRLPLPPYIEHDPDATDETR
FT                   YQTVYASNPGAVAAPTAGLHFDEPLLAKLDAMGIERATLTLHVGAGTFQPVRVENIAEH
FT                   KMHSEWYELPQSLVDKIAATRARGGKVIAVGTTSMRALEAAARDAEAAGRPLAATQAET
FT                   DIFITPGYRFRVVDRLVTNFHLPKSTLMMLVSAFAGIETIRAAYRHAIEQRYRFFSYGD
FT                   AMLLTRRDTPEATHA"
FT   CDS_pept        616606..618981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="BMULJ_00576"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="COG1200: RecG-like helicase, Ralstonia solanacearum"
FT                   /note="KEGG, K03655"
FT                   /note="RecG protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00576"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42540"
FT                   /db_xref="GOA:A0A0H3KKS6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKS6"
FT                   /protein_id="BAG42540.1"
FT                   /translation="MPVSPRRSAAAADSDDPFDTEFAASPPTRATDRDAAPPAGRAAQR
FT                   RAPKRGADGRLAQPAAAAQAESADDDAHAGPHADAPADGDGAPAAKRGKKAAAAKSSKP
FT                   ALKTADKLAKLGLTRSIDLVLHLPMRYEDETTLTPIRDLLPGGIAQTEGVVIDNEVAYR
FT                   PRRQLVVKIRDDDGEQLVLRFLNFYGSQVKQMAVGQRLRVRGDVRGGFFGMEMVHPAVR
FT                   VVEADAPLPQVLTPVYPSTAGVSQAYLRKAIENALERTPLPELLPPEIERDYLKPLGVP
FT                   TLADAVRILHHPGVDSDEAALMDGSHPAWTRIKFEELLAQQLSLKRAHEERRTRAAPAM
FT                   PRRTARDTDALTTRLYAALPFRLTGAQARVVDEIAHDLTLPHPMQRLLQGDVGSGKTVV
FT                   AALAAAQAIDAGYQAALMAPTEILAEQHARKLRGWLEPLGVSVAWLAGSLKAKDKRAAI
FT                   EAAALGTAELVIGTHAIIQDTVEFARLGLVIVDEQHRFGVEQRLALRAKAANAADGAQG
FT                   FQPHQLMMSATPIPRTLAMTYYADLDVSTIDELPPGRTPVLTRVVGDARRDEVIARVRE
FT                   AALTGRQVYWVCPLIEESETLQLQTAVETYETLAAALPELKVGLVHGRLSPADKAAVMD
FT                   AFTRNEVQLLVATTVIEVGVDVPNASLMVIEHAERFGLAQLHQLRGRVGRGTAASVCVL
FT                   LYSGPLSIAGRERLKTMRETTDGFEIARRDLEIRGPGEFLGARQSGAAMLRFANLETDG
FT                   WLIDPARDAAARLIAAYPDVVTQHLARWLGAREQYLKA"
FT   CDS_pept        619107..620066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="BMULJ_00577"
FT                   /product="LysR family hydrogen peroxide-inducible genes
FT                   activator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K04761"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00577"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42541"
FT                   /db_xref="GOA:A0A0H3KCD8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCD8"
FT                   /protein_id="BAG42541.1"
FT                   /translation="MTLTELKYIVAVARERHFGRAAEACFVSQPTLSVAIKKLEDELNV
FT                   QIFERGASEVSVTPIGDQIVTQAQRVLEQTFAIKEIAKQGKDPLVGPFRLGVIYTIGPY
FT                   LLPTLVKQMIQRVPQMPLMLQENYTLKLLELLKQGEIDAAIMALPFPETGLMVRPLYDE
FT                   PFVVALPAGHPWEKRREIDAEDLKQETMLLLGNGHCFRDHVLGVCPELMRFSQTADGIQ
FT                   KTFEGSSLETIRHMVASGVGITVLPRMSVPEIGPRANGPDAELLSYVPFNEPVPDRRVV
FT                   LVWRKSFTRMPAIDAISEAIAACELPGVAKLDMPATLN"
FT   CDS_pept        620671..622857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="BMULJ_00578"
FT                   /product="catalase/peroxidase"
FT                   /note="COG0376: Catalase (peroxidase I), Methanosarcina
FT                   acetivorans str.C2A"
FT                   /note="KEGG, K03782"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00578"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42542"
FT                   /db_xref="GOA:A9AGE5"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AGE5"
FT                   /protein_id="BAG42542.1"
FT                   /translation="MSTEPKCPFHHTAGSGTSNKDWWPNQINLNILHRHSSLSDPMDKD
FT                   FNYAEAFKQLDLAAVKRDLHALMTTSQDWWPADFGHYGGLFIRMAWHSAGTYRIADGRG
FT                   GAGGGQQRFAPLNSWPDNANLDKARRLLWPIKQKYGRNISWADLLILTGNVALESMGFK
FT                   TFGYAGGRPDTWEPDDVYWGSEKIWLELSGGPNSRYSGNRELENPLAAVQMGLIYVNPE
FT                   GPDGNPDPVAAARDIRETFARMAMNDEETVALIAGGHTFGKTHGAGPASSVGPEPEAAA
FT                   LEQQGLGWQSTFGTGKGKDAITSGLEVTWTSTPTKWSNDFFKHLFSYEWELTKSPAGAH
FT                   QWVAKDAEAVIPDAFDPSKKHRPTMLTTDLALRFDPEYEKISRRFYEHPDQFADAFARA
FT                   WFKLTHRDMGPRSRYLGPDVPAEELLWQDPVPAVDHPLIDEADIAALKAKVLASGLSVS
FT                   QLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNRPAELAAVLETLEGVRKAFND
FT                   AQTGGKRVSLADLIVLAGAAGVEQAAKNAGVAVTVPFAPGRTDASQEQTDVHAMAVLEP
FT                   VADGFRNYLKRKFKTPAEALLVDKAQLLTLTAPEMTVLVGGMRVLGTNVGDPKHGVFTE
FT                   RPGTLTNDFFVNLLDMRTEWKPASADNDVFEGRDRATGELKWTGTRVDLVFGSHSQLRA
FT                   LAEVYGSADAQQKFVHDFVAAWNKVMNLDRFDLV"
FT   CDS_pept        622974..623135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00579"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42543"
FT                   /db_xref="GOA:A0A0H3KC38"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC38"
FT                   /protein_id="BAG42543.1"
FT                   /translation="MTQRTLDLHAAFGAPALRAPAAARRLVGAAIAGSGAAVLIAHALG
FT                   AIAHMAGA"
FT   CDS_pept        623257..623751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="BMULJ_00580"
FT                   /product="starvation-inducible DNA-binding protein"
FT                   /note="COG0783: DNA-binding ferritin-like protein
FT                   (oxidative damage protectant), Ralstonia solanacearum"
FT                   /note="KEGG, K04047"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42544"
FT                   /db_xref="GOA:A0A0H3KGY8"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGY8"
FT                   /protein_id="BAG42544.1"
FT                   /translation="MAKKGNANATQINIGISDKDRRKIAEGLSRLLADTFSLYLKTHNF
FT                   HWNVTGPMFNTLHLMFEEQYNELWLAVDSIAERIRTLGVVAPGTFGDFARLSSVPEAEG
FT                   VPAAEDMIRQLVEGHEAVVRTAREIFPAADAASDEPTADLLTQRLQTHEKTAWMLRSLL
FT                   A"
FT   CDS_pept        624022..624885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="BMULJ_00581"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /note="COG0382: 4-hydroxybenzoate polyprenyltransferase and
FT                   related prenyltransferases, Ralstonia solanacearum"
FT                   /note="KEGG, K03179"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00581"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42545"
FT                   /db_xref="GOA:A9AGE2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AGE2"
FT                   /protein_id="BAG42545.1"
FT                   /translation="MLARFPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGHPRWPLIV
FT                   IFALGTLLMRSAGCAMNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAVGLSFVAFL
FT                   LILPLNTLTKELSVVALFVAGTYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQNTVPPL
FT                   AWVMLIANVFWSIAYDTEYAMVDRDDDIKIGIRTSALTFGRFDVAAVMACYAVTLGIYV
FT                   WIGIALGFGAAYWVGWAAAAGCAVYHYTLIKGRERMPCFAAFRHNNWLGGVLFAGIAAH
FT                   YLMAGS"
FT   CDS_pept        complement(625039..625851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="BMULJ_00582"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="COG0345: Pyrroline-5-carboxylate reductase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00286"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00582"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42546"
FT                   /db_xref="GOA:A0A0H3KCC7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCC7"
FT                   /protein_id="BAG42546.1"
FT                   /translation="MKIAFIGGGNMAAALIGGLVKRGVAADGLYAIDVNEDVRARAAQQ
FT                   FGIRTGAAIDAALGDYDAIVLAVKPQVLKDVAQALAPHLRAQLVISIAAGIRGADLSRW
FT                   LGGYARVVRTMPNTPALVGMGVTGLAALPGVDAAGRELASNVLGAVGEIVWFDDESRLD
FT                   TVTAISGSGPAYVFYFIEALQEAARRLGMNDEQGRALAVATFTGAAQLAAQSGEPAGVL
FT                   RERVTSKGGTTAAALASFDAQGVKEAIVRGVLAADARAKEMGDELGRA"
FT   CDS_pept        complement(625895..626593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00583"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0325: Predicted enzyme with a TIM-barrel fold,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K06997"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00583"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42547"
FT                   /db_xref="GOA:A0A0H3KKT1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKT1"
FT                   /protein_id="BAG42547.1"
FT                   /translation="MSDLAVRLESVHRRIADAARAAGRDPASVSLLAVSKTFPADAVRA
FT                   AHAAGQRAFGENYVQESIDKIDALADLRASLEWHFIGPLQSNKTRAVAERYDWVHSVDR
FT                   LKIAQRLAEQRPAHLPPLNVCVQVNISGEASKSGVAPAEVAEVARAVAALPSLRLRGLM
FT                   AIPEPAADLDAQRVPHRALRTLFDALRADGLALDTLSMGMSADLEAAVLEGATIVRVGT
FT                   AIFGARDYSR"
FT   CDS_pept        complement(626795..628021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="BMULJ_00584"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.3.15"
FT                   /note="COG0247: Fe-S oxidoreductase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00104"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00584"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42548"
FT                   /db_xref="GOA:A0A0H3KCE3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCE3"
FT                   /protein_id="BAG42548.1"
FT                   /translation="MQTNLADFIRDTPDGNEADAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQMVEGAKVTRSTQQHLDRCLTCRSCETTCPSGVQYGRLVEIGRKHVEA
FT                   QVQRPLSQRLVRRLLASLVPNATLFSPVMRLGQHVRPLLPKRLRDKVPPRTRLLEWPQR
FT                   THPRKMLMLGGCVQPSMLPNINIATARVLDALGVETIVAPDAGCCGAIRLHLNYHDEAL
FT                   DDARRNIDAWWPYVEQGVEAIVMNASGCGATVLEYAHLLRDDPAYAEKARRIVALTRDI
FT                   SDVLLAFEAELATLGRRRAIHTVAYHPPCTLQHGQQSRGKVERLLETLGIDVRLPADSH
FT                   LCCGSAGTYSLTQPSLSYRLRKQKLLKLQALEPQMIVSGNVGCIAHLQSGTQIPVAHWI
FT                   QLVEHLIYG"
FT   CDS_pept        complement(628029..629117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="BMULJ_00585"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.3.15"
FT                   /note="COG0277: FAD/FMN-containing dehydrogenases,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00104"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00585"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42549"
FT                   /db_xref="GOA:A0A0H3KC56"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC56"
FT                   /protein_id="BAG42549.1"
FT                   /translation="MEEDDIVAEWAERVRSASADGRPLRIRGGGTKDWYGQTLEGEILD
FT                   TRALHGVVSYDPAELVVTVRAGTPLAQLESVVAERGQMLPFEPPHFGRAATVGGCIAAG
FT                   LAGPRRATSGAPRDFVLGVTLMNGRGETLRFGGQVVKNVAGYDVSRLMAGSLGTLGLML
FT                   ELSIKVLPVPVAEVTLKFEMTATDAVRKLNEWGGHPLPVSGSAWRNGTLVLRLSGAEAA
FT                   VKSAKTQLGGEVVDAVEAERFWAGLREHTDPFFNGIPPDYALWRLSLPSITEPMHLPGT
FT                   QLMEWGGAQRWWITDADAQTVRMSAKQAGGHATLFRAGDAYDRSAGVFTPLAAPLLKIH
FT                   RGLKAAFDPARIFNRGRLYPDL"
FT   CDS_pept        complement(629380..630873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="BMULJ_00586"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.3.15"
FT                   /note="COG0277: FAD/FMN-containing dehydrogenases,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00104"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00586"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42550"
FT                   /db_xref="GOA:A0A0H3KGZ2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGZ2"
FT                   /protein_id="BAG42550.1"
FT                   /translation="MNAPVELSAQMRAQRQREVVQALMAVLPTHCLLYRDEDTAPYECD
FT                   GLSAYRRLPLAVALPETESQVQRIVQICRRMDVPIVPRGAGTSLSGGALPISLGVVLSL
FT                   ARFTRIVEVDPYARTATVQPGVRNLAISEAAAPYGLYYAPDPSSQIACTIGGNVAENSG
FT                   GVHCLKYGLTVHNVMRVRAVTIDGEIVEFGSLALDMPGLDLLAVMIGSEGMFAIVTEVT
FT                   VKLIPKPQAAQLVMASFDDVVKGGEAVAAIIASGIIPAGLEMMDKPATQAVEAFTHAGY
FT                   DLDAKAILLCESDGTPEEVAEEIVRMTAVLREHGATRIQVSRNESERLRFWSGRKNAFP
FT                   AAGRISPDYYCMDGTVPRRAIGPLLARIEQLETRYGLRCINVFHAGDGNMHPLILYNAN
FT                   NPDELHRAEQFGAEILECCVEFGGSVTGEHGVGIEKLNSMCVQFSPQERDAFFAVKRAF
FT                   DPPELLNPDKGIPTRARCAEYGRQHVRGGLLPHPDLPRF"
FT   CDS_pept        complement(630969..632378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dld"
FT                   /locus_tag="BMULJ_00587"
FT                   /product="cytochrome D-lactate dehydrogenase"
FT                   /EC_number="1.1.2.4"
FT                   /note="COG0277: FAD/FMN-containing dehydrogenases,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00102"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00587"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42551"
FT                   /db_xref="GOA:A0A0H3KCD2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCD2"
FT                   /protein_id="BAG42551.1"
FT                   /translation="MNHPAPPAATRRPLPPAMLDALRARFGERVSVADAVRAHHGRDES
FT                   PFDPQLPDAVVFAHSVDDVREVVSLCALYGVPLIPYGAGSSLEGHLLAVRGGVSLDLSE
FT                   MNRVLSINAEDLTVTVEPGITRKALNEALRDTGLFFPIDPGADASIGGMTATRASGTNA
FT                   VRYGTMRENVLGLTAVLADGRVVKTGSRARKSSAGYDLTRLFVGSEGTLGVITEITLRL
FT                   HPLPEAVSAAICTFPTMGDAVRTVIETIQIGVPIARVEFVDALAVRSINRHSNLTLAEA
FT                   PTLFFEFHGTEAGVKEQAELVQALAGQNNGQGFEWATRPEDRSRLWSARHNAYFAMLQL
FT                   KPGCRAVTTDVCVPISQLAACVEETEADLRASSLPCPIVGHVGDGNFHVAILIDPDKPE
FT                   EIDEAERINDRIVERALRLGGTCTGEHGVGLHKMRFLPKEHGDNAIDTMRAIKLALDPR
FT                   NLMNPGKIFAC"
FT   CDS_pept        632633..633184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="BMULJ_00588"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="COG2096: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00798"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00588"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42552"
FT                   /db_xref="GOA:A0A0H3KKT6"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKT6"
FT                   /protein_id="BAG42552.1"
FT                   /translation="MGNRLSKIATRTGDDGTTGLGDGRRVGKDDARIAAIGDVDELNSN
FT                   LGVLLAETLPDDVRTALVTIQHDLFDLGGELCIPGHTVIDDTHLARLDRWLADYNATLP
FT                   PLKEFILPAGSRAASLTHVCRTVCRRAERSIVALGRHEALNDAPRRYVNRLSDLLFVLA
FT                   RVLNRAAGGADVLWERGRVR"
FT   CDS_pept        633280..634488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmpA"
FT                   /locus_tag="BMULJ_00589"
FT                   /product="nitric oxide dioxygenase"
FT                   /EC_number="1.14.12.17"
FT                   /note="COG1018: Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1, Sinorhizobium meliloti"
FT                   /note="KEGG, K05916"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00589"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42553"
FT                   /db_xref="GOA:A0A0H3KCF0"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCF0"
FT                   /protein_id="BAG42553.1"
FT                   /translation="MTQITADQMARVKATAPVLAEHGATITKHFYQRMFARHPELKNLF
FT                   NQTHQKTGAQPETLAKAVYAYAANIDNLGALGGAVSRISHKHASLNIRPEHYPIVGENL
FT                   LASIVEVLGDAVDADTLEAWRVAYGQLAQILIGAEADLYAGAAWSGFRPFKVARKVRES
FT                   DEITSFYLVPADGGAAPSFEPGQYVTVKRFVGDLGVDQPRQYSLSDAPNGKWLRISVKR
FT                   ESGDAEAIPAGKVSTLMHDGVEAGSIVEVTAPMGDFSLRRDADTPVVLISGGVGITPMM
FT                   SMLSTLVAEGSRRDVRFVHACRSGAVHAFRDWLNDTVREHANVKRTVLYERVGPNDRVG
FT                   IDHDLEGRLTPERLKQYALEPDADYYICGPIAFMKAQRDALLALGVAPERVNTEIFGSG
FT                   ALE"
FT   CDS_pept        complement(634567..634956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00590"
FT                   /product="PilT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42554"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC65"
FT                   /protein_id="BAG42554.1"
FT                   /translation="MKLLLDTPIALWAAEGAPQLSTTAAALIGHPENTLYVSAASIWEI
FT                   AIKYRKGNLPVHPRDARSAFRLAGFAELPISSDHVEGVAALPDFPDHADPFDRVMVAQA
FT                   LHEGMPLVSADPKLWRYHATLVLRA"
FT   CDS_pept        complement(634953..635222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00591"
FT                   /product="antitoxin of toxin-antitoxin stability system"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00591"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42555"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KGZ6"
FT                   /protein_id="BAG42555.1"
FT                   /translation="MSTVNMHDAKSRLSSLVEALESGREIEVVIARNGHPVARIVPYAA
FT                   PKRIGAARQLLAGLNIPTTVEAFNAADESIAADCEASSEQRLAP"
FT   CDS_pept        complement(635338..636411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="BMULJ_00592"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="COG0722: 3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase, Ralstonia solanacearum"
FT                   /note="KEGG, K01626"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00592"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42556"
FT                   /db_xref="GOA:A0A0H3KCD7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCD7"
FT                   /protein_id="BAG42556.1"
FT                   /translation="MPPHNTDDVRIRELKELTPPAHLIREFACSEAASELIYNARQAMH
FT                   RILHGMDDRLIVVIGPCSIHDTKAALEYAGRLVKERERFKGELEIVMRVYFEKPRTTVG
FT                   WKGLINDPHLDNSFKINEGLRTARELLLQINEMGLPAGTEYLDMISPQYIADLISWGAI
FT                   GARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAIKAASQPHHFLSVTKGGHSAIV
FT                   STAGNEDCHVILRGGKAPNYDADSVNAACADIGKAGLAARLMIDASHANSSKKHENQIP
FT                   VCADIGRQVAAGDSRIVGVMIESHLVEGRQDLKEGCELTYGQSITDACINWEDSVKVLE
FT                   GLAESVKARRVASGSGN"
FT   CDS_pept        complement(636807..638273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="BMULJ_00593"
FT                   /product="TldD protein"
FT                   /note="COG0312: Predicted Zn-dependent proteases and their
FT                   inactivated homologs, Ralstonia solanacearum"
FT                   /note="KEGG, K03568"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00593"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42557"
FT                   /db_xref="GOA:A0A0H3KKU2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKU2"
FT                   /protein_id="BAG42557.1"
FT                   /translation="MNIIEPGIRNLALAKDILLTPYGLDESLLTRTIADIFTHRVDYAD
FT                   LYFQATRSEAWSLEEGIVKSGSFSIDQGVGVRAVAGDRTAFAYSDDLSPEAIAQAAAAT
FT                   KAIAAAGGGRQKVKAATSLKGISGRDLYLPSDPLASLDATAKVKLLERVEQMARSRDPR
FT                   ITQVMAGLAGEYDVVLVARSDGALAADIRPLVRVSVTVIAEQNGRREIGTGGGGGRFDY
FT                   GYFTDDVLSRYVDDAVHAALVNLDARPAPAGAMTVVLGPGWPGVLLHEAIGHGLEGDFN
FT                   RKGSSAFAGRIGEQVAAKGVTVVDDGTLPNRRGSLNIDDEGNPTQCTTLIEDGILKGYI
FT                   QDTLNARLMKMPVTGNARRESYAALPMPRMTNTYMLNGDKDPQEIIASVKNGLYAVNFG
FT                   GGQVDITNGKFVFSASEAYMIENGKITYPVKGATLIGSGPESLKYVSMIGNDMSLDTGV
FT                   GVCGKEGQSVPVGVGQPTLRIDKMTVGGTA"
FT   CDS_pept        complement(638359..639186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00594"
FT                   /product="nitrilase"
FT                   /EC_number="3.5.5.1"
FT                   /note="COG0388: Predicted amidohydrolase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01501"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00594"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42558"
FT                   /db_xref="GOA:A0A0H3KCF5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCF5"
FT                   /protein_id="BAG42558.1"
FT                   /translation="MTDSASSATPFRVAALQMVSTPDVGRNLAEARRLIAEAADEGAQL
FT                   VLLPEYFCFMGQRDTDKLALAEPYGDGPIQQFLADAARRHALWVIGGTLPLKAPEPQRV
FT                   LNTTLVFDPSGNEAARYDKIHLFNFEKGDESFDEARTIRPGETVVTFDAPFGRVGLSVC
FT                   YDLRFPELYRRMGDCALIVVPSAFTYTTGRAHWETLLRARAVENQCYVLAAAQGGKHEN
FT                   GRRTWGHSMLIDPWGEIVAVRDEGASVVSGTLDAQRIADVRQSLPAWRHRVLT"
FT   CDS_pept        complement(639238..643437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00595"
FT                   /product="putative membrane protein"
FT                   /note="COG3164: Predicted membrane protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00595"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42559"
FT                   /db_xref="GOA:A0A0H3KC70"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC70"
FT                   /protein_id="BAG42559.1"
FT                   /translation="MSDRQESAAAAPEAATPKHDHPVLRRVFKVTLAVAIGTYFVACGT
FT                   FLGLRYVLLPRIDEFRPRIERAVSDKLHAQLSIGKLSPHWSGMQPGVEVTHLTIRGRDG
FT                   QVALSVPHATAALSWVSLLRLSPALSSLIVDEPDLVVARAADGSLSIAGVGVASAHGGN
FT                   DTFGTWLLKQEAIVLRGGTLRWRDAQHDAPELALSGIRLAVLNDGRRHKAALQAPANGT
FT                   LLLGPLDFRARFTHKALAPIGKPSNWTGNAYLSTGPVDLQTLARYVDMPLTIHAGRIDN
FT                   AIWATFSNGRLRSAGGDLQGADVALRVRPTQPRLDVPTVGFRWDLALDPGRDYTLHLTH
FT                   FNAELGQPPLPDGTPLARSLALSTLKARYRVPTADQGQLLSVVGDRVDLGILSEFIRGL
FT                   PLPARLRNELVKIDPRGMMSNYHIEVERAKPARPDLADEERRMGAAPIVRYRFVGDLQG
FT                   ISFAAQEPPPGLSARGHPRAGLPGVENLWGRVDASETGGTAEFDTVDAAVTVPGEFDEP
FT                   RLTFDKLRGRANWTITPAPGEKHARVDVKVPDLFVANPDAEVAVSGTYTNPGHGRGSLD
FT                   LRADFARASVARIPRYLPTGMSDHLRAYLGHALQDGRVAKGASIVARGPLDKFPFQHEP
FT                   TAGVFHIVAPFTGGRFEPTPYPPRTLANGTPSVWPALDGIDGVFELAQNKLRFDIDRAH
FT                   YKRVAVTKVAGRIDDLGHPSDSPLVIEGHAQGPLADLIDYADNSSLGAMSDHVGARIDA
FT                   QGPASLGLKLTIPQHVAHPHTRIEGALAFGGNTLSADGVPPLSALRGQVRFTETGASLH
FT                   ALSGRFLGGPVRANGRFQSHGPYAVDVDGKLALDAARGLNLRGAAAALLEHVSGDAPYR
FT                   IAVRGAPGRLPDIAAQSDLTGVALNFPAPFAKPAGTTMPFRFTLQPAPQTDGTRLEHAD
FT                   LTLGPVSATYLLDATRGAPLRAVRGAMGIHRMPDMPQEGVSAAVDVDAFDADAWIALAR
FT                   TLRAETPRAAQPPAASRVDVASFAPKRFALHFGTLTLLKRNWENVIVGASHVDDLWQAN
FT                   IASNQVSGYLSWAPGGGHNGAGVLNARLAKLVIPDSAQHDLVGRAMNLPTPTDRPMPSV
FT                   DVIVDQVVARNHDIGRLVVNARNVDENGTPVWQLDRLTLTNPDAKLSATGNWRTSRHAL
FT                   ARGVDESEAPRRSVFDFRLDVDDAGALLDRVGLPRTLAKGQGSVTGKVGWRGGPTAVDL
FT                   PSLNGQIALDLEHGQILKVDPGAAKLLGVLSLQSLARFLTLNFRDVIGKGLPFDKITGT
FT                   ARVSNGIARTDDFAMTTAPANVTVRGAVDLGTETQDLHAHVAPKVGAGAAAIAAAVINP
FT                   LLGVGVLAADFALSQTLQHAFALDYAITGSWAHPHIERVRGDQGKMNRDAAEAAGH"
FT   CDS_pept        643663..646467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="BMULJ_00596"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="COG1391: Glutamine synthetase adenylyltransferase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00982"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00596"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42560"
FT                   /db_xref="GOA:A0A0H3KH00"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH00"
FT                   /protein_id="BAG42560.1"
FT                   /translation="MTDASALISTSYSRYLARAAAARPALVEQIARWADAPLTRAQQDE
FT                   RLTELLGVPPAGAAVPTDEQLKRALRQLRTEVFGAVAERDLRGLASVAEVTGAMTDLAE
FT                   LAVQRSLALLSAEFEALYGEPRGADGQRVVLGVVGMGKLGGRELNVSSDIDLIFVYEDD
FT                   GETAGGTRAPLSTQEYFTRLGRRLIGVLSEVTADGYVFRVDMRLRPNGDSGPLVCSLGM
FT                   LEEYFYVQGREWERYAWIKGRLVSEGDSDAARRLASQLESIVKPFVYRRYLDFGVIGAI
FT                   RSLHQQIRHEAARRASMRPDKADDIKLGRGGIREIEFSAQVFQLIRGGQDAGFRVRPTL
FT                   AVLAHAQARGLIADDVRARLTDAYNFLRTLEHRLQYRNDAQTHAMPVEPDERAALAASL
FT                   GFADYAALMTVLDAHRTFVEAQFDQIFADKVGGGACSAGDDTAATWIWSGALADDGEDD
FT                   ALTARLEGLGFADPAAMLARLRAVWQSSRYTGLPEKSRQRFDSVAQRALEAAPNIDAAR
FT                   RDDTIVRLFDLLETVSRRGVYLALLTEYPAALDRVLSVLGATRWGGGYLIRHPQLLDEL
FT                   LDDEAIASPFDWPAFKDALRARLAAADGPEQQMDLLRHAQHAEVFRILLIDLAGQLSVE
FT                   HVSDRLSELADAVLDVTIEVVWSQLAKRHRDVPKFAVIAYGKLGGKELGYASDLDLIFL
FT                   YDDPDDRSADVYTTFTRRLITWLTTATGAGALFDIDLRLRPNGEAGLLVTDLDAFRRYQ
FT                   LREGDAANTAWVWEHQALTRARYSAGDAEIGAAFEAIRRQVLTTPRDADVLAKEIVDMR
FT                   AKVLAGHPNQTELFDLKHDRGGMVDIEFIVQYWVLLHASSDPELIRNTGNIALLREVAR
FT                   FGLMGEDEAERVGAAYRTYRKLQHKLRLDGMEKARVEPALVADERAAVIALWTRVFGAL
FT                   ETGV"
FT   CDS_pept        complement(646606..648255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="BMULJ_00597"
FT                   /product="DNA repair protein"
FT                   /note="COG0497: ATPase involved in DNA repair, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03631"
FT                   /note="RecN protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00597"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42561"
FT                   /db_xref="GOA:A0A0H3KCE4"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCE4"
FT                   /protein_id="BAG42561.1"
FT                   /translation="MLRHLSIRDFVIVAALDLEFDAGFTVFSGETGAGKSILIDALALA
FT                   LGERADASVVRTGCSRADITAEFTPHDRVARWLDEHAFDAEDTVMLRRVIDANGRSRAF
FT                   INGTSATLAQLRELGEMLVDIHGQHAHQLLMRPDAQRELFDTHAGLVAEAANVARAWRV
FT                   WRDATQAIDAAKAHERELQLEREKLAWQLAELDKLAPQPGEWEEVSAEHKRLSHSANLI
FT                   EGVRGALDALSESDDAMLTQLGAIVSKLRSLADYDAALGDALASLEPAEIQLQEAVYSL
FT                   SHYAQRLDLDPDRLAQVEMRLDALHSTARKFRLPPDTLHEEHAARRAQLAALDAAADLG
FT                   ALEAAQAKAWDAYLADAKRLSKARAQAAKALGTAVTAGMQELSMAGGSFEVALVPLADG
FT                   GPHGLEQIEFRVAGHAGVPLRPLAKVASGGELARISLALAVIASAASPTPTLIFDEVDT
FT                   GIGGGVAEVVGRLLHQLGRDRQVLCVTHLPQVAARGDHHFQVAKGSDEHGGTVSTVVAL
FT                   DKASRIEEVARMLGGLEITATTRKHAKEMLAA"
FT   CDS_pept        complement(648275..649177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00598"
FT                   /product="NAD+ kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="COG0061: Predicted sugar kinase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00858"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00598"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42562"
FT                   /db_xref="GOA:A9AGC5"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AGC5"
FT                   /protein_id="BAG42562.1"
FT                   /translation="MKTGNLFNTVALVGRSNTPGIAEPLATLAACIAKRGFEVVFEGDT
FT                   AREIGISGYPALTPAEIGARADVAVVLGGDGTMLGIGRQLAPYRTPLIGINHGRLGFIT
FT                   DIAAADMQALVPVMLSGKFEREERSLLEARIVRDGEPIYHALAFNDVVVNRSGFSGMVE
FT                   LRASVDGRYMYNQRSDGLIVATPTGSTAYALSSAGPILHPQLQGIVLVPIAPHALSNRP
FT                   IVLPDDSKIAIQIVGGRDVNVNFDMQSFTALELNDTIEVRRSKHTVPFLHPIGYSYYAT
FT                   LRKKLHWNEHASNEDDKAS"
FT   CDS_pept        649309..650331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="BMULJ_00599"
FT                   /product="heat-inducible transcriptional repressor"
FT                   /note="COG1420: Transcriptional regulator of heat shock
FT                   gene, Ralstonia solanacearum"
FT                   /note="KEGG, K03705"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00599"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42563"
FT                   /db_xref="GOA:A9AGC4"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AGC4"
FT                   /protein_id="BAG42563.1"
FT                   /translation="MLDPRARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNV
FT                   MSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVETPIDAAAVARQVQSTLQAGEPQ
FT                   QKVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSEKRILLIIVTPEGDVQNRML
FT                   ATPRDYSPSQLTEASNYINAHFAGLSFDEVRRRLRDEIDQLRGDMTALMHAAVTASTEV
FT                   PDTEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTGLLQLLDVSSHAQGVQIFIG
FT                   GESTLVPIEEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRVIPIVDITARLLSLTLSQQ
FT                   "
FT   CDS_pept        650564..651673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="BMULJ_00600"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="COG0276: Protoheme ferro-lyase (ferrochelatase),
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01772"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42564"
FT                   /db_xref="GOA:A0A0H3KKU9"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKU9"
FT                   /protein_id="BAG42564.1"
FT                   /translation="MKAIRFRASSTLLPMRFDLEPPSSVAAAHRVGVLLINLGTPDAPT
FT                   PRAVRRYLAEFLSDPRVVEIPQPVWQVLLRTLILPLRGRASAKKYAAVWMPEGSPLRVY
FT                   TERQTEGVRHLLASNDYHVLVDYAMRYGSPGIAQALAQFKRAGVERVLLMPMYPQYSAS
FT                   TTATAFDAAFAALARMRNQPEVRTVRHYADHPAYIHALAEQVRHYWAQHGRPDFAAGDK
FT                   LVLSFHGVPKRTLDLGDPYHDQCQQTGALLMAALGLSTIECRVTFQSRFGKAEWLQPYT
FT                   APTLRELGEAGVRRADVFCPGFTADCLETIEEIGMEVRDEFIAGGGQSFHRIPCLNGAP
FT                   AWIGALGEIVAENLQGWPVRTAQPETVNG"
FT   CDS_pept        651670..652077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="BMULJ_00601"
FT                   /product="ribosome-associated heat shock protein Hsp15"
FT                   /note="COG1188: Ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog), Ralstonia solanacearum"
FT                   /note="KEGG, K04762"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00601"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42565"
FT                   /db_xref="GOA:A0A0H3KCG0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCG0"
FT                   /protein_id="BAG42565.1"
FT                   /translation="MNYRISTEPGAKLRIDKWLWAARFFKTRSLASDAVDKGRVKIGGA
FT                   AVKPAKEVRVGDEVEIAIDGIVWHIAVLGVCDVRGPASVAQTLYAETEAGRAERLAELE
FT                   RRRTYREPAAALHGRPTKRDRRIIDKLSGGR"
FT   CDS_pept        complement(652049..652210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00602"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42566"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC74"
FT                   /protein_id="BAG42566.1"
FT                   /translation="MKLTFAISVVALVLIAGTTTICLSGAVTDRTTEYGSVRATFDQLF
FT                   SVHRTVCR"
FT   CDS_pept        652562..653107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="BMULJ_00603"
FT                   /product="molecular chaperone"
FT                   /note="COG0576: Molecular chaperone GrpE (heat shock
FT                   protein), Ralstonia solanacearum"
FT                   /note="GrpE protein"
FT                   /note="KEGG, K03687"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00603"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42567"
FT                   /db_xref="GOA:A9AGC0"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AGC0"
FT                   /protein_id="BAG42567.1"
FT                   /translation="MENTQENPASQSAEENGSETQAAQDAAPAAEAADAALAEAQAKVA
FT                   ELQESYLRAKAETENVRRRAQEDVAKAHKFAIESFAEHLLPVLDSLEAAVGDTSGDIAK
FT                   VREGVELTLRQLTSALEKGRVVAINPVGEKFDPHRHQAISMVPADQEPNTVVTVLQKGY
FT                   TIADRVLRPALVTVAQPK"
FT   CDS_pept        653118..653537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00604"
FT                   /product="thiol-disulfide isomerase"
FT                   /note="COG0526: Thiol-disulfide isomerase and thioredoxins,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00604"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42568"
FT                   /db_xref="GOA:A0A0H3KH06"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH06"
FT                   /protein_id="BAG42568.1"
FT                   /translation="MLPAGVDPAAFDAFGMQPLSADSFDGGIAGAGDALAVVFFWGVDC
FT                   FNCEIAKKAMLAQPDAIRALGLKWFHCNVYEHRELGRRFGLHGVPTWFFFHRGKRLGRA
FT                   TGWHGLAQFQAAVAAARAKIAASAPAEDDPASRGD"
FT   CDS_pept        653685..655631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="BMULJ_00605"
FT                   /product="molecular chaperone"
FT                   /note="COG0443: Molecular chaperone, Ralstonia
FT                   solanacearum"
FT                   /note="DnaK protein"
FT                   /note="KEGG, K04043"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00605"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42569"
FT                   /db_xref="GOA:A9AGB8"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AGB8"
FT                   /protein_id="BAG42569.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMEGNQVKVIENSEGARTTPSIIAYMDD
FT                   NEVLVGAPAKRQSVTNPKNTLFAVKRLIGRRFEEKEVQKDIGLMPYSIIKADNGDAWVE
FT                   AHGQKLAPPQVSAEVLRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAFGLDKAEKGDRKIAVYDLGGGTFDVSIIEIADVDGEKQFEVLST
FT                   NGDTFLGGEDFDQRIIDYIIGEFKKEQGVDLSKDVLALQRLKEAAEKAKIELSSSQQTE
FT                   INLPYITADASGPKHLNLKITRAKLEALVEDLVERTIEPCRIAIKDAGVKVSDIDDVIL
FT                   VGGQTRMPKVQEKVKEFFGKEPRRDVNPDEAVAVGAAIQGQVLSGDRKDVLLLDVTPLS
FT                   LGIETLGGVMTKMISKNTTIPTKHSQVYSTADDNQSAVTIKVYQGEREMAAGNKLLGEF
FT                   NLEGIPPAPRGVPQIEVTFDIDANGILHVGAKDKATGKENKITIKANSGLSEAEIDQMI
FT                   KDAEANAAEDHKLRELADSRNQGDALVHSTKKALSEYGDKLDAGEKEKIEAALKSLEDV
FT                   LKDTSADKAAIDAKVEELGKASQKLGEKMYADMQAQAGAAGAAGAAEGAAQGGAQQAAD
FT                   DVVDAEFKEVKKD"
FT   CDS_pept        655896..657026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="BMULJ_00606"
FT                   /product="molecular chaperone"
FT                   /note="COG0484: DnaJ-class molecular chaperone with
FT                   C-terminal Zn finger domain, Ralstonia solanacearum"
FT                   /note="DnaJ protein"
FT                   /note="KEGG, K03686"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00606"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42570"
FT                   /db_xref="GOA:Q5NSW9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5NSW9"
FT                   /protein_id="BAG42570.1"
FT                   /translation="MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPDNKDAEE
FT                   HFKEVKEAYEMLSDSQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFGDIFGDIFGQA
FT                   AGGRGGRGGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKPGTKP
FT                   ETCPTCHGQGTVRMSQGFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKETKTLEVKIP
FT                   AGIDDGMRIRSAGNGEPGINGGPPGDLYVEIHIKPHAVFERDGDDLHCQMPIPFTTAAL
FT                   GGEIEVPTLAGRATFPVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPVKLTE
FT                   HQRDLLKQFEKSLAEGGARHSPQSKSWFDRVKSFFE"
FT   CDS_pept        657030..658892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BMULJ_00607"
FT                   /product="para-aminobenzoate synthetase component I"
FT                   /EC_number="2.6.1.85"
FT                   /note="COG0147: Anthranilate/para-aminobenzoate synthases
FT                   component I, Ralstonia solanacearum"
FT                   /note="KEGG, K01665"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00607"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42571"
FT                   /db_xref="GOA:A0A0H3KCE9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCE9"
FT                   /protein_id="BAG42571.1"
FT                   /translation="MTDGNGSASFALLDDCDSTASARSSRLYSGFVRERVCTDPARLDA
FT                   LDAALAQDLRDGLHAVVVGDYEFGRSLQRAQPGHAPLRFLLYARCERLSRAEVDAWLAA
FT                   QDGTDTPSIAGVAHVRKSVTRDAFGAAIAAVHDALRAGDSYQINYTYRLNFDVFGTPLA
FT                   LYRRLRARQPVRYGALIALPDGAWVVSCSPELFVEKHGELLRARPMKGTAPRSADPQQD
FT                   AASAAFLANDPKNRAENVMIVDLLRNDVSRIARTGTVRVPALFSVEPYASVWQMTSTVE
FT                   AGWHDGTTFADMLRALFPCGSITGAPKHKTMQLIDAIETTPRGLYTGTIGWLDAPREAA
FT                   AACGDFCLSVAIRTLTLDAPPASAPAGDDRRRGTMGVGAGIVLDSVAADEYAECELKAR
FT                   FLTDADPGFQLFETTCATRADGIRHVDRHLARLQRSADAFGFRFDADALRRAIDTRCAA
FT                   LDGDGPYRMKLSLAKDGTLDIVAAALKPLPAGPVRVWLAADHGFAPTRANDALLLHKTT
FT                   RRADYDRAWQAAEALGGFDMLFVNERGELTEGGRSNLFVKLDGQWVTPPLASGVLPGVM
FT                   RAVLLEDPAFGAVERIVMRDDLARAQALLLTNALRGALDAVLMK"
FT   CDS_pept        complement(658997..659812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="BMULJ_00608"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="COG0413: Ketopantoate hydroxymethyltransferase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00606"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00608"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42572"
FT                   /db_xref="GOA:A9AGB5"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AGB5"
FT                   /protein_id="BAG42572.1"
FT                   /translation="MTYLQESSRPAVTVPKLQAMRDAGEKIAMLTCYDASFAALLDRAG
FT                   TDVLLIGDSLGNVLQGHATTLPVSLDDIAYHTACVARAQPRALVVADLPFGTYGTPADA
FT                   FANAVELMRAGAQMVKLEGGEWLAETIRFLVERSVPVCAHLGLTPQSVHAFGGFKVQGK
FT                   TEAGAAQLLRDARAIEAAGAQLVVLEAVPTLVASEVTHMLKIPTIGIGAGADCSGQVLV
FT                   LHDMLGIYPGKRPRFVKDFMQGQPNIEAAVDAYVKAVKDGSFPGPEHSF"
FT   CDS_pept        complement(659859..660545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="BMULJ_00609"
FT                   /product="deoxyguanosine kinase"
FT                   /EC_number="2.7.1.113"
FT                   /note="COG1428: Deoxynucleoside kinases, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00904"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00609"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42573"
FT                   /db_xref="GOA:A0A0H3KKV5"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKV5"
FT                   /protein_id="BAG42573.1"
FT                   /translation="MNPTPLTVTAPDLRAPHRYLVIEGPIGVGKTTLARLLAERWSMQT
FT                   LLERPQDNPFLERFYRDTARYALPTQLSFALQRAQQSAELIGALDTGRPVVADFMPQKN
FT                   DIFARLNLPEDEWQLYRSIAAHLEAPRAPAPDLVVYLQASPEVLFARIQKRGLPMELQI
FT                   SDAYLRALVDAYNEFFYHYDRTPVLTVAAEHLNPLDSPEDFALLVERIETMRGRKEFFV
FT                   KGETTR"
FT   CDS_pept        complement(660542..661081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BMULJ_00610"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="COG0801: 7,8-dihydro-6-hydroxymethylpterin-
FT                   pyrophosphokinase, Ralstonia solanacearum"
FT                   /note="KEGG, K00950"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42574"
FT                   /db_xref="GOA:A0A0H3KCG5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCG5"
FT                   /protein_id="BAG42574.1"
FT                   /translation="MTVAYLGLGANLGDARQTLKDAVVCLAQQRTITILDKSSLYRTAP
FT                   IDAGGDDYYNCVVKVDTTLAARELLALCQKIEHHFGRERPYRNAPRTLDIDILLFGADS
FT                   IDEADLIVPHPRLTERAFALVPLVEIEPLLDIPARGRADAFLAAVAHQRIEKVQTCQCL
FT                   MKALAAGDGADKNRCR"
FT   CDS_pept        complement(661117..662655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="BMULJ_00611"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="COG0617: tRNA nucleotidyltransferase/poly(A)
FT                   polymerase, Ralstonia solanacearum"
FT                   /note="KEGG, K00970"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00611"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42575"
FT                   /db_xref="GOA:A0A0H3KC79"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC79"
FT                   /protein_id="BAG42575.1"
FT                   /translation="MIKKLIRKLLGQDDAVQTSPAASAADTPASAAPRPARSARAAAAK
FT                   KPRSNHEPTIVPASVHGIDPALISKNAVRVTDTLQQAGYRAFIVGGAVRDLLLGIAPKD
FT                   FDVATDATPTEVQRLFRRARLIGRRFQIVHVQFGQELIEVSTFRALVDAPPEAATAEPP
FT                   KRLKRDELDRRTHAVDASGRVLRDNVWGEQHEDAARRDFTINAMYYDPSTQTVLDYHDG
FT                   MADVRARLLRMIGDPATRYREDPVRMLRVVRFAAKLGFEIEPHTREPINALADLINNVP
FT                   AARLFDEMLKLLLSGHALACLQRLRKEGLHHGLLPLLDVVLEQPQGEKFITLALNNTDA
FT                   RVRAGKPVSPGFLFATLLWHDMRQRFEQYTAEGEFPVPALHRAMDDVLDMQTEKLAIHK
FT                   RYSADMREIWGLQLRLEKRSGRSALRLLEHQRFRAGYDFLLLRCESGELDPAVGQWWTD
FT                   FIEGDATAREALLSQGGSKEKSPRKRRRRGGARNRKSGEGAAEQAPDTAGSSDD"
FT   CDS_pept        complement(662661..663338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00612"
FT                   /product="phosphoserine phosphatase"
FT                   /note="COG0560: Phosphoserine phosphatase, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00612"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42576"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH10"
FT                   /protein_id="BAG42576.1"
FT                   /translation="MTNLALFDLDHTLIPTDSDHEWGRFMVKLGIVDAESFSRQNDQFF
FT                   ADYKAGKLDIHAYLTAMLTPLAKYSREQLAQWHEQYMHEVIRPAMTPAALELVRTHLDA
FT                   GDLCCIVTATNEFITRPIAAAFGVETLIACEVETIDGHPDSPYTGRPTGTPSYREGKIV
FT                   RTEAWLASLGKHWDDFERSYFYSDSHNDIPLLEKVTDPIATNPDDTLRAHARDRGWRIL
FT                   DLF"
FT   CDS_pept        complement(663350..664084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00613"
FT                   /product="similar to chromosomal replication initiator
FT                   protein DnaA"
FT                   /note="COG0593: ATPase involved in DNA replication
FT                   initiation, Ralstonia solanacearum"
FT                   /note="KEGG, K02313"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00613"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42577"
FT                   /db_xref="GOA:A0A0H3KCF4"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCF4"
FT                   /protein_id="BAG42577.1"
FT                   /translation="MVTRQLTLDLGTPPPATFDNFITGENGELVTRLQKLDLALAAGPV
FT                   PDRSFYIWGEPGSGRSHLLQALVSDASYGYARYLTPQSPLGAFTFDPRIGIYAIDDCDR
FT                   MSDTQQVALFNLFNEVRAHPSSAFVAAGPAAPLALDVREDLRTRLGWGLVFHLSPLSDA
FT                   GKIDVLRLAAKERGITLTDDVAAYLLTHFRRDMPSLMALLDALDRFSLEQKRAVTLPLL
FT                   RRMLARPGDDIAPPGTGPNRFE"
FT   CDS_pept        664323..665378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BMULJ_00614"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COG0150: Phosphoribosylaminoimidazole (AIR)
FT                   synthetase, Ralstonia solanacearum"
FT                   /note="KEGG, K01933"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00614"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42578"
FT                   /db_xref="GOA:A9AGA9"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AGA9"
FT                   /protein_id="BAG42578.1"
FT                   /translation="MNPPKSAPDAQGLSYRDAGVDIDAGDALVDKIKPFAKKTLRDGVL
FT                   GGIGGFGALFEVPKKYKEPVLVSGTDGVGTKLKLAFHLNKHDTVGQDLVAMSVNDILVQ
FT                   GAEPLFFLDYFACGKLDVDTAATVVKGIAQGCELSGCALIGGETAEMPGMYPDGEYDLA
FT                   GFAVGAVEKSKIIDGSTIAEGDVVLGLASSGIHSNGFSLVRKIIERANPDLSADFHGRS
FT                   LADALMAPTRIYVKPLLALMQKIAVKGMAHITGGGLVENIPRVLREGLTAELDQKAWPL
FT                   PPLFKWLQEHGGVADAEMHRVFNCGIGMAVIVSAADADAAVSDLTAAGEQVWKIGTVRA
FT                   SREGEAQTVVV"
FT   CDS_pept        665479..665874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00615"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4319: Ketosteroid isomerase homolog, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00615"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42579"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKW0"
FT                   /protein_id="BAG42579.1"
FT                   /translation="MSEDERAIRELVDTWFVSSRRGDLATVLDLIADDAIFMVAGRPPF
FT                   DKAAFAAASRDANTGGADAPKIDGRYRIDELRVLGDWAYMRNFIEIEATPPGGDTVRRS
FT                   GHTLTIFRKQDGRWQLVRDANLVTLAQ"
FT   CDS_pept        complement(665968..666945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="BMULJ_00616"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="COG0324: tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase, Ralstonia solanacearum"
FT                   /note="KEGG, K00791"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00616"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42580"
FT                   /db_xref="GOA:A9AGA7"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AGA7"
FT                   /protein_id="BAG42580.1"
FT                   /translation="MSVSAQSVPTTIACLLGPTASGKTAAALALAARRPIEIVSVDSAL
FT                   VYRDMDIGTAKPTREERARVPHHLIDIIDPADAYSAASFRADTLRLIGEIVARGNTPLL
FT                   AGGTMLYYKALTQGLNDLPTADPAVRAELDAEAARDGWPALHARLAQIDPATAARLAPN
FT                   DAQRIQRALEVFMLSGQPMSALLAAPRPADEAAAAYRFVPVALEPSDRAVLHARIAQRF
FT                   DAMLAAGFIDEVERLRRRDDLHLGLPSMRCVGYRQAWEFLDGDIDYRTMRDKGIFATRQ
FT                   LCKRQITWLRAMPERIVVDCIAPDSTARALDALERVLDGRIAAG"
FT   CDS_pept        complement(666942..668930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="BMULJ_00617"
FT                   /product="DNA mismatch repair protein"
FT                   /note="COG0323: DNA mismatch repair enzyme (predicted
FT                   ATPase), Ralstonia solanacearum"
FT                   /note="KEGG, K03572"
FT                   /note="MutL protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00617"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42581"
FT                   /db_xref="GOA:A0A0H3KCH2"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCH2"
FT                   /protein_id="BAG42581.1"
FT                   /translation="MSEFTETAATAAPAPAPRPLRAIQPLPDQLISQIAAGEVVERPAS
FT                   VVKELLENAMDAGATTLRIVLEEGGVKRISITDDGCGIPPNELPLALMRHATSKIRSLE
FT                   ELEAVATLGFRGEALASIASVAEMYITSRTADAAHATRIDAQTGVLSPAAGAVGTTIEV
FT                   RELYFNTPARRKFLKSEQTEFGHCVEMIRRAALARPDVAISVLHNGKAVEHWNATEPAQ
FT                   RVAKILGDGFATAHLPLDERAGPLAVYGCAGLPTASRGRADQQYFFVNGRFVRDKLLTH
FT                   AVRAAYEDVLHGDRYPSYVLFLDLPPEAVDVNVHPSKIEVRFRDSRSIHQFVFHAVQRA
FT                   LARHAGASPETTAGGHAAHLEPAPRGPASFLSTPLGQSPNQPASTGGSGFSSPSSSAPG
FT                   STWLRQARMTQGTLPVAQPLALYDALFGRKDTSAATPDATTATAGDAPDDSAAPLAGFA
FT                   ALPSAASMHDEQPLGFALGQIHGIYVLAQNAHGLVIVDMHAAHERILYEQFKNALADRT
FT                   VAVQSLLLPVSMTATPVEIGTVEEERDTLEALGFDLAVLSPTSLAIRAVPALLKDADLQ
FT                   ALARAVLADLHAFGGSRVLTERQHELLGTLACHHAVRANRRLTLDEMNALLRQMEATER
FT                   ADQCNHGRPTWYQLTLSDLDRLFMRGQ"
FT   CDS_pept        669103..669786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="BMULJ_00618"
FT                   /product="membrane-associated protein"
FT                   /note="COG0586: Uncharacterized membrane-associated
FT                   protein, Ralstonia solanacearum"
FT                   /note="KEGG, K03975"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00618"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42582"
FT                   /db_xref="GOA:A0A0H3KC83"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC83"
FT                   /protein_id="BAG42582.1"
FT                   /translation="MDTLLHFVNLVLHIDAFLGDFIRQYGAWVYLVLFLIVFCETGLVV
FT                   FPFLPGDSLLFIGGAFAATGEMNVGALIVLLLVAAIGGNTVNYLIGRWVGPKVFNTRIP
FT                   VLERFLDRAALQKTHTFYEKHGGKTIVLARFIPVVRTFAPFVAGASAMSATRFQLFNVL
FT                   GALIWVLLLVLLGYFFGNIPFIRQYLNVIVLAGIGAAVVPVALGALWKLLRGRHSDTTQ
FT                   KTGGR"
FT   CDS_pept        complement(669982..670794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00619"
FT                   /product="MscS family small conductance mechanosensitive
FT                   ion channel"
FT                   /note="COG0668: Small-conductance mechanosensitive channel,
FT                   Nostoc sp. PCC 7120"
FT                   /note="KEGG, K03442"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00619"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42583"
FT                   /db_xref="GOA:A0A0H3KH14"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH14"
FT                   /protein_id="BAG42583.1"
FT                   /translation="MLNLETAQQFLMTRGLDFGLNLLAAIALWFIGRWAIHVGTRLLGK
FT                   VVRRSGKVDPTLADYLSSVVSVLLTILLILAILQLFGVQTTSFAALLAGLGLAIGTAWG
FT                   GLLSHFAAGVFMQVLRPFKVGDVISAGGVTGTVKELGLFGTTIITADNIVTIVGNNKIF
FT                   SDNIANYSATPYRRVDLTAKIANGVDAVDAINRLKAAVQKIPNVLTDPAPDVGVLQFTP
FT                   EGPLLFVRPSTQPANYWQVYCDTHRVILETFRDAQYPTPETPVAHRSA"
FT   CDS_pept        671081..671863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcbP"
FT                   /locus_tag="BMULJ_00620"
FT                   /product="short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /note="COG4221: Short-chain alcohol dehydrogenase of
FT                   unknown specificity, Nostoc sp. PCC 7120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42584"
FT                   /db_xref="GOA:A0A0H3KCF9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCF9"
FT                   /protein_id="BAG42584.1"
FT                   /translation="MSTQKNGVPRCVLITGATGGIGSALAQEYAQAGTAVLILHGRNSA
FT                   LLQKLSDACTALGARVVTATFDVRDHDTLRNWVSEMSATEAPDLVIANAGVNINTGPQH
FT                   QGEDWEDMHRLLDVNVKASLATAHAAMPAMRARRSGQIALISSLAAWRGLPETPSYSAS
FT                   KAAVKAYGEAMRDGLAAEGVKVNVVMPGYVESQMCFDMPGPKPFLWKAPKAARVIRLGL
FT                   RANRARISFPFPLNLGCFLLAGIHPAVSGWLLSRLGYE"
FT   CDS_pept        complement(671766..672941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00621"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKW7"
FT                   /protein_id="BAG42585.1"
FT                   /translation="MLRRLLYRKPAHGPSHLRHNTAVQRWLVLHQGDNPSTDYYVLPRL
FT                   QEQGLPVVYKNLDTALPQPGDLAPGTAVVIIRYLNARWARALRLHRAQLSRVVYFMDDD
FT                   LLHPRAWAGLPRPYVKKLRKYCHAHTTDIRELSTEYWFSTQELRDRYPERAAQLIAPRA
FT                   LLEDARRLRVRHALPEAPILVFYHGSAAHEAEIAWLQPIVAQVLARCPNVHFELIGAHA
FT                   VNALYRSLPRTRVVHPMGWANYRAHCRLLDGHIGLAPLLPSAFNAARSHVKAYDIARCR
FT                   AVGLYAAPGPYQAVIRHGENGLLLDNDPHSWVEALCALAGDPVRLHALRVAAQELLLHP
FT                   SAEPSPTIDVVRDAPAQISLTRNPAGSGAIRTRPDVFPPTRSTRDSAGMES"
FT   CDS_pept        673572..675584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00622"
FT                   /product="putative capsule polysaccharide export protein"
FT                   /note="COG3563: Capsule polysaccharide export protein,
FT                   Neisseria meningitidis Z2491"
FT                   /note="KEGG, K07266"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00622"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42586"
FT                   /db_xref="GOA:A0A0H3KCH6"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCH6"
FT                   /protein_id="BAG42586.1"
FT                   /translation="MLRHASAGPERHAYTLAPGVNRIPTLAALLDDFRLHYRPMGRPAE
FT                   GAGVLAWGRRPSALAAQRYAAKHGLAVYHIEDGFLRSVGLGKDDPPLAIIFDDTGLYLD
FT                   ASQPSRLESLIAQPLRDDQAARARALAQAWRDGRVSKYNHSRDLERALPDGCVLVVDQT
FT                   RGDASISCGLADASSFQRMLDAALRDHPERTILLKVHPDVVSGRKQGHFDLDAVRAMPR
FT                   VQVLDDDAHPASVLPLVHEVYTVTSQLGFEALMWGLPVRVFGMPFYAGWGLTRDALPAP
FT                   ARRGAATLEQLVHAALIDYCRYVDPETGKRCEVETVVAWLALQRRMRQRFTVDIDALGF
FT                   SGWKKDYVRQFFDGSAVRFRWRVRRSSNASVATWGRKLDDRLAPALPATCKVIRVEDGF
FT                   IRSVGLGADLTRPLSWVQDDVGIYYDATRPSRLETLLADATFSDELVERAANLRRAICD
FT                   AGITKYNLAGRANWSRPQGRRVILVPGQVETDASIRFGASGIRSNMELLQAVRAANPDA
FT                   YLLYKPHPDVMAGLRKVGRGEGDAAQWCDETIGAVSFHELLGSVDEVHVLTSLAGFEAL
FT                   MRGVKVVTYGQPFYAGWGVTHDAGLTDAVRRRRARVLKLDELVAAALILYPTYVSRTTR
FT                   RFTTPERALREVVEWRATPQVPRWRHWVARLFREA"
FT   CDS_pept        complement(675526..676914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsS"
FT                   /locus_tag="BMULJ_00623"
FT                   /product="capsular polysaccharide export protein"
FT                   /note="COG3562: Capsule polysaccharide export protein,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K07265"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00623"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42587"
FT                   /db_xref="GOA:A0A0H3KC86"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC86"
FT                   /protein_id="BAG42587.1"
FT                   /translation="MQRAILFLQGPPSLFWRQLSDHFDAAQVRTHRINFSLGDWAYWRK
FT                   RGAVNYRGRFSRWADFLRDYLIRHEITDIFYYADRLPYHAVAREIAQSLGIRTFSIEFG
FT                   YLRPDWLTLERGGMGTLSHFPTDPKEIRAIARRVGPFKQDTAHYSHTFGQEAFNEVLYN
FT                   LLTSLVPYFFPLYRTDKYYLPLLDYLRWLPRMVAQRLYEPARVAAADVLRHSNARYWML
FT                   ALQMQADYQLRANSAYTDQRQVIEEVIASFAKHTPPDGSLIIKLHPLDNGMERWEKFVA
FT                   RTAKRYDVASRVIAVTDCDLKRTIKHSQGVITVNSTVGLHALRANCPVKVLGIAMYDIA
FT                   GLTHQGSLETFWTKPERVNKPLLRDFVAAIAATVQVHGSFYNRAGRDAACREIVRRVLN
FT                   DEVNGHGAFVDPPPRLERALRSNVPIFGSLRGSGIEPAAGRGPVVTPHETDAQPSAASA
FT                   APVA"
FT   repeat_region   complement(677068..677075)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(677076..678443)
FT                   /mobile_element_type="insertion sequence: IS406"
FT                   /note="IS256 family"
FT   repeat_region   complement(677076..677102)
FT                   /rpt_type=INVERTED
FT                   /note="IS406, terminal inverted repeat"
FT   CDS_pept        complement(677130..678296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00624"
FT                   /product="IS406 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00624"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42588"
FT                   /db_xref="GOA:P24575"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24575"
FT                   /protein_id="BAG42588.1"
FT                   /translation="MAMRVETNPLEAAYAALLENGLDGAGEALRILVNEAAKIERSAFL
FT                   GARPYERTETRRDYANGFKPKTVLTRHGELTFQVPQVRSSDFYPSALEKGTRTDQAVNL
FT                   ALAEMYVQGVSTRRVIDVLQRLLGPEISLSSAQVSRAAAKLDEGLRAWRERPLGETPYL
FT                   FLDARYEKVRLEGRIVDCAVLIAVGIEASGKRRVLGCEVATSEAEINWRRFLESLLARG
FT                   LKGVTLIIADDHAGLKAARRAVLPSVPWQRCQFHLQQNAGALTTRQEARKTVAAQMRAI
FT                   FNAPDRTEAERLLKAALTLWCKEHPKLAEWAETAIPESLTVFDFPAAHRIRLRTTNGLE
FT                   RINRELRRRTRVASIFPNPDSCLRLVSALLAELDDEWMTGKVYLNFNP"
FT   repeat_region   complement(678417..678443)
FT                   /rpt_type=INVERTED
FT                   /note="IS406, terminal inverted repeat"
FT   repeat_region   complement(678444..678451)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        678452..680167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00625"
FT                   /product="glycosyl transferase"
FT                   /note="KEGG, K07011"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00625"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42589"
FT                   /db_xref="GOA:A0A0H3KH19"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH19"
FT                   /protein_id="BAG42589.1"
FT                   /translation="MAGNAKACVATVVLTMHDGRTQALNVLISNKGRIQELARTPAPVR
FT                   AVHLTVGRDQNPLRVLSLRHRRLTSAEFRLRQFWRAASTLRKQPLQRCARAGLTPVTLL
FT                   RNLDYAYEVACRFRANVYRQGYAGWYQEFYAITPTDRALMVRRAKNWQYVPVFKIFLLV
FT                   NKQTTPAEIDATRAALQAQTYQRFEIELLADSSGDWARLISAIPARDSWHLVIRAGVTL
FT                   SEQALFCLADAVIKTPDAAVIYADHDVVGADGQLSDPVFKPDWSPELLRSTNYIGGAFV
FT                   WNGRYAGRLPEFGADATDANAMHALLLALSELGSPMVHVPAPLWHMTPRSEERGDGAET
FT                   VRAVAAHLRRVGVPAEVESTGPGRCRVRYPVAEPAPLVSIVIPTRDQLGHLRRCISSVL
FT                   EKTRYGPYEIIVVDNQSAEPDTLAYLQSLQQLANVRVLPFDEPFNYSRINNMAVAEAKG
FT                   ELVCLLNNDTEVISPDWLREMVGLLLSDGVAVVGAKLLYGDDTVQHAGDTVGPGGCADH
FT                   LHNGIRRDEPGYMGRALVAQDLSAVTAACLLTKKSIYQTVKETLIYSARRSSQT"
FT   repeat_region   680121..680124
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  680125..681334
FT                   /mobile_element_type="insertion sequence: ISBmu2"
FT                   /note="IS5 family"
FT   repeat_region   680125..680140
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   CDS_pept        680211..681203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00626"
FT                   /product="ISBmu2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00626"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42590"
FT                   /db_xref="GOA:A0A0H3KT61"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT61"
FT                   /protein_id="BAG42590.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   repeat_region   681319..681334
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   repeat_region   681335..681338
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        681718..682839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00627"
FT                   /product="ABC-2 type transport system permease protein"
FT                   /note="COG3524: Capsule polysaccharide export protein,
FT                   Campylobacter jejuni"
FT                   /note="KEGG, K01992"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00627"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42591"
FT                   /db_xref="GOA:A0A0H3KKX2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKX2"
FT                   /protein_id="BAG42591.1"
FT                   /translation="MIINSIKKYKLFWGMVALPTMLAAIYFGFLAKNRYVSTSEVVVHK
FT                   VSSDSSGVGASEMQGLAVLMGGGGLADGMAAETLYVREFVTSQDMLDVLEKKLRWSQHY
FT                   AGHAGDLWYYLPADASREQLLKYYQRMVSAQFDQTTGLLAIKVEAFDSDFAKKTLSTII
FT                   AESDRFVNDISHRLAREQVNFAESELERSRVNYEERQEALLQFQGEHNALDVQRSAVAK
FT                   NDVITSLQADLIKENATLRAMRASLSEDSPQVRQQKIRISALQQQINAEEKTLIAKNAN
FT                   NKLNVLASRYETLQLNAGIAQETYKASIASLQAARMDATRKLRSLVVVVNPNTPDEALF
FT                   PRRLYSFCTIVVILLLAFGVTRFVIATINDHKD"
FT   CDS_pept        682893..683990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wza"
FT                   /locus_tag="BMULJ_00628"
FT                   /product="polysaccharide export outer membrane protein"
FT                   /note="COG1596: Periplasmic protein involved in
FT                   polysaccharide export, Agrobacterium tumefaciens strain
FT                   C58"
FT                   /note="KEGG, K01991"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00628"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42592"
FT                   /db_xref="GOA:A0A0H3KCI0"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCI0"
FT                   /protein_id="BAG42592.1"
FT                   /translation="MKYNHCLRRVVLLSGLFFVGGCTVLSGAGPHIASVTSARNMQNPE
FT                   YPYQLIDLSASNIAPYMRPPEKPLTDHIARPREPEVRLMAGDVLRVLISDDSGADKTVF
FT                   APLSLGGTVFGQVRVDADGKITLPYMGTKSVRGATLSEAESIIRRGVQGRASEPQVHVE
FT                   LVSDLSRSVLVAGAVKSPGRFSALQGPLTILDAINQAGGPVLEPYLINVVVRTGNAVKS
FT                   YNYQDLLSGGNITVPSNSEIILERARKRFVAMGAVGQPGLHDFPSSTPSLLEVLGAVGW
FT                   LNERTANPGGVFIFRLEDNGGTAKPVAQVFRLNMQEPVSMFLAKRFLVHPDDTVYVTNA
FT                   PTYEMQKIIAPIVQVLLLGKYADGF"
FT   CDS_pept        684002..684817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00629"
FT                   /product="ABC-2 type transport system permease protein"
FT                   /note="COG1682: ABC-type polysaccharide/polyol phosphate
FT                   export systems, permease component, Campylobacter jejuni"
FT                   /note="KEGG, K01992"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00629"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42593"
FT                   /db_xref="GOA:A0A0H3KC90"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC90"
FT                   /protein_id="BAG42593.1"
FT                   /translation="MSDLESPFKANRSSLRIVRSVLFALFLREMQTRFGARRMGFAWVI
FT                   FEPLAILVIILTFHAMLRATRMQSMDYVMFLVSGIVPFHMMRNIAWRITDSIQANQGLF
FT                   AYRQVAPFDTFVARLIVELCTYSCAYLIICFFLGFWFDHDVLISDPLAWLWAIGVGVFL
FT                   SFWFGVAFAIIAHSIPGAARVCKLSFIPLYITSGIFFPIWNMPEREIYFFSWNPYVEVV
FT                   DGIRAAVFDNYPVTKGLNYNYPLGFAMVLAFFVMVAYRRQRQALRSIKV"
FT   CDS_pept        684821..685477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00630"
FT                   /product="ABC-2 type transport system ATP-binding protein"
FT                   /note="COG1134: ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component, Campylobacter jejuni"
FT                   /note="KEGG, K01990"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42594"
FT                   /db_xref="GOA:A0A0H3KH24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH24"
FT                   /protein_id="BAG42594.1"
FT                   /translation="MIKLEKLTKSYVTKQGRKYIFRDLSFVVPPDKNIALIGKNGAGKS
FT                   TLMRLLCGTEVPDSGRIITDKKISWPVGLGGGFQGSLTGRQNVKFICRSLGAEGDEMDR
FT                   VISYVEDFAELGDYFNQPMKTYSSGMSARLRFGMSLAFDFDYYMVDEAMSVGDAHFREK
FT                   AAAEFKRRVGRTNLILVTHGMGQVRTLCDIVLLLKNGNVEVYEDVEEGIREYMKL"
FT   CDS_pept        686125..687111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00631"
FT                   /product="glycosyltransferase"
FT                   /note="involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00631"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42595"
FT                   /db_xref="GOA:A0A0H3KCG8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCG8"
FT                   /protein_id="BAG42595.1"
FT                   /translation="MVSARLNFIKFMERSAADGLKIGVAAIFKNECEFILEWIAYHRVI
FT                   GVDYFIISDNESTDGSRELLAKLEKIGLVKLIEFPNPPGLRPQLPAYSTMLTECPETID
FT                   VLAFIDADEFMFPLDGEDSVRPFFEHIFSDTEVSALALNWAIYGSSGHVFSRDGLVIDR
FT                   FTKMAEMNFGVNNHYKSVVRPSRVEYFENPHHAKLKGGRYVDARGTDVVYHEKYGHGLS
FT                   NDVVWKGVRINHYAVKSLEEFLVGKSRKGSASRELRVKHEAYFRRHDKNDVEFLVPKAL
FT                   REKIIVEIAEIQERLQSVVDEANSRDQTGEREGFWGKLIGLIGRNGQ"
FT   CDS_pept        complement(687883..688752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00632"
FT                   /product="putative glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00632"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42596"
FT                   /db_xref="GOA:A0A0H3KKX7"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKX7"
FT                   /protein_id="BAG42596.1"
FT                   /translation="MANYVRENRFSPRPRLAALGIIFATICSNGYAQSWNKTSPVTYAS
FT                   PIHLTTPDQDYVVRRPVTDRDRDLIARYRSGKLKPDFETRFTRRADLDDWDLQVSENTK
FT                   LRSCVRPNSVSTGPEGLTLTVEPATDCHAKWSTGQIVSKNRFKYGYFEASMKLAPISGM
FT                   DNAFWLVTSDGYEIDVTEAFYPKTATSAVHQWHPPRGKEHSMVSTAINIKQDLSKDFHD
FT                   YSVLWNEKELIFAIDGEPYVALTPNNTINGTAVLHLSNALVPWGAKPPSNPEGVRTMFR
FT                   GVRVFKLQ"
FT   CDS_pept        complement(688787..689908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00633"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42597"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCI6"
FT                   /protein_id="BAG42597.1"
FT                   /translation="MIKRVAIFGTNGGTLLSPHLVRGLNDIGENVGNSLFQYALTKKIA
FT                   NPKIFVTPQKITPEELRERADILVIPAANQINPAWDLGGWADFIEACNLPVVCIGLGAQ
FT                   SGKNETEVKNLKPGTIRFAKVLSERCNTIGVRGRFTANALEQLGISNVVITGCPSQTIN
FT                   LRASGKNIQSLLDSYTVIDSPKIAHVFGTMEPETRLAEKILSQLVLPHDHITVYQTDKK
FT                   ILNLVHSRKFLQEDDHIFFEWLRTNLHPSLKLEEYLKYIVDNGRVFSDARTWIDSMTRF
FT                   DLVIGMRIHGAVAAIQSGTLGICVAFDSRTLELASTMGYPHVMVEDVEAAQSLTDILEK
FT                   VVFDAARFDHLKVKNTEKIYEILRNGECLLEAD"
FT   CDS_pept        complement(689942..692416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00634"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00634"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42598"
FT                   /db_xref="GOA:A0A0H3KC95"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KC95"
FT                   /protein_id="BAG42598.1"
FT                   /translation="MNKFDSPLKKTNPIHEIGYNILGPIVQRWMLGINQYINYLSTSQT
FT                   KILFCARAGVRISKLYETFLENSNFHDSSQRDILWVSRISVAKGIYHRKPELTTKIISN
FT                   EYAHEPIKNLIKGVLRHQQSRLSHLNLELSEYAAHGFNFPGWIQGPTPAAASMRDYFQK
FT                   CGVAFDDYIRESLGDCTQAVLIDSGWQGTMQSMLNEAYPEIKWKGLYFGRILTSDFNSK
FT                   IVDDIIGIIFQSEKYESQDPATAFIRHRHLIEALVEPNGPSIEEIPSGEFLGTANSLID
FT                   KNVNEIYEDHDALFECAMDYLANEGKNASITKIISNYELAIQKAARLILHPSRDDAMAL
FT                   LGKERSADFGKDITVPVLRLPGHSDFATADLRIQHALWQEGQIALEYDGAMAYELQSQI
FT                   SGQRTIAAYFDPKSEDQKTSGVRAHLNRPSVAIITRTKNRPLLLKRAAHSVANQSYTNY
FT                   TWVIVNDGGDLSPVLSVIEESLIDRRKIVLVHNESSLGMEAASNAGISNSTSDYIVIHD
FT                   DDDSWEPAFLEKTVSFLSSPSGNRYGGVITHSTYISEEIKNNTVVEHHRQPYMNWVRNV
FT                   QIAEMAAGNIFPPIAFLYKRSFWEEIGGYNEKLPVLGDWYFNLAFLLKGDIAVLTEPLA
FT                   NYHHRDRGTQTAYTNSVVGGISKHEEFAAIARNEFVRQYGKNDFGALTAIFGYYIADIR
FT                   NRINGIQGETRSITNNTQSPTNPISPNQSHDDSDRKWVISNINKTRRAKSFFKKNDHPH
FT                   ISQDASWQEINALLQKRKIVIPPPQDFDEDTYLKKNSDVANAVQHGRFSSGYQHYILHG
FT                   KREGRGREYRTQ"
FT   CDS_pept        complement(692445..693368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00635"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00635"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42599"
FT                   /db_xref="GOA:A0A0H3KH30"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH30"
FT                   /protein_id="BAG42599.1"
FT                   /translation="MSNVTTVHRFDAIEAEVENCNTRSVLFHDPHFKERLFEKIDSLAP
FT                   QGNFVLSFDVFDTLLLRNQKSELRRFIEIGQRMSAFRKKSGLKNTTPRDLDTLINSLSL
FT                   SDIDAFLARHLGTKASYRAGKKVAGYGEGSLIEIQCTASKILNGSDRLKDDFIEIELSY
FT                   EAEGLSVNDALLSYATRHKQNGGKVILVSDMYMHAEHIENLLGRLKIDLELFDLIISSA
FT                   DTKISKSSGKIFEEIEKILNEPSDRFIHIGDSIDGDYIKARKAGWRALHLPISTAEMSE
FT                   RISDHALLSEMLEDKFSIRTDIQAPR"
FT   CDS_pept        complement(693487..694839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="BMULJ_00636"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="COG0156: 7-keto-8-aminopelargonate synthetase and
FT                   related enzymes, Sinorhizobium meliloti"
FT                   /note="KEGG, K00652"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00636"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42600"
FT                   /db_xref="GOA:A0A0H3KCH3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCH3"
FT                   /protein_id="BAG42600.1"
FT                   /translation="MSKTKTPGLPGLTSALKNKLIQQALERKLREAGRDQPTASPVAGR
FT                   KTASSVPEAYTRFDQYPGYRQLRIMNDGAARLGVRSPFFKLHEGTAGAQTEIAGNTYIN
FT                   YASYNYLDMSGDPVVSQAAKDAIDRYGTSVSASRLVSGERPIHRELERTLADLYGVDDA
FT                   ITFVSGHAANVTTIGYLFGPRDLVIHDELIHNSVLQGIQLSGAKRFSFAHNDADALERL
FT                   LTEQRHQFERVLIVLEGIYSMDGDYPDLPRFVDIKRRHRAFLMVDEAHSMGVMGKTGRG
FT                   IREHFGLAGDAVDIWMGTLSKSLAGCGGYIAGETALVEHLKFLAPGFLYSVGMPPPVAA
FT                   ASLAALRRMLELPERVATLQARGQYFLAQAKAAGIDTGSSAGIAVIPAILGSSLRATKW
FT                   SEALFQQGINVQPILYPAVPEQSARLRFFISCAHSETEIDKVIACMRRLKD"
FT   CDS_pept        complement(694847..702478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00637"
FT                   /product="polyketide synthase"
FT                   /note="COG3321: Polyketide synthase modules and related
FT                   proteins, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00637"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42601"
FT                   /db_xref="GOA:A0A0H3KKY5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKY5"
FT                   /protein_id="BAG42601.1"
FT                   /translation="MSKSVALVGLAFRFPGTDSRHYWSDLLNGKDCVTEVEPDRWCKDA
FT                   YLHPAKEHPGTAYTFAAGSIGDVSGFDADFFGISPREAALMDPQQRLLLELCWESIESA
FT                   GIKPSSLRGSDCGVFVGIASADYSYRMADDIATVDASMATGNTASIAANRLSYVFDLRG
FT                   PSLAVDTACSSAMVAFHLACRAIANGEISHAIAGGVSLHLHPYGFITFSKASMLSPEGR
FT                   CKVFDASGDGYVRSEGGGLFLLKDYDQAVADGDRILAVVAGTAVNTDGRKSGLTVPSVD
FT                   AQTALMRQVYEQAGIPPDAIDYLEAHGTGTPVGDPIETRAIGQALGQRRPADAPLPIGS
FT                   VKSNLGHLEAASGVAGLVKAVYSLQHRVVPGTIGIQEFNPNIRFEDWNIEVVTKPHPLR
FT                   ETGTLTIGVNSFGFGGANAHVILQSPAETGRAIGTVSRSTAAAVPVVVTGRSADALQAN
FT                   ARRLADMLRSQSAPALYDVAYAAALRRDWHDKRAVVFGADSESIAQLLDQIGADETANP
FT                   AVHTGFGVRGAQGPVFVYSGNGSQWAGMGSKLLAHPVFGQSVADIDGLFVKLAGWSLKE
FT                   LFEGDARSDVYERTEIAQPALFAIQVGITRMLAAQGVQPTAVTGHSVGEVAAAWACGAL
FT                   TLADAITVIYHRSQQQGLTKGKGRMAAVGMDGAAAAALLDELGLQHALCVAGYNSTKGA
FT                   TLAGAVDALEKVAHVLAERRVFYKQLDLDYAFHSSAMDPIEAPLKQALAHIRPRRGDVP
FT                   FFSTVEGAVLDGAALDADYWWRNIRVPVRFEQALDSLVSQGSDVLIEIGPAPVLRGYVN
FT                   EMLKHHGKTGVCIPTGRRNDDAPAHVQAAVAQTIISGAPIDWAHFFPTGAARIELPPYA
FT                   WQRERYWHPVTAESLNQLGRRRVHPLLGYKMSQQTQPAWENQLDTLLQPWLADHVVGHA
FT                   TVFPGSGFAEIALAAALQWYPGDYADIEELEIHAPLLLSAAPSKITRLSLDDSDGRFRL
FT                   RSKQVGSTDPWTVHASGRLLSGANPQQLIETAPALPAREPDFTGETHLALTRAAELDYG
FT                   PAFQAVSHGWLESPRDVVAVLHAPAALAASLPHSLLHPALLDCTFQLIIQMLKDDPSLG
FT                   QGVAFVPTRIGRLRWRAGLGTPHRVRARLLKRAPHSLTAEFALFDEHGQQIAAISEARF
FT                   RSVRLSKSHAEPLAFLDYVAIPSPHPQHLQQANPALRRDALQPALRAMVRSIVTDGLLE
FT                   RYAQEVDPLLETLCDRYAADALLTLSTNGRLEASVLTACRDAAPHAAPLLDWLLARTAR
FT                   RLADSPDWQIDVPQDDGASTADIWNSLLREYPDYFTLVHATGRIGLHLPALLSGEAAWA
FT                   NVCPRDISPVELAHYVLGDAASQRLSDTLGVHLEKALLARAPEQRVGILEIGAGASRVA
FT                   AELCRHLDFAVADFGYASSEDAALEHAERLREHCPELSVERIDANATSTRRDVDLIVFH
FT                   GDFGSLEGARQALQYGANRLKPGGTLLLWGTQPAAWMDFIFGGNAAWWTKRADGTPGTP
FT                   QRTAAYWQSELAQLGLDCDEPLELAPESACGPYLLAAGLPVEASAVAQPQVPQGGWLIL
FT                   ADAHTAGESGAARKLADHLSSRRRLPVRIETDVTPEQLDALLQRAQVELGEIRGIVHLA
FT                   GLASGANLDADDPQRLLQAQVQRCALAAGLASASERAGLKTTLWLLTAGAAPFLPAAKA
FT                   DGYATLNDASLWLYGRTMINEAAGFDVRLVDLPQAAPVPVEALARELLWPDGEQEVALG
FT                   AAGERYAPRLRKNPRPHAESPAAPASAADTALRLGFEVPGQLRNLRWEAHPLPDMREDE
FT                   LQIRVEATGLNFRDVMYTLGLLSDEAIENGFAGPTLGLEFSGVVERVGRKVTGYKAGDA
FT                   VVGFGPASFGNVVVTQPSALSHIPRSLSFEAAATIPSTFFTVYYALHHLARLEPGERVL
FT                   IHGAAGGVGIAAIQFAQWIGAEIHASAGSDEKRDFLRLMGVKHIYDSRSLDFADEILAA
FT                   TDGEGVDVVLNSLAGEAINRNLRALKPFGRFLELGKRDFYENTRIGLRPFRNNISYFGI
FT                   DADQLMSKRPDLTRRLYGEMMALFEEGVLRPLPYHAFDANDIVDAFRHMQQARQIGKIV
FT                   ITYRRALHANAPAPVAATAGELQLRDDASYLVTGGLSGFGLRTAQWLADKGARHLVLVS
FT                   RSGPASDEAQEAIAALRERGVAVHAAPCDVTDRAALAALLAQVDAQMPPLRGIVHAAMV
FT                   IDDGLVRGATAAQIERVMAPKIVGALHLDELTRALPLDFFVFHSSGTTLFGNPGQSNYV
FT                   AANGWLEALARHRRARGLPATSPRWGAIADAGFLARNQKVKDALQNRMGGSALPAATAL
FT                   DALEDMLLAGTGDLGVLELDWRSLARFLPSAQTPKFAWVARDAATSHQDEDGGNDVAEL
FT                   LATLSDEELHPAVVDMIKHEVSEILRVPADKIDPDRSVYDMGLDSLMGVELVVALESRF
FT                   GVRLPVMALSESPTMTKLATRLIEVLRGDEPAELDTVAQQVAHVVAQHTEDVSSEALAE
FT                   FTDEIKAAQEAGHKPQRMIR"
FT   CDS_pept        complement(703117..704019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="BMULJ_00638"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="COG1091: dTDP-4-dehydrorhamnose reductase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00067"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00638"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42602"
FT                   /db_xref="GOA:A0A0H3KCJ1"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCJ1"
FT                   /protein_id="BAG42602.1"
FT                   /translation="MQTSDRKTILLTGINGQVGFELQRTLQGLGNVVALDRSRLDLSRL
FT                   NQVRDVVRDLKPDLIVNPAAYTAVDQAETDVAMATRLNAQAPAVLAEEAKRIGAALIHY
FT                   STDYVFAGTKAGPYVEDDAVDPQNVYGRTKLDGERAIAASGCAHLIFRTSWVYGTRGKN
FT                   FLLTMLRLGAERDELKVVADQIGAPTWSNTIATLTAHVVAQGIAAGAAGREAWWNAHSG
FT                   VYHLCAAGSTSWHGFAEAIFRLSDMQKKPSVKPIPATAYPTPASRPANSRMSNEKLAEH
FT                   FGLRAPHWVAALELCMNGM"
FT   CDS_pept        complement(704028..704579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="BMULJ_00639"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="COG1898: dTDP-4-dehydrorhamnose 3,5-epimerase and
FT                   related enzymes, Ralstonia solanacearum"
FT                   /note="KEGG, K01790"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00639"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42603"
FT                   /db_xref="GOA:A0A0H3KCB1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCB1"
FT                   /protein_id="BAG42603.1"
FT                   /translation="MAITVTATALPEVKIIEPKVFGDARGYFYESFNGREFAEQVEPGV
FT                   EFVQDNHSRSAKGVLRGLHYQIQHAQGKLVRVVEGEVFDVAVDIRRSSPNFGKWVGVTL
FT                   SADNHRQLWVPPGFAHGFVVLSEAAQFLYKTTDYWYPEHERSIVWNDPDIGIEWPIEFE
FT                   PLLAAKDAAGKRLAEAECFQ"
FT   CDS_pept        complement(704564..705457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="BMULJ_00640"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="COG1209: dTDP-glucose pyrophosphorylase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00973"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42604"
FT                   /db_xref="GOA:A0A0H3KH35"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH35"
FT                   /protein_id="BAG42604.1"
FT                   /translation="MARKGIILAGGSGTRLYPITQAVSKQLLPVYDKPMIYYPLSTLMI
FT                   AGIRDVLIISTPQDTPRFESMLGDGSQWGMNIQYAVQPSPDGLAQAFIIGKDFVGNDPS
FT                   ALILGDNIFYGHDLAKQLEHANAQEHGATVFAYHVHDPERYGVVEFDKDFRALSIEEKP
FT                   AKPRSHYAVTGLYFYDNRVCDIAADIKPSARGELEITDVNSRYLQDGTLNVEIMGRGYA
FT                   WLDTGTHDSLIEAASFIATLQKRQGLVVACPEEIAYRRQWIDAEQVQKLAQPLAKNGYG
FT                   KYLLNILTDQVAWPSR"
FT   CDS_pept        complement(705469..706530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="BMULJ_00641"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="COG1088: dTDP-D-glucose 4,6-dehydratase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01710"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00641"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42605"
FT                   /db_xref="GOA:A0A0H3KCH8"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCH8"
FT                   /protein_id="BAG42605.1"
FT                   /translation="MILVTGGAGFIGANFVLDWLRASGEAVLNVDKLTYAGNLRTLQSL
FT                   EGNPKHVFARVDICDRAALDALFAEHKPRAVLHFAAESHVDRSIHGPADFVQTNVVGTF
FT                   TLLEAARQYWNGLNDADKAAFRFLHVSTDEVFGSLSATDPQFSETTPYAPNSPYSATKA
FT                   GSDHLVRAYHHTYGLPTLTTNCSNNYGPYQFPEKLIPLMIANALAGKPLPVYGDGQNVR
FT                   DWLYVGDHCSAIREVLARGVPGETYNVGGWNEKKNLEVVHTLCDLLDAKRPKATGSYRD
FT                   QITYVTDRPGHDRRYAIDARKLERELGWKPAETFETGLAKTVDWYLDNQQWVDEVASGE
FT                   YRKWVETNYAQRA"
FT   CDS_pept        complement(706732..707565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00642"
FT                   /product="glutamine amidotransferase-like protein"
FT                   /note="COG0121: Predicted glutamine amidotransferase,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K07008"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00642"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42606"
FT                   /db_xref="GOA:A0A0H3KKZ1"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKZ1"
FT                   /protein_id="BAG42606.1"
FT                   /translation="MCRWLAYTGNPIHLETVLFRAKHSLIDQSLHSELGATTTNGDGFG
FT                   IGWYGHPDELPFRYRSVHPAWNDRNLREAARAIRSPMFVAHIRAATDTPVQETNCHPFR
FT                   HGRWLFVHNGLIRDFHKLRRDLTMKIDPALFPTLEGSTDSELMFRLALTYGLEQAPLPA
FT                   LERMVGIVEETAARHRVAEPLNMTICATDGERIIAVRYSSERQSRSLFHSTSFKHLHAL
FT                   YPHNPRIAEAGDDAFMVVSEPLVDLRGAWEQVPESTAIVAHGAEVRRMGFAPRHK"
FT   CDS_pept        complement(707663..707992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00643"
FT                   /product="putative alkylhydroperoxidase AhpD core"
FT                   /note="COG0599: Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit,
FT                   Haemophilus influenzae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00643"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42607"
FT                   /db_xref="GOA:A0A0H3KCJ5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCJ5"
FT                   /protein_id="BAG42607.1"
FT                   /translation="MMNWNEYRKELSTRIGEIAKLSPDTLAGYKALSGAGAKTGHLDAK
FT                   TRELIALAVAVTTRCDGCIAVHTAEAAKHGATKEEVAEALGVAVALNAGAALVYSARVM
FT                   DAMGD"
FT   CDS_pept        708121..709068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00644"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00644"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42608"
FT                   /db_xref="GOA:A0A0H3KCB5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCB5"
FT                   /protein_id="BAG42608.1"
FT                   /translation="MDALSQLLLLGRSHVELDLRCLLDGAFAMPHAPLPPGEAAFHLVL
FT                   AGSCRLRTAGGRTLQLAEGDFVLLPGGDAHDLLDAIAVRSRVTAPLREPDRDGGTVLPI
FT                   KSNLGAADRDRASVDLLCGRFVYARGAGELLMRTLPRMLHVGLRDGLATAPPLQWLTDA
FT                   LRSEASSAQPGARAIVNALGQALLAYALRAYGRDTRMPSGWLAVAADARLGPSVLAVLQ
FT                   APAQPWTVESLGDAVAMSRATYARHFREKAGMSVGAFVAQVRMMHACTLLQETQRGQAE
FT                   IGQAVGYQSEAAFGKAFRAVLGTTPGRWRRAWRE"
FT   CDS_pept        709247..709909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00645"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH39"
FT                   /protein_id="BAG42609.1"
FT                   /translation="MNNFMRIFIVLCFLIEFEAAIAQVPQAEGSPLLGEWRYVSAQHEG
FT                   KKPYSTFVIQLHRSSGNQVAGAYCFITEEGRRVDCDPDGVSNLSGVISPDGSRATINFF
FT                   PFFGAKDGVADVSLSNGELHWKVVKTPDGDFFYGPFDVFLVRNEKPSRNKPVVSNRAYL
FT                   YAGPTSKSKSKSYLIKGDEVELLNISDNLKFWRIRYTTTDGRTIERWIECGTVNACP"
FT   CDS_pept        710169..710873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00646"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCI4"
FT                   /protein_id="BAG42610.1"
FT                   /translation="MRFIEKVALFTFFVMASWAACASPGACKNELRELVVPSFQGVAMN
FT                   KSGIQAEIEDEYNGIYSVRLYVAADSPDNLDKQVSIGWVNLDTNSMKVLDVTRDPDHPA
FT                   ELRVDEEKYRKFVSDCIRASPKTVSMCDDLNNRTSETAVRILHSESKVTVIGSGRLQFY
FT                   SAPDLSCKIPGVFILPGESVVAEKSDRGFTFVAYRSAKKDGPVLGWVRSDRLKHNGVGA
FT                   TPRQPANSEQTK"
FT   CDS_pept        710870..711121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00647"
FT                   /product="putative membrane protein"
FT                   /note="contains two PAAR domains"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00647"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42611"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKZ6"
FT                   /protein_id="BAG42611.1"
FT                   /translation="MMNLIRIGDDTDHGGKVETGSTTMRFDGRYVARKGDRVSCPQHPD
FT                   VSPNLIEEGDSSITDNGIPIARHGHRATCGCHLISSLV"
FT   tRNA            complement(711408..711483)
FT                   /locus_tag="BMULJ_00648"
FT                   /product="tRNA-Lys"
FT                   /note="anticodon TTT"
FT   CDS_pept        complement(711541..712290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_00649"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1729: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00649"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42612"
FT                   /db_xref="GOA:A0A0H3KCJ9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCJ9"
FT                   /protein_id="BAG42612.1"
FT                   /translation="MTHRVTWLRAVAAFCVVGAAWSAAPAHAGMFDDNEARRAVLDLRS
FT                   KSDNLANQLSAAQRTILDQSARLDQLNQQVATLRGENEDLTNRLTTLERQQKEYYEDLD
FT                   TRLKKFEPQQKTIDGVEGTVQPGETDALNAAQQQFRNGNFKAAAASFRSFIAKYPQSPY
FT                   QPTAQYWLGNAQYALRDYRGSTATWQAIVSKYPQHPRAADALVAIGTNQLEQGQKAAAK
FT                   KTFEQVVSQYAGSNAAQTAQGKLESIK"
FT   CDS_pept        complement(712310..712819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="BMULJ_00650"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /note="COG2885: Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03640"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42613"
FT                   /db_xref="GOA:A0A0H3KCB9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KCB9"
FT                   /protein_id="BAG42613.1"
FT                   /translation="MMSKKVRLALAVMMIGALAACKSGVKLDDKANAGAMSTQPSADNV
FT                   AQVNVDPLNDPNSPLAKRSIYFDFDSYSVKDEYQPLLQQHAQYLKSHPQRHVLIQGNTD
FT                   ERGTSEYNLALGQKRAEAVRRALALLGVADSQMEAVSLGKEKPQATGHDEASWAQNRRA
FT                   DLVYQQ"
FT   CDS_pept        complement(712837..714132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="BMULJ_00651"
FT                   /product="TolB protein"
FT                   /note="COG0823: Periplasmic component of the Tol biopolymer
FT                   transport system, Ralstonia solanacearum"
FT                   /note="KEGG, K03641"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00651"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42614"
FT                   /db_xref="GOA:A9AFQ0"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AFQ0"
FT                   /protein_id="BAG42614.1"
FT                   /translation="MSLMTKLGFRALVASCLIAAGSAANAQVNVLITGVGSTQFPIATA
FT                   NFANEAGLPQQVTSIVRADLARSGKFTNIDAGSTPVPETASVDLGAWKAKGANAFVAGS
FT                   VNHEGNGQYKINFILYDTVKQQSLGGLSLSANDTTLRTAGHKIADYIYQKLLGVRGVFA
FT                   TRLSYVIKTGNRYQLQISDSDGQNARIALSSTEPIISPAWSPSGTKVAYVSFERKKPIV
FT                   YIHDLPTGRRYMVSDQKGNNSAPAWSPDGNTLAVALSLTGNTQIYSVNSNGGGLRRLTQ
FT                   SSSIDTEPFYSPDGRWIYFTSDRGGAPQIYRMPAQGESAGAAQRVTFTGSYNTSPRVSP
FT                   DGKLLAYISRTGGGFKLYVQDLQTGAANAITNTNRDESPSFAANGQYILYATQSGGRNV
FT                   LAAVPSDGSAPPQILSVQGGSVREPSWGPFMQ"
FT   CDS_pept        complement(714242..715294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="BMULJ_00652"
FT                   /product="bacteriocin import membrane protein"
FT                   /note="COG3064: Membrane protein involved in colicin
FT                   uptake, Haemophilus influenzae"
FT                   /note="KEGG, K03646"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_00652"
FT                   /db_xref="EnsemblGenomes-Tr:BAG42615"
FT                   /db_xref="GOA:A0A0H3KH41"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KH41"
FT                   /protein_id="BAG42615.1"
FT                   /translation