(data stored in ACNUC29543 zone)

EMBL: AP009386

ID   AP009386; SV 1; circular; genomic DNA; STD; PRO; 2473162 BP.
XX
AC   AP009386;
XX
PR   Project:PRJDA19401;
XX
DT   04-JUN-2008 (Rel. 96, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 5)
XX
DE   Burkholderia multivorans ATCC 17616 genomic DNA, complete genome,
DE   chromosome 2.
XX
KW   .
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-2473162
RA   Ohtsubo Y., Yuji N., Tsuda M.;
RT   ;
RL   Submitted (17-APR-2007) to the INSDC.
RL   Contact:Yoshiyuki Ohtsubo Tohoku University, Department of Environmental
RL   Life Sciences, Graduate School of Life Sciences; Katahira 2-1-1, Sendai,
RL   Miyagi 980-8577, Japan
XX
RN   [2]
RA   Ohtsubo Y., Yamashita A., Kurokawa K., Takami H., Yuhara S., Nishiyama E.,
RA   Endo R., Miyazaki R., Ono A., Yano K., Ito M., Sota M., Yuji N.,
RA   Hattori M., Tsuda M.;
RT   "Complete genome sequence of Burkholderia multivorans ATCC 17616";
RL   Unpublished.
XX
DR   MD5; c0a9117ab2797843a612476ba3d1826f.
DR   BioSample; SAMD00060926.
DR   EnsemblGenomes-Gn; BMULJ_03313.
DR   EnsemblGenomes-Gn; BMULJ_03478.
DR   EnsemblGenomes-Gn; BMULJ_03704.
DR   EnsemblGenomes-Gn; BMULJ_03719.
DR   EnsemblGenomes-Gn; BMULJ_03722.
DR   EnsemblGenomes-Gn; BMULJ_03728.
DR   EnsemblGenomes-Gn; BMULJ_03741.
DR   EnsemblGenomes-Gn; BMULJ_03743.
DR   EnsemblGenomes-Gn; BMULJ_03744.
DR   EnsemblGenomes-Gn; BMULJ_03746.
DR   EnsemblGenomes-Gn; BMULJ_03749.
DR   EnsemblGenomes-Gn; BMULJ_03780.
DR   EnsemblGenomes-Gn; BMULJ_03782.
DR   EnsemblGenomes-Gn; BMULJ_03793.
DR   EnsemblGenomes-Gn; BMULJ_03919.
DR   EnsemblGenomes-Gn; BMULJ_04056.
DR   EnsemblGenomes-Gn; BMULJ_04057.
DR   EnsemblGenomes-Gn; BMULJ_04310.
DR   EnsemblGenomes-Gn; BMULJ_04311.
DR   EnsemblGenomes-Gn; BMULJ_04446.
DR   EnsemblGenomes-Gn; BMULJ_04448.
DR   EnsemblGenomes-Gn; BMULJ_04475.
DR   EnsemblGenomes-Gn; BMULJ_04476.
DR   EnsemblGenomes-Gn; BMULJ_04611.
DR   EnsemblGenomes-Gn; BMULJ_04691.
DR   EnsemblGenomes-Gn; BMULJ_04697.
DR   EnsemblGenomes-Gn; BMULJ_04699.
DR   EnsemblGenomes-Gn; BMULJ_04879.
DR   EnsemblGenomes-Gn; BMULJ_04993.
DR   EnsemblGenomes-Gn; BMULJ_04995.
DR   EnsemblGenomes-Gn; BMULJ_05088.
DR   EnsemblGenomes-Gn; BMULJ_05089.
DR   EnsemblGenomes-Gn; BMULJ_05094.
DR   EnsemblGenomes-Gn; BMULJ_05095.
DR   EnsemblGenomes-Gn; BMULJ_05096.
DR   EnsemblGenomes-Gn; BMULJ_05174.
DR   EnsemblGenomes-Gn; BMULJ_05346.
DR   EnsemblGenomes-Gn; EBG00001436978.
DR   EnsemblGenomes-Gn; EBG00001436979.
DR   EnsemblGenomes-Gn; EBG00001436980.
DR   EnsemblGenomes-Gn; EBG00001436981.
DR   EnsemblGenomes-Gn; EBG00001436982.
DR   EnsemblGenomes-Gn; EBG00001436983.
DR   EnsemblGenomes-Gn; EBG00001436984.
DR   EnsemblGenomes-Gn; EBG00001436985.
DR   EnsemblGenomes-Gn; EBG00001436986.
DR   EnsemblGenomes-Gn; EBG00001436987.
DR   EnsemblGenomes-Gn; EBG00001436988.
DR   EnsemblGenomes-Tr; BMULJ_03313.
DR   EnsemblGenomes-Tr; BMULJ_03478.
DR   EnsemblGenomes-Tr; BMULJ_03704-1.
DR   EnsemblGenomes-Tr; BMULJ_03719.
DR   EnsemblGenomes-Tr; BMULJ_03722.
DR   EnsemblGenomes-Tr; BMULJ_03728.
DR   EnsemblGenomes-Tr; BMULJ_03741.
DR   EnsemblGenomes-Tr; BMULJ_03743.
DR   EnsemblGenomes-Tr; BMULJ_03744.
DR   EnsemblGenomes-Tr; BMULJ_03746.
DR   EnsemblGenomes-Tr; BMULJ_03749.
DR   EnsemblGenomes-Tr; BMULJ_03780.
DR   EnsemblGenomes-Tr; BMULJ_03782.
DR   EnsemblGenomes-Tr; BMULJ_03793.
DR   EnsemblGenomes-Tr; BMULJ_03919-1.
DR   EnsemblGenomes-Tr; BMULJ_04056.
DR   EnsemblGenomes-Tr; BMULJ_04057.
DR   EnsemblGenomes-Tr; BMULJ_04310.
DR   EnsemblGenomes-Tr; BMULJ_04311.
DR   EnsemblGenomes-Tr; BMULJ_04446.
DR   EnsemblGenomes-Tr; BMULJ_04448.
DR   EnsemblGenomes-Tr; BMULJ_04475.
DR   EnsemblGenomes-Tr; BMULJ_04476.
DR   EnsemblGenomes-Tr; BMULJ_04611.
DR   EnsemblGenomes-Tr; BMULJ_04691.
DR   EnsemblGenomes-Tr; BMULJ_04697.
DR   EnsemblGenomes-Tr; BMULJ_04699.
DR   EnsemblGenomes-Tr; BMULJ_04879-1.
DR   EnsemblGenomes-Tr; BMULJ_04993.
DR   EnsemblGenomes-Tr; BMULJ_04995.
DR   EnsemblGenomes-Tr; BMULJ_05088-1.
DR   EnsemblGenomes-Tr; BMULJ_05089-1.
DR   EnsemblGenomes-Tr; BMULJ_05094-1.
DR   EnsemblGenomes-Tr; BMULJ_05095-1.
DR   EnsemblGenomes-Tr; BMULJ_05096-1.
DR   EnsemblGenomes-Tr; BMULJ_05174.
DR   EnsemblGenomes-Tr; BMULJ_05346.
DR   EnsemblGenomes-Tr; EBT00001814629.
DR   EnsemblGenomes-Tr; EBT00001814630.
DR   EnsemblGenomes-Tr; EBT00001814631.
DR   EnsemblGenomes-Tr; EBT00001814632.
DR   EnsemblGenomes-Tr; EBT00001814633.
DR   EnsemblGenomes-Tr; EBT00001814634.
DR   EnsemblGenomes-Tr; EBT00001814635.
DR   EnsemblGenomes-Tr; EBT00001814636.
DR   EnsemblGenomes-Tr; EBT00001814637.
DR   EnsemblGenomes-Tr; EBT00001814638.
DR   EnsemblGenomes-Tr; EBT00001814639.
DR   EuropePMC; PMC2704722; 19429613.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; AP009386.
DR   SILVA-SSU; AP009386.
DR   StrainInfo; 39670; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2473162
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /chromosome="2"
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395019"
FT   CDS_pept        1..1182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="BMULJ_03196"
FT                   /product="SMC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03196"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45070"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIJ8"
FT                   /protein_id="BAG45070.1"
FT                   /translation="MTVDEMRQSIREELESMRAAGARRQELSLHACKRLFFDLGIRPSA
FT                   ANVRDLTQTGSASDIPKDIDHFWERIRSASKVRLEGAAIPKSVEEKAGALIGALYEEAL
FT                   KAARDGLDVDRQQVRAEMAAAEQRLRDATVRQETLEAALARSEARNEQLQARVTELEVQ
FT                   LASQTTHGSANEVTLRATVARLETELAAAHGRVNTEQTLNATLRDRIDELQAELQHRTE
FT                   HYAQQIKDAVAEAERRVKPMLVELDSLRSMASTYQSGLRDVQRKEFDFLQQLSAAKARA
FT                   DRLEEQLRTQSDELERATRDVNALRANRTMSPEIATLIRRLADAGHLDADAFAAIGTAL
FT                   DHDVPVPSQCPHCDGEPELSHTDDGFEVSCPECEHASGSWPSRLEAVTRFARR"
FT   CDS_pept        complement(1323..2336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03197"
FT                   /product="tyrosine recombinase"
FT                   /note="COG0582: Integrase, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03197"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45071"
FT                   /db_xref="GOA:A0A0H3KN99"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KN99"
FT                   /protein_id="BAG45071.1"
FT                   /translation="MSLPTPAAPPARAEEKDLFDRGASDWIVSPEAAFDAWLAMQDYRR
FT                   SSADVYRAQWGAFLTWLRARQKNLATVDTASIAEFVGELPIRKTQRLRYLRLIERVLDH
FT                   IRRTEFASTNPARFIAQDGEADWRKARDNEPTSFLTPAERAKLLAYLFSPIGVSGAAYW
FT                   KERRDRALVAAFLGAGIKTGEARVLTISCVNTSGTSLRIPSTHPDFARDAHLASFAIAL
FT                   FDAWLAERSRQQIPGDLVFPASHTGRPMHKATMLRAIDAIVESAGLTSSRTARTSPQTL
FT                   RNTYAAELFEHDVPPERVGKWLGFVQPISANRLHRAWKTWRAELVEGDAAGSGETH"
FT   CDS_pept        complement(2443..2829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03198"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03198"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45072"
FT                   /db_xref="GOA:A0A0H3KJ43"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ43"
FT                   /protein_id="BAG45072.1"
FT                   /translation="MTEEQDLAALSFKAAAHDLEHIVRHIAARYIRQRVPLTWRLLHAI
FT                   EAEALADLGFASRHDAGMRQLFERPADMTFPETDDPIDFGRSNALPAVFSFAVLAYEAA
FT                   ARAESEASTRRDRTPSARQQAWGD"
FT   CDS_pept        complement(2955..3566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03199"
FT                   /product="XRE family transcriptional regulator"
FT                   /note="COG1396: Predicted transcriptional regulators,
FT                   Ralstonia solanacearum"
FT                   /note="contains cupin sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03199"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45073"
FT                   /db_xref="GOA:A0A0H3KSI6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSI6"
FT                   /protein_id="BAG45073.1"
FT                   /translation="MASSSGSRRTTAGAAPQPPAATPPRVGEQIQRLRNERKLTLDDLS
FT                   RAAGVSKSMLSEIERDKANPTIAVAWRLTNALGITLDELFSQPKAPEAIRVDGPHDIPT
FT                   LAGHDGQYQLRVWGPIDLAGKFEWYELTLPGGGALVSNAHEPGTREHLTVLQGTMEIEA
FT                   GAASRRLKAGDTGRYAADTPHAIRNPGKAEARALLIVIHR"
FT   CDS_pept        3732..4931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="BMULJ_03200"
FT                   /product="glycine C-acetyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /note="COG0156: 7-keto-8-aminopelargonate synthetase and
FT                   related enzymes, Salmonella typhimurium LT2"
FT                   /note="KEGG, K00639"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45074"
FT                   /db_xref="GOA:A0A0H3KIQ2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIQ2"
FT                   /protein_id="BAG45074.1"
FT                   /translation="MRDAFLAQVRGTLDQIRADGFYKTEREIASPQAAAVRLAGGAGVL
FT                   NFCANNYLGLANDPRLIEAAKAGLDQDGFGMASVRFICGTQTVHKQLESALAAFLGTED
FT                   SILYSSCFDANGGLFETLLDENDAVISDELNHASIIDGIRLCKAKRYRYRNNDLADLEA
FT                   KLKEADAAGARHKLIATDGVFSMDGIIADLKGICDLADRYGALVMVDDSHAVGFIGAHG
FT                   RGTPEHCGVEGRVDIITGTLGKALGGASGGYVAARPEIVDLLRQRSRPYLFSNTLTPSI
FT                   AAASLKVLELLGSDEGAQLRERVRENGVRFREQMTEAGFTLVPGAHPIIPVMLGDAQLA
FT                   SNMADKLLGEGVYVIGFSFPVVPRGRARIRTQMSAAHTPEQIDQAVAAFVRVGKSLGIV
FT                   "
FT   CDS_pept        4945..5973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="BMULJ_03201"
FT                   /product="threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="COG1063: Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases, Salmonella typhimurium LT2"
FT                   /note="KEGG, K00060"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03201"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45075"
FT                   /db_xref="GOA:A9AR24"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AR24"
FT                   /protein_id="BAG45075.1"
FT                   /translation="MKALAKLERAPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIW
FT                   KWDDWAQKTIPVPMHVGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAGRR
FT                   HLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNLV
FT                   GEDVLITGAGPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVARESLRD
FT                   VMADLRMTEGFDVGLEMSGVPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFKGL
FT                   EIKGIYGREMFETWYKMVAMLQSGLDLSPIITHRFAADDYEKGFAAMLSGESGKVILDW
FT                   TV"
FT   CDS_pept        6673..7299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03202"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator, Nostoc sp. PCC
FT                   7120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03202"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45076"
FT                   /db_xref="GOA:A0A0H3KIK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIK2"
FT                   /protein_id="BAG45076.1"
FT                   /translation="MNPQIDPSVEPADSGVRERLLDAAEALIYSGGIHATGVDAIVKRS
FT                   GAARKSFYSHFESKEALVVAALERRDARWMRWFVDATLARGKSPRAQLLVMFDVLRVWF
FT                   AQPDFHGCAFLNTSGEIADADDPVRVVAREHKARLLAFVRERLDAYADVAGIERRTLAR
FT                   LARQWLVLIDGAIGVALVSGNAGAARDARATAELLLDAALRPSTS"
FT   CDS_pept        7353..7832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03203"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3558: Uncharacterized protein conserved in
FT                   bacteria, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03203"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45077"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNA9"
FT                   /protein_id="BAG45077.1"
FT                   /translation="MSDSVEVRPPVPPFTLETARQKVRAAEDAWNTRDPQRVSLAYTPQ
FT                   SRWRNRAEFVTGREAIVGLLQRKWTRELDYRLIKELWAFGGNRIAVRFAYEWHDDAGNW
FT                   FRSYGNENWEFDENGLMAHRHASINDLPIREADRLFRWPLGRRPDDHPGLSDLGL"
FT   CDS_pept        complement(8371..9456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuC"
FT                   /locus_tag="BMULJ_03204"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="COG0473: Isocitrate/isopropylmalate dehydrogenase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00056"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03204"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45078"
FT                   /db_xref="GOA:A0A0H3KJ47"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ47"
FT                   /protein_id="BAG45078.1"
FT                   /translation="MSDRIYNIAVIPGDGIGREVMPEGLRALDAVTARFGIRFQFTHID
FT                   WASCDYYAQHGKMMPDDWKAQLSGMDAILFGAVGWPATVPDHVSLWGSLLKFRREFDQY
FT                   INLRPARLFDGVPSPLAGRRAGDIDFMIVRENTEGEYSSVGGTMFEGTEREVVMQQAIF
FT                   TRHGTERVLKFAFELAQRRAKQLTVATKSNGIAISMPWWDARAAEMAERYPDVAWDKQH
FT                   IDILCARFVLQPDRFDVVVASNLFGDILSDLGPACTGTIGIAPSGNLNPDRTFPSLFEP
FT                   VHGSAPDIAGQFIANPIAMIWSAAMMLDFLGNGAGRERDAHDAIVAAIEDVLRNGPRTR
FT                   DLGGQAATQEVGEAIAARIAG"
FT   CDS_pept        9578..10501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03205"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Escherichia coli
FT                   K12"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03205"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45079"
FT                   /db_xref="GOA:A0A0H3KSJ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSJ0"
FT                   /protein_id="BAG45079.1"
FT                   /translation="MNKSPNLEDLRVFSLVVRLASFSAAAEQLAVSPAYVSKRIAMLET
FT                   QLGTRLLHRSTRRVTVTEAGERVFAHAEKILDDVDHLVEDVSTTRTVPRGTLRISSSFG
FT                   FGRHVVAPALLDFSARYPQLNVRLDLFDRLVDVAAEGYDLDVRIGDEIADHLIARRLAA
FT                   NYRVLCASPDYLARRGMPRTLADLASHDCLAIKERDHPFGVWRLNVRGDTVTVKVGGAL
FT                   STNHGEVAVQWALAGRGIVLRSIWEAGPLIDSGALCRVLPDAVQPANIWAVYTERVAAS
FT                   AKVRVCVDFLAQALAGLNADSAAGAA"
FT   CDS_pept        complement(10820..11254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03206"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45080"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIQ7"
FT                   /protein_id="BAG45080.1"
FT                   /translation="MPTFPHFPIRALTIAASFAAAVACSAPAFAQTSNVPTSTAAATPD
FT                   NAILLTVFLKHDQSRPLAELNAQLAKQGFYKAFPPPGIEVVSWTVTMGIGQIIVLRLPA
FT                   SRLREVNRVLEDTAWGAYRTEFYPTYDYKAIGLAEHDRAK"
FT   CDS_pept        complement(11926..12390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03207"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45081"
FT                   /db_xref="GOA:A0A0H3KIK7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIK7"
FT                   /protein_id="BAG45081.1"
FT                   /translation="MPIFIALFALIAVGWGAVHTFHVIAAQFGRPIAIAAAVLAAALLF
FT                   ALIAWWIKRRRDVAPNTKEQGWTHTMHRAWGELRVSATQGLLWLSHDGADGRYTLSQLE
FT                   GCEAAPIDGRWHLVVRVHDGARGEWKLPMMDKRDAQRWARVLTLAKDNRL"
FT   CDS_pept        complement(12451..13668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03208"
FT                   /product="patatin-like phospholipase"
FT                   /note="COG1752: Predicted esterase of the alpha-beta
FT                   hydrolase superfamily, Ralstonia solanacearum"
FT                   /note="KEGG, K07001"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03208"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45082"
FT                   /db_xref="GOA:A0A0H3KNC5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNC5"
FT                   /protein_id="BAG45082.1"
FT                   /translation="MKPHARTEKQAVDAAELQHEAGAPAAARSLPYETIALVLQGGGAL
FT                   GAYQAGVFEGLHEAGIPLDWIAGISIGALNTALIAGNAPEHRVERLREFWETICQPAFF
FT                   PAIPAAFEFALFNSIDQIRTFFTATQAASAMMQGQQGFFVPRFPPPLPGVSDHPQKISW
FT                   YDTSALRATLLKLCDFDRINSGETRVSVGAVNVGTGNFVYFDNSRIRLLPEHFMASGAL
FT                   PPAFPPVEIDGEYYWDGGVVSNTPLMEVLRAHPRRDTLAFQVDLWSARGPLPRTMADVA
FT                   ERTKDVQYSSRTRFVTDTLQREQRYRNVLRHVLDQVPEERRKTDPWCIEAEAMSNGKKY
FT                   NIQHLIYQQKAYEHHYKDYQFGLSTMRDHWSAGLDDIRKTLAVKDGLALPTNDAGFITH
FT                   DIHRRR"
FT   CDS_pept        complement(13665..14450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdh"
FT                   /locus_tag="BMULJ_03209"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases), Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00019"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03209"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45083"
FT                   /db_xref="GOA:A0A0H3KJ53"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ53"
FT                   /protein_id="BAG45083.1"
FT                   /translation="MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNLDGANA
FT                   VADEINKAGGKAIGVAMDVTNEEAVNTGIDKVAETFGSVDILVSNAGIQIVNPIENYSF
FT                   ADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGL
FT                   LGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGNTV
FT                   DGVFTTVQDVAQTVLFLSAFPSAALTGQSFVVSHGWFMQ"
FT   CDS_pept        complement(14501..15241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adc"
FT                   /locus_tag="BMULJ_03210"
FT                   /product="acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /note="COG4689: Acetoacetate decarboxylase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01574"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45084"
FT                   /db_xref="GOA:A9AR15"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AR15"
FT                   /protein_id="BAG45084.1"
FT                   /translation="MKISDVRSKAFAMPLTSPAFPMGPYRFVDREFLIITYRTDPDRLR
FT                   EIVPEPLKVTEPLVHYEFIRMADSTGFGDYTESGQVIPVEYNGQPGGYTLAMYLDDHPP
FT                   IAGGRELWGFPKKLASPTLHVNTDHILGTLDYGKVRVATGTMGYKHKELDIVEQAKRLA
FT                   GPNFLLKIIPHVDGTARVCELVRYYMQDIVMKGAWTGPASLELSPHALAPVADLPVLEI
FT                   VEARHLVADLTLGLGEVVYDYLAQ"
FT   CDS_pept        15677..16258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03211"
FT                   /product="membrane-associated phospholipid phosphatase"
FT                   /note="COG0671: Membrane-associated phospholipid
FT                   phosphatase, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03211"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45085"
FT                   /db_xref="GOA:A0A0H3KSJ5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSJ5"
FT                   /protein_id="BAG45085.1"
FT                   /translation="MHNINLTLFSALNAGHAPNAGVARLAIFAADWVVYALPAMLLLTW
FT                   LFGERTTRRQAIEAGVGACVALLLAQAIGHLWFSPRPFMTGVGTQLIPHAPDSSFPSDH
FT                   MTFAWSVAAGMLLGSTTRVTGWVMAALALAIAWGRIYAGVHWPFDMAGGVLVGTAGALA
FT                   AHLYARRAVDTLDRIGDAVHAVIMGRQPAP"
FT   CDS_pept        complement(16315..16539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03212"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45086"
FT                   /db_xref="GOA:A0A0H3KIR2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIR2"
FT                   /protein_id="BAG45086.1"
FT                   /translation="MTKENHAAPFVRHLKIVGYCGLAAVVLALFVAMCAILKESALERD
FT                   AVAQQSTDTTELHGTTGPSATAEAAKTPG"
FT   CDS_pept        complement(16712..17524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03213"
FT                   /product="putative siderophore-interacting protein"
FT                   /note="COG2375: Siderophore-interacting protein,
FT                   Deinococcus radiodurans"
FT                   /note="KEGG, K07229"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03213"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45087"
FT                   /db_xref="GOA:A0A0H3KIL3"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIL3"
FT                   /protein_id="BAG45087.1"
FT                   /translation="MNTTLADRTVTRVRHTLKFRLLQVLRVHAVTPHLLRVTLGGPDLA
FT                   DFESSSFDDHVKVFFPAPGTERPALPTLGANGPEFPEGEPRPVARDFTPRRFDRAACEL
FT                   DLEFVMNHPGPASQWAAQARPGQWLGIGGPRGSFVVPTGFDWHLLIGDDTALPAVARRI
FT                   EELPAGARVAVVLEVADRSAKIAFDARADVHEIWRFRDEGNDDALLDAVRDLPLPDGDG
FT                   YVWAAGEALAIRAVRAHLTGERGIDKSRIRASAYWKRGATAVHETLDD"
FT   CDS_pept        complement(17559..18311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03214"
FT                   /product="PadR-like family transcriptional regulator"
FT                   /note="COG1695: Predicted transcriptional regulators,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03214"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45088"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNC9"
FT                   /protein_id="BAG45088.1"
FT                   /translation="MRHHSFNGHARCAGRDAHIRHDWLAGLWHAIGRHRRGHDPFGGGP
FT                   FGGPGGPGGPGGRGGRGGFGDFGDDGMPRGRQFTSDDLQLLLLALLAEQPSHGYELIKA
FT                   LDTRSSGFYSPSPGMVYPALTYLEEVGYVASQAEGNRKRYALTDAGRTHLDAQRERVDT
FT                   LFARLTHLARKMEFMRRAFAGEASGAGASGAAAQDEAQAGWLPEFVDARVALKHALLHK
FT                   SAASPDEQRRIAAILRRAIAEIEGRSDV"
FT   CDS_pept        18514..19170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03215"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ59"
FT                   /protein_id="BAG45089.1"
FT                   /translation="MNRTDKSSKARAALDQLFSDVPPAGGEGAARPGDPFAPVSGDSGR
FT                   GSRVDVTVSTRIQLRGYPSADAFMKRMAQAWGLTWGLYDAVRAVATLPAGWRVRELPGI
FT                   TQIVDARGVLRAESSLQGGEMSYLKVHPRYYIDARKGSGWGQSSRASDDPDLDGPDWRC
FT                   LVIDRETSGDVHEITSAPFKADLDKARATLLKWLDEHYPEHRDPFAYWSDCESAA"
FT   CDS_pept        complement(19246..19968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="BMULJ_03216"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K00065"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03216"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45090"
FT                   /db_xref="GOA:A0A0H3KSJ9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSJ9"
FT                   /protein_id="BAG45090.1"
FT                   /translation="MSQAQTFERKTVVVTGGTSGIGAHTALRFAKAGASVVSIGLQAAG
FT                   PHAPVHERIRHVELDVADSDALTRMIGALPRIDVLVNGVGISRHADEYRMDEFEHVLNV
FT                   NLTSVMRASDAARPALSVDGGAIVNIASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAW
FT                   ADRGIRVNAVAPGWIDTPLSSALMADAQASRRILERTPLGRWGKPDEVADVILFLCSPG
FT                   ASFVTGAIVPVDGGYSTV"
FT   CDS_pept        complement(19946..21067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gutB"
FT                   /locus_tag="BMULJ_03217"
FT                   /product="L-iditol 2-dehydrogenase"
FT                   /EC_number="1.1.1.14"
FT                   /note="COG1063: Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases, Pseudomonas aeruginosa"
FT                   /note="KEGG, K00008"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03217"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45091"
FT                   /db_xref="GOA:A0A0H3KIR6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIR6"
FT                   /protein_id="BAG45091.1"
FT                   /translation="MRALQWHGPRDVRLVDIDTPRVGPGEVRIAVAYCGICGSDLHEYA
FT                   DGPHAIPVDAPHPLSGRTAPLTLGHEFCGTVVEVGAGVTTLRAGDRVAVEPEYRCQRCA
FT                   YCRAGSYNLCVSMGFAGLMGDGGMADFAVVPAYMLHRLPEGVTLEQAAVLEPAAVALHA
FT                   LRRGELRLGNTCAVFGLGPIGLLLIMLAKLQGATTIVAVDVSPQRLAAAKRFGATRAFD
FT                   ARSLDAAALRDAIRAETGGLGVDVAFEAAGLPATFEAAMHALRKGGRVVMVGLMPHAGF
FT                   DAFRAVNDELTFTASVGYRHAYDDLLRIVASGVLDPASIVTRTVALEHAIADGFDALLA
FT                   DRTQIKVLVSPALGASRRTYASGSIEHEPSADV"
FT   CDS_pept        complement(21069..22379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03218"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03218"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45092"
FT                   /db_xref="GOA:A0A0H3KIL7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIL7"
FT                   /protein_id="BAG45092.1"
FT                   /translation="MLFRSFPRPAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMAAE
FT                   LHLTNAQLGMVSSALALTWALSGAVTGAWSDARGTRKPLLIAAVLGFSVCSALSGFVGG
FT                   FASLIAFRALMGIAEGPVLPLSQSLMIESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVV
FT                   IGIASAAGWREAFYVSCIPGIAIAFCIWRWVRETPPGGAIDARADACSATKDTAKGATV
FT                   SRWALLKARNVLLCVLISCFFLTWFVVVISFAPTFLVSSRHFSASDMGVVMTCLGAAWV
FT                   FWGFAVPAISDRIGRKPTMIVFALIAALCPLAMIHIASLWALCALVFATYTGLGCFTLF
FT                   MATIPAETVPPGAVASALGLIMGAGELIGGFVAPTVAGFAADRFGLSFAMEMSAAGALV
FT                   AGLLSIGLVETAPAVLRRRALASAAARRFDTQNLGGR"
FT   CDS_pept        complement(22398..22931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03219"
FT                   /product="2,4'-dihydroxyacetophenone dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03219"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45093"
FT                   /db_xref="GOA:A0A0H3KND4"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KND4"
FT                   /protein_id="BAG45093.1"
FT                   /translation="MVDKAVAEFWQNIAPIANPFKPDALPEAYIPNAASDDERYYVPFT
FT                   ETVSSRPLWISPTQNKWCDILMAKQAGLVNRHYHPHEVFAYTISGKWGYLEHEWTATRG
FT                   DFVYETPGEGHTLVAFDHPEPMRAFFIVKGPLIWLDDEGNPDGYFDVHSYIAMCKAHYE
FT                   KVGLGAHAVEKLFR"
FT   CDS_pept        23105..24085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03220"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45094"
FT                   /db_xref="GOA:A0A0H3KJ63"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ63"
FT                   /protein_id="BAG45094.1"
FT                   /translation="MTQSTVLSRTRGSTADVPVRDRMAYWDAFNAATLVGLRCSSLSPA
FT                   GLDVEKTDIALPGLGLTDISGQDHVIERSPALVRQLPKESLFACQILRGRAYFIQRDRC
FT                   LLAEAGDIVVYDTRVPYLFGFLTPMRQLLVDVPIAMVDGRLDAELAALPLRIAPRPGAG
FT                   AMLGATLRTNVERFMQDPVEGEATRFADYTRQLVVELIDVEVNGAHASRASLSYLLTAK
FT                   QYIATHLGEPELAPQAVADAVGLSLRHLSRLFAAEGESITQHIWSERLSHAYRDLTDAR
FT                   LRKTSVGEIAFRWGFSSHAHFSRAIRDRYGASPMALRDAVPSGER"
FT   CDS_pept        complement(24148..25095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03221"
FT                   /product="NADP-dependent aryl-alcohol dehydrogenase"
FT                   /EC_number="1.1.1.91"
FT                   /note="COG0667: Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases), Pseudomonas aeruginosa"
FT                   /note="KEGG, K05882"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03221"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45095"
FT                   /db_xref="GOA:A0A0H3KSK5"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSK5"
FT                   /protein_id="BAG45095.1"
FT                   /translation="MALRTLGTSSIQVSPLAFGGNVFGWTVDENASFSLLDALADTGIN
FT                   FIDTADVYSAWAPGNRGGESETIIGKWLKRTGKREQVVIATKVGMLEARAGLSKDNILK
FT                   AADDSLRRLQTDYIDLYFSHRDLPETAPLEETLAAYQALIDAGKVRIIGASNYSGARLR
FT                   EAAEISRRDGLPTYQVIQPEYNLYDRAEYERDLEPVVRDLKLGVVNYYALASGFLSGKY
FT                   RSEADLKKSVRGSRVAGYLDARGLRILAALDAVSAKHGTQPAAIALAWQIARPTITAPI
FT                   ASATSLAQLALLGDALRVQLDQDDIRQIDEASAV"
FT   CDS_pept        complement(25390..26010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03222"
FT                   /product="putative LysE family lysine efflux permease"
FT                   /note="COG1279: Lysine efflux permease, Brucella
FT                   melitensis"
FT                   /note="KEGG, K06895"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03222"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45096"
FT                   /db_xref="GOA:A0A0H3KIS0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIS0"
FT                   /protein_id="BAG45096.1"
FT                   /translation="MNWLAFSHGAALCASLIVTIGAQNAFVLRQGIMRSHVGKIVLLCA
FT                   LSDMILIAAGVGGASALVERYPTFVHAVLYVGLAYLAWFGFNALRRAFKPGHETLDVRG
FT                   DAVAPPPQSALAIVLMTLAFTWLNPHVYLDTFLLIGTAGAREPEGARLAFAIGAMSVSI
FT                   VWFIGLGYGARLLAPWFRKAVAWRVLDGAIGSMVLFLAAVQLR"
FT   CDS_pept        26110..27003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iciA"
FT                   /locus_tag="BMULJ_03223"
FT                   /product="LysR family chromosome initiation inhibitor"
FT                   /note="COG0583: Transcriptional regulator, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /note="KEGG, K05596"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03223"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45097"
FT                   /db_xref="GOA:A0A0H3KIM1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIM1"
FT                   /protein_id="BAG45097.1"
FT                   /translation="MLDYALLDALAAVIRHGSFERAAKELNVTPSAVSQRVKLLEERVG
FT                   SVLVKRGQPCVATTSGALLCRHTERVQLLEAELSGRMPALPGPLASTWPTLRVAVNDDS
FT                   VATWFVDAVAPFCAERETLLDLVIDDQDYTAERIRDGSVQGAVTAQAEPIQGCRSTRLG
FT                   RIRYRAVCSPAFHARYFGAGITRDALRRAPCVMFNPKDGLQARFIRRVTRADLDPPQHW
FT                   IPHVAGYLRACETGLGWGMCPDRMVDRQLAAGELVDMSAGRTVDIELYWQSWRLSIGWL
FT                   DDFSAALKARAALFLD"
FT   CDS_pept        complement(27073..27819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnr"
FT                   /locus_tag="BMULJ_03224"
FT                   /product="CRP/FNR family anaerobic regulatory protein"
FT                   /note="COG0664: cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases, Neisseria meningitidis Z2491"
FT                   /note="KEGG, K01420"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03224"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45098"
FT                   /db_xref="GOA:A0A0H3KNE0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNE0"
FT                   /protein_id="BAG45098.1"
FT                   /translation="MLTPVATRPAATPQANGWAPRQAAHCSSCAMRHLCMPQGLAPEAL
FT                   SRLEAVICAARPVKRGEALFREGDAFDNLYAVRSGSLKTVATRHDGREQVTGLHLAGEA
FT                   LGLDGICDDTHPRTAIALEDSSVCVIPYAALKALCSEAGSMQLRMHKLMSEQIVRETSQ
FT                   AMLLGSLNAEERVAAFLLDVSSRYLKRGYSPSEFNLRMTREDIGSYLGMTLETVSRTLS
FT                   KFQKRGLIEMRGRLVQIVDFDGLHHV"
FT   CDS_pept        complement(28037..28513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="BMULJ_03225"
FT                   /product="UspA family universal stress protein"
FT                   /note="COG0589: Universal stress protein UspA and related
FT                   nucleotide-binding proteins, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03225"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45099"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ67"
FT                   /protein_id="BAG45099.1"
FT                   /translation="MYKRILVAVDGSDTSRHAFEAALALAKAHGAELQALYVVENAAIY
FT                   YNVPGYDPSVLRDQLLAQGGDLAKEFTAQMQAAGVKGETVTNEASSFNDVSTLILEGAK
FT                   AFGAELLVLGTHGRRGFRRLVLGSIAEQCVRHASLPVLLIPAAAHADADAGASA"
FT   CDS_pept        complement(28849..29259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03226"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45100"
FT                   /db_xref="InterPro:IPR021551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSL0"
FT                   /protein_id="BAG45100.1"
FT                   /translation="MASSTPNRPVRPRSIELDNDDTLDSTVDTDGKHREAARLAGGGPF
FT                   SPDQITRSNASLVDAMPEAGDGLAGFDSRPGGNHPAFALRAGYVLVEKGFDAPAAVGDD
FT                   MFGAVHRMYGSVYGPGHDRRPGRVIELAPADR"
FT   CDS_pept        29538..29771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03227"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIS4"
FT                   /protein_id="BAG45101.1"
FT                   /translation="MQATTAFTHRGYLLNCAPARTSDGSFKPYVVISRSSDGELVANRF
FT                   FPSDLQFNDEDAAIAHARDWAVRWIDASSITM"
FT   CDS_pept        29908..30828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BMULJ_03228"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG, K00640"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03228"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45102"
FT                   /db_xref="GOA:A0A0H3KIM6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIM6"
FT                   /protein_id="BAG45102.1"
FT                   /translation="MSTSPVRQWGLEEIVAGLRESREERHRTRHPRGIRELPSRDAICK
FT                   IVTGLRASMFPTHYGAPDLTDESVDYYVGHTLESTLRILSEQIRRALPFLPEHADTPPA
FT                   ALEERAFEIAREFGRQLPAIRALLVSDIQAAYAGDPAAQHITEILLCYPGVLAMMHHRL
FT                   AHALHRLGVPLLARFINEIAHSATGIDIHPGAQIGPSFFIDHGTGVVIGETAIIGERVR
FT                   VYQAVTLGAKSFPADGDGALVKGNARHPIVEDDVVIYAGATILGRVTIGRGSVIGGNVW
FT                   LTHSVPPGTSVAQGKVREGERAEKP"
FT   CDS_pept        complement(30989..31792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03229"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03229"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45103"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNE6"
FT                   /protein_id="BAG45103.1"
FT                   /translation="MQSTKQAADAPVVLVTGAARRAGRAFAEYFAAHGYRTAVHYDRSA
FT                   DAAEAAARAIAERGPDSVALQADLSDEAQIASLIDAVYARFGRLDVLVNNASVFWQDHF
FT                   PSFDLAAFDHAWTVNCRAPILLTRAFYERARAAGTQGVVVNVVDQKIKENFHRDHFSYT
FT                   VAKAALGNLTQMLALSAAPVLRVNAVFPGLMLPSDDQTQADFEHASRASTPLARIAGPD
FT                   DVASAILLLTGSAYNGVDFVVDAGQNLIRVDQDVLYKHRSPSSRH"
FT   CDS_pept        complement(31793..32422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BMULJ_03230"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="COG0302: GTP cyclohydrolase I, Xylella fastidiosa
FT                   9a5c"
FT                   /note="KEGG, K01495"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45104"
FT                   /db_xref="GOA:A0A0H3KJ71"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ71"
FT                   /protein_id="BAG45104.1"
FT                   /translation="MGKKTARSEPAASRPSREEAEDAVRVLLRWAGDDPTREGLIDTPA
FT                   RVVRAYEQFFAGYSIEPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHV
FT                   AYLPNHRVVGISKLARLVDAFAKRLQIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCI
FT                   STRGVHKPGVEMVTSRMLGTFRTDPSTRREFLSIVANPSSVNLTNT"
FT   CDS_pept        complement(32512..33438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaR"
FT                   /locus_tag="BMULJ_03231"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /note="PcaR protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03231"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45105"
FT                   /db_xref="GOA:A0A0H3KSL4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSL4"
FT                   /protein_id="BAG45105.1"
FT                   /translation="MDALDLNLIPYLVALDDTRNVSRAGELLGVSQPRVSTALGRLRAY
FT                   FGDPLFVRTSRGMEPTPRALALLPAARDALAQIERGLVAPHDFDPAASTHTFSIALSDV
FT                   GEIVFLPKLLQAFAQCAPHANLRSVSLPHDEVGRGLEAGSIDLAVGYFPDLDGNNFFQQ
FT                   RLFTHRFVCLMRRGHPLEQARPFTVEQFLESGHAVVRAEGRSQEVLEKYLAKQRMQRRA
FT                   VLETPHFMSLPFILSRTDLIATVPHAIGYAYAAEHAFIVPVEPPLPLPRFDLKQHWHRK
FT                   FHNDPRTAWLRGVVASLFNDEQDEWPK"
FT   CDS_pept        33600..34832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="BMULJ_03232"
FT                   /product="p-hydroxybenzoate 3-monooxygenase"
FT                   /EC_number="1.14.13.2"
FT                   /note="COG0654: 2-polyprenyl-6-methoxyphenol hydroxylase
FT                   and related FAD-dependent oxidoreductases, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00481"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03232"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45106"
FT                   /db_xref="GOA:A0A0H3KIS8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIS8"
FT                   /protein_id="BAG45106.1"
FT                   /translation="MRTQVAIIGAGPAGLLLSHLLRLQGVESILLEARSREYCENRIRA
FT                   GVLEQGTVDTLNAAGLGDRMRREGLQHHGIELLFGGQRHRIDLSGLTGGRAITVYSQHE
FT                   VVRDLIAAGVEHGHPMHFDVTDVALHDVDGDRPFVTFKHADGRADRIDCDYIAGCDGFH
FT                   GIARQTIPAERLRTFERVYPFAWLGILADAAPSLDELVYAHHERGFALFSMRSPTVTRL
FT                   YLQCRPDEDLGAWSDARIWDELHTRFSNDTGWTPTEGRITQKSVTPMRSFVSETMQYGR
FT                   LFLAGDAAHIVPPTGAKGMNLAVADVRALSRALGARYRTGDATALDAYSATCLERVWRA
FT                   EHFSYFMTNMLHPSADDTPFVNRLKLAELKYVTRSRAAAQSLAENYVGLPFDDEAGPET
FT                   SRLDNALCATL"
FT   CDS_pept        34976..35689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaI"
FT                   /locus_tag="BMULJ_03233"
FT                   /product="3-oxoadipate CoA-transferase alpha subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="COG1788: Acyl CoA:acetate/3-ketoacid CoA
FT                   transferase, alpha subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K01031"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03233"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45107"
FT                   /db_xref="GOA:A0A0H3KIN1"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIN1"
FT                   /protein_id="BAG45107.1"
FT                   /translation="MVNKIFESLQSAVADVHDGATIMIGGFGTAGMPSELIDALIEQGA
FT                   RDLTIVNNNAGNGETGLAALLKAKRVRKIICSFPRQSDSQVFDALYRAGEIELELVPQG
FT                   NLAERIRAAGAGIGGFFTPTGYGTKLAEGKETRVIDGKPYVFETPIHADFALVKAYKGD
FT                   RWGNLVYRKTARNFGPIMASAAKVAIVQVSQVVPLGALNPEHIVTPGIFVQRIVEVPQA
FT                   AHAAELAAERASQAA"
FT   CDS_pept        35709..36362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaJ"
FT                   /locus_tag="BMULJ_03234"
FT                   /product="3-oxoadipate CoA-transferase beta subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="COG2057: Acyl CoA:acetate/3-ketoacid CoA
FT                   transferase, beta subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K01032"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03234"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45108"
FT                   /db_xref="GOA:A0A0H3KNF1"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNF1"
FT                   /protein_id="BAG45108.1"
FT                   /translation="MKRLTRDEMAKRVAQDIPEGAYVNLGIGVPTLVANHLDPSKEIFL
FT                   HSENGLLGMGPAPAPGEEDDELINAGKQHVTLLTGGAYFHHADSFAMMRGGHLDYCVLG
FT                   AFQVSANGDLANWHTGAPDAIPAVGGAMDLAIGAKQVFVMMEHLTKQGESKIVAQCSYP
FT                   VTGVQCVSRIYTDLAVLDVTSDGLAVSEIFTDLSFDELQKLTGVPLIDATRKAA"
FT   CDS_pept        36443..37798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BMULJ_03235"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="COG0015: Adenylosuccinate lyase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01756"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03235"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45109"
FT                   /db_xref="GOA:A0A0H3KJ79"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ79"
FT                   /protein_id="BAG45109.1"
FT                   /translation="MLEDSARLTSLICGIEPLNRIWSPRATVQRMLDVEAALARALAAQ
FT                   QVIPAAAVAPIERACVADRLDADALARDAALGGNLAIPLVKQLTAQVKADDAEAAKFVH
FT                   WGATSQDIIDTATVLQLRDTLDVLEPMLDDACASLATLARTHRATPMIGRTWLQQALPI
FT                   TLGLKFAQWLDALLRHRTRLAELRARALVLQFGGAAGTLASLRDRASGVSAALAKELEL
FT                   AAPAVPWHTQRDRIAEAAAWFGMLIGTLGKIARDISLQMQTEVGELSEPAAAGKGGSST
FT                   MPHKRNPVGCAAVLTAAVRAPGLVATVFAGMVQEHERALGGWQAEWDALPDLARLAGGA
FT                   LAQIAQIVAGLDVNAERLAANLDLTHGLILGEAVMLALGDRIGRLDAHHVVEHASKEAV
FT                   RTGATLFDVLAADATVSAHLSRDALAQLLDPAQYVGEAHAYVDAVLALHART"
FT   CDS_pept        37816..38601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="BMULJ_03236"
FT                   /product="3-oxoadipate enol lactonase"
FT                   /EC_number="3.1.1.24"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01055"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03236"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45110"
FT                   /db_xref="GOA:A0A0H3KSL9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSL9"
FT                   /protein_id="BAG45110.1"
FT                   /translation="MPFATVNGVKLHYRIDRAARDDAPWLVFSNSLGADLQMWAPQIRP
FT                   FTQHFNVLRYDTRGHGHSDAPAGSYTIDQLAGDVIGLLDHFGIAQASFCGISMGGLTGA
FT                   ALAARFPSRIVRAVLANTAAKIGSPEVWTPRAHKARTEGMAALADAVLPRWFTDAFVQR
FT                   EPRLFDAIRDTFVHTDKDGYAANCDALNAADLREEVKGIALPVLVVTGAHDLSTPPDQG
FT                   RALAAAIPGARHVEFDAAHISNIERTDDFNRALLDFLTA"
FT   CDS_pept        38612..38998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BMULJ_03237"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="COG0599: Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01607"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03237"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45111"
FT                   /db_xref="GOA:A0A0H3KIT3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIT3"
FT                   /protein_id="BAG45111.1"
FT                   /translation="MDDQQRYEAGMKVRRAVLGDAHVDRSIENRTEVTEEFQNLITRYA
FT                   WGEIWTRDGLPRHTRSLLTIAMMVALNRSEELALHLRAARNNGVTRDEIKEVLLQTAIY
FT                   CGVPAANSAFHLADRIFKEQDAAG"
FT   CDS_pept        39168..40526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaK"
FT                   /locus_tag="BMULJ_03238"
FT                   /product="4-hydroxybenzoate transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03238"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45112"
FT                   /db_xref="GOA:A0A0H3KIN4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIN4"
FT                   /protein_id="BAG45112.1"
FT                   /translation="MNRTAVVDVQTFINEQPFGGFQWLVFLMCFVIVLLDGFDTAAIGF
FT                   IAPSLLGEWNLTKPDLAPVLSAALFGLACGALVSGPLSDRLGRRVLLLGSVFLFGIACL
FT                   VSAFSTTIGHLTVLRFVTGVGLGAAMPNAVTMMGEFCPDKRRATVINLMFCGFPLGAAF
FT                   GGFLAAWMIPHFGWRSVLVLGGVTPLLLGVLLLLKMPESVRFMVAHGHPVDRIRATLAR
FT                   ISRDALNASAFAMTESAPQTGGKGLGVVLSRSYVIGSVMLWAAYFMGLVIFYASINWMP
FT                   ILLKDAGLTPKSATLISALFPLGGVGAVLCGVLMDRFNANRVIAVCYALTAVSVYAIGQ
FT                   AAGNVGLLVLVVFVAGVLMNTAQSSMPALAAAFYPTEGRGTGVAWMLGVGRFGGIAGSF
FT                   LVAELTRRHFSFAGVFATIAVAGLLACVALLIKQIARPHRTTPSTGTIEPIGH"
FT   CDS_pept        complement(40697..40945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03239"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNF7"
FT                   /protein_id="BAG45113.1"
FT                   /translation="MKPMLRAGERIEGMHWVAEYHPGTHDIRVLREDIEVGTYCAPPTL
FT                   FGDEEEMGAANLADHRCREAALRAYLRTFVKEHDAEE"
FT   CDS_pept        complement(41049..41666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03240"
FT                   /product="putative threonine efflux protein"
FT                   /note="COG1280: Putative threonine efflux protein,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45114"
FT                   /db_xref="GOA:A0A0H3KJ86"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ86"
FT                   /protein_id="BAG45114.1"
FT                   /translation="MEFLTLSALPAGMLFALVTSITPGPNNTMLLASGVNFGFRRTMPH
FT                   LFGISIGVAILMLCVGFGLGEAFKRVPLLYTILEVASVAYLLYLAWRIGTSGEVKAHGA
FT                   KPRPMTFIEAAAFQWVNPKAWMMVLTAATTIRLSADYGMNAAWMAVVFVLIGFPCISLW
FT                   AAFGLGLRRFLSNPRALRIFNVTMAVLLILSLYPLVAHVLPQ"
FT   CDS_pept        41901..42176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03241"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1937: Uncharacterized protein conserved in
FT                   bacteria, Agrobacterium tumefaciens strain C58"
FT                   /note="conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03241"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45115"
FT                   /db_xref="GOA:A0A0H3KSM4"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSM4"
FT                   /protein_id="BAG45115.1"
FT                   /translation="MSHTIKEKQKLLNRVRRIKGQVEAIERALEEERSCSEILQLITSG
FT                   RGAMNGLLAVVLEDHIRSHLVDADDTHADEGGATEQLVAVVRSYFK"
FT   CDS_pept        42188..43225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03242"
FT                   /product="CDF family cation efflux system protein"
FT                   /note="COG1230: Co/Zn/Cd efflux system component,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K03295"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03242"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45116"
FT                   /db_xref="GOA:A0A0H3KIT8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIT8"
FT                   /protein_id="BAG45116.1"
FT                   /translation="MSDFRNAAFGAGHDHIFLGAAHERNERRTWAVIALCAAMMVAEIV
FT                   GGSLFGSLALVADGLHMSTHAGAMLIAALAYTYARRHARDPRFVFGTGKLGDLAGFTSA
FT                   IVLAMIALLIGYEAVVRLLSPVPIHFGEAIPIAVVGLIVNIVSAWLLSGDHHHGHDHHG
FT                   HHHYHNHAHAHDHDHEHEHEHEHEHEHAHDAHTPSAATTRDHNLRSAYIHVIADAAVSL
FT                   LTIVGLLLARAFGWIWMDPLAGIVGALVIANWSYGLMRDTGGVLLDMNADRRLTERVRH
FT                   ALEHDGDTVADLHVWRVGPGHMSAIVSVTTDDPTRDARFYHGLLKHIGGLSHVTVEVLP
FT                   AAAGQ"
FT   CDS_pept        43222..43413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03243"
FT                   /product="predicted Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03243"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45117"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIN9"
FT                   /protein_id="BAG45117.1"
FT                   /translation="MTMAVRSPCVEVCTFDGRTGYCIACLRTRDEAREWKKMTDHRRHR
FT                   IVNDRARRQAKLARAASE"
FT   CDS_pept        complement(44117..44272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03244"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45118"
FT                   /db_xref="GOA:A0A0H3KNG3"
FT                   /db_xref="InterPro:IPR021738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNG3"
FT                   /protein_id="BAG45118.1"
FT                   /translation="MLGTIVIVILILLLIGAFPTWPHSQSWGYWPSGTLGLIVIIVVVL
FT                   VLLGRI"
FT   CDS_pept        44474..45148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03245"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="COG0406: Fructose-2,6-bisphosphatase, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03245"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45119"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ90"
FT                   /protein_id="BAG45119.1"
FT                   /translation="MAELYLVRHGQASFGTDDYDRLSDVGVQQGVWLGEYLARAHAPFD
FT                   RVICGTMTRHAQTVDAILRGMGRDDVAVERHPGLNEYDFHGLFAAAASDYPEIARLAAG
FT                   SMHEHFRALKQVLQLWTEDRLGPAAPESWAHFQQRVADARAAIRQSGGKRVLAVSSGGP
FT                   IAVTIQQVLAAPPTSAIALNLQIRNSSLSQFFFNAEAFHLASFNGIPHLEDPERQSFRT
FT                   YG"
FT   CDS_pept        45180..46211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03246"
FT                   /product="putative aminoglycoside phosphotransferase"
FT                   /note="COG3173: Predicted aminoglycoside
FT                   phosphotransferase, Mesorhizobium loti"
FT                   /note="KEGG, K06979"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03246"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45120"
FT                   /db_xref="GOA:A0A0H3KSM7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSM7"
FT                   /protein_id="BAG45120.1"
FT                   /translation="MTNTTQQLDVGRLARYLEQHVPGFEGPVEAEKFAGGQSNPTFLLT
FT                   AKSGRYVLRRQPPGELLKSAHAVDREFRVLSALSRTAVPVARPYHLCEDRDVIGSLFYV
FT                   MSYEDGRIFWNPALPELPQADRAACYDAVLRTMAALHDVDVDAVGLGDYGRPGNYFERQ
FT                   IGVWTKQYRAAETERLDAMETLIDWLPRACPDDTGRPALVHGDFRLDNLMFERDDYRVK
FT                   AVLDWELSTLGNPLADLAYFCMCLRLPADGHIPGLARQDRAALGVPDEAQIVARYCALR
FT                   GIEPIRDWHFYLAFSFFRLAAIAQGVKARALQGNASNEQALRVGAMAGRLAEQAVRVID
FT                   AHR"
FT   CDS_pept        46255..47019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbr"
FT                   /locus_tag="BMULJ_03247"
FT                   /product="NADPH-dependent carbonyl reductase"
FT                   /EC_number="1.1.1.184"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K00079"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03247"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45121"
FT                   /db_xref="GOA:A0A0H3KIU3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIU3"
FT                   /protein_id="BAG45121.1"
FT                   /translation="MATNLFDLTGKIALVTGASRGIGEEIAKLLAQQGAHVIVSSRKLD
FT                   DCRAVADAIVAAGGRAEALACHVGRMEDIAATFEQIRNKHGRLDILVNNAAANPYFGHI
FT                   LDTDLAAYEKTVDVNVRGYFFMSVEAGRMMKAQGGGAIVNTASVNALQPGDRQGIYSIT
FT                   KAAVVNMTKAFAKECGPFGIRVNALLPGLTKTKFAGALFEDKDIYETWKAKIPLRRHAE
FT                   PREMAGTVLYLVSDAASYTNGECIVVDGGLTI"
FT   CDS_pept        47027..47785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BMULJ_03248"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K00059"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03248"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45122"
FT                   /db_xref="GOA:A0A0H3KIP2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIP2"
FT                   /protein_id="BAG45122.1"
FT                   /translation="MKIDSYAGQAVMITGAASGFGARLASELAAMGARLALGDLNADAL
FT                   ERVAAPLRAAGTEVIAQRCDVRIEADVAALVQASVGRYGRLDVGVNNAGIAPPMKALID
FT                   TDEADLDLSFAVNAKGVFFGMKHQIRQMLAQREGVILNVASMAGLGGAPKLAAYAASKH
FT                   AVIGLTKTAAIEYARHGIRVNAICPFYSTTPMVTDSDIGDRQDFLAQGSPMKRLGRPEE
FT                   IVATMLSLCAKENTYLTGQAVAVDGGVSAF"
FT   CDS_pept        47820..49064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd"
FT                   /locus_tag="BMULJ_03249"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.-"
FT                   /note="COG1960: Acyl-CoA dehydrogenases, Deinococcus
FT                   radiodurans"
FT                   /note="KEGG, K00249"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03249"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45123"
FT                   /db_xref="GOA:A0A0H3KNG7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNG7"
FT                   /protein_id="BAG45123.1"
FT                   /translation="MDFGYTPKVEELRERVRAFMDAHIVPRIRQWNDEVHAGQYPVSFM
FT                   EELKARAKAEGLWNLFLPHLKDDEPGTRLTNLEYAPLAEIMGRVGWASEVFNCNAPDTG
FT                   NMELLHMFATPEQREQWLLPLLRGEIRSAFAMTEPDVASSDATNITTRIVREGDDYVIN
FT                   GRKWFITNAAHPNCKIFIVMGKTDPAAESHRQQSMILVPRDTPGVTVVRNITVVNHYAP
FT                   EGHCEITFDNVRVPARNLLGEEGSGFALAQARLGPGRIHHCMRSIGAAELALELMIDRA
FT                   QAREAFGKPLNRHGTVGEWIARSRIEIDQARLLVLKAAWMIDKVGAKAARKEISMIKAL
FT                   VPTVHTNVCDRAMQLFGAAGLSPDTPLADHWTWGRALRFADGPDEVHLQSIARMEIKQA
FT                   VPGASAPYLTPPPRG"
FT   CDS_pept        49163..50059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03250"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45124"
FT                   /db_xref="GOA:A0A0H3KJ96"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ96"
FT                   /protein_id="BAG45124.1"
FT                   /translation="MRLSKIDLNLFVVFDAIYNKRNLTRAAELLNLTQPAVSNALARMR
FT                   KTLNDPLFVSTPAGMMPTPFAENIVGRVREALQLLDSSVHEGDVFDPASSERVFRLSMS
FT                   DLTEALLLPALGELLQRQAPGMHVRSYTMDRREIATALANGTVDIAIDAPLLGDPHLHQ
FT                   APLVRDRYACMIRDGHPFKGDTLTMDDYLAMGHIHVSSRRKGSGHVDAELTRLGLRRNI
FT                   QMRVQHYMVAPLIAMRGDLALTAPLRLLQRYPARILELPFEMPGLEYFCYWHRSADQDQ
FT                   ANRWLRERLAELMRDMG"
FT   CDS_pept        complement(50069..50791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03251"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG1802: Transcriptional regulators, Sinorhizobium
FT                   meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03251"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45125"
FT                   /db_xref="GOA:A0A0H3KSN2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSN2"
FT                   /protein_id="BAG45125.1"
FT                   /translation="MKGGVMSKEAPESEGGGRRHGGRYVYEELRKQILTLKLKPGVQLD
FT                   EISLAAQFGLSRSPVRDAIARLSSEGLVTILPNRTTLVTPFEIEEFPKYISALDLIQRA
FT                   VTRLAATQRTDADLAKIRKADDVYMEAVASGDFQAMSETNKALHMAIAHAANNPYFVGY
FT                   YERLLGEGQRLLHLHFDFTVSSPTAAKLGRDHDELIDAIARRDADAAEKAAHEHTMLFQ
FT                   KRFLDYMKQNLTESMSVL"
FT   CDS_pept        complement(50841..51887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prdF"
FT                   /locus_tag="BMULJ_03252"
FT                   /product="proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="COG3938: Proline racemase, Agrobacterium tumefaciens
FT                   strain C58"
FT                   /note="KEGG, K01777"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03252"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45126"
FT                   /db_xref="GOA:A0A0H3KIV0"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIV0"
FT                   /protein_id="BAG45126.1"
FT                   /translation="MRWKKTLQLVDVHCEGEIGKVVTGGVLDIPGQTMLEKMNYLNETD
FT                   DSLRRLVVLEPRGCLQMSVNLLLPPTRPEAHAGFIVLQADKAHPMSGSNCICVVTALLE
FT                   LGMVPMQEPETTVVLDTPAGLVTARATCRDGRCVGVSLDMVPSFVEQLDVDVHTPEFGT
FT                   LPVDIAFGGVYYALVDVDRIGLSIAPDNARQLATHGVRLREIINRQVSVQHPLYPEINE
FT                   VAYVMFRHRVDDTVYQTCTTLPPGRVDRSPCGTGSSANLATLAARGRVHVGDCLTSRST
FT                   IGGEFRVEMLGTTEVGGRPAVLPRVTGRAWVFGFQQLGVDPDDPLAAGFLLSDTWGDGF
FT                   DSSATSGT"
FT   CDS_pept        complement(51900..53381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="BMULJ_03253"
FT                   /product="betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Bacillus subtilis"
FT                   /note="KEGG, K00130"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03253"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45127"
FT                   /db_xref="GOA:A0A0H3KIP6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIP6"
FT                   /protein_id="BAG45127.1"
FT                   /translation="MNSYQRLFIDGRWVAPARGRSFDTIDPSDETVIAPVAAGTAEDID
FT                   LAVAAARRAFDEGPWPRMTGAERAVVLRAIAQHIRDRLPELAELEVRDNGKPLPEAMWD
FT                   LGDAAGCFDFYAGLAEQLDSHVEAPVTLPDSRFSSVVRKEPIGVAGAIIPWNFPLLMAA
FT                   WKVAPALAAGCTMVLKPSELTPLTALELARIADAAGLPPGVLNVVTGLGADAGAPLAEH
FT                   PGIDKLAFTGSVPTGSRIMQAAARDIKNVSLELGGKSPFIVFDDSNLEAAVEWILFGIF
FT                   WNQGEVCSATSRVLVQRRLYAPLIERLAQEARKIRIGNGRDDGVLLGPLVSRGQYDKVR
FT                   EAIARGREEGARLVTGGGRPAHLERGYFIEPTVFADVPEDSWIWREEIFGPVVCVRPFD
FT                   TEDEAIRSANDSRFGLAAAVMSADLSRCDRVARALRAGIVWINCSQPTFTEAPWGGYKQ
FT                   SGIGRELGEWGLNNYLEIKQITRYDSDTPWGWYIK"
FT   CDS_pept        complement(53407..54690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="BMULJ_03254"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Mesorhizobium loti"
FT                   /note="KEGG, K00285"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03254"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45128"
FT                   /db_xref="GOA:A0A0H3KNH4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNH4"
FT                   /protein_id="BAG45128.1"
FT                   /translation="MPEPHAGVSPGAARSETVVVIGGGIVGVCCALYLQRDGHAVTLID
FT                   PAAPGDSTAKWSCGQMAVSEIIPLSKPGILKKVPGWLLDQSGPLALRPGALPGILPWFF
FT                   RFVASARHAKIVSIAQAMATLTHDVYTDYAPLLDACGDSALLGQHPVLEVFDDPAGIAH
FT                   EQPHLELRQSLGFQSQRLTATEIGDLEPALAGRFRHGLLFPEWRAVNDTEGFIAALTAS
FT                   FEAQGGRRVRANAARIDEADGRATGVMLTSGEHIAAAHVVVAAGTGSRQFFGALGVRVP
FT                   LEGIAGYQALLADPGVAFRHSVIYADGGFCFSPMTRGLQIGGTIEFAGRNAQPNFRRAD
FT                   IILEKAKRILPELRTARVEYGVGYRPFLPDTKPIIDRSKRLPNAYMAFGHGQLGLTLGA
FT                   TTGRLIADLAAGRPTRQNLAPFSAYRFA"
FT   CDS_pept        complement(54696..55712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prdF"
FT                   /locus_tag="BMULJ_03255"
FT                   /product="proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="COG3938: Proline racemase, Mesorhizobium loti"
FT                   /note="KEGG, K01777"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03255"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45129"
FT                   /db_xref="GOA:A9AQW9"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AQW9"
FT                   /protein_id="BAG45129.1"
FT                   /translation="MTIHGFTCIEGHTEGMPVRMVIDGAPTLQGATMNARREDFVAHHD
FT                   WVRRTLMLEPRGHAHMSGTIFYPPVSDNADFSLLFIETSGCLPMCGHATIGSIAFAIEE
FT                   RLVVPKRPGTVTVDVPAGQIVARYQTDGERVTSVRFTNVPSFLLKRDVEIAIPALGTLA
FT                   VDIAYGGNFYPIVEVQPNFPGCEHFTPDELLAWGRDVQRAVGDALEVVHPDNPAIRGVR
FT                   HCMWTGKPIADDAHGRAVVIAGDSLVDRSPCGTGSSARVAQRFARGWLKEGEAYCHESL
FT                   IGSRFIGRVESTVRLESGVDAVLSSIEGRAWVTGRAQYRVDPSQPYALGFSLQEFVN"
FT   CDS_pept        complement(55770..56648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BMULJ_03256"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="COG0329: Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /note="KEGG, K01714"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03256"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45130"
FT                   /db_xref="GOA:A0A0H3KJA2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJA2"
FT                   /protein_id="BAG45130.1"
FT                   /translation="MQLKGILPALVTPFDASGAVDHDTLASILEFQLTAGVSGFVPLGS
FT                   TGEYYALTNDERRAVMKTVREVVGQRGELVVGANGSSTREVIEQVRQARDAGYTNILIA
FT                   PPYYALPSQQELIGHYDAILAAVTDVNVILYNYPVRTNVEVGFGVLDAFKDHPRVIGIK
FT                   ESSGNLLRAIEIGGKYKDHYQLSCGSDDQALDFFLWGATSWICGPANCFAKQVVSFYDK
FT                   FSAGDIAGAQNVMRALFPVMASMESGKFIQKVKYGCELAGFKVGNARMPLQPLTDQEKA
FT                   EFRAIFEASQA"
FT   CDS_pept        complement(56682..57347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03257"
FT                   /product="polar amino acid transport system permease
FT                   protein"
FT                   /note="COG0765: ABC-type amino acid transport system,
FT                   permease component, Listeria innocua"
FT                   /note="KEGG, K02029"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03257"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45131"
FT                   /db_xref="GOA:A0A0H3KSN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSN7"
FT                   /protein_id="BAG45131.1"
FT                   /translation="MNLDFSVVWPYWWVLVKGLGLTLAYTATCAIVGSLLGFVLSLLRM
FT                   SPSRWLRGPVAAYVEFFRGTPLLIQLFWVFFCFPVVLRLPIPPYLSVLISLTLYMAAIT
FT                   SETFRGSLKSIAGEQHDACIALSLSPHVKIVYVIFPQALLRAIPPLLSNVVSLFKESAL
FT                   ISSVGIADLMFVGQNVSNSTARPVEFLTTVAVIYFLVAFPLTRLVGVVESRMLRRYAY"
FT   CDS_pept        complement(57358..58029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03258"
FT                   /product="polar amino acid transport system permease
FT                   protein"
FT                   /note="COG0765: ABC-type amino acid transport system,
FT                   permease component, Bacillus halodurans"
FT                   /note="KEGG, K02029"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03258"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45132"
FT                   /db_xref="GOA:A0A0H3KIV5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIV5"
FT                   /protein_id="BAG45132.1"
FT                   /translation="MNYHFDFSFLAGSVGALLDGLKVTVVLAVAANAMGLVLGFVLCLF
FT                   AMSRWALVRWPAQLFIEFFRCTPALLQIIWFFYCIPMMVDVFIDPITMGVLALGLNLTA
FT                   FNAEAYRAGVQAVPKEHLDAAVALGLRPWQRTIFVVLPQALRNAMPVLLTNGIGSLQQS
FT                   ALVAIVAVADLMYVAKSLATQAYRPLETYSVVALVYFALSLPIARLVHVIERRQDAAVQ
FT                   R"
FT   CDS_pept        complement(58040..58879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03259"
FT                   /product="polar amino acid transport system ATP-binding
FT                   protein"
FT                   /note="COG1126: ABC-type polar amino acid transport system,
FT                   ATPase component, Thermotoga maritima"
FT                   /note="KEGG, K02028"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03259"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45133"
FT                   /db_xref="GOA:A0A0H3KIQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIQ1"
FT                   /protein_id="BAG45133.1"
FT                   /translation="MLSPQTMAVRSAMHPHSTARFSATAPDADFVRLRDVHKSYGPNLV
FT                   VMDGMSLDMRADDRLVIIGPSGSGKSSLLRVMMGLEGIQRGEIAFRGQPYIRGGGTRGA
FT                   PRIDAKLQKQVGMVFQHYTLFPHLSVLGNLILAPVRVGGMSKAEATERARMYLARLGLE
FT                   SKLHAYPSQLSGGQKQRVAIARALMLEPKLMLFDEVTSALDPEMVVEVQNVMLQLAEQK
FT                   MAMIIVTHDMHFARDIATRVVFCANGKIVEQGAPSEIFKCPREARTREFLEKVLHLD"
FT   CDS_pept        complement(58974..59807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03260"
FT                   /product="ABC amino acid transporter periplasmic
FT                   ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45134"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNH9"
FT                   /protein_id="BAG45134.1"
FT                   /translation="MNRLSRFTRQLVACAVATTSLFAATPSHAAGPDAWAGVKKAGVLR
FT                   CGAAVAPPYVMRDPKTGNYSGFFSDLCRDFGQNVLKVKVEFVDTSWDNIVAGLQSDKWD
FT                   LSLALNDTPEREKAVAFSAPATDYNVSFVYNRNNPRVPKALRTLADIDKPDLTIAVMSG
FT                   TSQDKAISAELKRARIMRLPGNDETRLSLISKRADLLADANITNMLLTEAHPDWAASFN
FT                   PTPPLAQQEVAFGLRKDTPKADIDALNSYLAQQTKSGAIDRLIKTSVQSMLTTGK"
FT   CDS_pept        complement(60193..61302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03261"
FT                   /product="conserved DnaJ-class molecular chaperone"
FT                   /note="contains C-terminal Zn finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03261"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45135"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJA8"
FT                   /protein_id="BAG45135.1"
FT                   /translation="MTARRGTAVAIAPGYESTRLSKARKTFNALVEQIDKRRERLAAWE
FT                   AVMPAFQKKFVDGLLPLEQTSTALRIRLVQLLDDAFLKKGLSKAEQRILSGLIADMARD
FT                   LLDVSDDAQLSVIYNRHGASGIDSDATAARRAAKTKPEPAPGGEPIDDLDTLSPDELAA
FT                   RIQAELDEQYERDMASHAAREAQRAKRRKAPRPSAAQAKREAEQAASSRSIREIYRKLA
FT                   SALHPDRETDPREQERKTVLMQRVNDAYAKGKLLQLLELQLEIEQIDQHAIDSFGEERL
FT                   ARYNGILEEQLRELDQEIRHVEGDFRRTYGIASSVKLAPDTVMRVLARDIASVQRGIHE
FT                   LNVALRTFEDLDHVKDWLKDVKRGHRFDD"
FT   CDS_pept        complement(61368..63743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="BMULJ_03262"
FT                   /product="DNA polymerase II"
FT                   /note="COG0417: DNA polymerase elongation subunit (family
FT                   B), Pseudomonas aeruginosa"
FT                   /note="KEGG, K02336"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03262"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45136"
FT                   /db_xref="GOA:A0A0H3KSP3"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSP3"
FT                   /protein_id="BAG45136.1"
FT                   /translation="MTEFEQGFILTRHWRDTSAGVEVEFWLATEHGPRRVRLRPQEAVA
FT                   FVPAEQQPLAERVLAGERDAELRPLALRDFRKRAVVGLYCRRYRHLTALQKRLAAAGVD
FT                   VYEADVQPPDRYTMERFITAPVRFRGRPGDARTLVDAELKAATDYRPALRCVSLDIETS
FT                   VHGDLYSIALEGCGQRQVFMLGPPNGDAAEARDFGLDYCDDRATMLARLNDWFDAHDPD
FT                   AIIGWNLVQFDLRVLHAHAEQLGVPLKLGRGGSVLDWRAHGQQPDHFFAGAAGRLILDG
FT                   IDMLKSATWSFPSFSLEYVAQQLLGEGKSIDNPYQRMDEIQRRFDHDKPALARYNLKDC
FT                   ELVTRIFAKADLLSFALERATVTGLAADRTGGSVAAFTHLYLPRMHRLGYVAPNLGDVT
FT                   GQNSPGGFVMDSRPGLYDSVLVFDYKSLYPSIIRTFLIDPVGLIEGLAHPDDDASVPGF
FT                   LGARFSRTAHCLPDIVRRVWEGRDDAKRQRNAPLSQALKIIMNSFYGVLGSTGCRFFDP
FT                   RLASSITMRGHEIMHRTRELIEAQGFDVIYGDTDSTFVWLGRAHDDDEAARKGRALVAH
FT                   VNGWWRTHLRERFGLDSALELQYERHYRRFLMPTVRGAEEGSKKRYAGLAAAADGSEDL
FT                   VFKGLETVRTDWTPLAQQFQRELYRRVFRREPYRDFIRDYVQRTLAGEFDALLVYRKRV
FT                   RRPLREYQRNVPPHVRAARIADEFNQANGRPLQYQRGGWISYVMTTAGPEPLEATHAPI
FT                   DYAFYVSRQLQPVADAILPFLRDDFERVVSGQGQLFLE"
FT   CDS_pept        complement(63858..65444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03263"
FT                   /product="EAL domain (diguanylate phosphodiesterase)
FT                   protein"
FT                   /note="COG2200: FOG: EAL domain, Nostoc sp. PCC 7120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03263"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45137"
FT                   /db_xref="GOA:A0A0H3KIV9"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIV9"
FT                   /protein_id="BAG45137.1"
FT                   /translation="MPAPTSGAKPVFQRSAVWLRLAFCAVVIACVLVPAGALVLAGRYA
FT                   RDAVARHEGLVAGDIAASVDRILNSLRSRHADVLPPLVGRPCRQIFAPLAEAETRLRYL
FT                   RAIALVNGNRLTCSSALGAIDAPLDAYVRAPAATPAADGTRIALLSETPYQRGIPVLVA
FT                   FRATARDAGVLYLIEGDYVADALAHSGSYGAESATLSIAGAGRLDHRGRFIPASRAVRP
FT                   RGTAIASRAWPFTVSVVASAQYVSQVERRYRLLFGTIALLVDALVVAAYLIATAPRRLL
FT                   LKAVGDALRRNEFHVVYQPIVEIETRRTVGVEALLRWHHPKWGAISPTAFVPQVESSAV
FT                   LPRVTEYVLRTAVSELTALAPAMPLRIAINVAPKDLERPRFMSIVDEAIRRLPPGFTLV
FT                   LEVTERVLLEKNPRTTAMFAALRAKGVKFAIDDFGTQHSNLDMLSRFPFDYVKIDRQFV
FT                   AQLDGGSARLIEGIAAVAHHYGLKIVAEGVETEEQHRALHAVGIQYAQGYLYRRPQRAE
FT                   QLMDGLVSAPA"
FT   CDS_pept        complement(65828..66145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03264"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIQ6"
FT                   /protein_id="BAG45138.1"
FT                   /translation="MLSPHEFATLMLVRHAPDQLDMTRAELDTLLERQLVMLEHAAGGA
FT                   RRAHLTARGRSLLDAFDPTPPAPARRRPPRLDGNVADDAPPPHARIAANPANDGVSESS
FT                   A"
FT   CDS_pept        66535..67185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03265"
FT                   /product="putative dihydroxyacid
FT                   dehydratase/phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03265"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNI3"
FT                   /protein_id="BAG45139.1"
FT                   /translation="MDLFDIVEEQRDAMRLPLYAVTVTAAARVNTPLIAILHWHGFRRE
FT                   TPLELPGIAIPPRPVPGCAIQIGSAWHAFEAVDAMLLDAAWRLGAWELERIERRACTEI
FT                   GAPASEALACRQAFGDYDSGAPAEQHLVDGAPDRGALMQLAARKGYLRWMFRPVKGGLW
FT                   RALDERDDTLDADGGRRPPCPIPPRPIVPRPRRAARAARTVYRLGDIRGILLR"
FT   CDS_pept        67346..67663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BMULJ_03266"
FT                   /product="chaperonin GroES"
FT                   /note="COG0234: Co-chaperonin GroES (HSP10), Neisseria
FT                   meningitidis MC58"
FT                   /note="KEGG, K04078"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03266"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45140"
FT                   /db_xref="GOA:A0A0H3KJB4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJB4"
FT                   /protein_id="BAG45140.1"
FT                   /translation="MQIRPLYDRVIVKRIEQQRTTASGIVIPDSAAEKPEQGEVIAVGS
FT                   GRLLQDGSQRPLQLKVGDQVLFGKYAGQTVKVDGEELLVMREEDVMGVLEPEASAARKA
FT                   A"
FT   CDS_pept        67744..69366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BMULJ_03267"
FT                   /product="chaperonin GroEL"
FT                   /note="COG0459: Chaperonin GroEL (HSP60 family), Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K04077"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03267"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45141"
FT                   /db_xref="GOA:A0A0H3KSP8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSP8"
FT                   /protein_id="BAG45141.1"
FT                   /translation="MAAKDVKFHDGARSRIVKGVNVLADAVKVTLGPKGRNVLIERSFG
FT                   APTITKDGVSVAKEIELKDRFENMGAQVVKQVASKTADVAGDGTTTATVLAQAIVQEGM
FT                   KHVAAGINPMDLKRGIDKAVGAVLDELRKLSRPIATNKEIAQVGAISANSDEAIGKIIA
FT                   DAMERVGKEGVITVEDGKSLENELEVVEGMQFDRGYVSPYFINDPEKQAAYLDDPLILL
FT                   HDKKISSIRDLLPILEAASKAGKPLLIVAEDVDGEALATLVVNAMRGILKVAAVKAPGF
FT                   GDRRKAMLEDIAILTGATVISEETGKQLEKATLEDLGRAKRVEVRKDDTIIIDGAGDPA
FT                   RIDARVKAIRVQIDEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDA
FT                   LHATRAAVEEGIVPGGGVALLRARAALADIKGANADQDAGIRIVLRALEAPLRVIVSNA
FT                   GEEPSVVIAKVLEGKGNFGYNAATGEYGDLVEAGVVDPTKVTRTALQNAASIAGLILTT
FT                   DATVADAPKDESAAPAPSPALDY"
FT   CDS_pept        complement(69491..70360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03268"
FT                   /product="hypothetical protein"
FT                   /note="COG0491: Zn-dependent hydrolases, including
FT                   glyoxylases, Mycobacterium tuberculosis CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03268"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45142"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIW6"
FT                   /protein_id="BAG45142.1"
FT                   /translation="MVIHHLNCISTCPLCGRLMNGSRHGIFERGSLACHCVLIETRDSL
FT                   VLVDTGFGLRDVADPRSRLSRFFLGLVSPAFREEMTAIRQIERLGYDPRDVRHIVLSHL
FT                   DFDHAGGLDDFPGATVHLLETERAYAAAQRTWMDRQRFRPQQWSTSGKWRTYPDGGETW
FT                   QGFAGVKALAGLPPSILLVPLRGHTLGHAGIAIETAHGWLLNAADAYFDAREMNANPQC
FT                   HVGLRMYQWMLEKDRRARLANQAALRALAQRRNGVLVFSSHDRSEFERLADRAADVPAG
FT                   VPASQHDL"
FT   CDS_pept        complement(70432..71337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03269"
FT                   /product="Mn-containing catalase"
FT                   /note="COG3546: Mn-containing catalase, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K07217"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03269"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45143"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIR1"
FT                   /protein_id="BAG45143.1"
FT                   /translation="MFIHNTRLQYTVRVDAPNPGLANLLLEQFGGPQGELAAAMRYFTQ
FT                   AITEEDPGRKDMLLDIATEELSHLEVIGSLVAMLNRGAKGELAEAVDEQAELYRKLNGP
FT                   GNDSHVTQLLYGAGSPLTNSGAVPWSAAYIDTIGEPTADLRSNIAAEARAKIIYERLIN
FT                   VTDDPNVRDALGFLMTREVSHQKSFEKALYAIDANFPPGKLPPMEPYDRVYFRMQPDAE
FT                   PLIGPWNHGGDLEVRPAEPAVDGGTGIAEGMLEAQQAEAIDALAQRLRSDPNCDPTTGA
FT                   ELGAGAPVEQSPDADKPERS"
FT   CDS_pept        71706..73043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03270"
FT                   /product="Nramp family metal ion transporter"
FT                   /note="COG1914: Mn2+ and Fe2+ transporters of the NRAMP
FT                   family, Deinococcus radiodurans"
FT                   /note="KEGG, K03322"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45144"
FT                   /db_xref="GOA:A0A0H3KNI7"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNI7"
FT                   /protein_id="BAG45144.1"
FT                   /translation="MSTVGRNPLTERTASGIRDVFAGRRRGPGTLFLFAGPAVIASVAY
FT                   MDPGNFATNIRAGAQFGYALLWVVLLANVIAMLFQSLSAKLGIVTGRNLAELCAEHFPR
FT                   PIVYAMWIVSELAAMATDLAEFLGGAIALALLFELPLIVGMFVVAMVTYAILLFDRNGF
FT                   RPMEIMVGALVSLIGLCYLAEMFIAPVDWAQVAMHAVVPQMPRGDALLVSVGIVGATVM
FT                   PHALYLHSGLTQRRVPGLDAAQRRLLVRYSNLEVIVALSVAGAINMAMVIMASAAFHAG
FT                   FSDVAEIETAYHTLTPLLGTTAAAFFLVSLMSSGISSSAVGTLAGQMIMQGFVGFRMPV
FT                   WLRRLVTMVPAFIVVGVGVDATQALLISQVVLSFVLPVPMAALVYFTARRDIMGEFVTR
FT                   PAMRWTAIAAAVVIAVLNLGLGVAMVQNATSTDAAAPAAVHGGASS"
FT   CDS_pept        complement(73108..73542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03271"
FT                   /product="predicted phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03271"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45145"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJC1"
FT                   /protein_id="BAG45145.1"
FT                   /translation="MVIEAIVTRLDAAFEQIEATPDSREARHQRDAIIQWLDSASEHGY
FT                   RLGLVTTLPAARLSDMFEGQFGRANLDRFSVVVSDADQRDRAANQHPFDVALQALGVPP
FT                   ERAAALASSEPERREAENFGLSHCMRITDTVRAIAPAGVH"
FT   CDS_pept        complement(73869..75227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="BMULJ_03272"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="COG1252: NADH dehydrogenase, FAD-containing subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00356"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03272"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45146"
FT                   /db_xref="GOA:A0A0H3KSQ2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSQ2"
FT                   /protein_id="BAG45146.1"
FT                   /translation="MDNTTPLVAAPAAPRVPRIVIVGGGAGGLHLATRLGDTIGRRGHT
FT                   EVVLVDRYPTHFWKPLLHEAASGHRDPASHTIEYAAQAKRHGFRFVQGALQRVDRAARI
FT                   ATIGAVHDADGTEILPARTLAYDDLVLAVGSVTNFFGVPGAARHALPLENLDQAEDFRR
FT                   KFLAACTKANHRAEQQPAQPAAPVSISVIGAGATGVELAAALRHAVQQLTTYRFKALDG
FT                   ARDVRIRLIEGAPRILPALDARLSDKMHAQLRALNVEVLTDTRVAEVGADAVTIASGER
FT                   LASDITIWAAGVAGPAILRELDGIALNRSNQVIVTDTLQTPDDPHVHAFGDCAACPSNG
FT                   ASGCLPPRAQVAHQQAVYLSQAFARRIAGKPVAGFTFRDAGTVVSLGHAGAVYQAELGV
FT                   RSRSLIVDGLAAIGLYKFLYRKHLFSVHGIKRALFQSLSHWLQSRNQPSIKLH"
FT   CDS_pept        75385..76284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03273"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Synechocystis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03273"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45147"
FT                   /db_xref="GOA:A0A0H3KIW9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIW9"
FT                   /protein_id="BAG45147.1"
FT                   /translation="MIARLGSVSRAAEELNLTQPAVSLQVRLLEEAVGAALLQRVGRGV
FT                   QLTAAGEIVARYAREILHLWSEAGDEVAALTGDLGGTLRIGAITTAEYLIPPLLVKFTA
FT                   TRPHVKTYFKVGNRDDIIRMLATHEIDLAVMGSAPKELRTHAVEFAKHPMVFVAAPDHP
FT                   LMQRKRVALKDLESAHLLVRERGAGTRSTVESLFKTSGYRFHVGSELSSNEAIKQMAEA
FT                   GLGVAFLSLHACALELRTGLLKQLPFPGNPIEREWYVVTVADRRISQVTGLFRDFLIRQ
FT                   GAPVIDGATSASHERRRK"
FT   CDS_pept        complement(76312..76491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03274"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45148"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIR4"
FT                   /protein_id="BAG45148.1"
FT                   /translation="MRECCLSRAACAARPRAAAPRAGGSLAGIGKWCARVVGWHRLERL
FT                   LASIPDSNDDFGLG"
FT   CDS_pept        76687..77625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03275"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03275"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45149"
FT                   /db_xref="GOA:A0A0H3KNJ4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNJ4"
FT                   /protein_id="BAG45149.1"
FT                   /translation="MSDPIHTAAPDDGVPVSLRSSRGRGWRGFGAALLGIRAGTYRIPA
FT                   ADHHRIGVHVGAPVRADCACDGQRMTRIQAHGDIDVIPAGLPGRWTDSADCRILHISLD
FT                   DAFVRRTAEQLELTPSRAQIRRRMQVRDPRLQHIAWAMAAELEAEEASDPLYAESLCTA
FT                   LVARLVDAQPQFRERRRMLSPQAAARVIDYVDAHLDRRLTLAELAALVSISVPHFKVLF
FT                   RETIGMPVHQYVVRRRVERAKALLLEGRLTLSQIALEAGFAHQSHMANWMNRVLGATPT
FT                   EIARSGGRATTLRLVDDRDGEEAAEANAPQR"
FT   CDS_pept        77793..78674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03276"
FT                   /product="predicted nucleoside-diphosphate-sugar epimerase"
FT                   /note="COG0702: Predicted nucleoside-diphosphate-sugar
FT                   epimerases, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03276"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45150"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJC6"
FT                   /protein_id="BAG45150.1"
FT                   /translation="MFVIFGASGHVGLATVTALRAAGHPVRAVLREPRGRERFAQLGCD
FT                   VAIADLADPRAVAAALDGAHAVQMLCPVPARDADPAATMAHTIEVAVEALGAHPPDVLL
FT                   ALSDYGAELEGNTGITRVFRDFEARLKTVPTQLTLLRSAEHLQNWARMLPVALATGALP
FT                   SLHQPVDRMFPAVWAPDVGEIAAQLLTEHVERASAPRIVSVEGPRRVSAHDIAAALGAA
FT                   AGRDIVAHPLPRDAWTPTLLRAGLSARHAELIVDLYDVHNAGRIDFEAGSERRFGTTMP
FT                   ADALAALLRAHA"
FT   CDS_pept        complement(78735..79931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benE"
FT                   /locus_tag="BMULJ_03277"
FT                   /product="benzoate membrane transport protein"
FT                   /note="COG3135: Uncharacterized protein involved in
FT                   benzoate metabolism, Pseudomonas aeruginosa"
FT                   /note="KEGG, K05782"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03277"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45151"
FT                   /db_xref="GOA:A0A0H3KSQ7"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSQ7"
FT                   /protein_id="BAG45151.1"
FT                   /translation="MQPNTPTSAPRAIGQDWSVSAVTAGFLAVLISYAGPLAIFFQAAQ
FT                   AAHASDAMVTSWVWAISIGAGLSGLFASWKLKVPVVTAWSAPGTALLVGLFPQLTLNQA
FT                   VGAYITAALIILLIGISGYFDRLVRHIPRGIACGMMAGILLPFGMHAFAAASAQPVLAF
FT                   GMIAAYVIFKRLLPRYSIVLVLLTGAALAMLLGMTHLALVSPSIARPIFIAPEWTLGTT
FT                   LSLALPLVVVSLTGQFLPGMTILRVSGYQTPARPIITATSIMSLVVACFGGITIVVAAI
FT                   TAALCTGKDAHEDPDRRYVAGIANGVIYLIAGIFAGSIVAVFFALPKAFVAILAGLALI
FT                   GAIGANVHGIFEDESHREASLITFLATASGMTWLGLGSAFWGIVIGSLSYAVLNRVRR"
FT   CDS_pept        complement(80048..81073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03278"
FT                   /product="fatty acid desaturase domain protein"
FT                   /note="COG3239: Fatty acid desaturase, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03278"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45152"
FT                   /db_xref="GOA:A0A0H3KIX3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIX3"
FT                   /protein_id="BAG45152.1"
FT                   /translation="MAEYFDVDHARAIAALRTRFTARTEWPTWLLILAVYGGWLAVLLA
FT                   VRAHALSLAAATPPLILLGAWHLSLQHELLHGHPTRSIRVNKLLGYPPLTVWYPYTVYR
FT                   ETHLRHHRDDDLTVPGIDPETNYVSRACWARLPRWRRVLSSARNTFVGRLLVGPPTSVA
FT                   AMLRDACAAFRRGEWRDLPMWATHVACVAALLVWLDRAIGVPWWYYLVAVTWPAHSLAM
FT                   IRSLYEHRAARHPKARIAINEAGFAMRLLYLNNNYHLVHHDLPALPWYDLPRAYRMRRD
FT                   AYRQKCDGFVIRRGYAELLLRHAWRPTDAPVHPFDQGTASLSTGSGARIAAVDGYLQIS
FT                   T"
FT   CDS_pept        81400..82224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03279"
FT                   /product="putative ABC phosphate/phosphonate transporter
FT                   periplasmic ligand-binding protein"
FT                   /note="COG3221: ABC-type phosphate/phosphonate transport
FT                   system, periplasmic component, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03279"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45153"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIR8"
FT                   /protein_id="BAG45153.1"
FT                   /translation="MSQWTAALPMYNVTPHHAALWLALLRDALDAFAKAGGPADVHVLH
FT                   EPFGDLLALWRRGDLLLSQTCGFPYRMLGLRDAVQLIATPAFDADGCSGAQYRSVLVVS
FT                   ARVHDGGVTTLAACRGLRAACNGADSHSGMNAFRHAVAPHAHDGRFFGSVTSFGSHLNV
FT                   LRALGAGEADCAAIDCVTFAYVRDALPALLNDVRVIDMTASAPGLPFIASRALGDAQAD
FT                   ALRDALASAVKADAARARALRLRSFERLSPCDYDVIQRFAQDAAVHGYPALA"
FT   CDS_pept        complement(82251..83645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="BMULJ_03280"
FT                   /product="ATP-independent RNA helicase"
FT                   /note="COG0513: Superfamily II DNA and RNA helicases,
FT                   Ralstonia solanacearum"
FT                   /note="DbpA protein"
FT                   /note="KEGG, K05591"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45154"
FT                   /db_xref="GOA:A0A0H3KNJ7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNJ7"
FT                   /protein_id="BAG45154.1"
FT                   /translation="MTQPTATPFSTLPLTPAMLANLEQLGYVDMTPIQAASLPIALAGH
FT                   DLIAQAKTGSGKTAAFSLALLSRLDARRFDVQAMILCPTRELADQVAQEVRRLARAEEN
FT                   VKVLTLCGGTPMRPQAQSLEHGAHIVVGTPGRIMDHLDRGNLQLDALNTLVLDEADRML
FT                   DMGFFDDIAKVARQCPPTRQTLLFSATYPDGIAKLSQQFLRSPKEVKLEERHDDSKIRQ
FT                   RFYEVTETERLHAVGMLLNHYRPVSTIAFCNTKQQCRDLIDVLHAQGFHALALHGELEQ
FT                   RERDQVLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVHVHRIGRTGRAD
FT                   QAGWALSLASMDEMGRVGAIEQAQKRDVEWRPLSELTPASDAPLLPPMETLQILGGRKD
FT                   KIRPGDVLGALTGDAGFDGKQIGKINVTEFSTYVAVERGIAHDALRKLNAGKIKGKRVK
FT                   VRLMDE"
FT   CDS_pept        complement(83642..83839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03281"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJD2"
FT                   /protein_id="BAG45155.1"
FT                   /translation="MFTCRNQSCGTQWETSDVVIKDEGQGLLFRCPLCGARNYVERFED
FT                   DEGNVVYEQMEGRPYLGDLS"
FT   CDS_pept        complement(84285..84872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03282"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45156"
FT                   /db_xref="InterPro:IPR025522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSR2"
FT                   /protein_id="BAG45156.1"
FT                   /translation="MKSLFRHAALACVTIGFLSGCASSVTRDASTSAGAAVTASTTHFG
FT                   TKPVIVNVTLDDTAREELKDNLKFDAKKLQEKLETALDARKLLAKADSPDAMHLNVEVT
FT                   GIRVRSSFSAVMFGFMAGNDHVNGAVTLADADNRPVDRFKVSASYALGGIAGIDSMRMD
FT                   WLYEKFTEQTLATLDPATAAQQAAAATGKSKL"
FT   CDS_pept        complement(85364..86299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03283"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03283"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45157"
FT                   /db_xref="GOA:A0A0H3KIX7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIX7"
FT                   /protein_id="BAG45157.1"
FT                   /translation="MKLKQLNAFLAVAEHRTIRGAARALGVTQPAVSGIVRELEGELGV
FT                   PLVMRSVKGVALTDYGSAFAIRARRIVEEIQRTRDEIEQLRLGTTGSVSIAVSPTVALT
FT                   ILPHAFDAFTRALPGATVNIDDALTATDLARLRDGSLDFIVTHQLSDALPDADEFASIP
FT                   LFRTAFVVVARSRHRLARARSLRELGDARWCVPRYGDGGDDLIRSIFVPRGIEMPKRIV
FT                   HCPSFAATLGLVSRTDALGVFARPLADVERGSRRLVVLDLVEPLPALTVAIVMRRHALL
FT                   TPAALRLIDCLKAAAAEVSGGEGGGDSDGV"
FT   CDS_pept        86404..87627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allC"
FT                   /locus_tag="BMULJ_03284"
FT                   /product="allantoate amidohydrolase"
FT                   /note="COG0624: Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02083"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03284"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45158"
FT                   /db_xref="GOA:A0A0H3KIS3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIS3"
FT                   /protein_id="BAG45158.1"
FT                   /translation="MVRVNQQRLWDSLMEMATIGATARGGSCRLALSDDEVRGRRRFIA
FT                   WCEAAGCEIRIDPIGNVFARRPGTEPDAPAVMCGSHLDTQPLGGRFDGVYGVLAGLEAI
FT                   RTMNEHGIATRHPIDVVAWTNEEGSRFTPGMMGSAVYAGKLDLDDALARPCMHTGVRLG
FT                   DELERTGFAGPARERQMPKAYFEAHIEQGPVLENAGVPIGVVTGVQGIVELDVTVTGFE
FT                   SHAGTTPMSVRKDAMGVAAAMIAAIVEHGHGFDADARVTVGHLACQPNSPSTIPGQVRF
FT                   SVDVRHPSRSALQRLVADIGAICTQRTALRGTQVDVQLIAEYDPIAFDAACIERVRQAT
FT                   IAAGYPYLEMFSGAGHDAVNLSYVAPSAMVFVPCKAGLSHNEAEDADPVHLAQGASVLA
FT                   NLLVDCAR"
FT   CDS_pept        87785..88252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03285"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45159"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNK3"
FT                   /protein_id="BAG45159.1"
FT                   /translation="MSTTPPRELLKATDIAKMEPTRAVHPLNPNAVRLRKPLGDLTGIT
FT                   QLGFHLITLMPGHESAEYHRHLYEEECVYVLSGNGTVTIGERREAVGPGDFLGFARGGE
FT                   AHTLQNTGDTPLELIVVGQRLEHDVCEYPRVGKRLYVAGPLEDFVDLPTQP"
FT   CDS_pept        88380..89219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BMULJ_03286"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Caulobacter vibrioides"
FT                   /note="KEGG, K00059"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03286"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45160"
FT                   /db_xref="GOA:A0A0H3KJD6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJD6"
FT                   /protein_id="BAG45160.1"
FT                   /translation="MDTPHPPTHTAIPETEFEAEVDAEVETAVEPRASRVHRPVALVTG
FT                   STSGIGAAIARRLAADGYAVILHSLRSVETGRAMATELGGAYVQADLADDAERVRLIRD
FT                   ALAVHGRLDVLVNNAGISRTIAHDDLAAATPDVWRELYEINAIAPFRLVAEAQPALLEA
FT                   ASHGRAGCVVNVSSHAGVRPKGASIPYAAAKAALNHTTRLLARTLAPAIRINAVAPGLV
FT                   DTPLTADWTDAQQLWRERAPMRRAATPDDVAQTVAMLVASDYVTGEIIMLDGGLNLT"
FT   CDS_pept        complement(89338..90117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="BMULJ_03287"
FT                   /product="5'-nucleotidase"
FT                   /note="COG0496: Predicted acid phosphatase, Brucella
FT                   melitensis"
FT                   /note="KEGG, K03787"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03287"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45161"
FT                   /db_xref="GOA:A0A0H3KSR5"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSR5"
FT                   /protein_id="BAG45161.1"
FT                   /translation="MQETRPLFDRVLLTNDDGFDAPGLAVLERVAAQLAREVWIVAPAE
FT                   DQSGTSHSLSLHEPLRVHRKDDRRFAVRGTPGDCVAIAVSHLMKDARPDAVLSGVNRGA
FT                   NLGTETVFSGTVGAAMTSMLLGVPAIALSQAFTDRHAVPWDTALAHAPDVVRRLVAAGW
FT                   DSDVCLNVNFPARPAQDVRGLKATNQGAGTLQGVEIVSGRDPRDIEYHWLKLARAPRDD
FT                   DADSETVALGEGFISVTPLKFERTHDHALARLRSSIG"
FT   CDS_pept        complement(90419..90718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03288"
FT                   /product="putative membrane protein"
FT                   /note="COG4541: Predicted membrane protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03288"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45162"
FT                   /db_xref="GOA:A0A0H3KIY3"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIY3"
FT                   /protein_id="BAG45162.1"
FT                   /translation="MPDFSTVATIVLMASTTYLSRILGYVMLRNRPLSPRMAAVMENVP
FT                   GCVLISVIAPAFVSTRPADLLALGITIVAATRLSILPTVAIGVVSAGVLRHLLG"
FT   CDS_pept        complement(90711..91445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03289"
FT                   /product="branched-chain amino acid permease"
FT                   /note="COG1296: Predicted branched-chain amino acid
FT                   permease (azaleucine resistance), Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03289"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45163"
FT                   /db_xref="GOA:A0A0H3KIS7"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIS7"
FT                   /protein_id="BAG45163.1"
FT                   /translation="MSSSVSTSSGLRERPAYIAEMGRGLRAALPVMLGFVPFALVLGAQ
FT                   AAQKGLSLFEVPMMTGLNFGGGSEFAAIHLWTSPPHIALIVAMSFLVNSRHILMGAAFA
FT                   PYIRRLPRRRAFAALFFMCDESWAMSLADTRSRADTHISVPYYAGICAGLYLTWISMTT
FT                   LGAAVGPTIGNVEQYGFDMAFTAVFLVLLRGMWKGLRASRPWFVSLVVAAATHLAVPGA
FT                   WYVAAGACAGLIAALWWEPRDA"
FT   CDS_pept        91570..92028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03290"
FT                   /product="AsnC family transcriptional regulator"
FT                   /note="COG1522: Transcriptional regulators, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45164"
FT                   /db_xref="GOA:A0A0H3KNK7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNK7"
FT                   /protein_id="BAG45164.1"
FT                   /translation="MKLDAIDRRILTALQRDGRMQNVELAQEVGLSPSPCLRRVRLLEE
FT                   AGVIEKYVAVLNPAKVGKGLTIFTRVWLKGQDAETVNRFAEAVQQMPEVVECHLMAGDC
FT                   DFLLRVVAADIDDYRRFQMEYLTRIPGVLSVKTDIPMQKIKLTSALPT"
FT   CDS_pept        92160..92729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03291"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45165"
FT                   /db_xref="GOA:A0A0H3KJE1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJE1"
FT                   /protein_id="BAG45165.1"
FT                   /translation="MQPVNSPWNSLEIVKLVLGVLTPLSVAGLGWLVARRLKRLELVQW
FT                   TNQKLIEKRLALYDVVAPQLNALLCFYTWIGYWKDISPDDVIRAKRELDRTFHLYRYLF
FT                   DDDVYDAYHAYIHALFEMHTGAGRDARIRSLIHGPDGDRSVHGTYDWKPGWSERFATDN
FT                   VEDKADVLRHYTRLMERLRVALGANR"
FT   CDS_pept        complement(92869..93201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03292"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4390: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03292"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45166"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSR8"
FT                   /protein_id="BAG45166.1"
FT                   /translation="MIQPTAVFKDNLAQLPAIDGIARIDLVAANGDVVASIENQPGKQG
FT                   SLAVYHYLKQTFGTLDAKAAEHGLAVFAEHTADARNRPGAHPNVDRLLAIVAGGEALRI
FT                   DVVEKG"
FT   CDS_pept        complement(93246..94679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03293"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Xylella fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03293"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45167"
FT                   /db_xref="GOA:A0A0H3KIY7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIY7"
FT                   /protein_id="BAG45167.1"
FT                   /translation="MRPTRTASRDAADEARPARHRLVLPTLCIAVLIAQIDTAIVNLAT
FT                   GAIGATFGARVGALQWVIDAYNLAYAVLLLTGGLIGDLYGRRRAFVAGAALLSGASVVC
FT                   ALAPTLGVLIAGRALAGAGAALLIPASLAIVRVTWRDPAERARALGIWAACGGIAMIVG
FT                   PTLGGVLIRSFGWPSIFGIVIPFGVAAIVLAAVAVRESADPHGRRFDVVAQVLGALAIG
FT                   GIVFATIDARHAPLHAALLVAASGVAVALFVRVERRLGAAALVPLDLLANRPFRGMLIA
FT                   NGAMTFGGYGMLFVLPLAWQSHRVLDAAGAGVALLPMSVPFALVSFGSGAVAARVGART
FT                   AGAGGVALMGLGLAVIGIGAAGSTDARAPMLAWAACGLVLTGTGLGLAVGSLAATAVGA
FT                   VDAARAGTAASLMNVTRMIGAVLGVAALGALYDAFGGGAAALRIAMGAGSIVQLGCAAL
FT                   AWRTSGGGRAPARASRAIG"
FT   CDS_pept        complement(94679..95407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03294"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1853: Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family,
FT                   Bacillus halodurans"
FT                   /note="typically associated with flavoprotein oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03294"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45168"
FT                   /db_xref="GOA:A0A0H3KIT1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIT1"
FT                   /protein_id="BAG45168.1"
FT                   /translation="MHAPHRVTEPNILYFGTPVVLISTLNADGTANLAPMSSAFWLGWR
FT                   GVLGLANSSQTAHNLLRTRECVLNLPSPAQAHAVDRIARTTGTYPVPESKHAKGYVYEA
FT                   DKFGTAGLTETASHTVAPPRALECPVHLEAVVVATHGIGDDAPDLRGRIGLFEVRVQRV
FT                   HVHPDLLVDGEPDRIDPDKWSPLIMSFQKFYGLGAQQVHPSRLAEIPERAYRSRDIDRA
FT                   RDARHAANAVHDGSLPGDRR"
FT   CDS_pept        95602..95928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="BMULJ_03295"
FT                   /product="thioredoxin 1"
FT                   /note="COG0526: Thiol-disulfide isomerase and thioredoxins,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K03671"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03295"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45169"
FT                   /db_xref="GOA:A0A0H3KNL2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNL2"
FT                   /protein_id="BAG45169.1"
FT                   /translation="MLTPQRYTSNAPTRAEVEALTGATVIEFGANWCGICAGAQPSIVA
FT                   SLAAHPEVRHLKIEDGPGRPLGRSFGVKLWPTLVFLRDGVEVARVVRPIDARQIEAEGF
FT                   AALA"
FT   CDS_pept        95949..96368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03296"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0432: Uncharacterized conserved protein,
FT                   Synechocystis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03296"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45170"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJE6"
FT                   /protein_id="BAG45170.1"
FT                   /translation="MQQAIQHVGVDTRGRGLVEFTARVRAFVDQQTIRTGLLTVFCRHT
FT                   SASLLIQENADPSVQRDLERYFETLAPEDATRYEHDTEGADDMPAHLRTALTQVQLSIP
FT                   VENGRMVLGTWQGIYLFEHRRAAHRRDVVLHLIGE"
FT   CDS_pept        complement(96426..98231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03297"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03297"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45171"
FT                   /db_xref="GOA:A0A0H3KSS1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSS1"
FT                   /protein_id="BAG45171.1"
FT                   /translation="MTRRRWRNRKVILVLGSVWLLGFAAWAFLLWDLLATSVNEGVLEG
FT                   PREGVFWTAAQYRNVYTRFNRQLILYATHQDDDFDKLQMQLDSLSVSFGFLERPSEVSE
FT                   YWLRIPSARGEIATLGAFMAQLKRDVPKLRDAPQQAPRVLADVDAYWPRVNGLANDFRA
FT                   IEMAQRDFTFHQLRAKQRTILLLGGVLGVLLCALFALLFYTMRTRDALLERQNAALDAE
FT                   RQASDRAFEMIEAKNAFLGMVSHELRTPLQAICGSIEILLARPQSDANLKTIRRLQNSA
FT                   ASLEALVKDLTDYIKLRSTKRLADAETVGIASLLADVLDPLRAKVDAKGLALSSHVAPA
FT                   DLAVRSDRKLLRQVLANLVENAVKYTHRGSIAVSITRADAPAGPQLRIAVRDTGVGIAK
FT                   AHLSKIFEPFYRANDAVGLSVDGIGMGLAVVREIVTTLRGRVEVHSVAGQGSEFVVTVP
FT                   VDVPGAADSAHEAPAGAAPAALRDTRALIVDDNDNARETLGAMLATLGIDADLCGTGRE
FT                   GLARAAEIAYDVVILDLELPDISGVDVARRLRAARAPGARRPAILGVTAYESLALGENR
FT                   QAFDEYVPKPVHLRELGAAIERLLG"
FT   CDS_pept        complement(98228..98728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03298"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45172"
FT                   /db_xref="GOA:A0A0H3KIZ2"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIZ2"
FT                   /protein_id="BAG45172.1"
FT                   /translation="MQATTLWLKRVLTVYLLGLAAACWAAPFTFTVDGKIAKTNQSGRQ
FT                   AYVFSEAALMALPQHTIRTSTSWTPVATFTGPRLSDVLKAVGAHGKQIEFRCIDEYTFT
FT                   IPASDADRYGVILARTMNGKVLGNDNYGPLWIMYPRDQFPDELKTPLGEAKFAWQVVGL
FT                   TVK"
FT   CDS_pept        complement(98767..99639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03299"
FT                   /product="putative two-component transcriptional response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03299"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45173"
FT                   /db_xref="GOA:A0A0H3KIT5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIT5"
FT                   /protein_id="BAG45173.1"
FT                   /translation="MPNSQQANVDLITANKVRDLLNRNGIAPRSHNTTIANVLGLSFSV
FT                   VTRKMKGLIPWNLSQLQDIATHFGVPPAILLDDKGAQPADAEMIDATLVIESRRFRCRA
FT                   AISTKASSQIDTEFVALQSQGEWIVTERRHAREGRTYAVELIELRSSRPNAYAARIAVV
FT                   DDSPDVAETVCEYFIEKGVHAIPYHDGRTFREALAVEDFDGYILDWMLGDETAADLVRG
FT                   IRASENGDAPIFLLTGKISTGEASEDEIAHIVSHYNARCEEKPVRLPILFAEVARELKI
FT                   VPPVAPAGT"
FT   CDS_pept        100295..103384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsC"
FT                   /locus_tag="BMULJ_03300"
FT                   /product="two-component system capsular synthesis sensor
FT                   histidine kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K07677"
FT                   /note="RcsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45174"
FT                   /db_xref="GOA:A0A0H3KNL7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNL7"
FT                   /protein_id="BAG45174.1"
FT                   /translation="MRAFRAACRPRCVMPDSSLQSIRRYQNISMFGGGIVVTVLILIAC
FT                   ALGMASIVYGYLDGERRNYLAGFVQTLNEIKVSETSFRNGVSNAQLIWRDIDRAPDGVV
FT                   DAFYASDQQIAITPYPSVVFGVPGQTADRREVARYLSLSVLLARICAASSINRGYALIG
FT                   YHYSTRTAMFGLVPNSRGDGAGLATPDERARTLDALRIDFGDAPPSAGHGRPHVRWLPP
FT                   FIDPVSGERRIRIAAQAQVDGEPFAVLVTEYAPDYLLSWVPSNAADGTFFVTTADNRLV
FT                   TAGPGVAHDDARIARLLALDVAREPGDADEPVFRGGHVVFRGTLDKTGWTLAYALSWTH
FT                   IVATVALRAGLLLGASLLTIAIMWILLVRFHHRVLTGVYARSQRVFDSESLCRSVIEMS
FT                   PIGLGLISRADGRFMLVSPVLAERVARLGCDCGTLSAQILAQYRAGASNAPFQIELVLP
FT                   DAQAAAGADAPPLHLEVIARDARYQASDVLIVAVVDVTAKRQLVQKLEEAVRAADSANA
FT                   AKSSFLAAMSHEIRTPLNVILGNLELLERSTLDLPQRSRVQTLRNAASGLLELVSGILD
FT                   FTKVEAGAMPVESIEFDAIGVIARELGAYAPVAKAKGLPLFCEIAASASQRMRGDPTRL
FT                   AQVFGNLLSNAIKFTAHGHVTARVRAVRGECGTAELAIAIEDTGIGIGSADLHKLFRAF
FT                   SQVDATIARRYGGTGLGLALCDRLVTAMGGRIAVTSAPGAGSCFTVRLPLGLDVEPIAA
FT                   PVACDAGTLLLVARQAEWRQFALPHLAAWGFDVRVYACPAQIPAARCTRASAIVLFGDA
FT                   DEWPRDALDRLAGSAPVVLATPDGPLEPGRVGRMMRVSSYALGALRAALMPARDGTAAI
FT                   APFDRTAEPAVDGRTTMRVLLADDASVNGTILREQLDVLGCAVHVVGLAGAALDLLYRS
FT                   DWDLLLIGTDLPDMAACALAEAVHARGMPCSVAIVTTHLAPDDARRCAAANVQSVLTKP
FT                   VTLVRLRSVLAAVARRRGKHVDEVERQEQDMAQLSHDGIA"
FT   CDS_pept        103496..103693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03301"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03301"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45175"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJF2"
FT                   /protein_id="BAG45175.1"
FT                   /translation="MEKVIALLLDFAMLPEKSRREFLASINEFLIMSPLQRRHAIKAWK
FT                   QAAQSARREAGMAGEGANGR"
FT   CDS_pept        103996..104670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsB"
FT                   /locus_tag="BMULJ_03302"
FT                   /product="two-component system captular synthesis response
FT                   regulator"
FT                   /note="COG2197: Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K07687"
FT                   /note="RcsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03302"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45176"
FT                   /db_xref="GOA:A0A0H3KSS3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSS3"
FT                   /protein_id="BAG45176.1"
FT                   /translation="MDEFCVRVMVADDHPSSAIGMSRVLAESSTIELVGTVSNSTDLVA
FT                   ALEEKPSDVLVLDYVMPGGKFGDGLVLLSFLQRRYPALRIVTITMIDNPSVLHAIRRQG
FT                   VGCILSKSDAISHLVGAVHAAFVCADYQSPHIRHLLDSAGSSVTERRLTTREIEVVRLY
FT                   AAGLTVGEIASQLHRSKQTISSQKASAMKKLGIVRDADLIRFADEGMLPDPAANIRRKA
FT                   RP"
FT   CDS_pept        104774..107779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsC"
FT                   /locus_tag="BMULJ_03303"
FT                   /product="two-component system capsular synthesis sensor
FT                   histidine kinase"
FT                   /note="KEGG, K07677"
FT                   /note="RcsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03303"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45177"
FT                   /db_xref="GOA:A0A0H3KIZ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIZ7"
FT                   /protein_id="BAG45177.1"
FT                   /translation="MPKELKKLAARSASATVKRFEPARVRRQQRALLYGGGAAVTVFIL
FT                   ACAVLIVLLDVSDFLARARSAFLGREAELHAELQVANALLTHHADSIEMFERTDPHATP
FT                   AQLRRLDDAHGRLIVTGRAGLPSTAVLADLAHDRGAAAYSRYVALLFQQTDMIAVSMPH
FT                   TINAGLSAYLIGTGGDFIGIVGIQPVGRLTGRLDAIDVRALIRSVEPHRGIGVPLRTID
FT                   GRDDALLDTRDDTLLGRPVWRLSRPVRDASGQPIAWLVINTRAQVGTIMKPDYADDAHA
FT                   LVDARGTIAVGAPVEAALVERALAFARAPGDVRAAVHRVGTRFVIGDRLPESDLVFVTT
FT                   FSWRSVVEALAVPLGVTAGAALFAIAVLWLAIVLFDRRALRPAYRRAIRLIESDALNRA
FT                   LIRTAPAGLALLSLADGDEIVSNETMARYERLAAGAPLGKRLWRAYREHRDASGYAKVV
FT                   TCELPIAPDRADTPHVVANIMRTRYRGVDALLCTLTDITARKQMEQKLHEARVAAESAN
FT                   KAKSTFLATMSHEIRTPLNAIVGNLELMARAPLAPTERRRLDTIASSSDALLRIIDDVL
FT                   DLSKAESNQMTIERIPFDVRDVLDDIAAFYRPLASAKGLELTCRVAPELADGYVGDPVR
FT                   LRQIVSNLVDNAIKFTERGSVSIDAQRVVRGAGGARVEIRVADTGIGIPADSLPTLFDV
FT                   YIQADASIYRRFGGTGLGLPLCRRIATLMHGDLLVDSREGEGTTMCVTLPLPEAPPNWR
FT                   AAQPDVAAQAAPGSADVARDAAPIRVLVAEDHPASRALLRDQLEALHHSATIVENGIEA
FT                   MRAFFEAPFDVVLTDLGMPELDGYALANFLREQRAGVPVIAMTAHATEDDYRRCEQVGI
FT                   AELVLKPLSIAVLDAALARHAGRRAASARDTADTAHDAPPVLSDDVRDTLRAATHRSMA
FT                   SLGDAVTRGDVATLRLELHSMRGGFALAGDIDARDACAAMERAVEAGTVDANWPDFQQA
FT                   IARALARLDAGA"
FT   CDS_pept        complement(107926..108942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03304"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="COG2515: 1-aminocyclopropane-1-carboxylate
FT                   deaminase, Ralstonia solanacearum"
FT                   /note="KEGG, K01505"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03304"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45178"
FT                   /db_xref="GOA:A9AQJ3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AQJ3"
FT                   /protein_id="BAG45178.1"
FT                   /translation="MNLQRFPRYPLTFGPTPIQPLKRLSEHLGGKVELYAKREDCNSGL
FT                   AFGGNKTRKLEYLIPDALEQRADTLVSIGGVQSNQTRQVAAVAAHLGMKCVLVQEHWVN
FT                   YDDPVYDRVGNIQLSRMMGADVRLVPDGFDIGIRRSWEEALESVKQAGGRPYPIPAGCS
FT                   EHPLGGLGFVGFAEEVRAQEAQFGLRFDYIVVCSVTGSTQAGMIVGFAADGRADRVIGI
FT                   DASATPARTREQITRIARHTAELVDLGRDITDADVVLDTRYAGPEYGLPNEGTLEAIRL
FT                   CARLEGVLTDPVYEGKSMHGMIDKVRRGEFEPGSKVLYAHLGGVPALSAYSAIFADG"
FT   CDS_pept        109132..109632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03305"
FT                   /product="AsnC family transcriptional regulator"
FT                   /note="COG1522: Transcriptional regulators, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03305"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45179"
FT                   /db_xref="GOA:A0A0H3KIT9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIT9"
FT                   /protein_id="BAG45179.1"
FT                   /translation="MKLERKAASRGELAPALDRIDRAILRQLQRDASISNVNLAAKVKL
FT                   SAPACLRRVERLKEMGLIRGIVALLDPKPLGAGMLVVIGFVLDRSTPEAFAAFETAAQK
FT                   VSGCVECHVVTGEFDYFMLVRTRDNESFNRLHAEQLLYLPGVRQVRSFMVLKEILSTHA
FT                   LPV"
FT   CDS_pept        109938..110498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03306"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45180"
FT                   /db_xref="GOA:A0A0H3KNM3"
FT                   /db_xref="InterPro:IPR007540"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNM3"
FT                   /protein_id="BAG45180.1"
FT                   /translation="MKIKQLVVALGVSGALIGLAHAAPANDSQVSKKITLTAQINDGIF
FT                   VSKPDGSSWYSTEELEAVDYKQSKFQKTLPIRVWTKGADFNVSLAQELKLSSGNGYSMV
FT                   NPVVTLASAAGNKTLAFGKQEKITQVVAGNGGYDELHDLTIAVDAPTAVGNRSTNGSYS
FT                   GDLVMVFEPVAAAGGGGAGGAGQ"
FT   CDS_pept        110602..112884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03307"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45181"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJF7"
FT                   /protein_id="BAG45181.1"
FT                   /translation="MSAFQAPFQLNKLWLSAFLFIYSHSYAEVKVSYGVPEGFSAAEMD
FT                   DSANYVATFKGRTLPGFIRYSATAASLEFDAEKYAANGISPDEVDTIRSVVSQLDYKRC
FT                   RNGCDVEIAGYYVTIDKMKRSISIRDTREDYFVPETAFGLVNDQSVDVRAATDSYRAFN
FT                   LNGTTWVGLPSQSFGYLSWYVNHTETRGNTIGTQGVSSYYVQKNFAGTYVRAGKQNSID
FT                   YASGAVSTLLSPGFDQFVTVGSQRNLQVNRSVGSLILYATAEGNYEFYRGGRLILKRPA
FT                   ALGRNEISFADLPGGYYPVEVRLVDRSGHVVSQEVREINNVNFGRAAGNAWRFTVGKEM
FT                   REQGGFLMEAAMSRNFRQFYMNASTLAGHGGDWAAEINVTRPTMLADIDLSPTLGVLGG
FT                   ERGAGGYMTLAAAHEVLGNVMVSRYLNNDVSRFYRGTSSTSVSYSRNIRRATASYNYQR
FT                   SPFNETQQAEVRWNYRPNGLWATFALGVQKGSFVRGSGSGDYGVYFNMTMQLDRTQASF
FT                   NAAHSGGQTQLSGDYRKDFRDGFGTTTLGVTGSRVGSDYGMNVYGSRSGTRGDASLNVG
FT                   YNGDAANLDFNYRGMFAASPEGIAFGRYGGSGSAMLLRTPNIDGMNYGFNVEGNPVGGN
FT                   STYAVPLNAYSDVPFARVLSNSSKLDMNIEVPANILRAHPGQVYAASAKVDINMIYSGF
FT                   LTDQDGKPISGKIAETGDTVYRNGLFSIVSKRMLSDLTVAGDGYQYTCSLKDASGSYYR
FT                   CSAGVAQ"
FT   CDS_pept        112923..113588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03308"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45182"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSS6"
FT                   /protein_id="BAG45182.1"
FT                   /translation="MLSLMAGLLSAVAIPALAAGELMVTPATTRVVSEHDQRVTVKNMG
FT                   DEPMYLSISVQKVMNPGITPEQKVDLGDLERPGLIASPDKLTLGPNQSRQITLQSLTEV
FT                   PQEELYRLYIIPVKSLKVDEAPKDKITAPLSVSIGYGVLVRHLPKPLKQHAAWAHRCEN
FT                   GGITLESTGTVRSVFHDVSVGDGRPAQTVAVFPGMPQHFATKQIKLDAGDKPVTLTCE"
FT   CDS_pept        113597..114091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03309"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45183"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ02"
FT                   /protein_id="BAG45183.1"
FT                   /translation="MPAARAFAAGARRCAAGVLIAAYCTSSVAAGMLKLSRPELTLEAG
FT                   KPPGELWVENVGDTPLYLTVSQELVTNPGQMPEQRAPIDDVPHPGLLVTPNRLSLAPGQ
FT                   KYRMTLKVFAVPEETQVWRVTFRPNELIRVEGRDAERGPAPLFVSVGYGAVIYHLGRDK
FT                   R"
FT   CDS_pept        114156..115238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIU4"
FT                   /protein_id="BAG45184.1"
FT                   /translation="MLSIISAVIRRATESRRWIAFTVPMLACFVADHAYARATGFWLAE
FT                   LDISDRYHSCSWTDNGDGTSSVRVSIDYKPSEGRTLGQPFLSRGILVYAYDKNGGMFQS
FT                   SDIARAVYMGGNRHTIVGPGRGYIIYNGYQIGDGLNPPAYTWWGVTRAFTAQVTVIVDN
FT                   AKVEDWPALSIRAANYPSKLAEGLLPGSYFGYDVAEIKGAAYITRYGGSGNCPVVNPVT
FT                   PPEPPRSVAINVTAPNWDLGELPRGEGKKSFSGIDDALCFKYSASAVNGKRFVIDASSA
FT                   AGTVNGRYRLKNGAATIPYTVELAGGAGNIPLPNTGSMTVPLDSSGQSCWMPTFTTDVP
FT                   ADAKVGQYHDVLTFTVVTKT"
FT   CDS_pept        115286..115834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03311"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNM9"
FT                   /protein_id="BAG45185.1"
FT                   /translation="MTKRIAAYGLVAACMLPAFAMAQQVTLSGKTSSTITATVVPRDNF
FT                   DVTDEKGGWFDSGLEMKQLGGRDAPYEVEARLRVLSTSGTFQVRLDTPLEIRNQAEPQK
FT                   LFQRPSVTLAPDGGQPKSIVTGQGTTFSNPVPPVAGEDSVGYYTLAVAAYPPAGDFKAT
FT                   AGTYSGVLSLTFEPTIKTR"
FT   CDS_pept        115978..116655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03312"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45186"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJG2"
FT                   /protein_id="BAG45186.1"
FT                   /translation="MNLSLLARFSATFAACLMMPASALAAIDLIPKEVLIDGEETAVQV
FT                   INNGDRPEYVSISLSRLLNPGVPLADEKVEPVGESDAPALYAFPFKISLAPGQSKTITL
FT                   KPLRAVETETVYRLDVKPVLNVSSGEKARATGTVLVSLAFSGLVRQLPERAREGLSMTC
FT                   EAGGARLTATGNVRHTVKGAKVDGHLLDDFNVYPGVPLPLKGRVVSVPGQTACPEQAGA
FT                   GSS"
FT   CDS_pept        116690..116863
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03313"
FT                   /note="truncated AsnC family transcriptional regulator"
FT   CDS_pept        117108..118814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxB"
FT                   /locus_tag="BMULJ_03314"
FT                   /product="pyruvate dehydrogenase"
FT                   /note="COG0028: Thiamine pyrophosphate-requiring enzymes"
FT                   /note="KEGG, K00156"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03314"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45187"
FT                   /db_xref="GOA:A0A0H3KSS9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSS9"
FT                   /protein_id="BAG45187.1"
FT                   /translation="MAEYLAKTLAAAGVERIWGVTGDSLNGLSFSLSQIGSIRWMHTRH
FT                   EESAAFAAGADAASTGRLAVCAGSCGPGNLHLINGLYDCHRNHQPVLAIAAHIPSTEIG
FT                   LGYFQETHPQELFRECSHFAELVTNASQFPRLLARAMRTAIEERGVAVIVLPGDIALGD
FT                   GPDEAPRWHDAAPPSIVPADADLDRLAALLNASDAVTLLCGSGTQGAHDEVVALADTLG
FT                   APVVHALRGKQFVEWDNPFDVGMTGLIGFSSGYHAMESCDTLLMLGTDFPYRPFYPSNA
FT                   KIAQIDWKGSQLGHRAPLALGLVGTVKETIAALLPRLTRKTQRRFLENALKHYAAARKG
FT                   LDDLAVAEPPGRAIHPQYLTKIVDEVAADDAIFTADVGTPTLWAARYLTMNGKRQLHGS
FT                   FNHGSMANAMPQALGAQGAHPGRQVVSLSGDGGLSMLLGDLLSARQLNLPIKIVVYNNS
FT                   LLGFVSMELKAAGYLDTNVDLSATDFAAIAKGAGIFSVRVEHSENVEHALRTAFAHDGP
FT                   ALVDVVTSKYELAMPPKVELAHAKGFSLFMLRAILSGRGDEIVELAKTNLR"
FT   CDS_pept        119408..119968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03315"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03315"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ07"
FT                   /protein_id="BAG45188.1"
FT                   /translation="MYLTEEVHIARPVSRRARVEALPSGRQLARQIMMTVRAADVLLRQ
FT                   AIQVPDRHQWSVDTERVDAAGGPLAAWDSHVMFRVAKAFEPGVDANARAADPHQVAVEI
FT                   RLFLPEQAYVAERRIGVFGRRHGNHFGATLSVTAGSQWGGRRVEFVPPPGRHVRGDTLE
FT                   ALVDAVAPIVNAALAMTGFGVPK"
FT   CDS_pept        complement(120066..120941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03316"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03316"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45189"
FT                   /db_xref="GOA:A0A0H3KIU9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIU9"
FT                   /protein_id="BAG45189.1"
FT                   /translation="MKMLDHDVLATVVAVAETGNMTRAAEAVNRSQSAVSMQIKSLEDA
FT                   IGRPLFVRKPRSIVLTREGEVLLGFARRMLALRDEAWAAVVRPEVTGKVVIGVPDDYAS
FT                   SLLPSVLKKFSATYPKVEIQVIGLPSSALAPLLKDGTVDLVCGTRVKGLSGDFVRHEPM
FT                   AWAAMTNGPRVWEERPLPIAVFMPGSVARENAIRSLERAKVPYRTSYESPSLLGLLSMV
FT                   EAGLAVAPLARCAIPAQLSMLGRSHGLPDLPPLELILARSTKSKRPPCDFLAEQLMEDL
FT                   QRQTGQAGDA"
FT   CDS_pept        121098..122402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03317"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4949: Uncharacterized membrane-anchored protein
FT                   conserved in bacteria, Agrobacterium tumefaciens strain
FT                   C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03317"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45190"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNN4"
FT                   /protein_id="BAG45190.1"
FT                   /translation="MRAALAAELHARPFLRIGEAVSLTHYAVYADGQPDLHETLLHALC
FT                   RDTGMAAPHEGATHHAAQSRCGWYLKWERHTEFSTFTFVAPRRDTGYFDDLAIEGIPAA
FT                   WFARLAGIRFVAVRMELLSGDAARLVCADLRRWIDGPVLVGSNVLGGGKVFCDWHVRDD
FT                   GFMRFLVVDDDFREEQGGRLLQRLYEIETYRMMALLALPVARRMSGELDEIHASLHALM
FT                   QQMDAGGAGDDDASLLVKLTHLAVRVEALSGAGGRFSASRAYEKLVLARIQELREERIE
FT                   GMPTIAEFMERRFAPAMETCRSVWARHEQIAARIARAVDLLRTRVNLAQEKDVTRLLAG
FT                   MERTARNQLHLQHAVEGLSVAAISYYVLSLATAAFKALHVMKLPVDPELAEGVLIAPVV
FT                   FAVIHITRRTRAQLAHAEAAHDGGAVRVAALKQAS"
FT   CDS_pept        122433..122648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03318"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJG8"
FT                   /protein_id="BAG45191.1"
FT                   /translation="MTFSLNPSELFDGFDSFDGFDGFDEPMHDHAGTPEEAHVTSYQAV
FT                   LQEPMVSLVGSVDRPDVASVAILGYN"
FT   CDS_pept        complement(122866..124347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="BMULJ_03319"
FT                   /product="betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Bacillus subtilis"
FT                   /note="KEGG, K00130"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03319"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45192"
FT                   /db_xref="GOA:A0A0H3KST2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KST2"
FT                   /protein_id="BAG45192.1"
FT                   /translation="MSTVERSPSTATFVLPAAQIAGRAVRTHSDTAGAPIFNASTGATI
FT                   GWQEFATAAHVDDAVRAARDAFAGWRDTPPAERGRLLAAIAERVEAERARLAALQMQVS
FT                   GKPPFEADADVGDVAATFAYYASLCADPATFAAEAVALPSESFAAERFYDAVGVAALIV
FT                   PWNFPMVTTAWKLAPALAAGCTVVLKPSELTSPAEHALLEIVAAAGVPAGVVNVVNGGA
FT                   DVGAALTAHPQIDKISFTGSTAAGRHVMRAAAADMKRVTLELGGKSALIVRDDADLELA
FT                   VSLAVAGAFTNAGQMCSATARILVHDSVYRRFMAAFETAVRALVVAPPDVADVAMGPLI
FT                   SAAQRARVEAMLQQGIDAGARVAFSGRVADTGGDGYFMAPVVIAEPAADNVLWTDEVFG
FT                   PVACVKSFRTDDEAIALANDTRYGLVATVVTRDAAAARQFQARVRAGLVWINAPQLIYP
FT                   HVCWGGFGLSGIGRELGVAGLRSYQELRHAMRALD"
FT   CDS_pept        complement(124383..125333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="BMULJ_03320"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="COG0010: Arginase/agmatinase/formimionoglutamate
FT                   hydrolase, arginase family, Pseudomonas aeruginosa"
FT                   /note="KEGG, K01480"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45193"
FT                   /db_xref="GOA:A0A0H3KJ12"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ12"
FT                   /protein_id="BAG45193.1"
FT                   /translation="MHRELNQPMGGNEMPRFGGIATMMRLPQADTTDGLDACFVGVPLD
FT                   LGTSNRSGSRFGPRQIRAESVLLRPYNMATRAAPFDSLQVADIGDVATNPYDLKDSVRR
FT                   IEEAYDRIVANGCRPITLGGDHTIAWPILRALHRKYGKVAVVHVDAHADVNDTMFGEKI
FT                   AHGTPFRRAVEDGLLQCDKVTQIGLRGTGYHADDFDWCREQGFTVVQAEACWNQSLAPL
FT                   MAQVRERVGDTPVYLSFDIDGLDPSFAPGTGTPEIGGLSVQQGLEIVRGMKGLNIVGAD
FT                   LVEVSPPYDPAGTTALVGANLAFEMLCVMPGVAYR"
FT   CDS_pept        complement(125480..126385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03321"
FT                   /product="LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03321"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45194"
FT                   /db_xref="GOA:A0A0H3KIV6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIV6"
FT                   /protein_id="BAG45194.1"
FT                   /translation="MLLNVNPFHRDNDRFNVSFKALGELIETVGTPHFVPRLTQLLNEV
FT                   VPLDVLHVERSRVDGAMPTGYRCEWIGSSGIGTASAEISDVMTLYYERFLDSDPLFAGL
FT                   RGKTGTMLVVRDIAAIPPGEFRQRLFDDVRIGHECVLARGTRYAQHSIALERGRDRPPF
FT                   TLAEMNRFRSISDVLFPLLELHASTTAARRVAHPAPDVHPLAQFDARIAADGVKLSKRE
FT                   YETCKHLLSGKTVPETAEILGVRVASAESYVKRAFAKLGVRTKRELVAWGAAAPLPTAA
FT                   RGDAHDAAPGDDAAPSAAAD"
FT   CDS_pept        126591..126935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03322"
FT                   /product="predicted enzyme of the cupin superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03322"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45195"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNN9"
FT                   /protein_id="BAG45195.1"
FT                   /translation="MTKLIKDILPLGAGVGEFTKLDFGMDESDWRAAEGKSGNYIVGWW
FT                   EGKVGAVDFPETAADEAVWLVEGRIALTDVEGNRKEFAPGEGYLLPAGFAGRWETLEDA
FT                   KKFYVLLEKS"
FT   CDS_pept        127110..128564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03323"
FT                   /product="glycine/D-amino acid oxidase"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03323"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45196"
FT                   /db_xref="GOA:A0A0H3KJI1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJI1"
FT                   /protein_id="BAG45196.1"
FT                   /translation="MEVNEAKRTVPEPPHARRGAPAALSVEQALEHTKLSPYWLDNPAA
FT                   PAAEPALSGDVTADLLIVGGGFTGLWSAVQAKEQMPHLNVVLIEAGKVAHGASGRAGGI
FT                   ISTSVMHGLPNAVRVFPNDIAQLEAFGHRNLDGFEETLKRYEIDADVEWNGEMTVAVDP
FT                   DHVAHLQGDYELHRAYGHDVVLLDRDETLEQLNSPLFAGALWSRNRSGIVHPAKLAWGL
FT                   KRAALSLGVKLYEHTPLTAVTDEGSTVYVKTPNGSVRAPRVVFGSGTAKVGIADINRRV
FT                   MQVRDHVLATEPLTDEQLARIGWKNRQGVYDTRTQLNYFRLTKHNSIIFGGLVSYHFDG
FT                   DPNPQQDGRRETYYRLAQAFYRTFPQLSDVRFSHAWGGPIDYCSRGSVFAKRYLGGKAV
FT                   FVAGYTGFGVAASRFGAFMGLNILFDRDSPERKLDIANQSPSYIPPEPMRWIAAKITFH
FT                   AFDGADAEGGWKRAWINGIKAMGFPM"
FT   CDS_pept        128637..129557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03324"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03324"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45197"
FT                   /db_xref="GOA:A0A0H3KST6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KST6"
FT                   /protein_id="BAG45197.1"
FT                   /translation="MFSNTTDLDLRLIRVFLAVVDARGITAAEASLGVRQSTISTQLSA
FT                   LEARVGFKLCDRGRGGFRLTSKGERFAATARTLVAATSEFVARVRDIDRKLVGTLSIGL
FT                   IGQAPLVENARLAEAIGAFRKRDQAVTFSMKVASPQELEESLVNNQLDLAIGYFWHRVP
FT                   GLVYTPLFTEQQVIYCGRGHPLFHASRAVTADDLQAHDWVWRTYPVPEEQCPLPERRVT
FT                   ASADSIEAATILILSGGHLGYLPAHYAEPFEQRGLVKAVGRATFSFDVPMHLAMKRSTS
FT                   EKPIVDAFCDDLLRAFDIKAVALAA"
FT   CDS_pept        complement(129575..130960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgoT"
FT                   /locus_tag="BMULJ_03325"
FT                   /product="D-galactonate transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Salmonella typhimurium LT2"
FT                   /note="KEGG, K08194"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03325"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45198"
FT                   /db_xref="GOA:A0A0H3KJ18"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ18"
FT                   /protein_id="BAG45198.1"
FT                   /translation="MTQSASRTHANQPERPPHAHAGSALPTESASRATDATPSRKRLLI
FT                   LVLLFVTVVINYLDRSNLSIAAPELFRELNIDPVHAGLVFSAFGWTYALMQIPGGWLVD
FT                   KVSPRLLYAGALALWSAATLLLGFAGSFVGVIVLRLAVGALEAPAYPINNRVVTTWFPT
FT                   RERASAIGGYTSGQFVGLAFLTPVLAWLQVHLGWHMVFVATGLAGIVWAAIWYAVYREP
FT                   RAFRGVNAAEIALIRDGGGLVDLEDRVAARRERTPSTWRDLGIVLGRRKLWGIYLGQFA
FT                   LNSTLWFFLTWFPTYLVKYRGMDFIKSGFLASLPFLAAFVGVLCSGLLSDWLMRRGASQ
FT                   GFARKLPIISGLLISTCIIGANYVTSTGWVIAFMTLAFFGNGFASITWSLVSGLAPARL
FT                   LGLTGGMFNLIGNLSAIATPIVIGLLVDGADFSRAITYIAAMALAGSLSYGLLVGKVER
FT                   IDA"
FT   CDS_pept        131212..133023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03326"
FT                   /product="putative extracellular
FT                   endonuclease/exonuclease/phosphatase"
FT                   /note="COG2374: Predicted extracellular nuclease,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K07004"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03326"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45199"
FT                   /db_xref="GOA:A0A0H3KIW2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIW2"
FT                   /protein_id="BAG45199.1"
FT                   /translation="MRSTLRLFAPLLLLPALIAPALAVTAAPVSANCGGSATPIADIQG
FT                   PGAPSPLAGQNVSIEAVVTADFGGTDGFGGFFVQQADPQRRNQPGVSEGLFVYAPKARA
FT                   KAGDLVHVTGKVEEKYGQTQLTLSGAIAVCANGQTVTPATLTLPVESANAFAAYEGMLV
FT                   RLPQTLTVTDNYELGRYGSVLLSNGRLRTPTSVVPPSQAQTQIDANARNRLILDDGSNK
FT                   QNPASVPYPAPQLSAANTLRTGYTVRDVQGVLEVRYGAWRVQPVPGAAAPTFDARANPR
FT                   TNAPARDPHANLRVASFNVLNYFNGNGLGGGFDDPNNRGAKTYQEFQRQEAKIVSALKA
FT                   LDADVIGLMEIQNNGYGELSAVRQLAAKLGGAWRVVDPGTSRLGGDAIAVAMIYDSRKV
FT                   EPVGRAATLAIDDKNRQPLAQSFRRIGGKQALTIVVNHLKSKNCPDATNDDLDQGDGQG
FT                   CWNPTRTRAAAKLADWLAGTPTGVAGQGVLLIGDFNSYTYEDPIRLLESRGYRNLVSRW
FT                   IGANAYSYVYNGEAGYLDHALASLPLASHVKAVHEWHINADEPVALQYTLAYKSAEQQQ
FT                   TYYAPDAYRSSDHDPVLIDIALPGGGR"
FT   CDS_pept        133737..135587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03327"
FT                   /product="carboxypeptidase C"
FT                   /note="COG2939: Carboxypeptidase C (cathepsin A), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03327"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45200"
FT                   /db_xref="GOA:A0A0H3KNP3"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNP3"
FT                   /protein_id="BAG45200.1"
FT                   /translation="MKPDRSCTGNRIGRRGRLAGLGVLTIVTLVLAACGGDDSSSVGVS
FT                   SLAQATTSRQASAQQAADGTTPSANQPYVDPVAYSMNATDGLDPTQVAEKAAVMHYTWK
FT                   SGGTTVNYTTTTGHLTAADAQGNPEASMSYVAYTAPSTNGKPRPVTFVYNGGPGSSSIW
FT                   LRLGSFAPTRVATPDPLFGTNWPNYPLVDNQESLIDTTDLVFIDPPGTGLSEAVLPNTN
FT                   QKFWSSDADVNIMRDFIQRYLAVNNRSSSPIYLYGESYGTPRTDMLALALESAGVHLTG
FT                   IVLQSSILNYFADAIEAVAITQSTEGLLLDTDTVAGYLPGYAAVAAYFNQVSPAPVNQG
FT                   LYALQTELFTTLIYQQLQKYSQSWVLSQLGIPDALGTPVFPSDATLRLWSLPSGLTQQA
FT                   LRGYFNANPFGTSLLPGTTIGRYDGRVSLPNSDPRLQTDGDPSDILISQPFTNALATQL
FT                   PDYLGYSAPNATYVPLNDSIIEVWDFSHDGQPMPDTIPDLLGALQLNPQLQVLAENGYH
FT                   DLATPFFSTEKELARLQTVKGLNPKLQVNFFQGGHMIYLDDVARPQMKRDLKRFYQGSR
FT                   IPTALTLRMLPPPWPDQSPAGTPTGSTPGSGAATAVAAAL"
FT   CDS_pept        135681..136070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03328"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJI6"
FT                   /protein_id="BAG45201.1"
FT                   /translation="MSPLIVVAATIGSAHALPPQPVAPVKLPHGARGVDGPFFPSHRVA
FT                   PVLPSTGTTLQQQAQRRVDARLGGNTVLSNGAAVTKAQAQSSGLGYIAKHFDEIDAKHT
FT                   GRVTMSDVRQYLQQRQLQQQQEQQE"
FT   CDS_pept        complement(136149..137627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="BMULJ_03329"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="COG1104: Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes, Pseudomonas aeruginosa"
FT                   /note="KEGG, K04487"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03329"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45202"
FT                   /db_xref="GOA:A0A0H3KSU2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSU2"
FT                   /protein_id="BAG45202.1"
FT                   /translation="MSDSTPFHYLDYAATTPADPRVIEAMTTCLGFDGIFGNPASSSHN
FT                   AGRLARQKVEHARKQVAALIGAHADEIVWTSGATESNNLALKGYADTATERRHLITSRI
FT                   EHKAILDTMANLSKRGMTVTWLSPTADGEITADAVAAAIGPDTGLVSLMLVNNELGTLT
FT                   DVGAIARIVHAAGALLHVDAAQALGKTPIDVHALGIDMMSMSAHKVYGPKGIGALYVRR
FT                   DIAERIAPQIHGGGHERGLRSGTLATHQIVGMGVACELAAAKLDSEAARIAALATRLKD
FT                   AVLALGDVTHNAAAAARIPHTLSLTVDAPGFLPFMLGDTLAVSSTSACNSTSGAPSHVL
FT                   TAIGLDAGAASRTVRVSLGRFTTEQDIDAAIACFRRAIEQCRAAASSGFAASRQITPAD
FT                   LRAIRDAGYRAVICNRPDGEDADQPAFEEIAAAARELGLDARYLPVGRDEIGDADVEAF
FT                   AALVDALPKPVLAYCRSGSRAGMLWHRLTMRSAA"
FT   CDS_pept        137970..139139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03330"
FT                   /product="predicted membrane protein"
FT                   /note="COG3503: Predicted membrane protein, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45203"
FT                   /db_xref="GOA:A0A0H3KJ23"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ23"
FT                   /protein_id="BAG45203.1"
FT                   /translation="MPIRSFPAVPTTAGARLIAIDALRGLVMLLMLVDHVRETFFLHRQ
FT                   VSDPMDALTVDPALFFTRLTSQLCAPAFVFLTGLSAWLYGRDRPVADTASFLVKRGAFL
FT                   IFLEVTFVSFAWTAEFPPSTLWLQVIWAIGLSMLALAALLRLPRGVQFALGVAIVAGHN
FT                   LLDGIRLEPDSAGFVPWAILHQRAFIDLWDGVRARTSYPVLPWIGVILLGYAAGPWFAR
FT                   GVAPGVRMRRLATVGFALVVAYVALRGLNVYGDKPWIATGEALRTTMSFLAATKYPPSL
FT                   MFLLPTLGATLLLLAAFERRDRCAVAQRLATVGGAPMFFYLLHLYVLKALYLVALATFC
FT                   ANQGNYFGFDALWGVWLASALLIVPLYWPAAWFARLKQRRKEVGWLKYL"
FT   CDS_pept        139136..140281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03331"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03331"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45204"
FT                   /db_xref="GOA:A0A0H3KIW7"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIW7"
FT                   /protein_id="BAG45204.1"
FT                   /translation="MSRTKRPRAAMPASLALALLAVDDARASSVVLYGIVDASIVYTRN
FT                   GGHSGSRVELQSGSLSGSRVGIKGVEPLGGGAAALFQLENGFNAVNGRLNQGGRLFGRQ
FT                   SHAGLRTPGGHTVVAGRLYDPLTDLVQPLQGDGYLGQTFSTPGDVDNADASARLNHALK
FT                   WSSARLGAWQASALVSLGGVPGAMGSGLSHGAALAYRHGAFAAAAGYLHVDLGNALHGR
FT                   RGRSSADSLFNSAVNAAYASAASVQIARVAAQYAIGSLAIGAYYGDARYRPDGASRFGH
FT                   TQAFRNASLYGVWQATPTVTAVIAYNQLHASGDSAARYRQVSAGASMLVSKRTDFYATA
FT                   AYADARGTNGLGAAQAVVGATGADAGGPTQVRLNAGVRHRF"
FT   CDS_pept        140460..141413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03332"
FT                   /product="AraC subfamily transcriptional regulator"
FT                   /note="COG4977: Transcriptional regulator containing an
FT                   amidase domain and an AraC-type DNA-binding HTH domain,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03332"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45205"
FT                   /db_xref="GOA:A0A0H3KNP9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNP9"
FT                   /protein_id="BAG45205.1"
FT                   /translation="MRRIGLVVVPQFQVMSLLALSVFDIANLRAGRALYEVSVISEDGG
FT                   PVEASFGMVASTKPAHASELHTVFVGASLSTPPLTDRMRELLLDLSGKVERMASICLGA
FT                   FLLAEAGLLDGRRATTHWAFLERFRDRYPSVAVEKDCIFVRDGSVWSSAGMSTAIDMAL
FT                   AMLEDDLGADAALQVAKDLVLERWRRTGAQPQNSVLIEHPARTNRIHAVITHIRANLST
FT                   DLTVAKLADVARMSKRQFTRRFKDETGLTPAKAVERIRLETARDFVTSSSWTIDTIARE
FT                   TGYADPERMRRSFVRAFGQPPQALRRLRKPETTGAD"
FT   CDS_pept        141797..142438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03333"
FT                   /product="putative response regulator"
FT                   /note="COG4566: Response regulator, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03333"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45206"
FT                   /db_xref="GOA:A0A0H3KJI9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJI9"
FT                   /protein_id="BAG45206.1"
FT                   /translation="MSDAAIKDDSTGVVYVVDDDPAMRASLDTLLRSMGLRVATFASTA
FT                   ELRAAEREDVSSCLLLDVRLRGESGLVFQQAHDRPPVPIVVITGFADVEVCRKALKGGA
FT                   VDFLVKPFTEQELIDAVNIALSLDAARRSRNDTRQQLQQSFELLTRREREVLAYVVSGA
FT                   LNKQIASHLGLSLITIKQHRASVMRKMNASSLADLVRKSEAIGVPLSAGC"
FT   CDS_pept        complement(142520..143827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydH"
FT                   /locus_tag="BMULJ_03334"
FT                   /product="two-component system sensor histidine kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="HydH protein"
FT                   /note="KEGG, K07709"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03334"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45207"
FT                   /db_xref="GOA:A0A0H3KSU8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSU8"
FT                   /protein_id="BAG45207.1"
FT                   /translation="MPHFRHSASRAARKLQLEHLVPMSTSATFAPDPLAAARSAESELF
FT                   LSAPIPILIEDWSRVYRAIKDLRASGIDNIDCYFDEHPEAVAQLRAQHSFVAANDAVVR
FT                   LFDADSREHFLQHARILLPADRLSNSAVLRAMYENRPTCQGERTLTTLKGRTVPIVWRC
FT                   SLPKDEDGYRRLHFYAFDVTEQKENSDRLEALRAEMARASRVSLFGEMSASILHEVSQP
FT                   LSAASASAEASLRWLARDEPNIAEATAAIANAARWARDATDICRKIRSFIGKAPVQSID
FT                   CPAADVVTAALFLIAPEAGARDVHVETAVDPDARIFADPVQIQQVLANLLLNGIQAIDM
FT                   GPSRARTLTLTVTVNGNEVVFDVRDTGPGIDPAAIEQLFQPFFTSKRDGMGMGLPVARS
FT                   IVEAHNGRIWAHGERGAGCCFSFALPARSGRPDPAE"
FT   CDS_pept        144126..144653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03335"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45208"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ28"
FT                   /protein_id="BAG45208.1"
FT                   /translation="MTQPTCVHDDVFERALMRLLDPSRVPATGDGAAEAMDRSGQLARQ
FT                   GRGKAAEDDGAPPRARIRIVEILSSSSVSIRWSDPQSGYFGEQVWHCVTARTSSQCVLT
FT                   GMPINRGDRVYRPRGRGRSVPCNWARMIHAAAVASFARSASRAAGGITPSGERDRQDGA
FT                   RHALPASVAAPP"
FT   CDS_pept        144802..145170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03336"
FT                   /product="CheY-like signal receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03336"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45209"
FT                   /db_xref="GOA:A0A0H3KIX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIX2"
FT                   /protein_id="BAG45209.1"
FT                   /translation="MHDKTVCIIDDEWAVRQSLESLVRAIGARVQLYDSAEAFLEHGRH
FT                   DASHCIVCDIRMTRMSGLELLACMRARACDVPFIFVTAHLTAHRELEARRLGALCVLEK
FT                   PFDPAELVQWMTRALAGR"
FT   CDS_pept        145280..146134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpo"
FT                   /locus_tag="BMULJ_03337"
FT                   /product="chloride peroxidase"
FT                   /EC_number="1.11.1.10"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Mesorhizobium loti"
FT                   /note="KEGG, K00433"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03337"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45210"
FT                   /db_xref="GOA:A0A0H3KNQ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNQ3"
FT                   /protein_id="BAG45210.1"
FT                   /translation="MANDTSSLNARTQFVDVDGRRLAYRTFGRGTPLVLCVRFRGTMDT
FT                   WDPLFLDTLVERGFQVTIFDYSGLGQSTGERTYHPASLAKDAIDLIVALKLGKAVIGGW
FT                   SVGGMAAQIVVAKAPQLVSHAVLIATTPPGPLVKPGEPLFYAMAKRENDFEDFVTLFFE
FT                   PASPASRAAAEQSAARVAARKVDLSPAVPVEWAGQQVGDGPKNPAFPVDAVLDALKSTS
FT                   IPVLHVGGDHDIVFPVENWYALNGQLPTLHLVTLPRTGHGPQLEYPVACASHIAAFVGT
FT                   RIG"
FT   CDS_pept        146235..146954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03338"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJJ4"
FT                   /protein_id="BAG45211.1"
FT                   /translation="MDDLVDRAIRAAGGMDRYRSFRSVSAQLHHTGAIWKLKQRDGVLT
FT                   DSRVTVQLHEQRVSHAPFAPTTDHSVYTPARVEIRRADGSVVEALDAPRASFDGYEMET
FT                   PWSNAQLAYFAGYTMWTYLTSPFLLRHDGVSSREIEPWRVDGLPWRRLRVEFPPEIATH
FT                   SAVQTFYFDADGLLRRHDYEVDIQGRNAAVRYLGDYVDVQGIRMPTRFRIYPRTAENRA
FT                   LPAPLIVGVDLSNFRFE"
FT   CDS_pept        146966..148012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="BMULJ_03339"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="COG1064: Zn-dependent alcohol dehydrogenases,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00001"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03339"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45212"
FT                   /db_xref="GOA:A0A0H3KSV4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSV4"
FT                   /protein_id="BAG45212.1"
FT                   /translation="MANSATYRAAVVKAPGQLELVERPMPDPAPGQVRIRVEACGVCHS
FT                   DSATVEREAPVGAPPRVPGHEVVGRIDALGDGVAGWRVGERVGVGFLAGEDRTCPSCRH
FT                   GDVVNCENPIITGMTTDGGYAEIMLAQARGLVRVPEDLDAAEAAPLLCAGLTTFNALRN
FT                   AGARAGDVVAIHGLGGLGHLAVQFARKMGFYTVAIARGADKAALAAQLGAHRYINAAAD
FT                   DVAATLRTLGGAKVVLGTAPTGTGMAETVAGLAARGKLIVVAVPGEPIAVNAVDLVFGG
FT                   RSIVGALTGTVADNEETLAFARLQNVRPMIETFPLEHAQAAYDRMMRADVRFRAVLTMH
FT                   SAPTGVSA"
FT   CDS_pept        148009..148728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ32"
FT                   /protein_id="BAG45213.1"
FT                   /translation="MNTIAQSVIDAHGGLAQWRKFRQVSARLVQGGALWGLKGFAGVLD
FT                   ETTVTVATDRQWASHAPVGALAARSEFTGDRIALLDSAGRVLAEREDPRGSFDGHALET
FT                   RWDELQLAFFAGCAMWTYLNVPFVLAWDGVRCDDDGVWEEQGETWRRIRVHYPDTLEVF
FT                   SKAQTIYVGPDGLIRRLDYDVEIAGNTAGAHYVSDYTTVSGIRFPTKRRIYPRTPDGHA
FT                   LPEPLVVSIDLHDIALS"
FT   CDS_pept        148773..149627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03341"
FT                   /product="predicted hydrolase or acyltransferase"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03341"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45214"
FT                   /db_xref="GOA:A0A0H3KIX9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIX9"
FT                   /protein_id="BAG45214.1"
FT                   /translation="MTAIDSSTVPTRYVDAFGVRYAYRRFGNDGGGRPLLCLQHFTGTL
FT                   DNWDPAIVDALARDREIILFENAGVGRSGGQVPTSVAQMAEHVLRFVDALSLDTLHILG
FT                   FSLGGFLAQEIAIARPALVERMIVSGSAPEGGEGAGMDRPELLAIYTDAEMPMSEKLKR
FT                   LFFPATQEGQAAAAAFVVRLAARSAEPDLPAGPEVASAQLQAMIAWANWSGDVAQKLSR
FT                   IRQPVLVTNGDDDRMIPTANSFVLAQGLPNATLIVYPNSGHGALFQYAQTYVAHVTEFL
FT                   RGA"
FT   CDS_pept        149663..150670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03342"
FT                   /product="ferredoxin subunit of ring-hydroxylating
FT                   dioxygenase"
FT                   /note="COG0604: NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03342"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45215"
FT                   /db_xref="GOA:A0A0H3KNQ8"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNQ8"
FT                   /protein_id="BAG45215.1"
FT                   /translation="MKAIVYAKAGVPIDDPTALYDTDVPVPAPGPRDLLVKIEAIAVNP
FT                   VDSKLRLGVQPAGPRILGWDAAGTVEAVGSDVELFEPGDKVWYAGDIARPGSYAEYGLV
FT                   DERVASRRPATLGAADAAALPLTAITAWELLFDRLKVAEHGGAGQSLLVIGAGGGVGSI
FT                   LVQFARKLTALTVIGTASRPATHAWVAELGAHHVIDHGKELQPQLNAVGIDHVDHVISL
FT                   THTDTYYAQIVDVLKPEGQLALIDDPDTLDAMPLKRKSISLHWEFMFTRSMFRTPDMIR
FT                   QHALLERVASLIDDGVLKSTVGEHLGKIDAANLRRAHALIEAGRAKGKIVLEGF"
FT   CDS_pept        150769..152133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="BMULJ_03343"
FT                   /product="mercuric reductase"
FT                   /EC_number="1.16.1.1"
FT                   /note="COG1249: Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes, Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K00520"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03343"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45216"
FT                   /db_xref="GOA:A0A0H3KJJ6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJJ6"
FT                   /protein_id="BAG45216.1"
FT                   /translation="MADVKRVDFLFLGGGKGGKSLAMDMARRGKRVAVIERGMIGGSCI
FT                   NVACIPSKALIHHARSMHAWREAAKRHEVTADMAAVSTYVASVVNGMVDVNRRAFEQSG
FT                   LELMIGTGRFVAPRTIAVRTDDGAEAIYEGENVYINTGTVAAIPDVPGLRDAQPLTHVE
FT                   ALRLTTLPRHLIVIGGGYIGLEMAQAFRRLGSAVTLVTDTPRVAMREDEDVGTVIQQAL
FT                   ADDGIQLMLAAKLVDVQGKSGERVTVRLADGSVVEGSDLLVATGRKPQTDGIGLERAGV
FT                   ETDARGFIKVDPQLATTAERTWAIGEVAGTPMFTHASFDDYRVLKAGIEGRPASTAGRI
FT                   IPYALFIDPELGRIGLNEADAKARDIEVRVAKLPMASVPRARTDGKTRGFMKALVRPDT
FT                   GAILGFTMVGTGAGDVTTAVQMAMLGGLPYTAVRDAIIGHPIVSEGLNLLFATLG"
FT   CDS_pept        complement(152454..152828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03344"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1733: Predicted transcriptional regulators,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03344"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45217"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSW1"
FT                   /protein_id="BAG45217.1"
FT                   /translation="MRHLPLGKHDHHTPATAASGIEEAIQMLEGRWKLVILFHLFGGKT
FT                   LRFSELERAIPGISQKMLIQQLRQLEQDGIVARIVHPQVPPKVEYHMTDWGQSLCPALD
FT                   ALLTWAEQRPTPGRQRKSKS"
FT   CDS_pept        152879..153223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03345"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45218"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ37"
FT                   /protein_id="BAG45218.1"
FT                   /translation="MKTSSHDASNLPRAIVSFFSHLATDPQAVARCFTEDAVVLDERRE
FT                   HYGSAAIAAWNADVIAKYACTTEPVSSQTIGAQTTVTANVSGNFPASPIRLRFRFTVAG
FT                   DLIIRLEISP"
FT   CDS_pept        153220..153999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03346"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03346"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45219"
FT                   /db_xref="GOA:A0A0H3KIY4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIY4"
FT                   /protein_id="BAG45219.1"
FT                   /translation="MSFDLELEGRRVLVTGGTKGVGAAVVSAFVEAGARVVATARTVPA
FT                   DSPGVHYVAADVTTAAGCALVASEVLTRLGGIDIVVNVLGGSSAPAGGFAALSDDEWEK
FT                   ELSLNLMPAVRLDRALLPSMLAQGSGVIVHVTSIQHVLPLPESTTAYAAAKAALSTYSK
FT                   ALSKEVTPKGVRVVRVSPGWVETEAAVRLAERLAAEAGTDYEGGKQIIMKALGGIPLGR
FT                   PAAPREVADLVVFVASPRAGSVTGTEFVIDGGTVPTA"
FT   CDS_pept        complement(154553..155521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03347"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45220"
FT                   /db_xref="GOA:A0A0H3KNR2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNR2"
FT                   /protein_id="BAG45220.1"
FT                   /translation="MAFDGHSRYKLNRPITAAESSARLHINERCADRAKSAGTVFEATD
FT                   SYLEVCDGLYREKGWGLLAFSTAGVLFLCLVAMFMWMATHMPIAVREKGQEGVVYTLLA
FT                   IFTLVGVCGLAVTVRALLVDCFNYTRKPIRFNRLDRTIYAFRHNGPGGVLSIPWDNAFL
FT                   YIERKPKAGLAATAARVIRCLVLDDQGRVVDTFSIGKYVELAFDENSPAGQLAMEELYQ
FT                   DFEYYRRFMQEGPSAVPPVSEFLTTEVSLRNSLKLQFDGASDLVKSGNPVVFLVTVIAT
FT                   LPTFILAVAYYIAQRTCREPVWPEEVERACNAAMPSKELPV"
FT   CDS_pept        complement(155726..157555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BMULJ_03348"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COG0449: Glucosamine 6-phosphate synthetase,
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains, Ralstonia solanacearum"
FT                   /note="KEGG, K00820"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03348"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45221"
FT                   /db_xref="GOA:A0A0H3KJK0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJK0"
FT                   /protein_id="BAG45221.1"
FT                   /translation="MCGIVGAVAQRDILPNLVDGLTRLEYRGYDSCGVVVYRDRALARA
FT                   RSVDRVANLQRDIAAQALSGYTGIAHTRWATHGAPVTQNAHPHFSPSDTDARIALSHNG
FT                   IIENCDQLRAELEAHGYVFASQTDSEAIAHLIDHLYDGDLFDAVQRAAARLRGSYAIAV
FT                   MCRDEPHRIVGARDGMPLVVGVGDGENFLASDAIALSGITDRIAYLENGDVADIQLHRY
FT                   WIVDAAGQRVERAVQRVAAHSGAADLGSYRYYMQKEIFEQPQAVADTLLDVTSIMPELF
FT                   GDGAWRVFNDVDSVLLLACGGSYHAALTAKYWIESIAKLPTNVEIASEFRYRDNVPNPR
FT                   TLVVAVSQSGETADVLGAVHVAKQRGMMQTLAICNVATSALMRECALQFVTRAGIEIGV
FT                   ASTKAFTTQLVALFLLTLSLAQVRGRLSEDDEHAHLRALRHLPDAMSKVLALEPQIMGW
FT                   SELLARRDDMLFLGRGMHYPIALEGALKMKEISYIHAEAYPAGELKHGPLALVSNEMPV
FT                   IAVAPNDMLLEKLRSNMHEVSARNGKLYVFADVDCGLSPSEGIEVIRLNEYYGPLSPIL
FT                   HTIPMQLLAYHAALARGTDIDKPRNLAKSVTVE"
FT   CDS_pept        157713..158210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03349"
FT                   /product="AsnC family transcriptional regulator"
FT                   /note="COG1522: Transcriptional regulators, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03349"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45222"
FT                   /db_xref="GOA:A0A0H3KSW6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSW6"
FT                   /protein_id="BAG45222.1"
FT                   /translation="MPGITLDDLDLRILAILQDDASVSNLQLAERALSSPPTCMRRVRR
FT                   LTEAGVIRRQVAMLDPVAIGTAVTAIIEISLDRQTAEDYDAFEAYVCAEPTVTQCYRVS
FT                   PGPDFVVVADLADVAEYDEFARRLFTGASNVRNVRTFFSTHRAKFETNARVGHAMRKRG
FT                   GE"
FT   CDS_pept        complement(158250..158783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="BMULJ_03350"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="COG0350: Methylated DNA-protein cysteine
FT                   methyltransferase, Ralstonia solanacearum"
FT                   /note="KEGG, K00567"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45223"
FT                   /db_xref="GOA:A0A0H3KJ39"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ39"
FT                   /protein_id="BAG45223.1"
FT                   /translation="MTPAHLIPSPLGDIAVRIEDDALTGLFFVGQKYYPSLAIAPGADV
FT                   YRTSPVARTVADEIAEYFAGARTTFSVPVHLRGTAFQRSVWKELLAIPFGTLVSYGELT
FT                   ARVGLPASAARAVGGAVGRNPVSIIVPCHRVVGASGSLTGYAGGIERKRALLSLEGAGL
FT                   GHGGWYSGQQVLAF"
FT   CDS_pept        complement(158780..160243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="BMULJ_03351"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="COG2169: Adenosine deaminase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00567"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03351"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45224"
FT                   /db_xref="GOA:A0A0H3KIY8"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIY8"
FT                   /protein_id="BAG45224.1"
FT                   /translation="MRLDPDICYDALLSRNRRFDGWFFVGVRTTGVYCRPVCPVKPPKA
FT                   QNCRYFPTAAAAEKAGFRPCMRCRPELAPGHGLLDVSGNLANAAATLIDDGFLNDRSVH
FT                   ALAQRVGVTERHLRRIFAAQFGVSPVEFAQTQRLLMAKRLLTDTALPVAVVASTAGFGS
FT                   VRRFNDLFLQRYGLNPLRLRKSAAAGASAGGDMTFPLPYRPPFAWQELMRFLAQRQIDG
FT                   VEWIDAQRYLRAVDLPAPRGAGRVTGWVSVSHVPHRFALAVTVSPALTPVVPTVLARVR
FT                   RLFDLDSRPDVIDAHLGELADGSPGLRVPGAFDGVEIAIRAIVGERLETMHADAVLARL
FT                   AAHFGPRVDSGAPPTLAHAMPPVSTLAALPPAALRSIGVARDAAEAIVSLAQAVAEGTL
FT                   ALEPMAPLDATLAALRAMPGFDERAVQYVAMRAMAWPNAFPADERLLLATQAGDRPPVA
FT                   SSLPRTSRWAPWRAYAALHVWRLHGDALR"
FT   CDS_pept        160588..161877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exuT"
FT                   /locus_tag="BMULJ_03352"
FT                   /product="hexuronate transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Caulobacter vibrioides"
FT                   /note="KEGG, K08191"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03352"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45225"
FT                   /db_xref="GOA:A0A0H3KNR7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNR7"
FT                   /protein_id="BAG45225.1"
FT                   /translation="MQSAVVGVVRAASRYRWTVCALLFFATVINYMDRQILGLLAPMLQ
FT                   HDIGWTQVQYGRIVMAFSAFYAIGLLGFGRIVDWLGTRISYAVAMLVWSIAAMLHAAVG
FT                   SVAGFAFVRALLGIGEGGNFPAAIKTTAEWFPRRERALATGIFNSGANIGAVFAPAIIP
FT                   AIAVAYGWRAAFVIVGAIGIVWLAVWLVFYRAADTRALAAEYDEPRDEAEALDAANADA
FT                   GAPRWRELIRKRETWAFLIGKFLTDPVWWFYLFWLPKWLNESRGMDMQHIGLPLVCIYA
FT                   LTTVGSIGGGWISSMLLRAGWSVNRARKTAMLICACCVLPIAFVSQVQNLWAAVLIVGL
FT                   AAAAHQGWSANLFTTASDLFPRRAVASVVGIGGMAGSIGGVLFSEVIGQVLQRTGHYWV
FT                   LFAIGALAYLLALAIMHALTPKMKPAKLDA"
FT   CDS_pept        complement(161927..162919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03353"
FT                   /product="LacI family transcriptional regulator"
FT                   /note="COG1609: Transcriptional regulators, Vibrio
FT                   cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03353"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45226"
FT                   /db_xref="GOA:A0A0H3KJK5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJK5"
FT                   /protein_id="BAG45226.1"
FT                   /translation="MKKVSPTIRDVAAEAGVSVATVSKYVNGTQRFSPSVEARLKDAIE
FT                   RLGYRSNPLARSMITGRTRTIGLVILDISNPHFTNVVKGANRVALQHDYTLLLVDTEEN
FT                   QARERSLIEALAQRVDGLIVSTRMPDEEAGWMLDLHKPLVLLRRSPGLPIPSVGIDNRL
FT                   STYMLARHLLNLGHTRIAYLGFGPARVNDERIEGARDCLAEAGLTLDVYDAHAPTAEAG
FT                   ERACSRVMLGPQRPQAVICYNDLIALGFMKEAASLGFRLPQDVSVTGVDNVPYGEYAAP
FT                   ALTTVDIQSENMGELAMQKLIDALAGRTDASYSTFEPRLIVRASTAPAA"
FT   CDS_pept        163120..163953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="BMULJ_03354"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="COG0451: Nucleoside-diphosphate-sugar epimerases,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01784"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03354"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45227"
FT                   /db_xref="GOA:A0A0H3KSX3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSX3"
FT                   /protein_id="BAG45227.1"
FT                   /translation="MNASTTGTRKPFRRLLLTGAAGNLGRQLRGALAEWADIVRVSDIA
FT                   SLGEAAAHEEAQVVDLADRPAVMHLVEGVDAIVHLGGISVDAPFDDLVGANITGTYNIY
FT                   EAARRHGVKRIVFASSNHAIGFHPVTEVLDADAPQRPDSLYGVTKCFGEALSRYYFDRF
FT                   GIETVCLRIGSSFEEPKNPRMLVTFLSYRDFIELVRCSLLTNRVGHAIVYGVSDNPVKW
FT                   WDNTKAGFLGFRPRDSSEQFAGLFPIAAPTADYDDPAQRFQGGAFVVGEPMERRA"
FT   CDS_pept        complement(164021..164341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03355"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5470: Uncharacterized conserved protein,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03355"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45228"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ45"
FT                   /protein_id="BAG45228.1"
FT                   /translation="MTAYAIAHLHDVEMCDDIVEYLERIDDTLAPFGGRFAIHGARPDV
FT                   REGTWHGDLIAIAFADMATARAWYESDAYRQIRPLRARHASGPLILIDGVDEHHKATDI
FT                   LR"
FT   CDS_pept        complement(164445..164765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03356"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03356"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45229"
FT                   /db_xref="GOA:A0A0H3KIZ4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIZ4"
FT                   /protein_id="BAG45229.1"
FT                   /translation="MDALPNSSDTSFQIFLAKLLEQPLPEWTEKQQMELEMARALSTEM
FT                   VRLAESLRGSTDLARCLVLLRYSKVLDFILTSLAARRDIHPQTLRTLFRLANLKVDDAY
FT                   PV"
FT   CDS_pept        complement(165291..166919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03357"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03357"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45230"
FT                   /db_xref="GOA:A0A0H3KNS0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNS0"
FT                   /protein_id="BAG45230.1"
FT                   /translation="MPDSASLQQLFPALDQIPAEFRLSAPIHQRVSLVDGELRPWDGAT
FT                   KTVLSPVCARQPDGSVEQVEIGSYPVMGEAESDAALDAAVRAYDAGRGEWPTMKVEQRI
FT                   ACMQDFIKRMVAQRELVVNLIMWEIGKSLADSQKEFDRTVTYMTQTIEALKELDNANSR
FT                   FVIAEGTIGQIRRTPLGVVLCMGPYNYPLNETFATLIPALLMGNTVVFKPPQYGTLLFE
FT                   PLLEAFRDAFPKGVINTIYAPGAVVVPHMLASGKINVLALIGSSKVADHLKKQHPKSHR
FT                   LRAILGLDAKNAAIVLPDADLDLTVKECLLGALSFNGQRCTALKMLLVHRSIVDEFLKR
FT                   FTAALEQLKIGMPWEKGVSITPLPGMHRTAYMTDAIDDAKAKGAQVVNESGGAFCKTLF
FT                   YPAVVYPVAEGMKLYREEQFGPIIPVAPFDDVETALDYVTTSEHGQQVSIFGSDPAQIG
FT                   ALVDPLVNQVCRVNINCQCQRGPDVFPFAGRKDSAEGTLSVTDALRAFSIRSMVAAKQT
FT                   ESSKQLLDTIVSDHYSKFINTGFIF"
FT   CDS_pept        complement(167397..168350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03358"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03358"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45231"
FT                   /db_xref="GOA:A0A0H3KJK9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJK9"
FT                   /protein_id="BAG45231.1"
FT                   /translation="MRKFKIPNMGALVAFEAAARHESFTHAAKELFLTESAVSRQIATL
FT                   ESSLGVRLFARVKQRVVLTRAGKLYGTQVRRALEALDRDTLSIIAHGSGGGYLELAVLP
FT                   TFASHWLIPRIKSFYDRTPDVRVNMGSRTDLFSFEDTHFEAAIHYGKPTWPGTSSDYLF
FT                   GEEVVPICSPALLDGPVTRVDDLLAYPLLHSTTRPGAWAQWFEAHGVEDIRTMQGVRYE
FT                   LHTMLISAAAAGLGVALVPKFFVEGQLQQLGLVVPCDAATVGDSAYYLVYPTEFSHSKP
FT                   LELFRAWLLEQASAYAAPRHEAVTVETDAEDDEDVE"
FT   CDS_pept        168571..169599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03359"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45232"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSX9"
FT                   /protein_id="BAG45232.1"
FT                   /translation="MRNPNIDSLLTKLLGQAKTDALFATLNMPSIFDEWETGVVTRAEI
FT                   TQAMNMALFEGLLERSPNGRAYTAETVEKGGSVYFDHGALRTVRWPHNGALPPGEAAFT
FT                   RILRPLGFRLNGRYPLDKLGMTGRAYAHEDAPDEIAQFFVSELHPERFSKEFQQAVTNV
FT                   IGSSRDPLSPAAVALLWEVEREGWLPLDAAHELLPAIVGAFARQHDVPSELDYETLLLE
FT                   SAEMAWIATEGNAFNHATDRVVDVFALSDEEKAKGRPMKPEVERSRSGRVFQTAYRADI
FT                   VEREFRTRDGGIVKRNVPGSFYEFITRRRTFDQAQRRWVTDLRFDAGNAQGIFKMTANA
FT                   SR"
FT   CDS_pept        complement(169828..170025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45233"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ50"
FT                   /protein_id="BAG45233.1"
FT                   /translation="MNEDKIKGQWKQLTGKLKAKWGKLTDDDLAVAEGNRDYLVGKIQE
FT                   RYGIARDEAERQLKDFDSEL"
FT   CDS_pept        complement(170083..170430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="BMULJ_03361"
FT                   /product="hyperosmotically inducible periplasmic protein"
FT                   /note="KEGG, K04065"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03361"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45234"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KIZ9"
FT                   /protein_id="BAG45234.1"
FT                   /translation="MNKPQHLSTLLAASAAFLLGAAPLTNAHAQASATGDTKAESNQPV
FT                   TDTWITTKVKSELATTDGVKSMDIDVKTVDGVVTLTGVLPTKIAVKKAIAVTRSIKGVK
FT                   HVDASGLKAKA"
FT   CDS_pept        complement(170489..170650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03362"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNS6"
FT                   /protein_id="BAG45235.1"
FT                   /translation="MKLHQTPDPTPQEPPDHPPEPAPGTDPPVPLPPDIPRPDMPPREP
FT                   GYDTPIAQ"
FT   CDS_pept        171244..172776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03363"
FT                   /product="transcriptional regulator"
FT                   /note="COG2202: FOG: PAS/PAC domain, Pseudomonas
FT                   aeruginosa"
FT                   /note="contains two PAS domains and HTH DNA-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03363"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45236"
FT                   /db_xref="GOA:A0A0H3KJL5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJL5"
FT                   /protein_id="BAG45236.1"
FT                   /translation="MNEQVNEQALKSHTDRRQLHQIIAGLTEGVILIEPDQRIVWANEA
FT                   ALAMHGVTELKALGDNVTEYRERFRLRYRNNHPVRDGHYPMDRVIAGEEFSDVTVEVES
FT                   AADDNVTWVHRIRSLVLTNAAGEPDCLALVLHDATEWASAEERFERTFNANPAPAVICR
FT                   LEDLRYVKVNQGFLDMTGHTRDDVLGRSVYEVDVLEQAERRELAIERLTEGATIPQMEA
FT                   VLKRADGTPNAVVVAGQPIDMNGEACMLFTFMDLEPRKLAERALRQSEERFATAFRMAP
FT                   VATAIVTADRFELLDVNDAFVAMTGHPQDELLGKSADEIGLWAERGARQRIDAQLAKDG
FT                   IVRNADVQIRTRDGDVRDCVVSADSVAIHGQDCLLIALLDISDRKRTEMELVYAIETAM
FT                   QDASWFSRTLIEKLANVRRANAPDAGAQLSDLTARERDVFDLLCHGLADKEIAGRLGLA
FT                   PNTVRNHVATIYAKLDVHSRGEAIVWARERGIVGSVDMNGARGDKGAKRDDD"
FT   CDS_pept        172974..173165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03364"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45237"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSY4"
FT                   /protein_id="BAG45237.1"
FT                   /translation="MDRNRIEGRRKQIRGSVKEALGKVTGDRATEAEGVAEQKAGRMQE
FT                   QAGEAADALRSRTNRERD"
FT   CDS_pept        173562..174713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="BMULJ_03365"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683: ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01999"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03365"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45238"
FT                   /db_xref="GOA:A0A0H3KJ55"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ55"
FT                   /protein_id="BAG45238.1"
FT                   /translation="MTFRLRLLSAAALTVANLALPTGAAHAQEAIVKVGVAVPLTGGGA
FT                   AYGKDIENGVRMAVDEANAARTTIGGKPVKFVIASQDDHSDPRIGVQAAQQLADGQVAV
FT                   VIGHFNSGTTLPASKIYAKAGIPMITPSATNPDITRAGLGTVYRVIATDTQNAGNAGAY
FT                   AASITKAKRIAIIDDRTAFGQGEADEFEKAVKANGGTIVAREFTNDKAVDFSAQLTKIK
FT                   SVNADLVFFGGLDAQSAMLVKRMRQLGIRAQFLAGGGVMNANFIKLAGSAAEGAAVWEY
FT                   GQPLSRLAKGKLFETKFKQKYGVDMLAYAPFAYDATWIAINAMQKANSTKPADFNAALK
FT                   RTQYDGITGTIAFTETGDLRNPSSTLYEVKNAAWQPVTTKSAD"
FT   CDS_pept        174849..176021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxA"
FT                   /locus_tag="BMULJ_03366"
FT                   /product="sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Ralstonia solanacearum"
FT                   /note="KEGG, K00301"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03366"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45239"
FT                   /db_xref="GOA:A0A0H3KJ05"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ05"
FT                   /protein_id="BAG45239.1"
FT                   /translation="MSSQIVIVGGGVIGSSIAYFLRATDPTVAVTVIERDPSYAKSSSA
FT                   LSAASIRQQFSTPLSIEMSLFGIEFLRTLGERLEVDGNRPSIDLHEGGYLFLATPAGDA
FT                   TLRENHALQTHLGADIRLMDRDALRAKFPWLNVDDLVSGAYGASGEGWFDGYGLVQALR
FT                   KKAQALGARYVASDVTNVVRDGRRITHVVTKDGERYACDTLVNAAGAWTRALSAMMGID
FT                   IPVYARRRSIFNVSSPAKLADCPLLIDPSGVYFRPEGRTYICGTSPSADNDPDDLPLDE
FT                   VDHALFDDVIWPTLAHRVPEFEALRVENCWSGYYEYNVFDHNAIIGYHPDLDNVVFANG
FT                   YSGHGLQQGPATGRGVSELILGGRYATLDLSPLGWSRVLENRPIVEKNVV"
FT   CDS_pept        complement(176178..176975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03367"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45240"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNT1"
FT                   /protein_id="BAG45240.1"
FT                   /translation="MHSRFDRFRATPVGTQLEALIDSPTRYIEFAALSRAGVAAIAAIA
FT                   DEVAQKFPEIEADTTARQFCGAMVADVMRRHGHELVQARGRIGGPLFTYGAVFSPRPIA
FT                   LSFDKVVEALARMPDTLAEYVARFPPAQWTTRPDGTGFSLVEHVCHLRDLDVVFARRID
FT                   AVRTTALPVLESVDGTALAERLNYLAQDLRDAQAAFARSRKRLCGALSKLPPEQLARCG
FT                   LRDGVRRMTLDELVRELLDHDRTHCLELDELASELGCAPAAVD"
FT   CDS_pept        177359..179944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="BMULJ_03368"
FT                   /product="aconitate hydratase 2"
FT                   /EC_number="4.2.1.3"
FT                   /note="COG1049: Aconitase B, Xylella fastidiosa 9a5c"
FT                   /note="KEGG, K01682"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03368"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45241"
FT                   /db_xref="GOA:A0A0H3KJL7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJL7"
FT                   /protein_id="BAG45241.1"
FT                   /translation="MLENFRAHVAARAALGIPPLPLTAQQTAELVELLTNPPAGEEQTL
FT                   LDLITHRVPAGVDEAARVKAGFLAAVAKGETACPLISRARATELLGTMLGGYNIQPLIE
FT                   LLSDAEVGAVAADALKKTLLMFDQFHDVKELADKGNANAKAVMQSWADAEWFTSRPEVP
FT                   ESLTVTVFKVPGETNTDDLSPAPDATTRPDIPLHALAMLKNARPGITPEEDGKRGPVKF
FT                   IESLKEKGHLVAYVGDVVGTGSSRKSATNSVLWFTGQDIPYVPNKRFGGVCLGGKIAPI
FT                   FYNTMEDAGALPIELDVSKMEMGDVIELRPYEGKALKNGEVIAEFQVKSDVLFDEVRAG
FT                   GRIPLIIGRGLTAKAREALGLPPSTLFRLPHQPADSGKGFTLAQKMVGRACGLPEGKGV
FT                   RPGTYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVKTH
FT                   QTLPNFISTRGGISLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVA
FT                   FAAATGTMPLDMPESVLVRFKGKMQPGVTLRDLVNAIPLYAIKQGMLTVAKQGKKNIFS
FT                   GRILEIEGLPDLKVEQAFELSDASAERSAAGCTVRLNKEPIIEYLNSNITLLKWMIAQG
FT                   YQDARSLQRRIAAMEQWLADPKLLEPDADAEYAAVIEIDLADIHEPIVACPNDPDDVKT
FT                   LSDVAGAKIDEVFIGSCMTNIGHFRAASKLLEGKRDIPVKLWVAPPTKMDQKQLTEEGH
FT                   YGVFGTAGARTEMPGCSLCMGNQAQVREGATVMSTSTRNFPNRLGKNTNVYLGSAELAA
FT                   ICSRLGRIPTKEEYMADIGVINANGDKIYKYMNFDQIEDFKEVADTVQV"
FT   CDS_pept        180356..181555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03369"
FT                   /product="2-aminoadipate transaminase"
FT                   /EC_number="2.6.1.39"
FT                   /note="COG1167: Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00825"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03369"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45242"
FT                   /db_xref="GOA:A0A0H3KSZ0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSZ0"
FT                   /protein_id="BAG45242.1"
FT                   /translation="MYAFTPSFQHPAGSPIRELFKYLAEPGMISFAGGYPASDLFDTDG
FT                   LAAAAARAYAQPVRCLQYGPTDGLAELKQQLIALMARRGVACTPAELLVTTGSQQGLDL
FT                   LLRVLVSPGDVVLTEQPAYPATLQAMRLQQAHIVTIPVDGAGVDVDRLAARLADGTIAQ
FT                   PKLLYTVPTFANPTGATLTRERRLKLLRLAVQYRFLIVEDDPYGDLRFAGEAVPSMLAL
FT                   AAEVDGARDWIVHFASLSKIVAPGLRVGWTIAPPEIARRCVIAKQTVDLCSTPWTQASA
FT                   AEYLADGALERHLPRIAAAYRRKCDAMCDALRDGFGDAIEFHRPEGGMFVWARLGAVSS
FT                   AALLQQAIANKVVFVPGNAFFADNPDDASLRLSFAAPDVEAIREGVARLARAYRAALAA
FT                   "
FT   CDS_pept        181566..181760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45243"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ60"
FT                   /protein_id="BAG45243.1"
FT                   /translation="MNIIVDDTATASVRPASGVRPAEHHSSQISAGPQYVAAVLGRFGA
FT                   EPADAGDAADAAPAVLGYN"
FT   CDS_pept        complement(181782..182675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvA"
FT                   /locus_tag="BMULJ_03371"
FT                   /product="LysR family glycine cleavage system
FT                   transcriptional activator"
FT                   /note="COG0583: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K03566"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03371"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45244"
FT                   /db_xref="GOA:A0A0H3KJ10"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ10"
FT                   /protein_id="BAG45244.1"
FT                   /translation="MPPRMSRLPPLNALRAFEVAARHLNFRAAADEIGVTQGAVAQQVR
FT                   HLEDVLGLKLFERLPRGLALTHDGAAYFSDVQRALHAIADATDRLVKRRATLTISTTPS
FT                   FASKWLIPRLAQFTDAHPDIDVRVIADQQLATFRHDGVDLAIRYGKPPFGKHFAAHALF
FT                   PLDVCAVCSPALLAAPASPRALAGHVLLHDAHDLWPAFIAALPEPVDVDPHKGLRFNQT
FT                   SLAIDAAVAGQGIALATDPLVERDIAAGRLCKPFDFAFPLSVGFYLVYPAERRDDDAIA
FT                   VMRDWMIGAAASDPRD"
FT   CDS_pept        182810..183514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BMULJ_03372"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K00059"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03372"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45245"
FT                   /db_xref="GOA:A0A0H3KNT8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNT8"
FT                   /protein_id="BAG45245.1"
FT                   /translation="MTVEKVALITAAGKGMGAAIARELAAGGYRVALMSPSGSAVALGD
FT                   ELGGFGIRGSVTEEADIDRLVQDTLARYGRIDAVVNNTGHPPKGDLLSITDDNWHAGLD
FT                   LILLNVVRVMRRVTPVFQQQGGGAVVNISSFAADAPEQPMPVSSALRAALSAWTRLYAE
FT                   RYAADNIRMNAVLPGFIDSWPETPEIVARIPAGRFGKTAEIAKTVAFLLSDGAGYITGQ
FT                   NIRVDGAIVKAL"
FT   CDS_pept        183776..184819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03373"
FT                   /product="predicted hydrolase or acyltransferase"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03373"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45246"
FT                   /db_xref="GOA:A0A0H3KJM2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJM2"
FT                   /protein_id="BAG45246.1"
FT                   /translation="MSDTVNTRRRLILGTALASLSLADLGFGDFAHAQGAPDAAAQPRA
FT                   AGGAAFGPIRQIDAGLLNVGYADVGPANGPVVFLLHGWPYDIHSYAEVAPLLAAAGYRV
FT                   IVPYLRGYGSTTFRSADTMRNGQQAVTAVDIVALMDALKIDRAVFGGYDWGARTADIVA
FT                   ALWPQRVKALVSVSGYLIGSQEANRKPLPPQAELQWWYQFYFATERGAQGYAANCDAFN
FT                   KLIWQLASPKWAFSDDTFARSAASFRNPDHVAVVIHNYRWRLGLANGEAQYDEIERRLA
FT                   AGPAIAVPTITMEGDANGAPHPAPAAYAKKFTGKYQHRTITGGIGHNLPQEAPQAFADA
FT                   ILHVERL"
FT   CDS_pept        184819..185358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03374"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45247"
FT                   /db_xref="InterPro:IPR032033"
FT                   /db_xref="InterPro:IPR038142"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSZ7"
FT                   /protein_id="BAG45247.1"
FT                   /translation="MRAAAGMSRRSRAIVARMLIAVAWAASASVACAEQAVPSKPAASP
FT                   IYGVTIPPGYRKWEMVAPAEEAAPLDELRVVLGNPVAIRALEQATLPFPDGTILVKLAY
FT                   KRKQSDEFAPATVPGQATTVQVMVKDSRRYASTGGWGFGRFVNGVPADIGQHQTCFACH
FT                   QARVKHHDYVFTRLAP"
FT   CDS_pept        complement(185520..186134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtC"
FT                   /locus_tag="BMULJ_03375"
FT                   /product="threonine efflux protein"
FT                   /note="COG1280: Putative threonine efflux protein,
FT                   Escherichia coli O157:H7"
FT                   /note="KEGG, K05835"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03375"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45248"
FT                   /db_xref="GOA:A0A0H3KJ65"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ65"
FT                   /protein_id="BAG45248.1"
FT                   /translation="MPAHLHLLLPLAGVLLLSVVSPGPNFVIVTSTAVASRRAGVMTSV
FT                   GLAAASGTWAAIAIAGLSLLVTHVAWVHTALRIAGATYLLWLGAKMIATARRPLALSTE
FT                   PGRSGWRAARNGYVVSMTNPKAVAFYGSVFALMVPAHAPAWFAPAVVGISIAISGAWYG
FT                   AMALLASHPTVRGLLIRRKAVLDTTAGVLLMGLGGKMLAGR"
FT   CDS_pept        complement(186190..187143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03376"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03376"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45249"
FT                   /db_xref="GOA:A0A0H3KJ15"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ15"
FT                   /protein_id="BAG45249.1"
FT                   /translation="MKLHQLQALVASAEAGSIRGAARTLGLSQAAVTRALRELEAAERL
FT                   PLLVRAPEGIGFTEYGKALLTHAKLVLKQLEQAHDDLARMRGRVDGRLSIGVTPWLTLT
FT                   FLAETVLRFRERMPDVRLELYEALMAVAQPLLRDGSMDFALGHIHPGSGAQEFAFEPML
FT                   RYDTAVMVRAGHPRERARSIHDLLDDDWVLNSTADGQTALVDYLFTRHGARIDERRIVR
FT                   AQSVSMLQTMLEQADMCTWCPTILAAVPSFGERMRALSLKETFEPRELGVVTRRSSTLS
FT                   EAARCFIDCLLHVIRRHARSARKEDLALFKTVSLLI"
FT   CDS_pept        187287..188456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hipO"
FT                   /locus_tag="BMULJ_03377"
FT                   /product="hippurate hydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="COG1473: Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K01451"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03377"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45250"
FT                   /db_xref="GOA:A0A0H3KNU4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNU4"
FT                   /protein_id="BAG45250.1"
FT                   /translation="MNPARIPPEMAAIEAEMIALRRRLHAHPELGFEEHATSDLVATCL
FT                   TTWGYRVTRGLGGTGVVGTLVRGDGKRLGLRADMDALPIVETTGLPHASRHDGVMHACG
FT                   HDGHTAMLLAAARCLAQRARFTGTLNLIFQPAEEGLGGAKRMIDDGLFEQFPCDAIFAM
FT                   HNVPGLPTGVLGFCDGAAMASADEVRVRVTGRGGHGAAPHTTVDPVVVCASIVMALQTV
FT                   VSRNVNPQELAIVTAGSIHAGTASNVIPSHAELALSVRALSPDVRALLERRIHEIVHGQ
FT                   AASYGATAEIDYRHGYPVLVNHAEETAFAREVAREWGGDGALIPHLRPIAASEDFAFML
FT                   NACRGAYLSIGNGEGAAGCALHNSGYDFNDASLAIGASYWIALAERYLA"
FT   CDS_pept        188527..189309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03378"
FT                   /product="polar amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0834: ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K02030"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03378"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45251"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJM7"
FT                   /protein_id="BAG45251.1"
FT                   /translation="MKKWTMALVAALAAGAAHAGDWTGKEIRLAVDPTYPPLEYKLPDG
FT                   TLTGFGVDITNALCAELRARCVWVESSFDGMIPGLLARKFDVIASSMTITPKRMQQIAF
FT                   TNRISNAPARLIARKGSPLLPTAAALKGKRVGVEQGSAQADYAIANWQPAGAQIVSYQN
FT                   QDQVYADLVTGRLDAAFQASIAASDGFLKKPQGKDFAFVGAPIEDTKYFGQGDGLGLRK
FT                   QDTELREAFNRALATILANGTYQRINRKYFDFDIYGAK"
FT   CDS_pept        189429..190619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03379"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03379"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45252"
FT                   /db_xref="GOA:A0A0H3KT03"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT03"
FT                   /protein_id="BAG45252.1"
FT                   /translation="MNWRSVFVAIPALCAAPAFAFAQSSVTLYGLVDAGIDYTNNVGGH
FT                   AAWQMASGFAQGSRWGLKGSEDLGGGYRALFQIENGFNVNSGTLAQGGRMFGRQAYVGL
FT                   GSTRFGTVTLGRQYDSLVDYLAPTTANGSWGVYPFSHPLDNDNTGNTFRVNNTVKYASP
FT                   EFAGFSFGGTYSFSNDTGFARNRQWSVGAQYEQGGLLIGAAFLNANDPGATSGGAIAGS
FT                   GSVGADANFASTRLRIFGAGINYTAGPATVGFAYTNSNVTRPTANVGYLFGDETIQPVT
FT                   GPLAGGTVTSIKYQNFEVNGKYQFTPAFFVGAQYVYTTVRYDATTGSAKPKIHSVGLMA
FT                   DYNLSKRTDVYVMGAYQRVAGDATGSSLDQAYIPGAADLSSTSKQVMVHAGIRHKF"
FT   CDS_pept        complement(190687..191706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03380"
FT                   /product="Zn-dependent NADPH:quinone reductase"
FT                   /note="COG0604: NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45253"
FT                   /db_xref="GOA:A0A0H3KJ70"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ70"
FT                   /protein_id="BAG45253.1"
FT                   /translation="MQAWQQTPGDGLAGLRRIDATHRPVGPTDVVVKIHSVSLNYRDLM
FT                   FARGDYVGIGDAPLIPVADGAGEVVEIGRDVTRFKPGDRVINTYFPRWIDGPPTPSKVA
FT                   GSPGAQFDGVLAERFVTDEAALVAIPAHLDYDEASTLSCAGITAWNALFADGGLAPGST
FT                   VVLLGTGGVSIVALQLAHAAGLRTIITSSSDAKLERARALGADETINYRATPDWQHEVL
FT                   RLTDGAGADLVVEVGGKDTLPRSVAATKLGGVVSVIGGVSGFGGPELGLLSLIGGIRRL
FT                   HGIMVGSRSMLDEVVQLFDRKQLRPIVDRVFAFDEAPAAYAHLQSGQHFGKIVIRVAH"
FT   CDS_pept        191835..192806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03381"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Sinorhizobium
FT                   meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03381"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45254"
FT                   /db_xref="GOA:A0A0H3KJ20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ20"
FT                   /protein_id="BAG45254.1"
FT                   /translation="MDERLRGVAEFVEVVESGSFAAAALRIGVTRSAVAKVVARLERRL
FT                   GVRLLQRTTRQLNLTDEGHLYYEQCRRLLAELGDTEAALDAGRREPSGRLRISVPVLFG
FT                   RQCVAPVMRRLVERHPRLEVDMSFSDRVADLIDDGFDIAVRIGVLADTTALVARRLGVQ
FT                   RMGICASPAYLDRHGWPSGPDALASHVGIPYARGGQPVPWRIIGADGEVREHRVTGRLR
FT                   YDDLQAIAEAAAAGAGLAWLPCWLMAPYLRDGRLALVMDSNSVSGADVSAVRPQARHVP
FT                   SKVRVAIDALVDEIPRMLASDDAAPPAPTPARSRARRARSAG"
FT   CDS_pept        192862..193755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03382"
FT                   /product="drug/metabolite transporter (DMT) superfamily
FT                   permease"
FT                   /note="COG0697: Permeases of the drug/metabolite
FT                   transporter (DMT) superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03382"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45255"
FT                   /db_xref="GOA:A0A0H3KNU8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNU8"
FT                   /protein_id="BAG45255.1"
FT                   /translation="MSVIGASDRGGKPGWLRAAPALFLLLWSSGFVFLKLGLRDADPLT
FT                   FLALRYACVVALLAGPFLWLRPALPRTRRAWLNLIVVGLLLQAGYFSFTYLSLKLGMSA
FT                   GAVALVTSQQPILVGLLAPALAGERVGALRWVGLALGAAGAVLVILARGAVAIASPWAL
FT                   AFALLALACITGGTLWEKRFGTDVHPVSANLVQYAVGLAVSAPLAFALEPMHVHWSAGL
FT                   AGSLAYLVICNSLIAISLLLAMVRHGEASRVSALFFLIPPATALIALAVLGETISALAW
FT                   PGMALAAAGLYLVMRH"
FT   CDS_pept        193964..195280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03383"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03383"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45256"
FT                   /db_xref="GOA:A0A0H3KJN1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJN1"
FT                   /protein_id="BAG45256.1"
FT                   /translation="MPMTAAAPPLHAATMRRLNLRLIPFLMLLYLVAYIDRSNISVAAL
FT                   QMNADLGLSAEMYGLGAGLFYVTYILFEVPSNLFLARVGARRWIARIMITWGVIAAGMS
FT                   AVHTPGQLYAMRLLLGAAEAGFTPGIIYYLSAWYPASDRARAMSFFYIGATLASVIGLP
FT                   LSGALLNLNGVLGVEGWRWLFLLEGVPALLLGIVVLRRLPDTPADARWLPADERAWLEA
FT                   TLRDTAPREHLSHGAALRRAFGDRNVWALAAFWLLQAFGTIGLTLFLPLLVKSLSGQSS
FT                   FAVGSLSALPFLFACVAMYANGRHSDLGGERALHLGVPMLLAGALLVGAIYVHVLPIAY
FT                   ALLVLAVGFNWAATPVFWAVTTEYVSGLTAAASIALINAVANIAGLALPPVMGRIKDVT
FT                   HSYDLALLLVAVALLVGGVLGLRIASRRRAMPMAARRAG"
FT   CDS_pept        complement(195419..197584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03384"
FT                   /product="large exoprotein"
FT                   /note="involved in heme utilization or adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03384"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45257"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT06"
FT                   /protein_id="BAG45257.1"
FT                   /translation="MQHTRQPHLPPAQPCARRALVAALACAMPLFAAHAQNAPLVVDPS
FT                   AAHRPTLANGANGTPIVNIAAPDGAGLSHNRFTEYNVGAAGLVLNNSAHAVDTQLAGRI
FT                   DGNTLLGGRPASVILNQVTGGNASMLAGATEVAGHAARVIVANPNGIGVNGGSFINANH
FT                   VSLVAGTVEFDEQGAIRQFRTEHGRIAIDGAGLDARDVDQLDLVSRTLQVNAALHARRV
FT                   TTVAQRGTANVEQPGSHQLSGQGDGAMPDVAIDVSKLGSMHASAITMHGSSAGVGVNLA
FT                   GKVDAVTGGIAISSGGIVKVQDGGSLTADRLSINGNLDNAGSVRAGRALSAMGTLHNRA
FT                   GGRIESGGTLSSMGSVRNAGTLHADAAMSLMGALKNERGARISSYGRINQMGHVSNAGE
FT                   LVQFAPRPTVAPVEDKPASTAPAGVAGNDVGGSEGATAVVEKPVAPTAPVIAESKPGLP
FT                   EVSTPVTEKPVAPTAPVIAESKPGLPEVSTPATEKPVAPTAPVVAENKPTQPDVPTPVT
FT                   EKPVAPTAPVIAENKPTQPNVPTPIIEEPVPPTAPIIAESKPTQPDVQTPVTEKPVTPT
FT                   APVIAENKPTQPNVPTPITEKPVPPTAPVIAESKPTQPDVPTPVTEKPVAPTAPIIAEN
FT                   KPPQPARPTAPIAAKPFPPTIAAFAPIFIPSITIPSITIAPIRPIGFPTFAFSPIAPPA
FT                   LPTFGMIPRPTMFAPMPAFSLTLASRV"
FT   CDS_pept        complement(197730..199430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03385"
FT                   /product="hemolysin activation/secretion protein"
FT                   /note="COG2831: Hemolysin activation/secretion protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03385"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45258"
FT                   /db_xref="GOA:A0A0H3KJ75"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ75"
FT                   /protein_id="BAG45258.1"
FT                   /translation="MRNPIYAVRTLCTVALLLRCVISVAQDTRSYAPPTDTAHRQAEQI
FT                   DHLREQLAPPIDALSARSPHATDRLSLPAEADCFAIHTIEWRHAEAFPWLPREAAVEHA
FT                   CIGPQGLRTLRDWVTRRLIARGYITSVAVIPEQDLSGGRLVVEIVPGRIGAIRDAGGRI
FT                   GWPAPLFPRHAHGLLNVRDLDQALENVRRLPGQAATAFDLLPGAALGDTDIVVRHPADA
FT                   RRVRVLATADNAGLDATGRNQLGAIVAVDSPLHLYDQLVLTYNTDAARGNKTLGSQAKS
FT                   AAWNVPIGYASVSVGISEWTSRRTLPATAGGEAALSLAQRTRRYEAALRVVPYRTSHGK
FT                   TTLRFTLSRRDDRSRLGSTELDVNRRDIVGYDVGIAHREKLADGAVDAGFGMRGSIPAL
FT                   SAHPGRVNDRPAWDGRYRLFTATLAADARFRVGARRFGYRGTLRVQHAPGAAPSTEFLQ
FT                   IGGRYTVRGFDGNQTLAGANGWIWRNELATGAFGANEIYAALDAGRVAGAGAAEGAGRG
FT                   GRTLVGTSVGVRGGYRLVGYDVALGAPLYKPALLNTAAVALDVSLTARF"
FT   CDS_pept        199882..201831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aslA"
FT                   /locus_tag="BMULJ_03386"
FT                   /product="arylsulfatase"
FT                   /EC_number="3.1.6.1"
FT                   /note="COG3119: Arylsulfatase A and related enzymes,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K01130"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03386"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45259"
FT                   /db_xref="GOA:A0A0H3KJ26"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ26"
FT                   /protein_id="BAG45259.1"
FT                   /translation="MSMSASRSVPFRLRVVCAIAAGALSLASCGGVDGNPPPQADATPS
FT                   AKRPNILYIMADDLGYSDIHAFGGEINTPNLDALVASGRILSNHHTGTVCAITRAMLIS
FT                   GTDHHLVGEGTMGVPTDERRGLPGYEGYLNDRALSFAQLLKDAGYHTYIAGKWHIGSGI
FT                   VGSATGSGQTPDQWGFERSYVLLGGAATNHFAHEPAGSSNYTEDGRYVQPGQPGQPGGT
FT                   GGNPAVFYSTNFYTQKLIQYIDSNHSDGKPFFAYAAYTSPHWPLQVPDPWLHKYAGVYD
FT                   AGYDAIRNARIARQKALGLIPADFKPFDGLPETTVASPATANDGTANAKYVSAVHSAAD
FT                   GYRDYGAGKVDKLWSSLSPAERKAQARYMEIYAGMVENLDYNIGLLIQHLKDIGEYDNT
FT                   FIMFQSDNGAEGWPIDSGADPTATDTANAQEPTYSALGTDNGKQNAQRLQYGLRWAEVS
FT                   ATPFRLTKGYSAEGGVSTPTIVHLPGQTQQLPTLRAFTHVTDNTATFLAVAGVTPPSQP
FT                   APPLINTLTGVDQNKGKVVYGNRYVYPVTGQSLLPVLTGAANGEVHTAPFGDEAYGRAY
FT                   LRSADGRWKALWTEPPLGPLDGHWQLYDLTTDRGETIDVSAQNPSVVSTLIDQWKAYMS
FT                   NVGGVEPLRPRGYY"
FT   CDS_pept        201842..202885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03387"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1262: Uncharacterized conserved protein,
FT                   Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03387"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45260"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNV2"
FT                   /protein_id="BAG45260.1"
FT                   /translation="MRFWTIGAALAAALFGAAFAAGYTHGPAAPDSAFDDANRDRPLAA
FT                   LGSEQQCARYSGLPANWRDDPKAGMVHLRGGTFVFGSTRGYQDERPAADGRTRVGGFWI
FT                   DQTDVTVAQFAAFVQATGYVTEAEQQGGAAVFHVPTRDELNARDLAWWSWVKGASWRHP
FT                   RGPGSDVEGRGNLPVTLVTQRDALAYARWLGRDLPTEAEWEYAGKAGRDDASLDAAPRD
FT                   ARGKPAANYWQGPFPVLDTAEDGHAGLAPVGCYAANGFRLYDMIGNAWQWTKDVYTGPH
FT                   QSHTNGDTAAVAPAARRHDTPMVIKGGSFLCSRDYCVRYRASSRERQEADLAASHIGFR
FT                   TILRDPA"
FT   CDS_pept        202882..203685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03388"
FT                   /product="ABC-type metal ion transport system periplasmic
FT                   component"
FT                   /note="COG1464: ABC-type metal ion transport system,
FT                   periplasmic component/surface antigen, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03388"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45261"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJN6"
FT                   /protein_id="BAG45261.1"
FT                   /translation="MIRVARFVTAVALAAAGFAGMQGACAADGPALRVGVTRGVHAQIM
FT                   DEVRRVAASRGLNVDVVVFDDASRIDAALVGGRIDAASFEDAQQLAATRAAHRYALTAV
FT                   APTVTLPMALYSRKLTNLNALQPGATIAIPADARGMARALVLLQNDTLITLRERAGLHA
FT                   TLRDVTGNRLGLRIVALRGDRLYAALDTVAFAAIDDDDAARAGLQPARDSIGIEDARSP
FT                   YAGVLTVRDADRTKPWVARLVAAYHSDDVARFILTRYQDSVRRPW"
FT   CDS_pept        203679..204668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03389"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45262"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT13"
FT                   /protein_id="BAG45262.1"
FT                   /translation="MVATYALACNACGRCCNSAPTLSLRELFRHRARFVGALTIHRVPK
FT                   RQIGERWRAGEREHVLDTDDVAACDALAERLFHRFGGASGDWAVLTLQGYDYPSLGRCP
FT                   ALADDGRCSVHADKPSICGAVPLDPLLPDRLQARVLAARRDDAVWFGSRCIVDETQAQH
FT                   AAAHAVPSIMLVRATEVVDRAALDACRDALAFERAVWRDAAFASLIDGGQPMREVWSRL
FT                   APGAYLTLPIAPVLLIVASLSAHCRALCLDFIDAQLALIDARIEAALARRRLDDRPATR
FT                   ELRGFAQALERARQVLLATPARSTHTHRDAAAIEAWLDGRPATDLQPA"
FT   CDS_pept        complement(204738..205670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03390"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45263"
FT                   /db_xref="GOA:A0A0H3KJ78"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ78"
FT                   /protein_id="BAG45263.1"
FT                   /translation="MNTRFLETFVTLAKLRNFRTTAAALHATPAAISQRIKALEDELQT
FT                   VLVDRDSREFRLTPHGEYLLAYAQAVVEATHELQAAASGESALRGKLRLGVIETVVHSW
FT                   LPHYLRRLAADYPQLEVDLTVDVSVVLQRRLMAGELDLIIRVEGSDEPAVVCDALANYP
FT                   VRWIARAGLLPATRTGLARQVLRQPILTYGRGTAPHRALEDIVRTLAHAHGVPLSETRI
FT                   TGSPSISVIVQLVRDGFGVAAIPSLFVDALIESGEVVELPLQPSPPSIVVSMSRRVDAP
FT                   RFVHGASIAARAACHEYCEKSHRRLVEAL"
FT   CDS_pept        205868..206650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03391"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4336: Uncharacterized conserved protein, Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03391"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45264"
FT                   /db_xref="GOA:A9AQ22"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AQ22"
FT                   /protein_id="BAG45264.1"
FT                   /translation="MNPITPSEFRQSVRRGAFRGPTAGHCGPFAQANLAILPDAYAHDF
FT                   LRFCQANPKACPLLGVGEPGAFRLDVLGDDLDIRTDVPSYNVYRDGRLTERVDSLEALW
FT                   RDDFVAFAIGCSFSFEDMLAREGIALRHVEEGRNVPMYRTSIPNRRAGVFGGQLVVSMR
FT                   PMRGADAIRAVQITSRFPGVHGAPIHLGDPRELGIADLGAPDFGDAVTIREGELPVFWA
FT                   CGVTPQTALMEAKLPLAIAHTPGHMLMTDITNASLAVF"
FT   CDS_pept        206813..208111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03392"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03392"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45265"
FT                   /db_xref="GOA:A0A0H3KJ36"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ36"
FT                   /protein_id="BAG45265.1"
FT                   /translation="MESKTLAAGTAEPERPARSGLFSWYADAQPRERRAFWSCKVGYML
FT                   DGMDTQMLSFVIPTIVATWGISLADAGFIGTITLLASAAGGWLAGLLSDRIGRVRTLQL
FT                   TVLWFAVFTALCGLAQNYHQLVAARALMGFGFGGEWTAGAVLIGEVIRARDRGKAVGLV
FT                   QSGWAIGWGLCALLYALLFSVLPAELAWRALFLVGLAPALLVVVIRRYVKEPDVYQKEK
FT                   AAQAREADAPRFTEIFAPKLITTTLRAALLTTGAQGGYYAITTWLPTFLKTERHLTVMG
FT                   TGGYLAMIILGSWVGYLTSAYLTDRLGRKPNFILFALGSMAIAFAYTSLHLTDTSMLFL
FT                   GFPLGFFASGIFSGMGAFLTELFPTRVRGSGQGFCYNVGRAIGALFPFLIGALAKHYGL
FT                   GASIGIFAVAAYGVMIVAALTLPETRGRELDAA"
FT   CDS_pept        208231..211869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03393"
FT                   /product="ATP-hydrolysing 5-oxoprolinase"
FT                   /EC_number="3.5.2.9"
FT                   /note="COG0145: N-methylhydantoinase A/acetone carboxylase,
FT                   beta subunit, Mycobacterium tuberculosis H37Rv"
FT                   /note="KEGG, K01469"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03393"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45266"
FT                   /db_xref="GOA:A0A0H3KNV5"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNV5"
FT                   /protein_id="BAG45266.1"
FT                   /translation="MTDRQTSPVSSDAARWQFWIDRGGTFTDIVARRPDGTLVTHKLLS
FT                   ENPEQYRDAAVAGIRHLLGLADGEPITPERVDMVKMGTTVATNALLERKGERTALATTR
FT                   GFRDVLRIAYQNRPRLFDLDIVLPDALYETVVEIDERVGAHGEVVTPLDLAGAEAALRR
FT                   VFDDGVRALAIVLIHGYRYTAHERALAQLARRIGFTQVSASHEVSPLMKMVSRGDTTVV
FT                   DAYLSPILRRYVEQVAHEMPGVNLQFMQSSGGLTRADAFQGKDAILSGPAGGIVGMVRA
FT                   ARAAGFERVIGFDMGGTSTDVSHYNGEFERVFETQVAGVRMRAPMMSIHTVAAGGGSVL
FT                   SFDGARLRVGPESAGANPGPAAYRRGGPLTVTDCNVMLGKIQPDYFPRVFGPHADAPLD
FT                   RDGVVAKFRALADEIHAATGRRETPEAIAEGFLEIAIGSMANAIKKISVQRGHDVSRYV
FT                   LTTFGGAGGQHACGVADALGMTQVFAHPLAGVLSAYGMGLADQTAMRERAIEAVLSDSS
FT                   LPALNAALDRLTDEAVGALLEQGVPPERIATERRVHLRYQGTDSALDVPAGSVDAMQRA
FT                   FEAAYRQRYAFLMPGTPLVVELASVEAIGRSDAPVEIAPLAPRGDGDAPRADTVARFYS
FT                   GGAWHDAALYVRDTLLAGDAIDGPAIIAERNGTTVVEPGWRAQMTAQGNLVLTRTTPLP
FT                   TRRSLGTDADPVRLEIFNNLFMSIAEQMGLRLQNTAYSVNIKERLDFSCAIFDRDGNLI
FT                   ANAPHMPVHLGSMGESIRTVIERNRGRMRDGDVFMLNDPYHGGTHLPDVTVITPVFADG
FT                   ADEPLFYVGSRGHHADIGGTTPGSMPPDSTHIEEEGVLIDNWLLVSAGTLRDAETRALL
FT                   ASGRYPARNVDQNMADLRAQIAANQKGVDELRRMVAQFGREVVLAFMQHVQDNAEEAVR
FT                   RVIGALQDGAYRYVLDNGAEIRVAIRVNRAARCAEIDFTGTSAQLDNNFNAPKAVCMAA
FT                   VLYVFRTLVGDDIPLNAGCLKPLTVIVPAHSMLNPDYPAAVVSGNVETSSAITNALYGA
FT                   LGCVASSQGTMNNFTFGNAQYQYYETIAGGSGAGPGFAGVGAVQTHMTNSRLTDPEVLE
FT                   WRYPVRVDSHRIRAGSGGRGRWHGGDGAVRRIRFLEPMTASILSNNRIHAPFGAAGGEP
FT                   GALGRNMIERADGTIETLDHIARAQMAPGDVFIVETPGGGGYGAAD"
FT   CDS_pept        212457..214460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03394"
FT                   /product="signal transduction GGDEF/EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03394"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45267"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJN8"
FT                   /protein_id="BAG45267.1"
FT                   /translation="MDDENDSAVLEAHVGTRSPCWRLGSDSNALELAAVRGMTNVSVAL
FT                   TGEQAARIRALTGVTSHLVLDIVLFGERVPLHLVGRKVNTTDWAGTASAYSDTVSVASD
FT                   LAHGLAFAEQVVSEVNSLVVILDRNGMVQRFNRLCEEVTGKREVDVIGRSAFELFMSPE
FT                   QGAQSRSNITGFFASNRAFSVERYINTVNGPRLFQFRNKFVQSGSGAEEQYLICSGIDI
FT                   TEERNAQQRLTELANTDVLTGLPNRHAISERIRTVIAQQTGDTPGQVGILFLDLDNFKR
FT                   VNDHYGHITGDRLLQDVSAIISGCLPSGATLARLGGDEFLVLFEQGTRALLEATAQIIL
FT                   ERLRTPIHLGLMEVYTSCSIGIAMHPQHGDSLETLIRNADTAMYVAKEAGKHTYRVFSL
FT                   EMNQRVAKYMWLDTNLRKALEEEQFVLHYQPVVDIATGDVHAVEALIRWQSPDRGLVAP
FT                   VEFIRFAEESGLIAPLGRWVMRTAAAQAAAWKAKGLGVRIAVNVSARQLQDMNIVHQFA
FT                   SIVDAAGLKPGLLDIELTESCFIDDEHGAHGLMKQFRQLGAKIHLDDFGTGYSSLSQLS
FT                   RLPLDAIKLDRSFITGIDRNPRSQALVRSVVSLANALNFSVIAEGVETHAEAEFLKQVD
FT                   VGHAQGYYFARPMPAHAFEAWLAETRKLRLIA"
FT   CDS_pept        complement(214504..215367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpfF"
FT                   /locus_tag="BMULJ_03395"
FT                   /product="putative enoyl-CoA hydratase/isomerase"
FT                   /note="COG1024: Enoyl-CoA hydratase/carnithine racemase,
FT                   Xylella fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03395"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45268"
FT                   /db_xref="GOA:A0A0H3KT17"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT17"
FT                   /protein_id="BAG45268.1"
FT                   /translation="MQLQSHPACRPFYEAGELTQLTAFYEEGRNIMWMMLRSEPRPCFN
FT                   QQLVTDIIHLARVARDSGLRFDFWVTGSLVPELFNVGGDLSFFVDAIRSGRRDLLMAYA
FT                   RSCIDGVYEIYTGFGTGAISIAMVEGSALGGGFEAALAHHYVLAQKGVKLGFPEIAFNL
FT                   FPGMGGYSLVARKADRSLAETLIATGEAHAAEWYEDRGLVDQTFEPGDAYLATRTFIDV
FT                   MKPKLNGIRAMLRARERVFQLTRSELMDITEDWVHSAFTIEPKDLAYMERLVMLQNRRV
FT                   SKLRTV"
FT   CDS_pept        216000..216320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03396"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45269"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ82"
FT                   /protein_id="BAG45269.1"
FT                   /translation="MLVTFRSAAAPDIVMLRDLAQYLLGLIGKGLDVRGVISTDELPGA
FT                   IARLEQAIGDDAAHARMHAHSTPALHVEASPHAGGLAQRAWPLLEMMRAARDQGRHVMW
FT                   GV"
FT   CDS_pept        complement(216425..216574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03397"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45270"
FT                   /db_xref="GOA:A0A0H3KJ40"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ40"
FT                   /protein_id="BAG45270.1"
FT                   /translation="MDHGIVRIVILLAILVFAVLFFAERRSRDRTRDRLLHRSSRRTSR
FT                   HRHP"
FT   CDS_pept        complement(216619..216894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03398"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNW2"
FT                   /protein_id="BAG45271.1"
FT                   /translation="MESALCLRYRQCEIRACALVEPAAGEGLELGALYLPLAVVCWRDA
FT                   QGRHEVHLPDPKHHVLRHDTDALRISIALAKRFIDTKLVGTCMPAG"
FT   CDS_pept        complement(217005..217190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03399"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45272"
FT                   /db_xref="GOA:A0A0H3KJP1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJP1"
FT                   /protein_id="BAG45272.1"
FT                   /translation="MVINNDFEIGYLVVAFALLGVILVGALLTALHLERCHPKLVGAAI
FT                   GALIGIALIEAMPMLT"
FT   CDS_pept        217465..219369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03400"
FT                   /product="transglutaminase"
FT                   /note="COG1305: Transglutaminase-like enzymes, putative
FT                   cysteine proteases, Xylella fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45273"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT23"
FT                   /protein_id="BAG45273.1"
FT                   /translation="MLLFSSRLVGCAALAAGAVSLGIGAAAHAQPADAASGNEAPVTLE
FT                   RDVHEFVLQHDGALVEHDDSTLRANDANGIDAIAQRYVWFDKHLEKVELLAAETIDRDG
FT                   VAHPVGADGIRDVQEPRSAGAPTFQDGVLRTVVFPAVAAGTRTRIVFRKTRTKPVNPGY
FT                   FGYTVEPSREPVDEQRLIFDVPADMPLVADARGYVALPPVTENGRTRYTFTYRHGPYAR
FT                   IEKGSVGYPDYGDHLVVSTLPDYAAFAARYQNAAADPGAHDPAVVQLAQSLTADAPDRR
FT                   DKARILYDWVQTNVRYVALFLGETAAAPHRVTDILRNRYGDCKDHVALFGALLGAVGIR
FT                   SEPVLLNLGAVYTLPSVPGYGAGAINHAITWLPDLGLYADTTTTGIAFGYLPPIVMDRP
FT                   ALLVDSGVLSRTPATQPRRRTARLDIDAAVRGDARFHAYVEDEGWTAELERSVFRRATP
FT                   DRIGQLANERLMQTGLRGRAQLTTSDRRTHAGPFDVTMSGTLDHPVWPDGTTAVPALSS
FT                   VAGGIATQVQAWLQEPVRTQPWVCIGGRFDETAQIALPPDVAVIDVPADKAVRDRFVDF
FT                   TSHYVFDPVARVVQITRRLNATFDGQVCSPDTFATLRASLERIERDTQAQIVVRARQR"
FT   CDS_pept        219459..219635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03401"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45274"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ87"
FT                   /protein_id="BAG45274.1"
FT                   /translation="MTERDYEIADLSKELLVRIVQGTVTNGATVDPQQCATLAVQCATV
FT                   LIDTLEARSDAGG"
FT   CDS_pept        complement(219779..220780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03402"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03402"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45275"
FT                   /db_xref="GOA:A0A0H3KJ46"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ46"
FT                   /protein_id="BAG45275.1"
FT                   /translation="MPDTLPPVTPDAHDLVSELLLGMRLSGVQYRRIQVARPFGLSFGQ
FT                   APGRAQFHFVGRGPVLLRDAAGTTMQLEAGDAILLPHGNMHTLVSDPDVPCREIGGFEV
FT                   ARICDSVASVASTGAATDGAAADSAGGDALIFSACMELDLGGMQPLVGTMPEFMHVGTL
FT                   LARYPEIRPMLDAMERESCAERAGFAGILARLADVVAAFIVRGWVECGCGDASGWVQAL
FT                   REPKLGRAIVALHRDPGRNWSVAELAAEAGVSRSVFAERFLAATGMTPVRYLTELRMRL
FT                   AARWIARDREAIETVAYRLGYGSLAAFSRAFKRVVGRPPGALRADADADAAA"
FT   CDS_pept        220889..222088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicM"
FT                   /locus_tag="BMULJ_03403"
FT                   /product="drug:H+ antiporter-1"
FT                   /note="COG2814: Arabinose efflux permease, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K03445"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03403"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45276"
FT                   /db_xref="GOA:A0A0H3KNW8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNW8"
FT                   /protein_id="BAG45276.1"
FT                   /translation="MNPGISSTAAQAAPREPAWGAVFAMALGVFGLVTAEFLPASLLTP
FT                   MADSLGVTEGVAGQAVTATATVALVTSLLIAAATRTIDRRRVLLAFSLLLVASNLAVAF
FT                   ATNLTTVLIGRVVLGIALGGFWTMATATAMRLVPAAMVPRALSIIFSGVAVATIAAAPL
FT                   GSYFGHLIGWRNVFLIAAALGGIAFLSQVATLPSMPPSGTTRLRTLIDVLRRPGVGLGM
FT                   FATTLVFTGHFAFFTYLRPFLEQVAGVGVNGLSAILLGYGVANFVGTSLAGRVLEHRLR
FT                   PMLIAMPALMVVLGVLLVVLGRAPAIDAILVALWGMAFGGVPVAWSTWVTRTVPDEAES
FT                   AGGLIVAAVQLAIATGAAAGGVVFDATGAGGVFVGAAVVLAVAVATIVTAVPKRVEAVS
FT                   "
FT   CDS_pept        complement(222282..223043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03404"
FT                   /product="putative PEP phosphonomutase"
FT                   /note="COG2513: PEP phosphonomutase and related enzymes,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03404"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45277"
FT                   /db_xref="GOA:A0A0H3KJP3"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJP3"
FT                   /protein_id="BAG45277.1"
FT                   /translation="MTTADKHARFRALHRAGDPLVLFNVWDAGSARAVADTGAPALATG
FT                   SWSIAKANGYADGEDMPRALAIELLARIVAATDLPVSADLESGYGEQPDDVADTIALSI
FT                   EAGAIGCNLEDSVPATGEVRSVDDAVARIAAARRAADKNGGGYFINARTDVCFVVPADT
FT                   HDEALIDAVLVRARAYAEAGADGLFVPGLKSPALIRKLTAASPLPVNVMRVADTPTIAE
FT                   LAACGVSRISHGPYPYIQAMKALAALVPQRG"
FT   CDS_pept        complement(223128..223556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03405"
FT                   /product="MarR family transcriptional regulator"
FT                   /note="COG1846: Transcriptional regulators, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03405"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45278"
FT                   /db_xref="GOA:A0A0H3KT29"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT29"
FT                   /protein_id="BAG45278.1"
FT                   /translation="MVRDCCLCLHMQRAARHLARVFDDALRPLDLTNGQFSLLMSLNRP
FT                   EPAPMKAVASLLAMDRTTLTAALKPLERRGLVAIEQDPHDKRSRLLALTPAGERLLAEA
FT                   FPLWQQTHAEIEKPFAPGDMDALRGQLRMLSEAPPARD"
FT   CDS_pept        223676..224044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03406"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45279"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ91"
FT                   /protein_id="BAG45279.1"
FT                   /translation="MSSQQQLYLAVFLGSKDSPRMQAWIAQPEQARRAKEQEGIAAWRA
FT                   WADRHRDAIVEMGGPLGKTKTVSARGIDDTSNALGGFTIVRAASHDAAARMFEGHPHFT
FT                   IFPGETIDVMPVLEIPRG"
FT   CDS_pept        224143..224760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BMULJ_03407"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="COG0625: Glutathione S-transferase, Sinorhizobium
FT                   meliloti"
FT                   /note="KEGG, K00799"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03407"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45280"
FT                   /db_xref="GOA:A0A0H3KJ51"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ51"
FT                   /protein_id="BAG45280.1"
FT                   /translation="MKLYGFAGTRTQRALWGLKELGLDFEFVPVNLLEGEHRRPDFLRI
FT                   NPAGKVPVLIDGDLVIPESAAIVLYLADKYPDKHLLPVDLAQRAHAYRWIMFAVTELEQ
FT                   PLWRIARHTMLYPPDKRLPADIALAREDFASMAVILERHLDGRAFIVGDTLTVADCVTA
FT                   YLIDWAGEYGLIDTFPNLRAYLERMYARPTAPQRIAEAMKAA"
FT   CDS_pept        225289..225873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03408"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45281"
FT                   /db_xref="InterPro:IPR021212"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNX1"
FT                   /protein_id="BAG45281.1"
FT                   /translation="MPESNLSFFGRLSLAVGTFFSVLGNREFAANVLRLRDGAAAPVAP
FT                   TPAAAPAPAPAPAAKAPAPELREASPQAALQLLGLLQRDARFIDFVEEDIAGYSDADIG
FT                   AAARLVHDGCRATLREHFTIVPVRDEAEGSRVTLPAGFDATAVRVTGNVVGSAPFTGTV
FT                   SHRGWRVADVRLPKLTGSHDASVIAPAEVEL"
FT   CDS_pept        225870..227711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03409"
FT                   /product="putative molecular chaperone"
FT                   /note="COG0443: Molecular chaperone, Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03409"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45282"
FT                   /db_xref="GOA:A0A0H3KJP6"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJP6"
FT                   /protein_id="BAG45282.1"
FT                   /translation="MSDPRYSIGIDLGTTHCALSYVDSAASDGEKIAQHVLPITQLTAP
FT                   GALESRDLLPSFLYLPHPSELTQGDLTLPWTASRDFAVGEMARSRGAGTPIRLVSSAKS
FT                   WLCHPGVDRRAAILPSDAPPEVTRVSPLESSIRYLTHLREAWDHAHPDAPFVEQDVTVT
FT                   IPASFDPAARELTAEAARAAGYTRMTLLEEPQAALYSWIQKSEGGWRKQVKVGDLILCV
FT                   DVGGGTTDLSLIAVVERDGNLELHRVAVGEHILLGGDNMDLALAHVVARKLAQQGTQAD
FT                   PWQLRALTYACRSAKETLLSDPTTDAVPLVVPSRGSKLIGGSIRTELTRAELTQTILEG
FT                   FFPQVDAAARPMTRARVGLTQLGLPYAQDAGITRHLAAFLGRQVAALDALEGVQHTLPA
FT                   GATFLHPTAVLFNGGVFKSSLLTQRVLDTLNGWLAAEGAPPARLLEGADLDLAVARGAA
FT                   YYGYVKRGRGVRIRGGTARAYYVAIESAMPAVPGLEPPVQALCVAPFGMEEGTSAALPP
FT                   QEFGLVVGEPVHFRFFGSSVRRQDEVGTLLDFWSPDELQELEEIQATLPAEGRTVGEIV
FT                   PVRLHARVTEAGTLELEAIPSGTDERWKVEFDVRGTA"
FT   CDS_pept        227717..230473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03410"
FT                   /product="putative molecular chaperone"
FT                   /note="COG0443: Molecular chaperone, Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45283"
FT                   /db_xref="GOA:A0A0H3KT32"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR021030"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT32"
FT                   /protein_id="BAG45283.1"
FT                   /translation="MKRYTVGIDLGTSNTVVAYVEPGSDAIRVFDVEQLVGAGAVAAQP
FT                   LLPSVRYHPAPGELAADALRLPWQGAGAAAQAGRDDAPSPVIGRYARTLGAQVPGRLVT
FT                   SAKSWLSHASVDRLAPILPWGAAEGVDKVSPVDASASYLAHVRAAWDARFPDAPLAQQH
FT                   VILTVPASFDDGARALTVEAARRAGLPALRLLEEPQAAFYDWLYGQRATLRDTFAAPRR
FT                   VLICDVGGGTTDLTLVDVAPGDDGEPTFTRVGVGNHLMLGGDNMDLALARLVETRLTEP
FT                   GTRLSAASLSQLVERCRAAKERLLGDEAPESVTVTLLGAGSRLVGGARSAELTRREVEQ
FT                   IVVDGFFPQVAADELPQRARAAIVEFGLPYASDPAVTRHVAAFLKRHAEGPLPDTLLLN
FT                   GGVFRAHALAGRLAQTLGAWRGAPLDVLHNAHPDVAVARGAVAYGLARAGHAPRIGGGS
FT                   ARSYFLVLDDGAADGRPRGVCLLPRGAEEGREIRLEDRTFALQLGQPVRFHLMSTVTDT
FT                   AYRPGDLVDLDGGDFVRLPPIATVVDGQADGGARETPVKLTASLTEVGTLEMHCIATDD
FT                   AARRWRLEFQLRGDAPAQQDGAAPARHPRIDQALELIDRSFGSRAANVTPKDTRRLRAQ
FT                   LEQVLGPREEWDVALARELFDALLARARRRRRSADHERAWLNLAGYCVRPGFGHPLDAW
FT                   RIEQLWPLFDDGIQYVNDAQVWSEWWTLWRRAAGGLDDDAQMQVRDAIAFLEPSPDDKR
FT                   RKLPFDPDKVGPADMMRLSASLERLPIERKIELGERLIAPVQKPAERALRAWALGRVGA
FT                   RRPFYGSAHNVVPADVACRWLDALFALDWKQVEPAAFAAAQIAQLTGDRERDLPDDTRD
FT                   AVIRRLSAANVSQTWIDRVREVVAFDEADTVRVFGETLPAGLKLLGG"
FT   CDS_pept        complement(230712..231302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03411"
FT                   /product="alkylhydroperoxidase"
FT                   /note="COG2128: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03411"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45284"
FT                   /db_xref="GOA:A0A0H3KJ94"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ94"
FT                   /protein_id="BAG45284.1"
FT                   /translation="MTTHAHGFTFDTLGWRAWLDTVPLDTATPEQLAVLEASHPQAKTS
FT                   DYYLLLVHLPEILRQRSGVFNAIMYGPGGLSRAERELASTAVSRVNGCVYCASVHAQRF
FT                   AQLAKRTDAIEQVFDDPATAGTTARERAIVRYAIALTERPDAVGADDIAALEAEGLTHE
FT                   EILDLSHAVAIFAWANRLMLTLGEPVFAEAGGR"
FT   CDS_pept        complement(231299..231829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03412"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4950: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03412"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45285"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ57"
FT                   /protein_id="BAG45285.1"
FT                   /translation="MTDTLTPAAAPDTIDRVAGLRDDDATAALRRARDKVRLHTQLGEA
FT                   ALFDPALPDLSPIERLHAARYVAQRSNAPALASLYRARLLGAGGSDADIAQADADAFDA
FT                   LPARLAAILAHARLLTTSPAAAQRADLDALKAAGLTTPAIVALSQLVAFVAYQLRVATA
FT                   ARALQARVAKEAA"
FT   CDS_pept        complement(231866..233290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03413"
FT                   /product="predicted flavoprotein"
FT                   /note="COG2072: Predicted flavoprotein involved in K+
FT                   transport, Ralstonia solanacearum"
FT                   /note="involved in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03413"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45286"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNX4"
FT                   /protein_id="BAG45286.1"
FT                   /translation="MTTSLDALESRLAEDLRWLDLPAPSWVPPRNVDGMRVLDVAIVGG
FT                   GMAGLAASAELRLLGIDNQCVIDRAPAGYEGPWVTFARMDTLRSPKQLAGPALGLPALT
FT                   FRAWFEAQYGRDAWDALYKIPRTQWMDYLRWYRRVLDLNVRNDTTLVALRPRDDGLLAL
FT                   DLDTQGHAQTLLARHVVLATGRDGLGGPYVPPVAQRAPRTRWAHSSEPIDFAALAGKRV
FT                   GVVGAGASAFDNAGTALEAGAARVDLFFRRTDIPRINKLTGIGSPGLVHGYADLDDASK
FT                   WRFMHYALTSQTPPPRDSVLRVSRHAHAFFHAGSPIETLAEHADGLEVTTPRGRYVVDF
FT                   LIFATGFHSDWTTRSEFAPFAAHVRRWKDRYRPAPGTWLDELAESPDLGPAFSFQERER
FT                   GACPAVTRIHCFNHAASLSHGKLSGDIPAISAGAERLARGIASRLFDADRERHYGALVA
FT                   FSNAELQGDEWRDADA"
FT   CDS_pept        complement(233340..234332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03414"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03414"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45287"
FT                   /db_xref="GOA:A0A0H3KJP8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJP8"
FT                   /protein_id="BAG45287.1"
FT                   /translation="MELHQLEAFSAVMSAGSVTGAGELLGRSQPAVTRQIQELEADLGY
FT                   ALFDRHGPRVTPTRRAFLLYEEVERSLIGLRAIDARARAIGSEIAQPVRIAATPALAAT
FT                   IVPAALAALPDDAHAPHYQLRSESAEHVVHEVLAGTADVGVVTLPMAHAGLDVHWIAQT
FT                   PCVAVLAAGDPLAAKPRIALRDLARRRIVTVANRHRLRQRIDAAFAAARVEPRVFIETN
FT                   ASLNAVMAARAGVGIGIVDPATGVALPVDGVVARPLDVDIPFAFGVATPAGKTRTAAVD
FT                   ALLDALHRTTRALFDDAIFHDASAHDALLRGDRPRTRARVRRLRPEVSA"
FT   CDS_pept        234688..235881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="BMULJ_03415"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683: ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01999"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03415"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45288"
FT                   /db_xref="GOA:A0A0H3KT37"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT37"
FT                   /protein_id="BAG45288.1"
FT                   /translation="MNVSGNDARGAWRRVLGTVAALAAAWGLSTGAALAAGVSGEPVVV
FT                   GVSGPLTGQDAQYGEQWKRGFDLALDEINGSGGIHGRPLAIDFQDSRSDPRQAVAIAQK
FT                   FVADPRVVIELGDFSSATSMAASPIYQRGQLIQFGFTNSHPDFTKGGDYLWSTALSQAE
FT                   EQPLLARYAVKELGFKRIAVLYLNTDWGRTSKDIFAKAAAALGAQVVAAEGYQPAEKDF
FT                   RSTLVRIGESRPDSIVLISYYADGAQIVRQARTSGIALPIAAVGSVYSPKFLELGGTAV
FT                   DGVYTESNFFPAEPRPEVQAFVQRYRAKFHADPDSFVARAYDALILSAEVLRRYGTTRQ
FT                   AAHDGFAKISDVPSVIFGKVRFDPQTRRVAGARTVYLVVKQGRWALWDGARPQLAAR"
FT   CDS_pept        235902..237713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03416"
FT                   /product="branched-chain amino acid ABC-type transport
FT                   system permease component"
FT                   /note="COG0559: Branched-chain amino acid ABC-type
FT                   transport system, permease components, Streptococcus
FT                   pneumoniae TIGR4"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03416"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45289"
FT                   /db_xref="GOA:A0A0H3KJ99"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ99"
FT                   /protein_id="BAG45289.1"
FT                   /translation="MASWLDYTLNGLIVGNIYALLAVGLALIFGVSHLINFAHGSVYMV
FT                   GAFIGWLCLTRFGLPLPVALAAVLLGCGALGVAIERIGLRPLRHAARIAPLLATIGISF
FT                   ILDQLAQLAFGADPRAVPTPLPDWHLRLGGATLGSLDLLIAGIGIAAAALLYGFLRFTR
FT                   LGWAVRATAQDRDAALQMGVDVDRVNQTVFAIACALGGVSGLLVGMYYNSIDPAMGFQA
FT                   TLKGVVALLIGGLGNVPGAIAGSLLLGLVESYGVALFGTSYRDLFAFGLLIVFLVWRPN
FT                   GLFSANRALPPEPMTGTFLAAAKALRVPRPAIVALVALAVVLPWLGASPYVLQTLTNAW
FT                   LYGLLALSLTLVAGTVGQISLGHAALLVIGAYASALLSSDLGWSPAVTIPCAGAITAVL
FT                   GTLLVYPAFRLRGHYVSIATLGIGEVVSLVILNWDGLTRGPLGITGIAPLPWASTAQAA
FT                   YWFTLTVLVAFALVQVRLLRSHLGRTLRAVREDDVAARAHGIAPNRYKAIAFAVGGVAA
FT                   GVSGGIAAHLYSYINHQTFDSQVSILALTMVILGGLGNVLGGIAGALALIGLPELFRWA
FT                   ADYRMLIYGLVLLLLVRFRPQGLLGTV"
FT   CDS_pept        237725..238585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03417"
FT                   /product="branched-chain amino acid transport system
FT                   ATP-binding protein"
FT                   /note="COG0411: ABC-type branched-chain amino acid
FT                   transport systems, ATPase component, Streptococcus
FT                   pneumoniae TIGR4"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03417"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45290"
FT                   /db_xref="GOA:A0A0H3KJ64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ64"
FT                   /protein_id="BAG45290.1"
FT                   /translation="MTTTQPPLLDVQGLTRRFDGVTALDGASLTLAEGELLSVIGPNGA
FT                   GKSTLFNLIAGADRPDAGRVTFDGRDVTGAAPERLAALGLARTFQHGRVFGNLSVLDNV
FT                   LIGAHARLRAARPGWPVLGAAAEVVRALLRPASVRREEAALREEAREIVAGFGERLTPR
FT                   IDHPAHSLSYANRRRVEIGRALALHPRLLLLDEPTAGMNETETAEMLELIRSLKARGLT
FT                   ILLIEHKLELVMRVSDRVMVLDNGVKIAEGAPRDVRHDPRVIEAYLGRRHAGGAPAVRA
FT                   AQAAA"
FT   CDS_pept        238615..239346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BMULJ_03418"
FT                   /product="branched-chain amino acid transport system
FT                   ATP-binding protein"
FT                   /note="COG0410: ABC-type branched-chain amino acid
FT                   transport systems, ATPase component, Thermotoga maritima"
FT                   /note="KEGG, K01996"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03418"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45291"
FT                   /db_xref="GOA:A0A0H3KNX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNX9"
FT                   /protein_id="BAG45291.1"
FT                   /translation="MTDALLKLEHLDTFYGPVQVHFDVNVAVGRGQIVSLLGGNASGKS
FT                   TTMKLILGLMRPRRGVVRFDGDDVTNLATPQRVRRGIAAVPEARRLFGDMSVRENLLMG
FT                   AYTRGDRAAVADDYERVLDLFPRVRERLAQRAGTLSGGEQQMLAMARALMARPKLICMD
FT                   EPTMGLSPLYVDKVLELIDTINRQGVTVFMVEQNASLALEIAHYGYVLQTGRVVLEGAA
FT                   KTLLDDERVRDAYLGGEAVTA"
FT   CDS_pept        complement(239473..240882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03419"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Xylella fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03419"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45292"
FT                   /db_xref="GOA:A0A0H3KJQ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJQ1"
FT                   /protein_id="BAG45292.1"
FT                   /translation="MPRTDWFPKTLFGRTLLFIALVVATGALALAAIARYYAGVAAERA
FT                   YDQLLAGASIQVAENLYVQGGVLALNPPVAALSTLSRYDLVYYKVVDSRGVVVAGYNDL
FT                   ASSATLAAAKQGPAFANAVYHGHRIRTATIARYMPEESTPGWALVTVAQTTNARQQLTN
FT                   EMSIKVWTLILLMSVLAIGASGLAIRRGLRPLAQIGAIIAARDPADLRPVAVDTPSEID
FT                   AIIGAINGLMRRLAERINAMQRFIADAAHQMRTPLARLDAQIELLDGDDDPARHAARLD
FT                   ALRATCADVGRLTGQLLNHAMVIHRTEAVPLQPVDLVALAKDVLGRAIPLAGERDVAVA
FT                   FASDAPHAWIDGDAISLQEALSNVLHNALLHGHADDIVVSVATSGHADDAVTLTVTDNG
FT                   RGIPREHWDAALQPFVRIAPDGTERRTGSGLGLAIVQEVMKAHGGRVGFAFPDAGGFAV
FT                   VLTFPKAARTG"
FT   CDS_pept        complement(240869..241534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tctD"
FT                   /locus_tag="BMULJ_03420"
FT                   /product="OmpR family two-component system response
FT                   regulator"
FT                   /note="COG0745: Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain, Xylella fastidiosa 9a5c"
FT                   /note="KEGG, K07774"
FT                   /note="TctD protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45293"
FT                   /db_xref="GOA:A0A0H3KT41"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT41"
FT                   /protein_id="BAG45293.1"
FT                   /translation="MRILVVEDDAEIGAAIRSRLARLGHAVDLETDGSTANSLLRVERF
FT                   DLVVLDANLPGLDGFAVLRNLRAAGSTTPVLLVTARSAIDDRVSGLGLGADDYLVKPFD
FT                   YRELDARVQALLRRNSGHASDVLTLGGLVIDRSSRLAELDGKPLSLSRQEFALLEILAS
FT                   RPQRIFSKDELLNQLFSFGNEPSANAVEQYVTRVRKKLQGSSVEIRTARGMGYQIAAH"
FT   CDS_pept        241742..242767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuA"
FT                   /locus_tag="BMULJ_03421"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   substrate-binding protein"
FT                   /note="COG0715: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems, periplasmic components, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02051"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03421"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJA4"
FT                   /protein_id="BAG45294.1"
FT                   /translation="MTSRPRRRALIAAGLGMLGALGAPSLVRAKPRTVRISKGYGVLYL
FT                   PLLVMEKQRLFERHAARHGMRDVAVDWVLLDGGNSVNDAMMAGTLDFAGAGAPGFIELW
FT                   ARARGIPNVEVIGISGLSTTSLSLNANRPGLTSLRDFTRSDRIAVPGIRTSLSAVVLQM
FT                   VASRQLGAAHFAQLDSITVNLPHPQAMQALIRRENGVTAHFTSPPFSTLELRQPGIHRV
FT                   VNSVDVLGPMTLDVVFAPKRLVDAEPALATAFLGALDEANRLIAQDPRAAAALYAASSG
FT                   VGVSHDDVMQMLAAPETRFSVRPNQLMDYVDFLYLAGTIKAKPRAWHEMFAPMLDDYRS
FT                   G"
FT   CDS_pept        242866..244176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03422"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03422"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45295"
FT                   /db_xref="GOA:A0A0H3KJ69"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ69"
FT                   /protein_id="BAG45295.1"
FT                   /translation="MNSTAYPDAASADEQRIMSKMARRLLPILVVMFLIAFIDRQNVGF
FT                   AKLQMVHSLGLTEAAFGLASSLFFIGYLLFEVPSTLALHRYGARVWLARIMLTWGLITV
FT                   LMGFTTSMPVFCALRFLLGIAEAGFYPGVIYYLTLWFPQSYRAKVLGIFTLGSALANML
FT                   GSLVGGVLLSLNGVWGLAGWQWVFVATGIPAVLVAIVVFRVLPASFREARFLDEREKQI
FT                   VAAALEREKPAQAEHAQPWKALLDPRVMLFAATYMLMSTSLYGVTYWLPTLVKSFGVSS
FT                   STNGLLSMLPWALAVLLLLWLPAKLRRAKSILRTISIVAALGALGFLLSLVLPSTPLRF
FT                   VALVLGGACIPLLYPCFWSMPPRYFTGARAAASVAAINSIGNLGGFFSQNLMPFAGKVT
FT                   GTAFGPMIVPIVCLAVLGIGALVAWTRSERAMVAAGA"
FT   CDS_pept        244478..244930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03423"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNY4"
FT                   /protein_id="BAG45296.1"
FT                   /translation="MIDLADVLSSALPDAIAWAEAQAARGLADGTPLTRPQLDDARAVG
FT                   VARPERIRIATVERMPFPDTPALAALARDTGLLPPGTIGLTLGHAVFVLRGHGTRRLLT
FT                   HEFRHVHQYEAAGSIGAFLARYLQEIATVGYGDAPLEADARRHERD"
FT   CDS_pept        245042..247060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03424"
FT                   /product="membrane-associated phospholipid phosphatase"
FT                   /note="COG0671: Membrane-associated phospholipid
FT                   phosphatase, Xylella fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03424"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45297"
FT                   /db_xref="GOA:A0A0H3KJQ8"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJQ8"
FT                   /protein_id="BAG45297.1"
FT                   /translation="MSAAIHAWLAEIGAHPALALAIVFATACAEAIALIGTVVPAGAVM
FT                   FAAGALAGAGALDPWTTIGVAAVGAIVGDGISYELGRYYRGMIRNGWARFGHAAVYARG
FT                   EQFVLRHGTKSIVLARFLAPVRAVVPVVVGCATLPRRSFYPVNIVSALVWAPVHIAPGM
FT                   LFGASAALAAALSVRIAAILLVVAALVLGVWYGVRLLLRRGWPLLHAAFAATLHACVRH
FT                   WPRVGARLHDSLVHLRRLPGAVPVLALLFVASVWLFGRIVQDVVANAPLMHADVALYAL
FT                   LQNLRTPPVDAAMRAVVVLHGRDAGLIVSAAFLAWLAIHRCWASAAWWLATVGIAVVLV
FT                   PAFGVVPPGATPAALPPGAAHMPLPDADAAFAILASSGIGWLLARDRPARWRTPVVTAV
FT                   VLWIVLGGFARLYVGDTWLSGLVGGWSLGLAWFALLAGAHAYWRVREHVQPVGATVALA
FT                   VVLATVGVWLVPAQWDADRAARPHAGDVVAMTVDQWMRGGWQRVPTRRTEIGGDREEYL
FT                   PLQWCATSDTLDRHLAQAGWQRATPWTLQTALRWLMPQGPAESLPVLPRYTHGESTRRV
FT                   FVRADPAHADSRLVLRLWRYPYALSDARGTRALWYGALYREALHRPARLMTVVRSTPID
FT                   DARTLTQTLAVEPTIVHAPRGLVAAPGGVLLVWSAEP"
FT   CDS_pept        247475..247978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03425"
FT                   /product="putative N-acetyltransferase"
FT                   /note="COG0454: Histone acetyltransferase HPA2 and related
FT                   acetyltransferases, Yersinia pestis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03425"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45298"
FT                   /db_xref="GOA:A0A0H3KT46"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT46"
FT                   /protein_id="BAG45298.1"
FT                   /translation="MITLRPMTEDDFARFWPTYRAVVAAQETYALDPAPTFEAARALWL
FT                   DAPLCTWVAEEDGVLLGSYYLKANAAGPGKHVCNCGYMVGEAARGRGVARLMCEHSQQV
FT                   ARDRGFLAMQFNSVVATNEVAVALWQKLGFEIVGRLPRAYRHARLGFVDCLVMFKWLGG
FT                   DAQA"
FT   CDS_pept        247975..249249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03426"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03426"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45299"
FT                   /db_xref="GOA:A0A0H3KJA7"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJA7"
FT                   /protein_id="BAG45299.1"
FT                   /translation="MKPPRRSTVRNDAPTRGAAPPPDASAHVTDRSRIAAWRLAIGLSL
FT                   GSAIALGLARFSYALLLPPMKADLGWSFAQAGALNTANAAGYLFGALAFPWLSRRWRAG
FT                   TLLAAGCVLTACLMAACGVTVGMQALLVQRLATGIGSALIFVSGGVLAARLASASPRDA
FT                   GLLLGLYYGGTGWGIVASSLLVPATLVHRAHGWQPAWFALALACVLCAAIAVSAARRIE
FT                   HNHRPPPARVDDAAAAQASPARFAFALGGYGLFGVGYIGYMTFIVALLRDAGMSGTVVS
FT                   AFYVMLGVATIVSARLWSGLLDRMRGGQALAVLNALLGIATLMPALIVHPAAAFVSGVL
FT                   FGATFLSAVASTTAFVRHNLPPDGWPKGISAFTTIFAFGQIAGPVAIGWVSDSAGLARG
FT                   LVYSALTLFAGAALAAAQRALRRAV"
FT   CDS_pept        complement(249266..249820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaC"
FT                   /locus_tag="BMULJ_03427"
FT                   /product="4-hydroxyphenylacetate-3-hydroxylase small chain"
FT                   /EC_number="1.14.14.9"
FT                   /note="COG1853: Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K00484"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03427"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45300"
FT                   /db_xref="GOA:A0A0H3KJ74"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR011982"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ74"
FT                   /protein_id="BAG45300.1"
FT                   /translation="MSATSPTTDSAPAVRAEPSDAQKAFRHAMAHLGAAVNVITTAGPH
FT                   GRCGITASAVCSVTDTPPTVLVCLNRSSAMHAIFERNRHVCINVLPAEHEMLARHFAGL
FT                   TELPMERRFALPVWDRGAHDVPVLRDALASLQGTIAGMQTVGSHSVMFIEATSIRVRDD
FT                   GDSLIYFGRAFHRVSRGACVR"
FT   CDS_pept        250135..250767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03428"
FT                   /product="LuxR family two component transcriptional
FT                   regulator"
FT                   /note="COG4566: Response regulator, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03428"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45301"
FT                   /db_xref="GOA:A0A0H3KNZ0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNZ0"
FT                   /protein_id="BAG45301.1"
FT                   /translation="MTSPAPIVYIVDDDGGMRTSLAWLLESVGIASEGFANAADFLARF
FT                   DANLPACLVLDVRMPEKSGFDVQAELNARGATLPVIFVSGHGDIPMSVRALQNGAIDFV
FT                   EKPYNSQQMLERVQRALRLAQQRHVADQRHRELRERLAALTAREKEVLQGVVDGKGSKQ
FT                   IASDLSISVKTVDVHRASIKEKLGATSIAALVRDVMVVWGDERERPR"
FT   CDS_pept        complement(250819..251562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03429"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03429"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45302"
FT                   /db_xref="GOA:A0A0H3KJR2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJR2"
FT                   /protein_id="BAG45302.1"
FT                   /translation="MSDRVVLVTGAARGLGAVIAERFHAAGYRVALADIAADAIRAHAR
FT                   DLDPEGTRAIAIPLDVTSKHDFEAARDALVARWGEVDVLVNNAGASKVVPAMEITAEQF
FT                   DQVIDVNLRSVLFGCQVFGQYFATRGAGRIVNIASLAGQNGGSATGAHYAAAKGGTLTL
FT                   TKVFARDLGAHGVTVNAISPGPLDLPIVHESVAPEKLRQVLASLPGGRLGSAGFVADAA
FT                   VLLASGDAYFANGACWDINGGLYMR"
FT   CDS_pept        complement(251617..252741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiE"
FT                   /locus_tag="BMULJ_03430"
FT                   /product="amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="COG0154: Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases, Pyrobaculum aerophilum"
FT                   /note="KEGG, K01426"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45303"
FT                   /db_xref="GOA:A0A0H3KT54"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT54"
FT                   /protein_id="BAG45303.1"
FT                   /translation="MTGFIDTFTLGGPGPTIAIKDTIDIAGYPTRAASRALADAPPATQ
FT                   HADVVRLLLDAGWQIAGKANMHELAFGMTGINDYTGTPLNPQDASRIPGGSSSGSASLV
FT                   GLGAVDAALGTDTGGSIRGPAACCGVFGLKPTFGRVSRRGVAPAETTLDCVGPFARDMD
FT                   TLSAAMAAIAPGFDRVRAAASAAGCTVAQVGVDAEPAIARALRAALDAAGLRTHTLVLD
FT                   DLHAAFDAGLVVINAETSRAFGHLVATGRLGADLDARLRAAATTTAAALDAAEAVRARF
FT                   TAQVDAALEHADALVLPTLPALPITLDEARNGVSVIAMSSLIRPFNLSGHPALSVPLPL
FT                   DGSPLKAGLQIVGRKGADEQVCALAAHVAAALAA"
FT   CDS_pept        complement(252773..253306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03431"
FT                   /product="probable succinyl-CoA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03431"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45304"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJB2"
FT                   /protein_id="BAG45304.1"
FT                   /translation="MNDTTERAAAHTLDALARRVAALEAERAVRATIARYMALCDVPEA
FT                   AGDGPALDALFTPDAVWEGIGPQYAQKFGRLEGPAAIVAMLRRYLPPDPHFGANLHFLT
FT                   SETIDVAADATAARGRWIMLQASRYADGSAELIGARLTVDFAPAQGGPAWLIRHFRTER
FT                   VLDGPWPLAAAQRP"
FT   CDS_pept        complement(253318..253695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03432"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45305"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ80"
FT                   /protein_id="BAG45305.1"
FT                   /translation="MSDSNPLPLRVLFCCGVSQNFFDLPREQIGEVWQAYGAMLAAVEA
FT                   MPGVRVLGVMDDDRLVVGHADGAPWTFYIMADVADFDTAVAVCNLYRTTPVGEYNLWRY
FT                   GKIEARVGRALTVPPAARPAS"
FT   CDS_pept        complement(253743..254936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03433"
FT                   /product="putative acyl-CoA dehydrogenase family protein"
FT                   /note="COG1960: Acyl-CoA dehydrogenases, Mycobacterium
FT                   tuberculosis CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03433"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45306"
FT                   /db_xref="GOA:A0A0H3KNZ5"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNZ5"
FT                   /protein_id="BAG45306.1"
FT                   /translation="MQHAAAAIDTAPRPAPPACVPDARLSALDAVIETVTARRDEFDRL
FT                   SHVPRDVIALFKQAGIYRAGTPRRFGGDALAPGAFLETIERIATADGSAAWVASFGSAN
FT                   VYLAALPLDTQAELYASGPDQVFAGGLFPVQPAQPAPGGWRVNGTWKFASGCKGADWLG
FT                   VGIAVPGAQDAAPNKPRTAVFRAADVEIVENWNVVGMQGTGSHDLRVNDRFVAEAWTFV
FT                   RGGEPTVDEPLYRYPTIAYAAQVLAVVNLGLARAALDVVNRMSGGRQTTTGAPRLADRA
FT                   YFRIELAKAEAQLRSARAFFYDATDSVWQSILAGNAVTPDQVSLLRLAATHIAREGASV
FT                   VERAYRLGGTPAIYRTHPLQRLLRDAMVVTQHAFLAEGNFDGAGAVFTGVAPFPGYL"
FT   CDS_pept        255067..256620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03434"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00936"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03434"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45307"
FT                   /db_xref="GOA:A0A0H3KJR8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJR8"
FT                   /protein_id="BAG45307.1"
FT                   /translation="MRSTRAGAMLGVRPRDAARLVPDPTMRFPDEDDFHRLLDALTTCV
FT                   LLHDAQTKAIVWANRAACIALGFSVEELLPLKAPDMTRPEPKYRREIGVGAMDRAIVEG
FT                   PQVYEWCYRSRTGVDMLSEAIATYVPLRGRDVVMVQFRDISAEEAIRQQLRRYEARLRE
FT                   FMQDLDEGIAVVTPHGGVQFISESGRRVLGLAADEAVGDVLDYCSADDRARLVAQLRDA
FT                   PSTCPSEPQRYRFVRRDGSTCWLRVACRQVEIEGDLDGLLVHFRDVSDEVAIEEARRAE
FT                   ARMLEYAGRYNAMGEMATVIAHELSQPLAAVRNFIEGAVQRLGARGNVDDAIWGLRSAD
FT                   RQAEHAALIIKSVREFIVKREPVVVLADLRDILADVAYFIELRAREAGVTVSIVQADVP
FT                   LPVRCERVLIGQVILNLAFNAIEAFAGCERATRMLTLGTAQVGALAELRAIDNGPGVAD
FT                   DAHDRLFDGFSSSKAGGNGIGLSLCKSIVTRHGGRIAARRAEGGGLDCRVTLPLADAGA
FT                   "
FT   CDS_pept        complement(256665..257051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03435"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03435"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45308"
FT                   /db_xref="GOA:A0A0H3KT69"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT69"
FT                   /protein_id="BAG45308.1"
FT                   /translation="MPTLEVFLPAGHDDARKAELIARLTHATVDAIGAPAESVRVLLTE
FT                   LPATHIGLGGRSAADGAPPALPVIVAILIAGRTDAQKRALIAALSDAGANVLDAPLQAT
FT                   RVIIKDIPNTDFGIGGQTARALGR"
FT   CDS_pept        complement(257157..257657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03436"
FT                   /product="putative aromatic-ring-hydroxylating dioxygenase
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03436"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45309"
FT                   /db_xref="GOA:A0A0H3KJB6"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJB6"
FT                   /protein_id="BAG45309.1"
FT                   /translation="MDDRNALFSQQTFARAVEFVWREAEMLDRRDYRAWLDLWDPAGHY
FT                   VVPIDPQTTDFAATLNYVFDDRDMREKRVQRMLSGYSASASDAARTVRTVSRFTLESSS
FT                   ADTVELKSAQVVVAYKRGTTTLFAADVTHRLHIDADGELRIAEKVVRLIDSTEALSAIG
FT                   FLL"
FT   CDS_pept        complement(257657..258940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03437"
FT                   /product="ring-hydroxylating dioxygenase large terminal
FT                   subunit"
FT                   /EC_number="1.14.12.18"
FT                   /note="COG4638: Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K08689"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03437"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45310"
FT                   /db_xref="GOA:A0A0H3KJ84"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ84"
FT                   /protein_id="BAG45310.1"
FT                   /translation="MNDIPYQTIDTRALHGLAQPDRIAPALYHDPALFEAELDRIFYRT
FT                   WIWVAHDSELPRPGDFITTTIGRQPVIVVRDKTGEVNVLQNRCRHRGATVCEAHKGNAK
FT                   GFTCPYHSWSYALDGTLRALPYGDGYEGVCDKGDLPLVKLRVGVYQGLIFASFNDEIEP
FT                   LEDFLGGAKPWIDLFMKQGAGYPIKANGEHKFRFKGNWKIQLENTTDLYHFPVVHKSWM
FT                   ESIDDETAAAITSFMTSDAAFCRSLGNGHSLAVLMPELVDLDDDDGAPLPERFAPLAAK
FT                   LAERHTPEQVRRIVRSLMGVGFNLNLFPNLALSMAFFRVLRPISATETEIRHVALAMDG
FT                   GPDEANRERLRIHEHFQGPFGFGSPDDAEAWERVQRGAYAGPDVPILVNRGLNRETIAA
FT                   NGEKTAHATDETGMREAYRQWRTMMEQA"
FT   CDS_pept        259263..260597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03438"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Salmonella typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03438"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45311"
FT                   /db_xref="GOA:A0A0H3KNZ8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KNZ8"
FT                   /protein_id="BAG45311.1"
FT                   /translation="MHSPAPTSTVTLSVSRHAGSVRRAVTTAVVGQALEWYDFFLYGTA
FT                   AALLFGKLFFPVGTDPLTGTIAAFGGFTVGFVARPIGGLLCGHIGDRYGRKTVMMLTML
FT                   TMGVATAGMGLLPTYREIGIAAPIALVLLRVLQGLAAGGEWSGSILLIHENAPAERRGA
FT                   LAAWSPCGAALGFVLSTAAFLLVQRLPVADIESWGWRIPFLASIVLVGFGLWMRRSVGE
FT                   SAAFEHVRSEQHASAAPLVDVLRECPREVATVFGLRFGEGAVSYLFFSFSLAYGKFIGL
FT                   DASWLLSGLVISMLLMIPVTLAAGRLTDRIGRKPVYLVGAIVVVLIAYPYFVLLQSGRF
FT                   AYVLAALILANSVAIGILEGAQPAFISELLPVRLRFSGLGIGREIASVLGGGLSPMIAT
FT                   ALLAHYRSAAPIVIYLIVLGAITIVATCIAPETYPKAARDAHRVR"
FT   CDS_pept        260651..261850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03439"
FT                   /product="putative acyl-CoA dehydrogenase family protein"
FT                   /note="COG1960: Acyl-CoA dehydrogenases, Mycobacterium
FT                   tuberculosis CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03439"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45312"
FT                   /db_xref="GOA:A0A0H3KJS4"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJS4"
FT                   /protein_id="BAG45312.1"
FT                   /translation="MQTSTVVRPFEPAAPSGLAPQSDDTSPLPLDAVIAEVERRRDEFD
FT                   RLSHVPRDVIALMKRAGIFRAGTPKQFGGDALPPHEFVAMLERIAVADGSAAWVAAFGS
FT                   ANTYLAALPLDTQRTIYANGPDQVFAGGLYPLQPAQRVAGGYRVSGRWRFASGCKGADW
FT                   IGVGIGGAAGEGGAPGKPFTAVFPAAEVEIVENWRVVGMQGTGSHDLALDDRFVADAWT
FT                   FVRGGEPTVDEPLYRYPAVAYQAQVHAAVNVGLARAALDLLTAMSGATKTTTGAPRLAD
FT                   RPYYRAGLAKAEAEWRSARAFFYETAEQVWASLVAGRPVSPSQANLLRLSATHAAQVCA
FT                   KVVMQAYQLAGTAAIYRENRLQQLVRDSIVVTQHAFLGEATYDGSGALFAGIDPVTPYP
FT                   "
FT   CDS_pept        261889..262416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpaC"
FT                   /locus_tag="BMULJ_03440"
FT                   /product="4-hydroxyphenylacetate-3-hydroxylase small chain"
FT                   /EC_number="1.14.14.9"
FT                   /note="COG1853: Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K00484"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45313"
FT                   /db_xref="GOA:A0A0H3KT79"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT79"
FT                   /protein_id="BAG45313.1"
FT                   /translation="MNHPTHLDDVRQNFREAMSRLPAGVNVITTDGARGRWGITASAVC
FT                   SVTDTPPTMLVCINRGSRAHDIMRGNGRVAINLLPSGCESIAQAFAGMTQTPGDARFDD
FT                   TRWVDGATGVPVLADANVSLEGHIIESKAVGSHSVMFVEIDHIALRSPGDGLIYFGRAF
FT                   HRLAHPLAVHAG"
FT   CDS_pept        262420..263121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03441"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJB9"
FT                   /protein_id="BAG45314.1"
FT                   /translation="MEVCLFLIAEHGDDGAQAASPDVAPAPDALRGVRGLARWIVHRPV
FT                   AFAADRADPVPRPRAPACVLQCYFFDLDALEAMLVPAGAAQAFVECCAAAGLRVAQQAM
FT                   AVRRVPLAGARAGAQCCTYLVSYEGEAADANAWLSHYLDHHPPLMAQLPGIREIEIYTR
FT                   IDYRSALPVPRARAMQRNKVVFDDAGALADALASPVRVLMRRDFEALPPFTGATPHFPM
FT                   ASRVCEITCAE"
FT   CDS_pept        263220..264140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03442"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03442"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45315"
FT                   /db_xref="GOA:A0A0H3KJ92"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ92"
FT                   /protein_id="BAG45315.1"
FT                   /translation="MNKSHPVVTDLNLLRVFLAISELRSLTAAGERLGLTQPAVSHALR
FT                   RLRNLFDDPLFVRTPAGMAPTDAARQLHGPLTRAFDIIDLAVQQVAHFDPATANRVFRI
FT                   SMSDMSEFYFLPPLLAKLAEVAPGVRVEVASAAVEAVGAAMRSGEIDLALGYVPDPGPG
FT                   CVSEPLFTDEHVCMVRAGHPLRKRTPTQADLAALRYIYASSNATGHRMVETWLDELQVE
FT                   RTIVLRLPHFIVAPEIVQHTDLAIIFPRSVAERFNRGRAFRILPLPFVLPPIEIDLHTH
FT                   AQFSSDPGIAWLRALIVEMFRRPVA"
FT   CDS_pept        264240..265160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03443"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03443"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45316"
FT                   /db_xref="GOA:A0A0H3KP05"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP05"
FT                   /protein_id="BAG45316.1"
FT                   /translation="MTSVDHLDLNLLRVFQAIVEERSLTKAGERLALSQPAVSYSLGRL
FT                   RTLFDDPLFVRTRAGMQPTPVALELAGIVGKALDMVRVALRYAERFDPATSTRTFRLSL
FT                   SDAGEMAYLPAICRALRERAPRVTLSVQPMPVEAIEEALRASRLDFAIGNLPELMPRTR
FT                   HQLLFEETYVCMTGRRRGLPSGTTLTLEQFVRAAHVNVKSVEHSHHALDDALRAQGVGR
FT                   NVALEVPHFVALPGVLQVTDLYATLPKRLAQILNRDNAFRLYALPVPLPPAPVTMHWHE
FT                   HFHEDEGITWMRALLAEIVERFDGA"
FT   CDS_pept        complement(265183..266163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03444"
FT                   /product="phthalate 4,5-dioxygenase"
FT                   /EC_number="1.14.12.7"
FT                   /note="COG1018: Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1, Pseudomonas aeruginosa"
FT                   /note="KEGG, K07519"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03444"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45317"
FT                   /db_xref="GOA:A0A0H3KJS8"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJS8"
FT                   /protein_id="BAG45317.1"
FT                   /translation="MQANRHQVRIDALIDAAQDIRCFRVSRVDGQPLDAYEPGAHIDVT
FT                   APSGVTRQYSLCGRPDERGSYLFAVKKETQSRGGSRSLHDDVRVGTELSIGTPRNLFRL
FT                   ADDASEHVLIAAGIGITPLLSMAYALAQRGARYRLHYFARSRDRAAFVDELSAEPFAPH
FT                   VTFHYGVEREALARELGRCVESIDAQAHVYTCGPAPFMDAVVAAAATRVPDDAIHLERF
FT                   AAEPAVAGDAANANASEGFEVRLQRSGQSVRVAPDTSIVDALARIGIEVDTSCGEGVCG
FT                   TCMVPVVDGEPDHRDHCLSKAERASNSVICCCVSRARSPVLVLDL"
FT   CDS_pept        complement(266314..267726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03445"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03445"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45318"
FT                   /db_xref="GOA:A0A0H3KT89"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT89"
FT                   /protein_id="BAG45318.1"
FT                   /translation="MSASLPRAADGKRYTYEWYVVVICMLAYVFSFVDRQVLVLMIEPI
FT                   KRDLHLTDTQFSLLNGFAFSLFYAVMGLPVAYLADRYARPRIISLGIALWSIATALCGL
FT                   SQHFVHMFVARMGVGVGEAALSPGAYSMLADYFPKEKLGRAIAVYSLGSFIGGGVAFLI
FT                   GGYVIALLKHASAFTLPIVGQVHAWQVTFLIVGLPGLLVALLFVATVRDPQRKGLAQDR
FT                   SGAVRRVSMRDSLRFVGTHRATFACHYLGFSFYAMALYCLLSWTPAFYIRRFGMTAVEA
FT                   GYTLGIVLLVANTAGVFCGGWLNDWLLRRGRVDAPMRAGAIGAACMILPATLFTQLDAL
FT                   PASLAMLVIAMFFASFPMPTSTAAMQTLAPNQMRAQISALFLLVSNLIALGIGTTVVAL
FT                   FTDRVFGTPAAVGHSMSIVNVAAAALAALLLGAGCRHYRRSLERERGHVQAAAPAADSA
FT                   AGAIAASGSGAR"
FT   CDS_pept        268156..269274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03446"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03446"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45319"
FT                   /db_xref="GOA:A0A0H3KJC3"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJC3"
FT                   /protein_id="BAG45319.1"
FT                   /translation="MTDSNGRAGRLAVPLAALLACAALPAAAQSSVTLYGRIDTAIEYA
FT                   NAGPNHVTRMGSGNLWASQWGLKGVEDLGGGYATIFKLEDGFNAASGALSNPSALFGRE
FT                   AWVGITGPFGGVQFGELYTILHTTLVTYSLPGLGAGLAWGNATNNFVGPAFLRVRNSLR
FT                   YTSPRYAGFMLRAMAARGANGAAGQPSTLGDTYGAGINYVRGGLSIDVDYMQQTFSPVA
FT                   ASTLGATSRAANGNYTLGAISYDFRVVKIAALYLRHRGGPDVAAAIDAQSAYPHSDIVE
FT                   LSATVPIGRASLLLSAGHYRKVADSDGNADSYGIRFDYPLSKRTVLYTGAAMVRNGAHA
FT                   RFVVNGAAGGGVAVAAAGATASSLVAGIVTSF"
FT   CDS_pept        complement(269313..270347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03447"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03447"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45320"
FT                   /db_xref="GOA:A0A0H3KJ98"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJ98"
FT                   /protein_id="BAG45320.1"
FT                   /translation="MTPSVPGRPPPLRTDAPPTDADACDGLRVQDLDLNLLKTFRAVYA
FT                   ERHVGRAALQLGVTQPSVSHALGRLRLMFRDALFVRTGTGVEPTPRAQRLAVSVDQALA
FT                   ILQHVLDEGSRFAPDTTQRVFRLHMSDFAASAFLPTLLAEFERRAPGAVIETLHVDECQ
FT                   LNVALESGRIDFALGHFADASSHFQRTALLHERCVLLMPRRTARRVALPDDFVLDGDAP
FT                   DTLRFVAVTSHPQSMQLLDRHGLMPRVRVALPDFMVVPALLQHGDYALILPETIALTFA
FT                   AQQPCTLHAIAGAGEWAVNAYWHRRFDADPGHRWLRALLLELFSIGTLAPFEAWLAPQP
FT                   PACA"
FT   CDS_pept        complement(270344..271318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03448"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03448"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45321"
FT                   /db_xref="GOA:A0A0H3KP09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP09"
FT                   /protein_id="BAG45321.1"
FT                   /translation="MDIALSGHAPNRLGALHAPDEVERAVAHRLGPHRMAAHGRDPFHA
FT                   ELYEVPLHHGALLELCYGRETRIDFGDDADHFLFRLTLSGSCELQAGQAIVHAGPGELT
FT                   VSSPARASRLRTSRDCRNLVLRLERRALERKLQDMLGTTLARPLQFEVDASRHRAGAAL
FT                   VLPTFDYLCRLGTQPALGAAAATFGADLSAWLMSLLLTHLPHSYSDALARGTPPLPAPV
FT                   RRACAYVDAHLGEPLALAALARVAGVAPRTLQHAFRTFLNTTPAAYVRDRRLAAVHAAL
FT                   QRGDARSVTDVLLAHGIHGFGHFAKAYARRYGHPPSVTARQPR"
FT   CDS_pept        271471..272577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03449"
FT                   /product="putative NAD/NADP octopine/nopaline
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03449"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45322"
FT                   /db_xref="GOA:A0A0H3KJT3"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJT3"
FT                   /protein_id="BAG45322.1"
FT                   /translation="MKVCVLGGGHGCHAAAIDLFEKGHDVAWWRRDRAPHARLRALGAL
FT                   TVTDARGTRTVPVGDARGAIRATDDLGAALRGARLVVVPLPATSHDALAADVAPLLEDG
FT                   QVVFLPPGTFGSFVFARAAARAGNRARFAFAETGTLPYLVRQHGDGNVVISAYATRLPT
FT                   GVFPAREASWAFDVLRAGYPSVEPLDDALSGALMNAGPVIHPPLILMNAGPLEHFDAWD
FT                   IHNEGTQPSIRAVTNALDAERIAVREALGYRAPHFPLADHYAADGDEWMYGRGAHGKLT
FT                   DSGDWREKIDLRAHRYMLEDTRLGLSFLVSCGRWAGVPTPVAQGLLAIAGAVAARDLYA
FT                   EGRTLERLGLAALSRDAMRTLLETGDAA"
FT   CDS_pept        272574..273584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaH"
FT                   /locus_tag="BMULJ_03450"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="COG1250: 3-hydroxyacyl-CoA dehydrogenase,
FT                   Halobacterium sp. NRC-1"
FT                   /note="KEGG, K00074"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45323"
FT                   /db_xref="GOA:A0A0H3KT93"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT93"
FT                   /protein_id="BAG45323.1"
FT                   /translation="MMPAAELTRVHVLGAGRMGQGIALAFAFAGLEVTLIDFKARDAAG
FT                   RLAFDRRTRDELARPLHAQVALGRIDAAQADAALARIAHVARDGAADAIRDAQVVFEAL
FT                   PEVLDAKADALRWLDAHVDADATIASTTSTFVVTELQRHVARPARVLNAHWLNPALLMP
FT                   LVEISRSDATAQHVVDELAALLVRIGKKPVICGPAPGYIVPRIQALAMNEAARMVDEGV
FT                   ASAADIDTAIRTGFGPRFAVLGLLEFIDWGGCDILYYASTYLAGEIGPRFAPADGVVRN
FT                   MNAGRDGVRTGAGFHDYADVDVAAYMRQRLGEFARLLEHLGLAPTFDGARRRPSA"
FT   CDS_pept        complement(273641..274978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03451"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Corynebacterium glutamicum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03451"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45324"
FT                   /db_xref="GOA:A0A0H3KJC8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJC8"
FT                   /protein_id="BAG45324.1"
FT                   /translation="MYPTDTVQSPSAARPLADRQLRRIVIASVAGNAMEWYDFFVYGTA
FT                   AALVFGHVFFPPGASPLAGSLAAFAAFALGFVARPLGGIVFGHVGDRYGRKASLVWTLL
FT                   IMGASTFAIGLLPTYAQAGIWAPAALVVLRLLQGIASGGEWGGGVLIISENAPPEQRGY
FT                   YAAWSQLGVGGGFVLSSAAFLAAQTLPNDMFMTWGWRLPFLASIVIFAIGIYIRRHLPE
FT                   SRDYEQAGKRGAHTHLPIVECIRRHPKEILLAMGLRVAENGGAYIFLAFSLVYGKYVGI
FT                   PNGVMLTGVMIAMIVEMGAMLAWGRLSDRIGRKPVYLIGALGLVACAFPFFWLLDTRVT
FT                   PLVWLALTVCTAVSHGAMIGTLPALVGELFSTEVRYSGVALGHEVASIFAGGMSPLIAT
FT                   ALLQRYQASWPVSLFLVALGLVTVATLCAMRETRIVRAGGARGGDA"
FT   CDS_pept        complement(275152..276204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="BMULJ_03452"
FT                   /product="spermidine/putrescine transport system
FT                   substrate-binding protein"
FT                   /note="KEGG, K02055"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03452"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45325"
FT                   /db_xref="GOA:A0A0H3KJA3"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJA3"
FT                   /protein_id="BAG45325.1"
FT                   /translation="MKLTGTIAAAAALCIASATASAPAFAQTKTIYVGMNGGPMEKAYT
FT                   SQVLPDFEKANNVKVVVVPGTSSDVLAKLLANRSKPQIHVAFLDDGVMARAVSLGVCQK
FT                   LDDSPVLKELYPFARMKDDVGAGVQLGMTGIAYNKKLFAEKGWAPPTSWMDFANPKYKG
FT                   KVVFQSASSSTFGLHGFLAINRLLGGSEQNVEPGFSKWASTVGPNVVEYIPNSAKISEM
FT                   VQTGEAGLFPLTPTGVGDLQDKGIPVAYANPKEGPVLLLVDLCVVANNPDPQLAQKLAQ
FT                   FLLSAPAQTKAAEAGKQIPTNRLAKMPAAMQQSLGNIDDLVRKVTVVDWTAINAHRAQW
FT                   DTRWNRQIER"
FT   CDS_pept        complement(276201..277352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03453"
FT                   /product="glycine/D-amino acid oxidase"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03453"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45326"
FT                   /db_xref="GOA:A0A0H3KP14"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP14"
FT                   /protein_id="BAG45326.1"
FT                   /translation="MSETGHYDVAVVGGGLVGASAALALARRGLRVALFERRDCGAQAS
FT                   GVNYGGVRCQGRPAEQLPLALRARRIWDRLPERIGIDGEFVVSGHLRLARSDADLEALH
FT                   AYAALAAEHGLPLRVMHGDAFRRRYPWLGRAALGGSLCETDGHANPRIVSPAFARAARA
FT                   AGADVFEHTPVDDVRHDGTRFRIHAAGRACTSTWLVNAAGAWANAIAERFGEAVPMEPI
FT                   YPNMWVTEPLPPFIEHNLGVYGGGVYARQVARGNCVIGGGRGRGDGEFGQPSVDTTRAV
FT                   MRDACALLPALRDALLIRTWSGVEGCTPDHNPIVGASRTTPKLLHAFGFSGGGFLLAPG
FT                   VGDVLADLVTTGETVTPLDAFSIGRFAPQAEPTIPCRQQETQR"
FT   CDS_pept        complement(277345..278781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03454"
FT                   /product="probable NAD(FAD)-dependent dehydrogenase"
FT                   /note="COG0446: Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03454"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45327"
FT                   /db_xref="GOA:A0A0H3KJT7"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJT7"
FT                   /protein_id="BAG45327.1"
FT                   /translation="MTDALRPVIVGAGPAGVRAAEALVDAGLRPVVIDENARWGGQIYR
FT                   QPPADGAFVRGKRALYGFDAAKADAVHRTMAALLPHVDYRPNTLAWACGAGRVDTLQDG
FT                   RETTVPYSHLIVASGATDRLLPVPGWTLAGVYTLGGAQVALKAQGCAIGRRIVFAGTGP
FT                   LLYLVAYQYAKAGAQVAAVLDTSPLHRQLAAAPALLRLPSTFAKGLYYIGWLRAHGVAI
FT                   ETGVTLERIVGERHVTALAWRAARDDARRTIDCDAIGLGFGLRSETQLADLAGCRFRFD
FT                   PLNRAWLPERDAAGRTSVRGLYVAGDGAGIAGADAAEASGRRAALALLDDAGIVAPPHR
FT                   AAGKPDAATLERTLARIGAFRAGLETAFAPPVAPAAQCPDDTIVCRCEEIDAGTLRRCI
FT                   RGGEATELNRLKALTRAGMGRCQGRMCADAAALVLAAETGRPLADVGRLRAQPPVKPFP
FT                   IAAALAGDDVVAIPDEARDE"
FT   CDS_pept        complement(278778..279125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03455"
FT                   /product="probable NAD(FAD)-dependent dehydrogenase"
FT                   /note="COG0446: Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03455"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45328"
FT                   /db_xref="GOA:A0A0H3KT97"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT97"
FT                   /protein_id="BAG45328.1"
FT                   /translation="MSIPASRSLDAADDGAQFVRLAERDRARIAFTLDGRPAHALAGDT
FT                   VLTAILVAQRRVRVSEFGGRPRAGFCLIGACQDCWVRTEAGARVRACSTPLAEGMRIVT
FT                   GAPPAATGDAR"
FT   CDS_pept        complement(279125..279919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="BMULJ_03456"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1177: ABC-type spermidine/putrescine transport
FT                   system, permease component II, Mesorhizobium loti"
FT                   /note="KEGG, K02053"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03456"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45329"
FT                   /db_xref="GOA:A0A0H3KJD1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJD1"
FT                   /protein_id="BAG45329.1"
FT                   /translation="MRKNGPFALAFHTLVILFVLAPLAIVVLVAFTPDETLTLPTHGLS
FT                   LRWFRAILDYPDFVTAFANSVKLAFASATLSLAIALPAGLAIGRATFPGRAFLNGLLLS
FT                   PLVIPGLVLGIALLRFFALIGATGSFAWLVVAHMIVITPFVMRLVLASVAGLDRSVEQA
FT                   ACSLGADPWTTFRRITLPMIVPGITGGWLLAFINSFDELTMSIFVTSPQTVTLPVRMYM
FT                   YATESIDPMMASVSALVIFITAGAMLLLDRVYGLNRILIGQH"
FT   CDS_pept        complement(279916..280893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="BMULJ_03457"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1176: ABC-type spermidine/putrescine transport
FT                   system, permease component I, Mesorhizobium loti"
FT                   /note="KEGG, K02054"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03457"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45330"
FT                   /db_xref="GOA:A0A0H3KJA9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJA9"
FT                   /protein_id="BAG45330.1"
FT                   /translation="MGQPTRPLQADGAPAGVAPRSAAEPVPARVAAGRAWRARWRAHAP
FT                   LWLMCAPAFALFAALVLVPLAMTFALTFYRFDPATGPIAAFQFGNYAEVLGSSYFHTIF
FT                   ARTFGIAALTTAICVAIGTPEAYVLSKMRDPWRSMFLLAILAPLLVSVVVRAFGWSMLL
FT                   NTGGLVNRTLALVGLGPYKLEYTTFAIVIALVHVMLPFMVIPVWTALQRLDPQTEYAAL
FT                   SLGASPFTTLRRIVVPQLMPGVLSGSLMVFGLSASAFAIPGLLGGRRLKVAATAVYDEF
FT                   LGSLNWPLGATIAVLLLVANLVVMLTYYRVLERRYARSLGGASR"
FT   CDS_pept        complement(280894..281976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="BMULJ_03458"
FT                   /product="spermidine/putrescine transport system
FT                   ATP-binding protein"
FT                   /note="COG3842: ABC-type spermidine/putrescine transport
FT                   systems, ATPase components, Agrobacterium tumefaciens
FT                   strain C58"
FT                   /note="KEGG, K02052"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03458"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45331"
FT                   /db_xref="GOA:A0A0H3KP19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP19"
FT                   /protein_id="BAG45331.1"
FT                   /translation="MSFLTLTDLTKSFGELTAVADVNLSVEQGEFVSLLGPSGCGKTTT
FT                   LQMIAGFVDVTRGRITLDGQDITHMKPNRRGLGIVFQSYALFPHMSVAENVGFGLDMRG
FT                   VDKAERTERIRAALALVRLDALAHRFPRELSGGQRQRVAIARAVVIEPPVLLLDEPMSN
FT                   LDAKLREEMQFELRAIQRKIGTTTIMVTHDQSEALSISDRVVVMEAGRITQIDTPYHAY
FT                   ERPENRFVSQFIGKANLLPGTIVAHDGDAIRIDLGHDLAETGRTAHLPAHERDVRVGDP
FT                   VSVCIRPEKLRLCAPGAGRVAATVTSRFFLGSQWLYRVDSALGEVLVCCQNEGAEPLAE
FT                   GAPVGIDWHSDAVRVMRREA"
FT   CDS_pept        282269..283147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03459"
FT                   /product="IclR family transcriptional regulator"
FT                   /note="COG1414: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03459"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45332"
FT                   /db_xref="GOA:A0A0H3KJU3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJU3"
FT                   /protein_id="BAG45332.1"
FT                   /translation="MQEPHSPGTSRAAPADGDAADTGGAPGTGMLQRAFAILRALAGMQ
FT                   QDGVRVTHLAKAVGLTQGTAHRILQSLIAEGMVEQDERSKLYRLSVDFFALAALAGNPS
FT                   SMRTLCRPALLRLCASLGETIFLLVKSGFDAVCLDLCEGPFPIRSFTGDIGGRVALGVG
FT                   QGSLAILAFLPEAEREEVIRFNVPRIRGYGVLDEVYLRTEIDRVRQLGYAGRNSGVLDG
FT                   MAGVAVPILDRTGYPVGALSVGTLASRLGDDRMPMVVELLRRQAEAIGPRTNPFDAALR
FT                   RPMHGLSGKAG"
FT   CDS_pept        complement(283300..284679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="BMULJ_03460"
FT                   /product="mercuric reductase"
FT                   /EC_number="1.16.1.1"
FT                   /note="COG1249: Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide dehydrogenase (E3) component, and
FT                   related enzymes, Ralstonia solanacearum"
FT                   /note="KEGG, K00520"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45333"
FT                   /db_xref="GOA:A0A0H3KTA0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTA0"
FT                   /protein_id="BAG45333.1"
FT                   /translation="MTQHFDAIVIGTGQAGPPLAARLSAAGMTVAIVERGRFGGTCVNT
FT                   GCIPTKTLIASAYAAQLARRASEYGVSVGGDVTVDMKAVKARKDRIAGRSNHGVEQWVR
FT                   GLERTTVFQGHARFEGAKTVRVGDALLEADRIFINVGGRAQVPPMPGLDTVRYLTNSSM
FT                   MDVDFLPDHLVIVGGSYVGLEFGQMYRRFGSKVTIVEKGPRLIRREDEDVSDAVREILE
FT                   NEGIDVQLDANCLSARPDGAGIAIGLDCGGSGREVTGSHLLLAVGRVPNTDDLGLDRAG
FT                   VDTDERGYIKVDEQLRTNVDGIWALGDCNGRGAFTHTAYNDYEIVAANLLDNDPRKVSD
FT                   RVPAYAMYIDPPLGRVGMTLAEAKRSGRKLLVGTRPMTRVGRAVEKGESQGFMKVIVDA
FT                   DNHAILGASILGVTGDEVVHTLLDVMTAGAPYTTISRAMHIHPTVSELLPTLLQDLHPV
FT                   E"
FT   CDS_pept        complement(284785..285354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03461"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJD4"
FT                   /protein_id="BAG45334.1"
FT                   /translation="MRPLRLLLPLLAALSGPALADDLPPAIAAQLPPGYEPMIAREGPA
FT                   LDNGLRSFLVVVHRAVDTRAQPSPRPLLIYEERPDHRYRLAARNDSVVLRANDALQCDP
FT                   FDPEDVADHGLAVKGRYFTVQNEVACGQHWSDYVTFRYDARTHGWLFANRIDTESFPVD
FT                   DKPDQVTVTRADPHRPVPFAQWRRKE"
FT   CDS_pept        285580..286218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03462"
FT                   /product="putative threonine efflux protein"
FT                   /note="COG1280: Putative threonine efflux protein,
FT                   Salmonella typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03462"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45335"
FT                   /db_xref="GOA:A0A0H3KJB5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJB5"
FT                   /protein_id="BAG45335.1"
FT                   /translation="MTATAAVFAILAALWLGAMIPGPSFVLVARNSIGLSRRDGLATAL
FT                   GMGVGGIAFGGVALAGLYTLLQTVEWLYVGLKIAGGAYLIYMASKIWRGADRPIAMDDS
FT                   RAAPAGSARKSFLTGLTTQLSNPKTAIWYGSIFAALLPQHPPLWCYLALPPLVFGVEFG
FT                   WYTIVALCFSTRRPRELYLRAKKWVDRVAAGAIALLGLRLILNAPKVGI"
FT   CDS_pept        286712..287470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03463"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45336"
FT                   /db_xref="InterPro:IPR021783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP22"
FT                   /protein_id="BAG45336.1"
FT                   /translation="MVQAPPRATLSGPTLVRLLARIVDADVAASPQTLSDRLSQWLGWT
FT                   DAITLSSALNASPPGVAAGVRGHDAERDCARVRHDLAQAITALNRPRARRRPGELPPPA
FT                   ADTADFADFRQRYLQLQQEMETAIGQLRGRLRVALAARSSGMARLATLDAIMERVLGAR
FT                   ERSLLSTVPALLGTRFERLREAERQALAEASAEPDGDAPADASVAAQPPAAAPGAWLDT
FT                   FRDEMQSVLLAELEVRFQTVEGLLAALRTC"
FT   CDS_pept        287483..290530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03464"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03464"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45337"
FT                   /db_xref="GOA:A0A0H3KJU8"
FT                   /db_xref="InterPro:IPR008520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJU8"
FT                   /protein_id="BAG45337.1"
FT                   /translation="MSRIRIDLVVFAAGLLAVCWIAAGYVGSNPLASAVTLLIGACYVA
FT                   GAWELLRYRQATAALSRAVAALAEPPARLDAWLDTLPAGLRGAVRARVDGTRVALPGPA
FT                   LTPYLVGLLVLLGMLGTLLGMVVTLKGTGAALESATDLDAIRASLIAPVKGLGFAFGTS
FT                   IAGVATSAMLGLLSALVRRERSEAAQQLDARIATTLRVHTPAHRRDESFRLLQQQADTM
FT                   PALVDRLQTMMTTLEARSVALHERQLESQQAFFDRTEQAYARLASSVGASLQESAAESA
FT                   RVAGAALQPVVAATMTGLAQEMATLRDTVSGAVQRQLDGLTNGFEAATANVTAAWHRAL
FT                   DAQRSAGDAVAQRLDTTLGQFADTFAQRSADLLDGVATRLESTEGRLADAWRDALSRQE
FT                   QVGETLAGQHARALSDAAATFERHSASTLAAMRDAHTHLQTELAARDAQRLAAWNDSLA
FT                   AMAAKLGDEWQRAGAKSADRQQEICDALAQTTRDLAAQAATFEQRSNDLLTTIRDSHTG
FT                   LQTQLAARDEERLSAWNESLAAMAAKLGDEWQRAGVHSAGRQQEICDALAQTTRDLAAQ
FT                   AATFEQRSNDLLTTIRDSHTGLQTQLAARDEERLSAWNESLAAMAAKLGDEWQRAGVHS
FT                   AGRQQEICDALAQTTRDLAAQAATFEQRSNDLLTTIRDSHNGLQTQLAARDEERLSAWN
FT                   ESLAAMAAKLGDEWQRAGVHSAGRQQEICDALAQTTRDLAAQAATFEQRSNDLLTTIRD
FT                   SHTGLQTQLAARDEQRLSAWNDSLAAMAAALRDEWQQASAHAAARQQDICDTLARTAND
FT                   IAAQAQAQASDTINEIGRLVQAASEAPKAAADVVAELRQRLSESMVRDTAMLEERSRLL
FT                   ATLETLLGAVNHASTEQRTAIDALVSTSADLLDRIGARFNDTVDAQSRKLDAVAAQVTA
FT                   GAVDVASLGDAFGAAVQVFGESNDKLLAHLQRIEAALEKSLARSDEQLEYYVAQAREVI
FT                   DLSMMSQKQIVEDLQQIAGRRTSVGA"
FT   CDS_pept        290534..291178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03465"
FT                   /product="putative flagellar motor protein"
FT                   /note="COG1360: Flagellar motor protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03465"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45338"
FT                   /db_xref="GOA:A0A0H3KTA5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTA5"
FT                   /protein_id="BAG45338.1"
FT                   /translation="MHEEIDGGAEAAPVWPAFADLMSVLLGAFVLILVGVIGMQLQLRS
FT                   KLEEAVRARQQEAQQRKTLEQALAGPLAAGRVTLVNGRIGIAGNLLFALNSDQLQPDGR
FT                   ELLKTLAGPLAAYLKTRDQILMVSGFADDQQVRAGNRMFADNWELSAKRALTVTRALID
FT                   AGVPASSVFAAAFGSEQPVSSNADDEGRAKNRRVEIAPVPRKSASNGGPAR"
FT   CDS_pept        291175..291816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03466"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45339"
FT                   /db_xref="InterPro:IPR021549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJD9"
FT                   /protein_id="BAG45339.1"
FT                   /translation="MTVDATQVRAMLDAWREQGAARLDPVRFHRLDALERRAAALDGDA
FT                   RALLDARLAALADEYAQLVARTPAPAGPDAPQAHAAPAHASSRGALAGLVERLARDAQA
FT                   DRRGIDPELVDYFRATWAKVRTEQQYRQSLDQVPRNAGPLNSNSLVHRSLSTMRELSPA
FT                   YLQQFLSYVDALACLEDLVGAGAQPDKDAARTKTTKPAKPAKKGTRTRVR"
FT   CDS_pept        complement(291813..292442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03467"
FT                   /product="probable histone-acetyltransferase-related
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03467"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45340"
FT                   /db_xref="GOA:A0A0H3KJC2"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJC2"
FT                   /protein_id="BAG45340.1"
FT                   /translation="MRIDVQHAQHDIDDELDALYARLHERGHRLHGLPAVALGDSGLIV
FT                   RHREADGEYFLYVENPAARELAGYTVFNRLPEIPRRADRHLRAPHTRLRGSMQRRGLAT
FT                   ALYRWALDAGQCLVSGARQSVGAAQLWNALAHEYRHGFVDVEGRALRYLGEAVATHVHD
FT                   ALHTRRLLLGRGWTLDELARATAMTDVACGAQNSSNAMPLALPSRR"
FT   CDS_pept        complement(292953..294236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03468"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03468"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45341"
FT                   /db_xref="GOA:A0A0H3KP26"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP26"
FT                   /protein_id="BAG45341.1"
FT                   /translation="MNSTLDGIAAVQDRPPRSATPFRAGLLGIAAGLFALWITRDRPDL
FT                   DAATRAVVASLSIIGTIALYELLISRVYLRPSAGLSRQAVRPLGIARVATRLGALASIY
FT                   AGIGAIYWLLPEYHGAFYLPFWSLLRSLAPYVIVAAPFYFAWMDRHQRETDDAYLLWGR
FT                   FLFRRDKPANWQPVREMLAGWGVKAFFLPLMTVYLSKDADHLSASLANALHAPMTLATF
FT                   VFLYDLSFTMDLMFGTVGYLCTFRILDSHVRTVEPTTLGWVAALICYQPFWSLISNNYI
FT                   RYEGSLFWDNWLLSAPTLRVIWGTVIILLLLTYALSTISFGLRFSNLTNRGIITSGPYR
FT                   FTKHPAYITKNLSYWMVSVPFVEPLGWQVGLMHCAGLVAVNLIYYVRAKTEERHLMRDP
FT                   DYRAYAEWIAQHGLFARIRQAFGARQPA"
FT   CDS_pept        complement(294357..297068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03469"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45342"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR031929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJV5"
FT                   /protein_id="BAG45342.1"
FT                   /translation="MHHYFNKTTVALAVSSLLALYGCGSVDGPTTPPTVKPSTSGTSGG
FT                   GGTSGTSGGGSSGTSGGGSSGTSGATSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGT
FT                   SGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSG
FT                   TSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTS
FT                   GTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGT
FT                   SGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTSGTGVTPLGNVLQKSGN
FT                   LVTSLGTVVANGGAQIGGVTVPGTNPTTATSVGNAVTSLGNGVQSVGNGIAAGLGSIGV
FT                   SANPLGPTLTSTTGLLTGTGGAVSNLGNAVKSLGAGPLSPLSPVTTLVGDLANTVGTAV
FT                   NSTASDLNTALNSTPVQQLETQLGKVINPITNTLTGGVDKPGVTQTLGSATLLGAPLNG
FT                   LLSTLGGGLGLAGTKIGGATDYPVGQGLGGAVGQLGATTTSVGGLLYGGSSSSGTNPLA
FT                   PLTGLLGSLTGGLGGIGGGSSSGSSGTGGTSGTSGTSGTSGGPLGPITGLLGPITGLLG
FT                   SLTGTLGGIGSSGTGGTSGTSGTSGTSGGPLSPITGLLGTVTGTLGGIGSSGTGGTSGT
FT                   SGTSGTSGGTLGPITGLLGTVTGTLGGIGSSGTGGTSGTSGTSGTSGSPLGPITGLLGT
FT                   VTGTLGGIGGSSGTGGTSGTSGTSGTSGTGGTSGAGVGGLLAPVTNLVNTLTPLGASLT
FT                   GTITTPGGGLTGAVGGVLTGTLTPPTAGVGGGAGAGATGGAGGAATTPSGGGTVSAGLS
FT                   GSSNGGAAAGGTGNLLSPVTNLLGGLLGGTKK"
FT   CDS_pept        295939..297060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03470"
FT                   /product="highly repetitive protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTA8"
FT                   /protein_id="BAG45343.1"
FT                   /translation="MTALPTLVAVVGFVPGTVTPPICAPPFATTVPSDVTRLPDFCRTL
FT                   PSGVTPVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPDVP
FT                   EVPDVPEVPEVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPEV
FT                   PDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPE
FT                   VPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVPEVPDVP
FT                   EVPDVPEVPDVPEVPDVPEVPEVPDVAPDVPELPPPDVPELPPPDVPDVPPPPDVPDVL
FT                   GLTVGGVVGPSTEPQPYSARSDDTASATVVLLK"
FT   CDS_pept        297421..297819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BMULJ_03471"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="COG0599: Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K01607"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03471"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45344"
FT                   /db_xref="GOA:A0A0H3KJE4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJE4"
FT                   /protein_id="BAG45344.1"
FT                   /translation="MSEQDRERGKARRTEVMGEPFVERAMRDLDGFSRPLQDWLNEHAW
FT                   GSTWQRGGIDLKTRSLCTCAMLAALGRSTELKGHVRGALNNGATLVEIREVLLHSALYA
FT                   GAPAAVEAFRSAREVIAELGLELPDDAS"
FT   CDS_pept        complement(298023..299000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="BMULJ_03472"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Mesorhizobium loti"
FT                   /note="KEGG, K01259"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03472"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45345"
FT                   /db_xref="GOA:A0A0H3KJC9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJC9"
FT                   /protein_id="BAG45345.1"
FT                   /translation="MSPTLHLILNILLGIVAVLAALALFSGYVARRVTRAFPPEGRVVE
FT                   IGGDRIHYVEYGSGTPIVFVHGLAGQLRNFAYLPLARLAQHHRVILVDRPGAGRSTRGA
FT                   GSQANVFAQARTIAAFIDALRLDRPVLVGHSLGGAIALAVGLNHPERVSRLALIAPLSH
FT                   PQSEPPAPFRPLVLPSPLVRRFVSWTFAIPMTILTGRQAVRLVFAPEDVPRDFAVKGGG
FT                   LLGLRPASFYATATDLLCAPDDLPAMESRYAELEVPVDVLYGREDRILDWRAHGDALAK
FT                   KSARVRLKVVEGGHMLPVTMPEATADWLLEVAAAPEAAAARAAH"
FT   CDS_pept        complement(299008..300570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03473"
FT                   /product="cyclohexanone monooxygenase"
FT                   /EC_number="1.14.13.22"
FT                   /note="COG2072: Predicted flavoprotein involved in K+
FT                   transport, Caulobacter vibrioides"
FT                   /note="KEGG, K03379"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03473"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45346"
FT                   /db_xref="GOA:A0A0H3KP30"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP30"
FT                   /protein_id="BAG45346.1"
FT                   /translation="MTSTTTDRRAAPPACGDSRDLDVLIVGAGLSGIGAAYHLNKRCPH
FT                   ASVAIVEARDAIGGTWDLFRYPGVRSDSDMFTLGYSFRPWHSDKAISDGQTILDYICDT
FT                   ARTYGIDKLIRYGQKVVAADWDSNRARWTVRVERTRDGATDTLVYTCRFLYMCSGYYDY
FT                   DAGYLPDWPAMDTFEGRIVHPQHWPKDLSYANRRVVVIGSGATAVTLVPSMAADAQHVT
FT                   MLQRSPTYIVSLPARDKIANALRRVLPSRLAHRLVRVKNVLLTMYLYNVSRRKPERTKQ
FT                   FIIRAASRQLGPDFDVAKHLTPRYNPWDQRLCLVPNGDLFKAIRAGRASIVTDEIERFT
FT                   PTGLKLKSGAQLDADVIVTATGLKVKMLGGARVTVDGRAVDLPQTVSYKGMMYSDVPNL
FT                   ASSFGYTNASWTLKAELIARYVCRLLNHMRAHGYDTCVPRLAPGDLGDVPAVNLSSGYI
FT                   QRAAGILPKQGHRKPWKFHQNYVLDLASLKFSGLADSAMHFERRATAGPAATPATEPVL
FT                   ETR"
FT   CDS_pept        complement(300567..301469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03474"
FT                   /product="acetoin dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K03366"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03474"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45347"
FT                   /db_xref="GOA:A0A0H3KJW1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJW1"
FT                   /protein_id="BAG45347.1"
FT                   /translation="MKGFSGKVAAITGAGSGMGRSLAVELARRGCEVALADVNDVGLAG
FT                   TAAACAQHGVRTSTRRVDVADRDAVFAWADFVRAEHGKVNLIFNNAGVSLAASAETASL
FT                   ADLEWIVGINFWGVVHGTQAFLPHLRASGDGHVVNTSSLFGLIAMPTQSAYNATKFAVR
FT                   GFTEALRMELELDGAPVSATCVHPGGVATNIVDASRVDTSIRALTGQDEATHRRQANRL
FT                   INATTADDAARQILAGVEHNARRVLVGADARRLDTLARVLGAGYQRLVLRHVRRARARN
FT                   LARTATPAAPASTAIKDTA"
FT   CDS_pept        301572..302234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03475"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03475"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45348"
FT                   /db_xref="GOA:A0A0H3KTB2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTB2"
FT                   /protein_id="BAG45348.1"
FT                   /translation="MEKALETEKRGRAYGGVAPEVRAAERRDALIRAATRVFGTIGFRK
FT                   ATVRAICQEAKLNDRYFYAAFDSTEDLLRCTYLHHAQQLHDAVAHAVAEHGGALHERID
FT                   AGLAAFFGFLRDPCAARVLLLEVMGVSADTDATYQRMLIDFGKLIMAIGSAREPQTVAE
FT                   RTEQRLIGLALVGAMTNVGAAWLLTGYRDPEAQMVASCRKVLLGTLREVGGADKSPT"
FT   CDS_pept        complement(302263..303216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03476"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03476"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45349"
FT                   /db_xref="GOA:A0A0H3KJE8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJE8"
FT                   /protein_id="BAG45349.1"
FT                   /translation="MADLRDVNLNRLAVFVAVVEAGSLTAAAERLGLAKTVVSTHMQRL
FT                   ESEVGANLLVRTTRRLSVTDAGRAFYEACRDIVQAAETALDAVSSDAGPLRGTLRVSVP
FT                   VDYGAQVVAPAVVALRDAHPSLDVELIANDRVVDLVAESLDVAVRIGRLADSNYRAVQL
FT                   GTYEKWLVASPAFVARYGLPRDPAALATLPFVMLSTLARPHTLELESARGGKASVRCNA
FT                   SVVSNTATACRSIALAGGGFGLLTDFSIADDVAAGTLVRLLPAWRAAPAGIHAVYPSTR
FT                   LPSPKVRAFIDAMKATIGATPRTPSARPATRRRTAR"
FT   CDS_pept        303342..304007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BMULJ_03477"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="COG0625: Glutathione S-transferase, Sinorhizobium
FT                   meliloti"
FT                   /note="KEGG, K00799"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03477"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45350"
FT                   /db_xref="GOA:A0A0H3KJD7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJD7"
FT                   /protein_id="BAG45350.1"
FT                   /translation="MPAAAQPVSPIRVYSFPLSGHAHRVRLFLSLLGLPFETVDVDLAA
FT                   GAQRAPAFLALNPLGQVPVIDDNGTVLADSNAILVYLAKRYGDAHWLPDDPLGAAAVQR
FT                   WLSFAAGPIATGPAAARLVTVFGAALDHDAAKRTAAKLLTAIDGELADKPFAIGAQPTI
FT                   ADIAAYTYIAHAPEGGVSLDPYPHVRAWLARIEALPRFVAMESTRAGLLADAASGSTT"
FT   CDS_pept        304004..304969
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03478"
FT                   /note="COG3576: Predicted flavin-nucleotide-binding protein
FT                   structurally related to pyridoxine 5'-phosphate oxidase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K07006"
FT                   /note="truncated family 1flavodoxin reductase"
FT   CDS_pept        305099..305302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03479"
FT                   /product="probable glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03479"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45351"
FT                   /db_xref="GOA:A0A0H3KP35"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP35"
FT                   /protein_id="BAG45351.1"
FT                   /translation="MKLFSMIRLVLWSFFGVRNSKAHASDLANVNFTLLPFVAIVLALL
FT                   VGAAIYGVVHLVVDPTVTTQGF"
FT   CDS_pept        305780..308011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03480"
FT                   /product="iron complex outer membrane receptor protein"
FT                   /note="COG1629: Outer membrane receptor proteins, mostly Fe
FT                   transport, Ralstonia solanacearum"
FT                   /note="KEGG, K02014"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45352"
FT                   /db_xref="GOA:A0A0H3KJW8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJW8"
FT                   /protein_id="BAG45352.1"
FT                   /translation="MTVSKTTARRTPRHRANAGLCAGVGITLFAAQAVAAPGDAPAAAA
FT                   TAAPDATLPAITVSGARGHTYRAREASVAGLDDAPLLDTPASVNVVTRAQLDDQQAKRL
FT                   SDVVRNDASVVNDYAPVGYYEGFAIRGFPVDLASAIRIDGLTVSGEQNVPLENKERVEI
FT                   LKGLAGIDSGVVAPGGVINFVTKRSANVASVTAGVDSRGSTSAVVDVGRRFGPDNQFGF
FT                   RVNAAKENMHSYIDGTNGRRTFGSIAADWDISPRASLQLNAEFQQWIQRSAPGYQLLGG
FT                   TVVPSVHTTSKALGTQPWAKPVTTDALNLNARFDYQFNDDWKAYIAAGRSRTVIDDNSA
FT                   FAYGCYYAASCAAGTTSPFFFGANGDYDVYDFRSPGEYRRNDDVRAVTTGKFATGPLRH
FT                   ELTLGVSVQRRVVHMAEAVYKDVGSENIYGPDTTFSPSPDVPGPSYPQLDAWQYGLFGL
FT                   DRISIGEHWQVLAGGKEVLLRQRSWDSIDGPATRTDRSVFLPQVALVYKPVRALSLYAS
FT                   YSKALSLGDQAPVRATNAYAFLPPVESHQVEVGAKYDWLDRLSLTAALFTISKPFQFAD
FT                   PDASGSSYTFVQRGTQRHQGIELGAAGRLTERLSLSASVAAIRARAYDSGSAAYEGHQI
FT                   INVPALRASLYADYAVPGVAGLDVLGGVEYSASRNANEEGTARVPSWFVFNLGARYTTK
FT                   IAGHRTVLRVSVDNLFNKFYWRDAGEQQGDAYLFPGAPRTARVSLTYDF"
FT   CDS_pept        308045..308656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnuC"
FT                   /locus_tag="BMULJ_03481"
FT                   /product="nicotinamide mononucleotide transporter"
FT                   /note="COG3201: Nicotinamide mononucleotide transporter,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K03811"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03481"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45353"
FT                   /db_xref="GOA:A0A0H3KTB5"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTB5"
FT                   /protein_id="BAG45353.1"
FT                   /translation="MSSLEIAGVIVSALAIWLTAKRRMLCWPVGLASVALYGWIFFDAK
FT                   LYSDMLLQGAFAVLQVYGWRRWLAQRTLEASGHAAPAGDVAPVTGVRPRQMLPDLIAAV
FT                   IGSALLGGMMARWTDAALPFVDASLTAFSLVAQYWTARRYIASWGLWIVVNVVYVGMFV
FT                   FKALYLTAGLYALFIALAVIGWRDWSRTADALRADARAAH"
FT   CDS_pept        308690..309880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03482"
FT                   /product="putative aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03482"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45354"
FT                   /db_xref="GOA:A0A0H3KJF3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJF3"
FT                   /protein_id="BAG45354.1"
FT                   /translation="MSFPLEPDGPAAREVAPPQFGVDGEQAERDWPLITHDEVAAVLAR
FT                   IDGAGVPARLTWHSPRPFSAAVLVRTEDERALFVKRHHASLRDVEGLAEEHRFIAHLRA
FT                   HGCPVPEVLTGRDGATAFAFGDWTYEVHVVAPGVDAYRGVMSWKPFAHPSHAYAAGRAL
FT                   AQLHRASAGYDAPARPIRTLLSSFRVLSSADLAGALERWVDAQPLLVRALGTRDWRADV
FT                   AATIGPYHARVVPLLPALAPLWTHGDWHASNLLWTDAAPGAQVCTVLDFGLSDRTCAVM
FT                   DVALAIERNMIDWLAPADARRVEYEQIDALLDGYESLDPLSDDAYAALVALLPIVHTEF
FT                   ALSEVAYFGCIVNAPDIVDVAYDGYLLGHARWFGGRDGRQLLDWLEQRRRGKRGRA"
FT   CDS_pept        complement(309921..311216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metY"
FT                   /locus_tag="BMULJ_03483"
FT                   /product="O-acetylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.49"
FT                   /note="COG2873: O-acetylhomoserine sulfhydrylase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K01740"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03483"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45355"
FT                   /db_xref="GOA:A0A0H3KJE3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJE3"
FT                   /protein_id="BAG45355.1"
FT                   /translation="MTDQASSKWRLETLAVHGGYRPDPTTRAVAVPIYQTVAYAFDDTQ
FT                   HGADLFDLKVQGNIYTRIMNPTTDVLEQRLAALEGGVGALALASGQAAVTYAIQTIAEA
FT                   GDNIVAASSLYGGTYNLFAHTLPQYGITTRFADPRDPASFAPLIDAHTKAIFAESVGNP
FT                   LGNITDIAALADIAHRHGIPLIVDNTVPSPYLLRPFEHGADIVVHSLTKYLGGHGTSLG
FT                   GAIVDSGRFPWPDHADRFKRLNEPDVSYHGVVYTEAFGPAAYIGRARVVPLRNMGAAIS
FT                   PFNAFQILQGIETLALRIERISDNALKIAQHLARHERVEWVNYAGLPDHPDHPLVARYL
FT                   SGRAPGLLTFGVKGGRAGGAKFQDALKLFTRLVNIGDTKSLATHPASTTHRQLSPAELA
FT                   KAGVKEETVRLSIGIEHIDDLIADLDQALAQV"
FT   CDS_pept        311350..312018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03484"
FT                   /product="O-methyltransferase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG4122: Predicted O-methyltransferase,
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K00599"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03484"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45356"
FT                   /db_xref="GOA:A0A0H3KP38"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP38"
FT                   /protein_id="BAG45356.1"
FT                   /translation="MDQDQWNRVDAYFSATLVPSDDVLDAALAASEAAGLPAINVAPNQ
FT                   GKLLQLLATIRGARRILEVGTLGGYSTIWLARALPPGGRLVTLELNPAHAAVATQNIAR
FT                   AGFADVVSVVVGSAKDSLARLIAEGEAPFDFIFIDADKDNNRAYLDAALKLSRPGTVIV
FT                   VDNVVRRGRVADPDNRDPDVVGVREGFARIVAEPKLTTTAVQTVGQKGWDGFSISIVGE
FT                   "
FT   CDS_pept        complement(312061..312828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03485"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="COG0500: SAM-dependent methyltransferases,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03485"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45357"
FT                   /db_xref="GOA:A0A0H3KJX4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJX4"
FT                   /protein_id="BAG45357.1"
FT                   /translation="MTRRTGVAPADETLYTDARLVAVYDLFNAGDHDFAFYAARIGAAP
FT                   QRILDIGCGTGTFARRLAAAGHDVVAIDPASAMMDYARRQPGADAVRWIACDLRDLPPG
FT                   APFDAAVMTGHAFQCLLSDDAIDSTLHGVRRVLTSGGRFLFETRNPRLEPWRAWTPQQS
FT                   ARRVDSPAFGAVELQHVSHAVEGPIVSFDTHYRFLRDDTRVTHASRLRFIAQRELQARV
FT                   AAAGFSAVEWYGDWQGASFDDATSVEIIAICRV"
FT   CDS_pept        complement(312825..313553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03486"
FT                   /product="putative threonine efflux protein"
FT                   /note="COG1280: Putative threonine efflux protein,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03486"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45358"
FT                   /db_xref="GOA:A0A0H3KTC0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTC0"
FT                   /protein_id="BAG45358.1"
FT                   /translation="MQPCRARRTPISKCASKRIQCGRLLPLHHSPGAAMFDLTTLTTFT
FT                   AVVLGLFLIPGPAVLLVLSRTVQGGRRTGIMTGLGVASGDFVHTLFAAVGLSALLMTSA
FT                   LAFNVVKWVGAAYLIYLGVRALLDKPSDPSLPKVSPVTPLKAYLQAIPAEVLNPKTALF
FT                   FLAFMPQFVHPERGSTFVQFAVLGLIFVVLSSLYTTLIACSIRPLGRIVKRLTWLTRWQ
FT                   GKIIGSIFIALGLRVAVQQR"
FT   CDS_pept        313627..314433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03487"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03487"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45359"
FT                   /db_xref="GOA:A0A0H3KJF8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJF8"
FT                   /protein_id="BAG45359.1"
FT                   /translation="MHKLSHGAGADPAVSLVHSATPRPLVLFGGSVVEPEWRLERHSHR
FT                   HAQLLYTLSGVIYCEIDGGVWSAPPQCTVWIPGDVPHAARGSAGATFYAVLIEPDAALA
FT                   LPTRCCTLGVSPLLRELLLKAASFPNLYDIDGPQGRLMATLLDELVAAPVEDLYLPMPA
FT                   DRRLRKLIDHLLDEPADKSPLAELARRAGISERSLTRLAAKELGMSLGDWRRRLHVALS
FT                   LQMLTTGRRVHQVAIDLGYESASSFVTMFRKATGKPPTQYLSDRQR"
FT   CDS_pept        314549..314965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03488"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45360"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJE9"
FT                   /protein_id="BAG45360.1"
FT                   /translation="MQITTTEFPFVWLRYTSSSSGDPASLFAELDALLARRERFVFLTD
FT                   DAPAGDGGAEDHALRKQLAKWTKANRAQSRASVPAMIAIEPDAQRRAALDAFSGAFEKV
FT                   WGYPLKAAANRDDALALARRLLAEPVRDAGTMNR"
FT   CDS_pept        315079..316074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03489"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /note="CeoR protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03489"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45361"
FT                   /db_xref="GOA:A0A0H3KP44"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP44"
FT                   /protein_id="BAG45361.1"
FT                   /translation="MDNPIRAMRIFARIVEMNSFTRAALSLGISRATATRTVQELEAAL
FT                   GMPLLVRTTRALRTTPEGDAYYRRCLRITADVDELEASIRRAARHPSGPQRVDLPGPVA
FT                   SAIVLPALGTFHARHPDLVLMLGVSVRAADMVGDAVDCSVRLGELPDSSFVARPLGALE
FT                   RVTCASPAYLDRCGVPRTLDDLDSHRAVGSTSGSGQRAAECDFMVDGAVRKIRLDVIVG
FT                   VDDEHAYLACGVHGLGLIQPPRAVAQPLIDAGLLRDVLPQWQPAAVPVSAVYVKRPHVS
FT                   PGVRAFVDWIAERFEAAARERAAGVIGWEARWRAPERIDMPVEGVSAAIA"
FT   CDS_pept        complement(316495..317403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03490"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45362"
FT                   /db_xref="GOA:A0A0H3KJY0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJY0"
FT                   /protein_id="BAG45362.1"
FT                   /translation="MTDTVQPADLAFFSTLAASGSLSAAARELGLTAAAVSKRLTQMER
FT                   RAGVTLVNRTTRRMMLTPEGDVYLDYARRILDQMDELGELLGSAKQRPKGLLRVNATLG
FT                   FGRSHVGPAISRFVARYPEVSVQLQLSVMPPPLTDDAFDVCIRFGEPPDTRVVARRLAP
FT                   NRRLLCAAPAYLARHGTPGTPHELTRHNCIGIRQGDENYGIWRLTTGRGAARHTEAVRI
FT                   NGNLTTNDGEIAVKWALDGHGILMRAEWDIRDYLADGRLVVVLQDYETPSADIYAVYAQ
FT                   RHQMSTRIRAFVDFLAAELGG"
FT   CDS_pept        317511..318593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuC"
FT                   /locus_tag="BMULJ_03491"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="COG0473: Isocitrate/isopropylmalate dehydrogenase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00056"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03491"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45363"
FT                   /db_xref="GOA:A0A0H3KTC3"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTC3"
FT                   /protein_id="BAG45363.1"
FT                   /translation="MKTYRIATIPGDGIGKEVVPAGKQVLEALARGSDRFAFEFEDFDW
FT                   GADYYRRHGAMMPADGLDALRGKDAILFGSAGDPDVPDHVTLWGLRLKICQGFDQYANV
FT                   RPTRILPGIDAPLKRCGPDDLNWVIVRENSEGEYAGVGGRVHQGHPIEAATDVSILTRV
FT                   GVERIMRFAFRLAQSRPRKLLTVITKSNAQRHAMVMWDEIAKQVAQEFPDVTWDKELVD
FT                   AATARMVNRPASLDTIVATNLHADILSDLAAALAGSLGIAPTGNIDPERRYPSMFEPIH
FT                   GSAFDIMGKGLANPVGTFWSVVMLLEHLGETEAAARVMRAIEAVTADPSLHTRDLGGHA
FT                   TTAQVTAAVCEHVAHAAVTA"
FT   CDS_pept        318758..320068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03492"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03492"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45364"
FT                   /db_xref="GOA:A0A0H3KJG3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJG3"
FT                   /protein_id="BAG45364.1"
FT                   /translation="MQADPETRVARKLMWRIIPFVMLLYFVSFLDRVNVGFAAMTMNKA
FT                   IGLSPTAFGLGGGLFFIGYFLFEVPSNLILHRVGARIWIARVMITWGIVSAVSAFAVGP
FT                   TSFYVLRFLLGVAEAGFFPGIILYLSLWFPARQRAVAAAWFMAAAPISTAIGSPLSGAI
FT                   MQMPPMFGLADWQMLYIVEALPAIVLGFVVLKCLIDTPSKAAWLQPDERDWLIAKLKSE
FT                   ADARHGRSGHTAGAWQALRDPRVLALALIYFGTSAGLYTLGLWAPLMVKQFGFSALQTG
FT                   LLTGIPSVAAVVAMIVWARHSDRTGERTWHVVIPCVLACIGFVFAGEASTALLTVLALV
FT                   VVNVGISAAKAPLWAMPSAFLSGAGAAAGIAMINSIGNLGGFVGPFAIGWLKQATGGYA
FT                   AGLYVVAATLAVSAIVTLMLSRKGAREQVASRVQHHH"
FT   CDS_pept        320629..320958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03493"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45365"
FT                   /db_xref="GOA:A0A0H3KJF4"
FT                   /db_xref="InterPro:IPR020127"
FT                   /db_xref="InterPro:IPR037234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJF4"
FT                   /protein_id="BAG45365.1"
FT                   /translation="MKFDLQRRYESADDFFALEGSIVMKLSAGAAIEICERAAEQGLVV
FT                   SRVEGGIWHFPGFEARLDCIWDGADPPVDSTAANQNNLAAADFIRAESNVHDVFVVTAP
FT                   HMTGW"
FT   CDS_pept        322419..323897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03494"
FT                   /product="putative cytosine/purines, uracil, thiamine, and
FT                   allantoin transporter"
FT                   /note="COG1457: Purine-cytosine permease and related
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03494"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45366"
FT                   /db_xref="GOA:A0A0H3KP50"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP50"
FT                   /protein_id="BAG45366.1"
FT                   /translation="MDLAGTPAGLEVESHSIDYIPEGERHARLRSQGPFWFLGNFHFFT
FT                   ISIGFVGPGMGLTAGWTTLAGALGIMFGTIFMAFHGSQGPEMGLPQMIQSRAQFGYRGV
FT                   ILALFATLFVFVGFNVVNVSLIVDGLRNVFGLDPATVAVVAAGSGALLAIYGHDLMHKA
FT                   FKWALIATLPLYALVTIALMFGVGESGTPHPVNLGFSWVAFLTQFAIGASYNISYAPYV
FT                   SDYSRYLPKHTSRAKLVAAIFVGASLSGSWMIGLGAWLAQQLKATDALAALNQVGSSIV
FT                   PGLGGLIVIVSVAGFVPIIALNTYSAMLTVLTGVDSLKKITPTRHARMVSIVVISAVLL
FT                   MCVLSIKGNSVALLNTFLVLLLYFLVPWTAVNLVDYFFVRKGRYAIPHFFTPKGIYGTW
FT                   QMRGIAAYLVGFVAMIPFFHIYNAAEDREVFVGYFARLLNGIDIAWLVGLIVSGGVYCL
FT                   FSRSLDLEYEQRVIDASDEGELIAIAHRSTEEQS"
FT   CDS_pept        323894..324712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03495"
FT                   /product="predicted amidohydrolase"
FT                   /note="COG0388: Predicted amidohydrolase, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03495"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45367"
FT                   /db_xref="GOA:A0A0H3KJY6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJY6"
FT                   /protein_id="BAG45367.1"
FT                   /translation="MTQPVVRLFQSTCVDGDVAHNLDAALRAIADSTGRADLIVFPETF
FT                   IPGFPTPENVAKLAEPIDGTSISAIRAAARAARVSVAIGFAESDGGHYYNTALLIDEHG
FT                   HILLKYRKTHLYASDIGVFERGQTFPVCEWHGIRVGMLICFDIEFPETARILARNGAEL
FT                   MLVLDGLMCPYGNVHRTMLPVRAMENQAYMVLVNRAGPGDRYTFAGQSHVADPFGCSVF
FT                   VADAERADPQDVRLDMSAVARSREAFSYVELTAITVGETPMPPRGAISAE"
FT   CDS_pept        complement(325047..325355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03496"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTC5"
FT                   /protein_id="BAG45368.1"
FT                   /translation="MGFVIFRRWAMRGSAGGRSAARGVADTGVDARSREVALAAMTAQG
FT                   DRKAAALEQKEATRWPPLPARRVESVRLMFWSCTRLRRPCAPRRLVLLFGRFGTAFG"
FT   CDS_pept        325476..326408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03497"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJG9"
FT                   /protein_id="BAG45369.1"
FT                   /translation="MKKQSLCLLAATAISAFIVAGCGGGDDSSNASSGAPANTGGANNA
FT                   ASAPAVASTPLAAAPASAPVASSQPAMVGEALPSLTNPQAGSTAATASGPTGIWTQSGN
FT                   LGYSTIALVDPNNNVSTLNLLSSFVMSNDFTSLTINGATWSLSSGFNFAGMTGIVKKID
FT                   SGSGAYSAKQTLSGTISRDGTASDFTWTYNAENALSVTQDSVTGAWSTTNASFTIASGG
FT                   SVTGTLSGCNMTGTLLLATPNSNQNMYDMTLTASTSSGCKLPAGVPLSGSAAIMFVPIR
FT                   GSNGFQRSILYVLRAADYSFVAYGQVIKQ"
FT   CDS_pept        326499..327302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03498"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJG1"
FT                   /protein_id="BAG45370.1"
FT                   /translation="MKNCSKVTRFACGLLVTLLSGCVTAPKTDMNAQAREKLHSIALLE
FT                   VAEPRQVGVINLGGAAGGFGLIGALAQVALNTSHTNTYTERVTVNKIAFVPDIVDGVTG
FT                   RLADNGYQIVKLNQKPKRAADGKSDDYSDIQTDADAIMNVWFTSFGYISPASRPDYIPS
FT                   VVVRARVIDAKTKQDLYFKTFACGYDIKANSVHVESDVAYTYGSFSDLEKNFDKSVEGI
FT                   KSCEKSIAELIGQDLARTPTTPASAPVAAATTMMTTSATTVAAPK"
FT   CDS_pept        complement(327468..328805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="BMULJ_03499"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COG0137: Argininosuccinate synthase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01940"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03499"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45371"
FT                   /db_xref="GOA:P59608"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59608"
FT                   /protein_id="BAG45371.1"
FT                   /translation="MSTILESLPTGQKVGIAFSGGLDTSAALHWMKLKGAVPYAYTANL
FT                   GQPDEDDYDAIPKRALEYGAAGARLIDCRAQLVAEGIAALQSGAFHITTAGVTYFNTTP
FT                   IGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLVNPDLKIYKPWLDQTFI
FT                   DELGGRAEMSEFMRQSGFAYKMSAEKAYSTDSNLLGATHEAKDLESLESGIKIVNPIMG
FT                   VAFWRDDVKIAAEEVTVRFEAGQPVALNGVEFKDQVELLLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGLALLYIAYERLVTGIHNEDTIEQYRENGRRLGRLLYQGRWFDPQ
FT                   AIMLRETAQRWVARAITGEVKIELRRGNDYSILSTKSPNLTYQPERLSMEKVASTFSPR
FT                   DRIGQLTMRNLDITDTRDKLRVYTQVGLLTPGEASALPQIKGDSGE"
FT   CDS_pept        complement(329059..330129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03500"
FT                   /product="putative membrane protein"
FT                   /note="COG1289: Predicted membrane protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45372"
FT                   /db_xref="GOA:A0A0H3KP58"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP58"
FT                   /protein_id="BAG45372.1"
FT                   /translation="MTVTPSARLPAFLRGALRPLLDPYRRYRHAKLIHAMRVALAILVS
FT                   IALSTGMRVPHGEWSTITVLIVVGGLQHHGNIRKKAAERALGTSIGAVAGLLLILVHSA
FT                   LGAPLAFYLLMAAACGLCAYYAIGKAGYIALLSAITMVIVAGHGDNEIVDGLWRAVNVL
FT                   TGIAIALAFSFALPLYATYSWRYKLGDALRACAAVHARLAGDRHVSDDAHLKEMAALSA
FT                   LLVQLRSLMPSVSKECAIPVAHLEAIQRSLRLCIGYLEILSSALPAREDVAAREYMRVS
FT                   MKALHRRIRDTLIGASRALKFGTPSRLSPRRQPAGTPPDAPPPQLSGYVSITAMLAAEV
FT                   DQLREKLLDTAQAWNI"
FT   CDS_pept        complement(330238..331770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03501"
FT                   /product="putative diguanylate cyclase"
FT                   /note="COG2199: FOG: GGDEF domain, Ralstonia solanacearum"
FT                   /note="contains GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03501"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45373"
FT                   /db_xref="GOA:A0A0H3KJZ3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJZ3"
FT                   /protein_id="BAG45373.1"
FT                   /translation="MNLLLPFAALRRHTASVVSRVLSPRGVLVAGIMLLLFSWALSVSL
FT                   LIDARRDARDHAVENARNLMLLIERDVARNIELYDLSLQNVVDGIADPELMRLPPPQRH
FT                   RVLFDRAATGTYLGSIFVLDAHGNITIDSGTIPARTGNFSERDYFVAHRDAQVKGLYIS
FT                   RPYASRLRGGALTIALSRRIDRPDGSFGGVVVGTLSIDYFRALLDGLAVGRHGSAAIVE
FT                   DNGTLVSRLPFDARVVGLDLHDSPLFIQARRAGDGVLTGTGAVDGVRRIYVYRQLAGLP
FT                   LIVDVAPAEADVYRPWRRRAASIVVLMSLFTGFVAWGSLLLSRELRRRQVAEAKLYRLA
FT                   RTDSLTGLDNRGAFDAALAQEARRAARSGRPLSVLFVDVDHFKAFNDYYGHLAGDDVLR
FT                   RVAQCASGCLRRATDHIARYGGEEFVVTLPDTDAQGAATVAEGIRRAIAALGIEHVKSP
FT                   YGHVTASIGTATDPHGRMDAATLLQRADDALYRAKYGGRNRVEYAARSAAGA"
FT   CDS_pept        332276..333820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03502"
FT                   /product="AAT family amino acid transporter"
FT                   /note="COG0833: Amino acid transporters, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03293"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03502"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45374"
FT                   /db_xref="GOA:A0A0H3KTD0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTD0"
FT                   /protein_id="BAG45374.1"
FT                   /translation="MSALPNSDRPGSSENPPKLHRALKARHLTMIAIGGSIGTGLFVAS
FT                   GASISQAGPGGAMIAYMLIGLMVYFLMTSLGEMAAFMPVSGSFATYGAKYVDEGFGFAL
FT                   GWNYWYNWAVTIAVELVAAQLVMHYWFPDVPGVWWSAAFLGVMFLLNALTVRGFGEAEY
FT                   WFALIKVVTVVAFIGVGLLMIFGILKGAPHGGWSNLTIGDAPFAGGLPAMMGVAMIAGF
FT                   SFQGTELIGVAAGESENPRTTIPRAVRQVFWRILLFYVLAIFVIGVLIPYTDPNLLKTD
FT                   VTDIGVSPFTLVFRHAGLAFAAGVMNAVILTAVLSAGNSGMYASTRMLYNLATEGRAPK
FT                   LFAKLSAGGVPRNALYATTAVGALCFFTSLYGDKTVYMWLLNTSGMTGFIAWLGIAVSH
FT                   YRFRKGYVKQGYRVDQLPYESKWFPFGPLFAFVLCIVIALGQDYQAFLANRIDWAGVVA
FT                   TYVGIPLFLAVWLGYRLVKKSRFVRYEDMEIAPWVAANRDGQRGAQAQPVSQRETA"
FT   CDS_pept        334025..334270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03503"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45375"
FT                   /db_xref="InterPro:IPR022191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJH3"
FT                   /protein_id="BAG45375.1"
FT                   /translation="MSASPAERKTEPVSIVRIEAAINAWRAVYPPAPDGEDGYALDAGS
FT                   DCLAELYGTMICYRLPDVPLDSLSDAQRDALYATEV"
FT   CDS_pept        334454..335320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="BMULJ_03504"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Deinococcus
FT                   radiodurans"
FT                   /note="KEGG, K01259"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03504"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45376"
FT                   /db_xref="GOA:A0A0H3KJG5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJG5"
FT                   /protein_id="BAG45376.1"
FT                   /translation="MTDIVTEETYVETPHGRLFAKRWHAGREGVASAVAAGETVAHQSA
FT                   APMPAAPQPAAPILLLHDSLGCVELWRDFPERLAAATQRDVIAYDRLGFGRSDPHRGTL
FT                   ATTFVRDEADHAFRAVLEQFGVDAFVAFGHSVGGGMAVGCAAAYPERCRALVTVAAQAF
FT                   VETRTLNGIRDAGRQFDEPGQLDRLARYHGDKAEWVLRAWVDTWLSPAFRDWSLNEDLP
FT                   RVRCATLAIHGEQDEYGSDAHPKRIAARVAGPSSYLMLGACGHMPHRERTDDVLAAVAT
FT                   LLRDARA"
FT   CDS_pept        complement(335349..335702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03505"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45377"
FT                   /db_xref="GOA:A0A0H3KP61"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP61"
FT                   /protein_id="BAG45377.1"
FT                   /translation="MATTHQHFHLELRHATAPTYFISYLFPALLFVYELLRVGQWIRDH
FT                   GMQFAAFKQMGYEFLLMLLFVGLQIVVEAIFLLGAAMRKDHRDFEHRVPNVILGIGCSI
FT                   ALLAIDLAIQLAF"
FT   CDS_pept        complement(335884..336537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03506"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03506"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45378"
FT                   /db_xref="GOA:A0A0H3KJZ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJZ8"
FT                   /protein_id="BAG45378.1"
FT                   /translation="MTPPPADSGRRARKRIQMLAHLADTAARLFDAHGYDAVTMEQIAD
FT                   EADVAKRTLYNHFATKEAVLAHWLERELARDLAHLQRDVARRRTFASRIACVLDASAAW
FT                   CEQHPAHLLAYLRHRFLSIGATAPEGGDPGGDIAPVWHRLIADAQRAGELNRSLPAEQL
FT                   ATWFHHLYLGAMLRWLTVPGLSLKQEFRAVAKLFVEGAQAAATAPRASRAAPAR"
FT   CDS_pept        336629..337852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03507"
FT                   /product="putative glycosyl transferase"
FT                   /note="COG1819: Glycosyl transferases, related to
FT                   UDP-glucuronosyltransferase, Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03507"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45379"
FT                   /db_xref="GOA:A0A0H3KTD5"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTD5"
FT                   /protein_id="BAG45379.1"
FT                   /translation="MKLVIATYGTEGDTRPLAALGRALLDAGHDVRLLADASTLASAEA
FT                   LGVPCAALSGDIRGALSDAVLGQGGFRDTSKALAAIANANTAAWMRELAQASAGCDAIV
FT                   VSGLAAFVGLSVAEYRNVPAIGAGMIPITPTAAFGSPFLPPRRVPRWLNRASHRLVNAL
FT                   LWHAFRRATNAARASVCGLPPRGRVWTDHPMLYGVSPALLSAPADWPDHVRAVGQWRAE
FT                   PPEWTPPRALASFLDAGERPIYIGFGSMTGFDRAAMAAALTAALDGRRALFYPGWSAID
FT                   ASLLPPNVHVIGDTPHDWLLPRTSMAIHHGGSGTSHSAARAGIPSVVVPFAGDQFFWAD
FT                   RLQRLGVAAGAVPGGRVQAAALADAIAFAEREGTRSRAGALGARIASEDGLTGAVEAIE
FT                   RWTRARRR"
FT   CDS_pept        complement(337878..338573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutC"
FT                   /locus_tag="BMULJ_03508"
FT                   /product="GntR family histidine utilization transcriptional
FT                   repressor"
FT                   /note="COG2188: Transcriptional regulators, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K05836"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03508"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45380"
FT                   /db_xref="GOA:A0A0H3KJH7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJH7"
FT                   /protein_id="BAG45380.1"
FT                   /translation="MTTPIYQEIKDFILARIHAGEWAEGDQVPSENELAREFNVARMTV
FT                   NRALRELTAEQVLTRTRGSGTYVASPKYESTLVAIRSISDEIAARGHAYRAEVLEVGAA
FT                   VADAKLADELQLDAGSPIFHSRVLHFENDTPVQLEERWVNPACAPEYALQDFTTTTPNQ
FT                   YLTRVAPLQRVEYRIEAAMPGAETRRRLAMDDREPCLMLHRRTWSQGMVASVANLWHPG
FT                   SRYRFTGHF"
FT   CDS_pept        338962..339735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03509"
FT                   /product="polar amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0834: ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain,
FT                   Salmonella typhimurium LT2"
FT                   /note="KEGG, K02030"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03509"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45381"
FT                   /db_xref="GOA:A0A0H3KJH2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJH2"
FT                   /protein_id="BAG45381.1"
FT                   /translation="MKKLVLSVALACIAVGAHAKDWSTIRFGVDASYPPFESKDASGKV
FT                   VGFDVDLGNEICARLKAKCVWVENDFDGMIPALKAKKFDGVLSSMSMTPARAEQIAFSD
FT                   KLFNTPTRLVAKKGAGLQPSAESLKGKSVGVEQGTIQETYAKAYWAPKGVQVVPYQNQD
FT                   GVYQDLMSGRLDAALQDAVQADLGFLKTPRGANFAFAGGNLDDPKTLGNGAGIGLRKED
FT                   ADLKAKIDAAIAAMLKDGTYRKLEKKYFAFDVYGG"
FT   CDS_pept        339799..340488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03510"
FT                   /product="polar amino acid transport system permease
FT                   protein"
FT                   /note="COG4215: ABC-type arginine transport system,
FT                   permease component, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02029"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45382"
FT                   /db_xref="GOA:A0A0H3KP66"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030199"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP66"
FT                   /protein_id="BAG45382.1"
FT                   /translation="MIFQGFGPLLWAGTVETVKLAVLSLAASLLLGLAGAAAKLSTNRV
FT                   LRAVGTFYTTLIRAVPDLVLMLLLFYGIQILLNNVTDLLGWQQIDIDPFFAGVVTLGFI
FT                   YGAYFTETFRGAFLAVPRGQLEAGFAYGMGGWRVFRRILFPQMMRFALPGIGNNWQVLV
FT                   KATALVSIIGLADVVKASQDAGKSTLDFFFFTLAAGAIYLAITTVSNVVLHHLEKRYSV
FT                   GVRRLAL"
FT   CDS_pept        340485..341198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03511"
FT                   /product="polar amino acid transport system permease
FT                   protein"
FT                   /note="COG4160: ABC-type arginine/histidine transport
FT                   system, permease component, Yersinia pestis"
FT                   /note="KEGG, K02029"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03511"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45383"
FT                   /db_xref="GOA:A0A0H3KK05"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK05"
FT                   /protein_id="BAG45383.1"
FT                   /translation="MIELVSQYWQNYLYTDGYRFTGLAITLWLLVVSIVLGFALAVPLA
FT                   IARASSNRWISGPVWLYTYVFRGTPLYVQLLMCYTGIYSLQVVHDHVLLDAFFRNAMNC
FT                   TLLAFVLNEAAYATEIFAGAIKATPSGEIEAGMAYGMSRFKLYTRVILPSALRRSLPSY
FT                   SNEVILMLHATTLAFTATVPDILKVTRDVNSATYMSFQAYGIAAVIYAVVVFALIWAFR
FT                   KLEARWLAYLSPRSH"
FT   CDS_pept        341230..341997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03512"
FT                   /product="polar amino acid transport system ATP-binding
FT                   protein"
FT                   /note="COG4598: ABC-type histidine transport system, ATPase
FT                   component, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02028"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03512"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45384"
FT                   /db_xref="GOA:A0A0H3KTE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTE0"
FT                   /protein_id="BAG45384.1"
FT                   /translation="MYKLIVEDLHKKFGDNEVLKGVTMKAKAGDVISIIGSSGSGKSTF
FT                   LRCINFLEQPCSGQITIGTEPIRTVRDSGGSLRVADPKQLQRMRTKLAMVFQHFNLWAH
FT                   MTVLENVIEAPIAVLGIAKDEAVARARKYLEQVGLPARVEGMYPSHLSGGQQQRVAIAR
FT                   ALAMEPEVMLFDEPTSALDPELVGEVLKVMQALAEEGRTMVVVTHEMGFARNVSNHVIF
FT                   LHQGKIEEQGDPQQILVNPKSERLGQFLSGRLK"
FT   CDS_pept        342130..342270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03513"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJI2"
FT                   /protein_id="BAG45385.1"
FT                   /translation="MKRIAKILTAAAVACAVLAPALAEAHAHRVCHFDHHHHHRMCRWV
FT                   H"
FT   CDS_pept        342560..343801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03514"
FT                   /product="putative cAMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03514"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45386"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJH4"
FT                   /protein_id="BAG45386.1"
FT                   /translation="MNRQQSWTRTAAPGEIIYAEGYAGEPVIFLIADGKVELSTRCDDQ
FT                   RVVLATLGRGEFFGEAALLAVEPRAHTAKALSFCQLTVVPTSVLDEEIERVSALLRHIV
FT                   RTSIRRVKRKDDQLATYTHADFMPGVLSYAHVLALMGDGTARETGDTWARRPLHVQAEQ
FT                   AAVPLVDVIRKCRAIAGHSRPHVMAMLRRMEKLNLVTIEAASVEAGGVALEHSASADAR
FT                   QVVTFDAARIVDRAQQVADHDLDLSINSELELIELADLESLIGVDRKLLLNKLAHGEIA
FT                   DDVFAFRKSKVLSFVERKGVAYFSRRDARRAADVRALEDLVWVDQRTLFEIVSAFDTYD
FT                   LAKLIANVDDRAVADRLFSVMTEVRRNEVSWVMRRDLKVDPVEVDDIERRLLDAVRAAK
FT                   APAAGAVPTPESGA"
FT   CDS_pept        343828..344592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BMULJ_03515"
FT                   /product="chemotaxis MotA protein"
FT                   /note="COG1291: Flagellar motor component, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K02556"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03515"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45387"
FT                   /db_xref="GOA:A0A0H3KP70"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP70"
FT                   /protein_id="BAG45387.1"
FT                   /translation="MDLLTLAGVLLGGAAIVFGFTLEGGHLATLFQLEAFVIVLGGTLG
FT                   AVMIQNTWARFVDAVKQLRLAFVRATAADRKHLSDLLEWGDRAKLEGLLAFESMDVTGI
FT                   HPFARRGLELLANGMSTAVIEDALQRELDAYERSHLAAARVWQQAGGYAPTFGILGSVL
FT                   GLVQVTGHILEPAQLGPGIAVAFVATLYGLAFANLVFLPLYGKLRAHVDSELRFRKLYL
FT                   DGLLAISRKESPHTIETRLTGDVRARAAESLA"
FT   CDS_pept        344633..345292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BMULJ_03516"
FT                   /product="chemotaxis MotB protein"
FT                   /note="COG1360: Flagellar motor protein, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K02557"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03516"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45388"
FT                   /db_xref="GOA:A0A0H3KK10"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK10"
FT                   /protein_id="BAG45388.1"
FT                   /translation="MNARTDAERDDEDAEGTQSGRWLISYADLITTLMVLFLALYVLQL
FT                   AKFNALDARERTRVRLDDAAPARTAEPQAPARVPAWVAQLDALKAGGRISLVQAPHGIE
FT                   IGIDAGILFHVGDAHLLPDALPVLERIAQALGPHAAGDILVEGHTDSVPIANAKYESNW
FT                   ELSSARAGAVVRYLAERGIAPHRLAAVGRADTQPLVAGDDASSRARNRRVTIFVAY"
FT   CDS_pept        345422..347284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03517"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="COG0840: Methyl-accepting chemotaxis protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03406"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03517"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45389"
FT                   /db_xref="GOA:A0A0H3KTE4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTE4"
FT                   /protein_id="BAG45389.1"
FT                   /translation="MHFWRKLSIQSKLILSMTSCLLVFVAISSGLSIRLIGDAVRDRVV
FT                   HQELPTAVNGIRADVQRQLAGPIAASRILARDAFLLQWEADSEPDAGTRNWIQLARNVK
FT                   DEQKAASVQWVSVKSGNYYNEAGLQRKVTDQDQWLTRFLQSGAPFEVHMDHEVTVGGYM
FT                   MFINSRIELDGAPIGAACMSLSVDALAKGIAAYRIGETGFAYLVRPDGAIMMHRDTSLI
FT                   DGKHFMKDTPGLPDDAASVLLAGKPYAYLSYAGDGGERFIATSFVPELNAYVVVEVPEA
FT                   ELLGPVTRAIQSAALVAAVVGLGVALVVIWFVGRAIAAPIRRAATLLSEIASGQGDLTR
FT                   RMTVESADEIGQLSDAFNRFVSSLSTLVHRIRAASASIATGSAQIASGNADLSERTEGQ
FT                   SSNLERTASSMEEITAVVRNNTETATTAAKMINGASETAARGGQVVGEVVSTMQQISDA
FT                   SQRISEIIVMIDSISFQTNILALNAAVEAARAGEQGRGFAVVASEVRNLAQRSAQAAKE
FT                   IKALIEHSAGTVDVGSKLVTEAGRVMSDVVSQVQGVSAMMSEIAEASLEQSAGIDQIGD
FT                   AVQSLDQMTQQNAALVEESAAAAESLRQQAAELTTLVSAFKVDE"
FT   CDS_pept        complement(347384..348016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03518"
FT                   /product="putative threonine efflux protein"
FT                   /note="COG1280: Putative threonine efflux protein,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03518"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45390"
FT                   /db_xref="GOA:A0A0H3KJI7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJI7"
FT                   /protein_id="BAG45390.1"
FT                   /translation="MPPMSTLLAFGLVSLGMVLTPGPNMIYLISRSICQGRRAGLVSLG
FT                   GVALGFVFYMFCAAFGIAALVLTVPYAYDALRVAGALYLAYLAWQALKPGGRSAFQVRP
FT                   LSPDSRRKLFTMGFVTNLTNPKIAVMYLSLLPQFISPEHGSVLAQSLALGCVQIAVSVS
FT                   VNALIASMAGSIAGFLARRPAWALAQRWLMGTVLAGLAARIALESRR"
FT   CDS_pept        complement(348143..349051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03519"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Bacillus
FT                   halodurans"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03519"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45391"
FT                   /db_xref="GOA:A0A0H3KJH9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJH9"
FT                   /protein_id="BAG45391.1"
FT                   /translation="MTLAQLQALAAVVELGSLTAAADRLNRSQSAISHALTELEDLTGV
FT                   KLLMRDRQPVALTAAGERLWPYVRNVVREAQTLRQQFSLSRGRLEGRLVVASLPSVSLA
FT                   FVAPALEALKAMHPGVSAVLLEGTDTEVEAWIDDGTADVGVVAGSKTFANHLPLLDEDF
FT                   VAVAAAGSFDDRKSVSAKHLSALPFIFSKAGCGPVIADYFARGGVPLRAAFNVVEMRTI
FT                   LSMAEAGMGVSIVPRITLTYTPFAGRVLTLSPKLQRSVRLAWNRTGNAVADEFIRLVAE
FT                   QRVKAGTAIRKRASKRASKEK"
FT   CDS_pept        complement(349222..350463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03520"
FT                   /product="putative amidohydrolase"
FT                   /note="COG1228: Imidazolonepropionase and related
FT                   amidohydrolases, Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45392"
FT                   /db_xref="GOA:A0A0H3KP74"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP74"
FT                   /protein_id="BAG45392.1"
FT                   /translation="MTITVLQGGNVLDLERGVLLEHHHVVIEGERIVEVTDRAVDFPNA
FT                   QVIDVRGKTVMPGFIDCHVHVLASNANLGANATQPNILAAIRSLPILDAMLSRGFTSVR
FT                   DAGGADWGLMQAVDTGLVAGPRIFPSGKALSQTGGHGDFRPRGDLLEPCSCCFRTGAIA
FT                   RVVDGVESVRLAVREEIQKGATQIKIMASGGVASPTDPIANTQYSEDEIRAIVDEAEAA
FT                   NTYVMAHAYTGRAIARAVRCGVRTIEHGNLVDEAAAQLMHQHGAFVVPTLVTYDALAKH
FT                   GAAFGLPADSVAKVASVQQKGRESLEIYAKAGVKMGFGSDLLGEMHAFQSGEFRIRAEV
FT                   LGNLEALRSATTVAAEIVNMAGQLGVVAAGAMADLVVLDGNPLDDIGIVAGEGEHIACV
FT                   LQRGKLVKARDGSR"
FT   CDS_pept        complement(350476..351792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="BMULJ_03521"
FT                   /product="proline/betaine transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /note="KEGG, K03762"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03521"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45393"
FT                   /db_xref="GOA:A0A0H3KK15"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK15"
FT                   /protein_id="BAG45393.1"
FT                   /translation="MQGTLSPRAAPSVDAAAQQRRRAIIATVIGNGLEWFDFTVYSFFA
FT                   VIIAKLFFPTGNELTSVLLTVATFGVGFFMRPVGGIVLGVYADKVGRKAALSLTILLMA
FT                   FGTALIGLAPTYEQAGIAAPMLIVVARLLQGFSAGGEMGGATAFLTEYAPPEKRAYYSS
FT                   WIQSSIGFAVLLGAATGTFVTTSLDTQALHSWGWRLPFLLGIVVGPVGYFIRSHLDETP
FT                   AFSAVEAQAKESSPLKAVLSTYPRETFASFAMVILWTVCTYVLLFYMPTYSVRTLHLPQ
FT                   STGFAAGMVGGSMIMCCSPLVGRLADLWGRRVFLSGAALAILALAWPMFAWINHAPGFV
FT                   SLIAFQAVFGLLIAAYTGPILAAFAELFPTKVLSTGLSVAYNFAVTIFGGFAPFLMTWL
FT                   IARTGSNMAPALYVIAAAAVSFVGTRFVKDTKRTAFANR"
FT   CDS_pept        complement(351926..352837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03522"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03522"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45394"
FT                   /db_xref="GOA:A0A0H3KTE9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTE9"
FT                   /protein_id="BAG45394.1"
FT                   /translation="MRITPLPPLQCLVAFEAAVRHASFTRAAAELHLTQSAISRQIQQL
FT                   EEFLGRSLFVREHRSLRLTIAGEQYAAQVHHLLTQCAEATHDVMKPYGDLELTIACSSG
FT                   VAVLWLTPRLPEFRAAYPNIKLRLIVRDGLASMSPAEFDVGVYYVRQQAPAEYTARRLF
FT                   DEEVFPVCAPGYLAGRTLDAADLANETLLRLEDGQRQWMSWSEWFDQNDIDRQKAQPQD
FT                   ITINSYPQIVQMTILGQGVSLGWRYMIDACIEAGVLVRVTDASASHGGGYYVISPNDRA
FT                   QNQAARLFSRWLFEQAERQTAA"
FT   CDS_pept        complement(352998..353996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03523"
FT                   /product="putative transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="COG3958: Transketolase, C-terminal subunit,
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K00615"
FT                   /note="contains putative C-terminal regulatory
FT                   molecule-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03523"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45395"
FT                   /db_xref="GOA:A0A0H3KJJ2"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJJ2"
FT                   /protein_id="BAG45395.1"
FT                   /translation="MSTAAQKPRLKTSAMIASIAAEGQPTRAAPFGHALVELARTKPDV
FT                   IGMTADLGKYTDLHVFAKAFPERYYQMGMAEQLLMGAAAGFAHEGAQPFVTTYAVFATR
FT                   RAYDFIHQTIAEDNLDVKIVAALPGLTTGYGPSHQAAEDLALMRAMPNMTVIDPCDALD
FT                   IEQMVPAIAAHDGPVYARLLRGNVPVVLDEYDYTFELGKAKRLRDGNDVLLISSGIMTM
FT                   RALEVANALEADRVGVAVLHVPTIKPLDTATIVREAKRTGRMVVVAENHTVIGGLGEAV
FT                   ARTLLAEGVAPTFRQIALPDAFLDAGALPTLHDRYGISTATMVASIKRWLG"
FT   CDS_pept        complement(353993..354838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03524"
FT                   /product="putative transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="COG3959: Transketolase, N-terminal subunit,
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K00615"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03524"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45396"
FT                   /db_xref="GOA:A0A0H3KJI4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJI4"
FT                   /protein_id="BAG45396.1"
FT                   /translation="MDSEVMTEDVALAERAYRIRRNALRMGEVQGQGYIGQALDIADVL
FT                   AVAYFGAMRYRPQDPDWEARDRFLLSNGHYAIALYAALFEAGVLPADELETYGSDDSRL
FT                   PMSGMASYTPGMEMSGGSLGQGLTIAVGRCLGLKRKGSDAFVYTLFSDGELDEGAIWEG
FT                   LMSAAHWQLDNLIAIVDVNNQQADGPSTQIMAFEPLVDKLEAFGWYVQRVNGNDIDAVK
FT                   QAFDNARRHDRPQPRIIVCDTKMGCGVPFLEQREKNHFIRVDAHEWQLALDALEAGRQA
FT                   "
FT   CDS_pept        complement(354875..356203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03525"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03525"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45397"
FT                   /db_xref="GOA:A0A0H3KP78"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP78"
FT                   /protein_id="BAG45397.1"
FT                   /translation="MKSRYSAPPLAGDAIPLTDPPTFEARTYAKVSRRLIPFLMLCYLG
FT                   AYLDRVNVGFAKLQMLNDLRFSETVYGMGAGIFFLGYFLFEVPSNLILHRVGARRWLAR
FT                   IMLTWAVISASFVFVKSPAAFYVLRFLLGVAEAGFAPGVILYLTYWYPSARRAKALSLF
FT                   FMAIPLAGIVGGPLSGAIMHTLHGAMSMAGWKWLFLLEALPSLVLGVAILRYLDDGIAH
FT                   AKWLSDPEKALLARNVAGDEAHKTAHLSIRAFVGDRRLWLMAAIYFCVVLGQYGLTFWL
FT                   PTIIRKAGVSDPLWVGVFTAIPYLCAIVALPLIGMSADRRRERRLHLAVPMLVAAAGFA
FT                   ALPALGSVTASIVCLSIAAAGILASSSQFWSLPTALLGGVSAAAGIAAVNCFANLAGFF
FT                   SPAIVGWLNDLTGKSTAGLIFISAAVTLGAALVFAVPARSVNR"
FT   CDS_pept        complement(356269..357018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BMULJ_03526"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K00059"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03526"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45398"
FT                   /db_xref="GOA:A0A0H3KK21"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK21"
FT                   /protein_id="BAG45398.1"
FT                   /translation="MLLENRIIVVTGAASPRGIGKATAQALAAQGARIAILDLREEDAR
FT                   AAAADLGSGHLGLACDVTDKAACVAAARATLERYGRIDGLVNNAGITQPVRTLDIGAKD
FT                   FDAIVDVNLRGTLYMSQAVIPAMKEQQGGSIVCMSSVSAQRGGGIFGGPHYSAAKAGVL
FT                   GLAKAMAREFGPDRIRVNAITPGLIQTDITGDKLTPDMRADIVKGIPLGRLGDAADVAN
FT                   ACLFLVSDLSTYLTGITLDVNGGMLIH"
FT   CDS_pept        complement(357112..357999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03527"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03527"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45399"
FT                   /db_xref="GOA:A0A0H3KTF4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTF4"
FT                   /protein_id="BAG45399.1"
FT                   /translation="MRIPPLKSIIAFESVARTKSVNRAAEELGLTASAVSHQLSNLEAL
FT                   IGRPLFQRSGRGLVLTPTGERYLADVTGSLADLSRATERASSRTDVDILRVHSSPSFGL
FT                   MWLLPRLSSFQEANGDLQLNLACSYENVSFSNGYYDIDIRHGYGNWDNLEVKTVRGEYI
FT                   APLASPAYLERHPVRTPEDLLAHRLIYSETPLVQWKQWFGRTGVSAKQKTFDFSFDRSY
FT                   MSIETAALGLGIALESLTLASVKIRDGLLVPVFDDSYAVEVGAHHLVYPSQNAALPRIQ
FT                   RFLAWIEREAAAST"
FT   CDS_pept        complement(358159..359073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03528"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03528"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45400"
FT                   /db_xref="GOA:A0A0H3KJJ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJJ9"
FT                   /protein_id="BAG45400.1"
FT                   /translation="MSTSSLTESRIAYFFEAVRCGAIRAAADWLDVAPSAVSRQIALLE
FT                   AELDAPLIERHARGVTPTEAGRFVIQYYREQRAHRDDLLSRLQDLRGLRTGHVRVVLGE
FT                   GFVSDLLSGPMQQFCTQYPKIRVNLDLGSTNDVMTKIAEDDGEIGLVYNPPREPRIVSR
FT                   AAHRQPMMAIVGARMARTIRRKSLTVQELAAYPLAATHPSYGTRQMLQAVEFAEKISLE
FT                   PAITTNSINIMKQFARSELGIVVLPAFAVASELKAGELKAIPIEHPILQNAEAHLVTRV
FT                   GRTLSVASNRMLQMMSSQMSAFR"
FT   CDS_pept        359235..360104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="BMULJ_03529"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="COG2084: 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenases, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K00020"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03529"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45401"
FT                   /db_xref="GOA:A0A0H3KJJ1"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJJ1"
FT                   /protein_id="BAG45401.1"
FT                   /translation="MKTVGVIGLGNMGRGIASSLKRAGFDVLGFDANAESVRQLADEGV
FT                   RPCASVAEIASAVDVLILSLPTSAIVEAVVLGDGGVASHAKRGLIVIDTTTADPNSTRK
FT                   VAAALDAHGIGFIDGPVSGGPKGAATATMTMVLGGADEHIAAVQPVLSAISAKQVHVGP
FT                   AGAGHVTKLLNNLLTGVHLLVTSEAVRAAEAAGVDKARLIEALSGGSGRNSATLTNYPT
FT                   WILNERFDSGFTMKLMRKDMRLALELLQRAHVSAPIASEAGRLWAASAESIGDAEDFNR
FT                   IVEFVDAR"
FT   CDS_pept        360134..361645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="BMULJ_03530"
FT                   /product="betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K00130"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45402"
FT                   /db_xref="GOA:A0A0H3KP83"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP83"
FT                   /protein_id="BAG45402.1"
FT                   /translation="MASPIEQALLDAFRQFFPGAQTVGSYVNGELVEGRGDTIQLFDAA
FT                   TGEQSLAYRDGGAEIVALAASAAQAAQRQWWALTHAARGRTMFDVAREVRSHAEALARL
FT                   ESLGSGKPIRDCRGEVAKVAEMFEYYGGWADKFYGDVIPVPTSHLNYTRREPAGTVLQI
FT                   TPWNAPVFTCGWQLAPAIAMGNAVLLKPSELTPFSSLAIARLAERAGVPTGLINVLAGY
FT                   GHTIAQAAIAHKAVKKVVFVGSPATGARIAEAAAKRVLPCVLELGGKSANIVFDDADLN
FT                   RAALTAQAAIFAGAGQSCVAGSRLLVQRSIYDRFVAMVATGAKKIRVGAPTDDATEVGP
FT                   ICHRAQYEHVMKMIASGVESGATLAAGSTERSAHGYFVAPTVLANVHNRMDVARTEIFG
FT                   PVVVAIPFDTEEEAIEIANDTDFGLAGAAWTNDVARAHRVAAQIDAGTFWVNGYKTINV
FT                   ASPFGGYGMSGYGRSSGVEALYEYTQTKSVWVETAKHPASAFGYL"
FT   CDS_pept        361763..363109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03531"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45403"
FT                   /db_xref="GOA:A0A0H3KK27"
FT                   /db_xref="InterPro:IPR021450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK27"
FT                   /protein_id="BAG45403.1"
FT                   /translation="MEHTMTADGAGSDGFRGAKLLVYAAAILLIAQSIGAFTFNVGPGK
FT                   VVLLPMIWALLMGGALGLLSERWRSSMRLDVKTQFLAAAVLQPALLLFVAKLGLMVGSA
FT                   LPKLAAAGWALAFQELGHFVGTILLGLPLALLLGIKREAIGATFSVGREPSLAIIGEKY
FT                   GMNSAEGRGVLAEYLTGTVFGAVFIAIFAGFVASLNIFHPLALAMGAGVGSGSMMAAAS
FT                   GAIAAAQQSPEVAKNVLTFAAASNLITTTIGTYFTLFISLPLAVFGYRVLEPLIGRTTK
FT                   ASSASASVEAARPSLGDVQTEAPALSYSGKVAAWLLTAVFSLVCDWITHGTSPLFGLPG
FT                   MAFMVLATVIGDALSTVTRRKIPAVCWVSVVAMFMTSPLCPWAPAIAAMSAKNDFLGVV
FT                   TPMLTFAGLSIAKDIPAFRRLGWRIVLVSFVANAGTFLGAALVAQIFHI"
FT   CDS_pept        363388..364311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03532"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03532"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45404"
FT                   /db_xref="GOA:A0A0H3KTF9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTF9"
FT                   /protein_id="BAG45404.1"
FT                   /translation="MGINFDLTDLQAFRAVVELGSFRKAADALSISQPALSRRIDKLED
FT                   ALGVRLFERTTRSVTLTTVGRVFAPSAEQLLDDLDAALLGIRDVSSSRLGHVTIACVPS
FT                   VAYYFLPNVIAEYHRRFPRIRVKLLDSGANEVLGAVISGEADFGVSFIGSQEPEIDFKV
FT                   LLQERFVAACRRDHPLARKKRVTWDELYAHEYVSVDKTSGNRLLLDQALSGVAPPVPSV
FT                   CETRHVTTLLGLIEAGLGVAAVPSMAMPGRDHPILTSVPLVDPVVKRRVGIVKRRGRQL
FT                   TPAAQAFHEMVVDAKRASSAASAAAS"
FT   CDS_pept        complement(364385..365167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="BMULJ_03533"
FT                   /product="molybdate transport system substrate-binding
FT                   protein"
FT                   /note="KEGG, K02020"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03533"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJK3"
FT                   /protein_id="BAG45405.1"
FT                   /translation="MKNLLLKLCATALVATSVATAPVQAAELHVMSSGGFTAAYKALGP
FT                   RFAADTGNTLDTTLGPSMGKSPEAIPNRLARGEPADVVIMVGYALDELIRQGKVVPGSR
FT                   VELADSRIGMVVREGAAKPDIGTADGLRQALLHAKSIAYSDSASGVYIERELFRKLGIE
FT                   AQVKPKATMIPRIPVASVVANGDYEIGFQQVSELLPVPGVTFVGRIPESLQSVTRFAGG
FT                   IPVGARHPQEAKALLDYLASPGVQPDVKATGLDPVSAR"
FT   CDS_pept        complement(365222..366517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03534"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Salmonella typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03534"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45406"
FT                   /db_xref="GOA:A0A0H3KJJ8"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJJ8"
FT                   /protein_id="BAG45406.1"
FT                   /translation="MHPSSSLSTGRSKAAAVFRVTAGNFLEQFDFFLFGFYATQIANVF
FT                   FPAASEFASLMMTFAVFGAGFLMRPLGAIVLGAYIDDVGRRKGLIVTLSIMASGTILIA
FT                   FVPGYATIGLLAPALVLLGRLLQGFSAGAELGGVSVYLAEMATPGRKGFFTSWQSASQQ
FT                   VAIVVAAALGFALNRWLSAADIAAWGWRVPFFVGCMIVPFIFMLRRKLEETQEFTARRH
FT                   RPTMKEVFATLAQNWAVVVAGMMLVAMTTASFYLITVYAPTFGKTVLHLSTADSLLVTL
FT                   CVGVSNFVWLPIGGALSDRIGRRPLLVAMTVLAIATAYPALSLLAHAPTFMNMLLVLLW
FT                   LSFMYGLYNGAMIVALTEVMPVQVRVAGFSLAYSLATAVFGGFTPAISTALIHMTGDKA
FT                   APGYWMSFAAVCALLATFALYRRQAATLTPAH"
FT   CDS_pept        366792..367202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03535"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45407"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR013423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP91"
FT                   /protein_id="BAG45407.1"
FT                   /translation="MAVALAERGVRRFPPGRVNPRIVEYNGHTNLVGYDDKISWCSSFV
FT                   NWCMARAGLRGTGSALARSWLEWGRPLAQPVYGCIAVLTREDPASWKGHVGFYLRHDAA
FT                   HVHLFGGNQLGAVRELAYPVASVIAYRWPHAE"
FT   CDS_pept        367315..367938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtC"
FT                   /locus_tag="BMULJ_03536"
FT                   /product="threonine efflux protein"
FT                   /note="COG1280: Putative threonine efflux protein,
FT                   Escherichia coli O157:H7"
FT                   /note="KEGG, K05835"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03536"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45408"
FT                   /db_xref="GOA:A0A0H3KK32"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK32"
FT                   /protein_id="BAG45408.1"
FT                   /translation="MSYVPQLAAVGGVMLLACVSPGPDLIAVSSHALGNRRAGLLAALG
FT                   IASSHAVWAAMAIFGLGLIVAKLAWLYEAIRIAGAAYLIYLGIKSLAGLRQSAQPADAM
FT                   RAPAVRGGAHAYRKGLLVGLTNPKAAAFFGSLFVTLLPAHAPAWVHGATLAVVVAVSLA
FT                   WFCTVALLFSTNRVQTGYAKLRKPIDAVMGTILLGLGAKLALDR"
FT   CDS_pept        complement(368048..369478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03537"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03537"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45409"
FT                   /db_xref="GOA:A0A0H3KTG3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTG3"
FT                   /protein_id="BAG45409.1"
FT                   /translation="MKQLIVALAVSAFAAGCAVQPAQHATLPDAVGALAPATWDTAVPA
FT                   AASDAATWWAQFRDPTLDRLIATVLDGNLDLQAAAERIKQAQALTASKRAALLPELDAT
FT                   AHASDARQNVPPPLGYVRQAGAGLALSWSPDVFGGERLDLLAARAELVGQTHAEDAMRL
FT                   ALAADAASAYVDLRWAQQELKLLQDNAAIRQRALELTRKRQAFGLSTELDVTRAKNQLD
FT                   ALEARIAPTRAQIAHQLNLIAVYSGRTPESIDQLVLAESAPIPAPPAGAPITLPSQALL
FT                   RRPDVLTAYAQVERRAAQVGVANAERYPKFSLNLADGVLAASYLGLPTLTDNLFSAALS
FT                   ATSPIFDAGRIAADIAQSESRLRESELALRQTMLQALREVEDARASLVATDAASQQLGS
FT                   ALAASDRALALATRLYKGGATDFLDVLTAQEAYLRDSDSLNQAAREHALAAIALYRSLG
FT                   GGWSRNDAGQAAAAVASR"
FT   CDS_pept        complement(369489..371063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03538"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03538"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45410"
FT                   /db_xref="GOA:A0A0H3KJK8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJK8"
FT                   /protein_id="BAG45410.1"
FT                   /translation="MTTAFSGDPASQPTKQRVFAFALMCVGFFMATLDIQIVASSLRDI
FT                   GGGLSASQDELSWVQTAYLIAEIIVIPMSGWLSKVMSTRWLFVASAVGFTITSMLCGLA
FT                   WDINSMILFRGLQGALGAAMIPTVFTTAFVLFPGRQRLIASTTIGALASLAPAIGPVIG
FT                   GWITDRWSWHWLFYLNLVPGILVAVLVPRYVRIDEPDPGLIKRGDYLGIALMSGFLGCL
FT                   EYVLEEGPRKNWFGDHVIVACAWIAGICGFLFVVHALTAEDPVVDLRALAVRNFGIGSL
FT                   LSFVTGIGIFVTVFLTPLFLAQVRAFSSLQIGIALLSVGAFQLLALCAYAFAARYFSLR
FT                   SLLVFGLVCFGVGCYLYTPITHDWGWQELLLPQALRGIGQQFSVPPIVTMALGSLPPSR
FT                   LKSASGLFNLMRNLGGAIGIAVSATMLNDRLNFHYLRLNEHMSAGVPQVASLLDGRTAY
FT                   WASVAGNTVDAAQAALANLHRLIYREALTLTYADAYYALSLCFVVALVAVVFSQPISLN
FT                   APPPDAH"
FT   CDS_pept        complement(371077..372168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03539"
FT                   /product="putative multidrug resistance efflux pump"
FT                   /note="COG1566: Multidrug resistance efflux pump,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03539"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45411"
FT                   /db_xref="GOA:A0A0H3KJK6"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJK6"
FT                   /protein_id="BAG45411.1"
FT                   /translation="MDTTQTAAAREAATAEPPAKQRRRVRWMRIAVIAVVVAVGAAALD
FT                   WLFVLRFQESTDDAYVGGDVTVLAPKVAGFVDRIGVTDNQRVKAGDVLVQLDARDYAAK
FT                   LAQASAEVDAARSAVAELEAKQQLQDAVIGQHAADKNASSAELTRAAADRVRYRELVKA
FT                   DAVSNQLVERADADYAKAHAAVERSDAALLASKRELDVLGAQLADARARVNTALAAQRV
FT                   AALNVEYTTIRAPVDGYVGNRTGRVGMLANVGVPLLTIVPASGLWIDANFKEDQLRKMR
FT                   AGDRVDVSLDASAARLHGRVDSVAPATGATFSVLPPENATGNFTKIVQRVPVRVHLDPQ
FT                   PGLEQVLRPGLSAVVTVHTDHAH"
FT   CDS_pept        complement(372258..372689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03540"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45412"
FT                   /db_xref="GOA:A0A0H3KP97"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KP97"
FT                   /protein_id="BAG45412.1"
FT                   /translation="MHTMTLTDDDCFAIRQAARRISQFYERHLAHAGVTPSQYSILALL
FT                   RERPGLTMAALSAELVIERTALLRALRPLVGAALVAGHTEPGGRRQTFSLTACGETKIA
FT                   EAHAHWLAAQQAFERRFGARQAAHLRDELFRIAHNLPAR"
FT   CDS_pept        complement(372795..373715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03541"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03541"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45413"
FT                   /db_xref="GOA:A0A0H3KK36"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK36"
FT                   /protein_id="BAG45413.1"
FT                   /translation="MDYIDKLRIFRSVVELRSFTRAADMHGLARPVVSRAIAELEARFG
FT                   GRLLHRTTRQVSLTETAERIYERCAAVLDELDALEAEAQTQTREPDGLLRLVAHTTAAL
FT                   NQFVPLIAGFKAAHPKVRIDVTLTERPVDLVGEGYDIGIVAPYMLSSDTTIVRLIARIP
FT                   FVIVATPAYLRAHGRPATPADLVDHPFVPLSPSLRRPALSFRVDGDVLTLPLRFDISSN
FT                   SPVFNREMVMHGFGIGIVPRTLIETELASGALVQLLGDADLVDGCVELKLAYANRSLLP
FT                   AKVKAFIDYASAMCDREGWITPVAA"
FT   CDS_pept        373820..374248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03542"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03542"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45414"
FT                   /db_xref="GOA:A0A0H3KTG7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTG7"
FT                   /protein_id="BAG45414.1"
FT                   /translation="MDDIETIGACNCFALRQATRFVTQIYERHLSAAGVTPAQFSIIAI
FT                   LSRRPDVLMSELADALVMDRTTLLRALKPLQRDGLVASAPSEHDPRAHVLNLTKQGVRA
FT                   FGQAKRAWQAAQREFEAAFGEQRAQALRDELLQLTGKR"
FT   CDS_pept        374591..375838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03543"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1679: Uncharacterized conserved protein,
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K09123"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03543"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45415"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJL1"
FT                   /protein_id="BAG45415.1"
FT                   /translation="MLQLSERDDAMLRGEFGEGVARAMRIVARTAQVMSAPHLIDITCA
FT                   HIDGCLYHGQTSLDFVDYFVATGARVAVPTTLNVGSLDLIHPELYRGDRTIERDAQRLM
FT                   DAHLQLGCESSFTCAPYQLKHRPALGEQIAWAESNAIVFANSVLGARTSRYGDFLDLAA
FT                   AITGRAPYAGLHVEANRAGQIVFNAPDFGRLPSRDIHFAALGLLVGKVAGATVPVIVGL
FT                   PADATEDELKALGAAAASSGAVALFHAVGVTPEAPTLDAALHGRAPRQTIDVSMADLAE
FT                   IRRTLNHGAEGDALVAVALGTPHFSLAEFRTLDALLDRFDGKPACDIYVNTSRFILWEL
FT                   GELGLADKFAARGVQIVVDTCTYITPVMKQLSGLVMTNSGKWASYAPANIGVTVAYGSM
FT                   SECVRSAFEGKVRFDD"
FT   CDS_pept        375831..376289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03544"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1786: Uncharacterized conserved protein,
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K09128"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03544"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45416"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJL2"
FT                   /protein_id="BAG45416.1"
FT                   /translation="MTEIHHAGAAGTVLAGDTLVPGHAYAETIVLPKPLSFWGGYDSVA
FT                   GRIVDRGHPLVGASLAGRIMVMAHAKGSSSSSSVLAEAIRNGTGPVGIVLSERDLIISI
FT                   GAIVAAELYAMAVPVVCVSAPVYDTIARASGPVRIEANDGDGGARILL"
FT   CDS_pept        376504..377619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03545"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   system periplasmic component"
FT                   /note="COG0683: ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03545"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45417"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPA4"
FT                   /protein_id="BAG45417.1"
FT                   /translation="MKLKCMIAVLALGGFTIGAAHAERVVTIAFSGPLTGPQAVSGKDD
FT                   ENGLRLAVETLNRTPITIDGQPVRFRIVAEDDQADPRTGVQVAQRLLDRQPAAFFGPEN
FT                   SGVAIPVARLTNAARVPMLTVASNPQLTALGYDNVFRTGASDSVLGASMAAFAAGKLGA
FT                   KTAAVIDDRTAYGQGLAEQFIAKAKSLGLQVVAREFTHSQATDFLAILATIKGKNPDVI
FT                   FFGGYTAQAAPMAKQMVQRGVRARLLGGDGICSANMGTVAQTASRNVYCAMSGSGLDRT
FT                   EAGRDYVARYRARFKSEPQTYGITYYDGMLLLAKTMASAQTTDPAKLIEALRSASHEGV
FT                   AGTYAFTVRGELMNAPTTVFTFEDGQMVPVR"
FT   CDS_pept        complement(377624..377995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03546"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45418"
FT                   /db_xref="GOA:A0A0H3KK40"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK40"
FT                   /protein_id="BAG45418.1"
FT                   /translation="MRSAGARMRNLTDDSIYLVRPARVQSARTDLTVTIGALLAFAFVI
FT                   GIMSAVQRSTDGMLAVFAWCAAATIGLYGLSTVLRSLFGFVTWPDIRRLRPPGGRREVG
FT                   AAKAALTLAPEEAARIRFL"
FT   CDS_pept        complement(378020..379075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03547"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03547"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45419"
FT                   /db_xref="GOA:A0A0H3KTH2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTH2"
FT                   /protein_id="BAG45419.1"
FT                   /translation="MSTPSRKDRLGLRRPTIPVAYPRLLLQALAARGIDAAAVRAGTGL
FT                   RDAVLAEPDARVAPAQWGRLVLNAIDIGGDRGIGLAFGLLLKPTVHGFLGYATLTAPDI
FT                   RTALHVTQRYFRMRNRQYRLTYAEDERGATLELHGVQANPVLQHHVMFEFVLTGLAQNI
FT                   AQWAGRTSPAIALRFAWPEPDYFARYRDRLPPVEFGCAANALWVARDVLDWPLPFADEV
FT                   AHRQALVQVEREYAQVRHDEGDFVERVRAELARTTGGYPDPEALAHTLLVSTRTLRRRL
FT                   EEAGSSYRQLLDEARFRDAKQLLAASDLDLKTIAERLQFTDPANFTRAFRRWAGQTPSA
FT                   YRQAAADVRRG"
FT   CDS_pept        379178..381211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadH"
FT                   /locus_tag="BMULJ_03548"
FT                   /product="NADPH2-dependent 2,4-dienoyl-CoA reductase"
FT                   /EC_number="1.3.1.34"
FT                   /note="COG1902: NADH:flavin oxidoreductases, Old Yellow
FT                   Enzyme family, Pseudomonas aeruginosa"
FT                   /note="KEGG, K00219"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03548"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45420"
FT                   /db_xref="GOA:A0A0H3KJL6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJL6"
FT                   /protein_id="BAG45420.1"
FT                   /translation="MTTPFPHLLAPLDLGFTTLKNRVLMGSMHTGLEDSRKTLPRLADY
FT                   FAERARGGVGLIVTGGFAPNVAGWTKPFGGTLMTSAAARRHRAITRAVHAEDGKIALQI
FT                   LHTGRYGYHPFAVAPSKIKSPISPFAPHELSARGIERQIRAFVRCAQLAREAGYDGVEI
FT                   MGSEGYLINQFISMHTNKRTDAWGGAYENRIRLPIEIVERTREAVGRDFILIYRLSMLD
FT                   LIPDGSDWRETVQLAKAVERAGATILNTGIGWHEARVPTIATSVPRGAFAWVTQKMKGE
FT                   VGIPLVTTNRINRPEIAERILADGCADMVSMARPLLADPEFVVKAAQGRADEINTCIGC
FT                   NQACLDHAFKNRIASCLMNPRACHETELQYARAAQPKRIAVVGAGPAGLACATVLAQRG
FT                   HRVDLFDGAAEIGGQFNLAKRIPGKEEFHEALRYFGRQIELTGVALHLNRRVEASDLIA
FT                   GGYDEIVLATGVSPRDPKIPGQDGPNVLGYIDVLTGARPVGPRVAVIGAGGIGFDVAEF
FT                   LVQDGPSPALDLDEWKAEWGVTDPAATRGGITRAKVSPPARDVTLLQRKPAPLGKGLGK
FT                   TTGWIHRATLKMKQVKMIGGVNYERIDARGLHVSYGEQRTGHALIEADTIVLCTGQEPQ
FT                   RALLAPLQAAGRSVHVIGGADRAAELDAKRAIDQGARLAARL"
FT   CDS_pept        complement(381234..381638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03549"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45421"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJL9"
FT                   /protein_id="BAG45421.1"
FT                   /translation="MFQSSAFDPEQPGFNPVQFERAAQRAVVDLQRAVAGPAQRALGLR
FT                   RRSHPAAERTMSWRALLDVEALAFSNAGFVSRNDPAIVGAFIRLCDSRLVPADIDEPVD
FT                   WRRDDDDLPAVYLIVRAMLEAEAAEQAEAA"
FT   CDS_pept        complement(381759..382652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03550"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45422"
FT                   /db_xref="GOA:A0A0H3KPB0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPB0"
FT                   /protein_id="BAG45422.1"
FT                   /translation="MTNLRRLDLNLLVTLDVLLAELNVTRAAEKLNLSQPSVSVHLQKL
FT                   RDTFGDPLLLPGPRGMRPTARAEALREPLRDALEAVERAVLPATPFDPSTATHTWRVAA
FT                   TDYGESTIVLPALHALRTAAPGTRLAIVELVPPRIEQAAARNDIDLAFHTTEGSPPGMR
FT                   RLPLFVERYVLVGRAGHPKLKRRPTLAQFNALEHVIVSPDGGGFFGVTDEALAKVGATR
FT                   RVVLSVPHFLFVMSVLASSDLVAMLPERLVRDTPALRVVDAPIDVPGYEMSMLWHERVH
FT                   RDPAHRWLRETIAAAV"
FT   CDS_pept        382740..383519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nqo1"
FT                   /locus_tag="BMULJ_03551"
FT                   /product="NAD(P)H dehydrogenase"
FT                   /EC_number="1.6.5.2"
FT                   /note="COG2249: Putative NADPH-quinone reductase (modulator
FT                   of drug activity B), Pseudomonas aeruginosa"
FT                   /note="KEGG, K00355"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03551"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45423"
FT                   /db_xref="GOA:A0A0H3KK43"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK43"
FT                   /protein_id="BAG45423.1"
FT                   /translation="MNVLIVYAHPEPRSLNGALRDFAVARLEAAGHTVQVSDLYAMNWK
FT                   PALDANDMMDRAHDARFDPALDSKRAYETGTQREDIAREQEKLKWADTVILQFPLWWFS
FT                   MPAIMKGWVERVYAYGFAYGVGEHSDRHWGDRYGEGSLAGKRAMLIVTTGGWESHYSAR
FT                   GINGPIDDVLFPIQHGILYYPGFDVLPPFVIYQTHRMDEARFAETRAALGKRLDELATT
FT                   PPIPYRRQNAGDYEIPALTLKPDIAPGKVGFAAHLAA"
FT   CDS_pept        complement(383690..383980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catC"
FT                   /locus_tag="BMULJ_03552"
FT                   /product="muconolactone D-isomerase"
FT                   /EC_number="5.3.3.4"
FT                   /note="COG4829: Muconolactone delta-isomerase, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K03464"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03552"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45424"
FT                   /db_xref="GOA:A0A0H3KTH5"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTH5"
FT                   /protein_id="BAG45424.1"
FT                   /translation="MLFHVEMKVRLPADMDPVKAATLKAEEKAMCQRLMNEGVWRHLWR
FT                   IAGQYANVSIFDVDSVQQLHDVLSQLPLFPYMEMEVRALCRHPSSVRDDDR"
FT   CDS_pept        complement(384029..384931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catA"
FT                   /locus_tag="BMULJ_03553"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.1"
FT                   /note="COG3485: Protocatechuate 3,4-dioxygenase beta
FT                   subunit, Pseudomonas aeruginosa"
FT                   /note="KEGG, K03381"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03553"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45425"
FT                   /db_xref="GOA:A0A0H3KJM1"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR012801"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJM1"
FT                   /protein_id="BAG45425.1"
FT                   /translation="MTRQEIDALLKTFDDAAEKPGNPRVRAIVNRIVKDLCYTIEDFDV
FT                   QPSEFWTALNYLNEAGREFGLIAAGLGFERFLDVRMDEAEAKAGIRGGTPRTIEGPLYV
FT                   AGAPESVGHARLDDGTDPGQTLVMRGRVLGSDGAPIANALVEVWHANHLGNYSYFDQSQ
FT                   PPFNLRRSIRTDAEGRYSFRSVLPVGYSVPPGSKTEQLLDQLGRHGHRPAHIHFFVSAD
FT                   GYRKLTTQINIEGDPHIWDDFAFATREGLIPKIRQAEGAEGKPYGIDGPFALIDFDFTL
FT                   VGARDNVPTTDVERVRAHV"
FT   CDS_pept        complement(384963..386096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catB"
FT                   /locus_tag="BMULJ_03554"
FT                   /product="muconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /note="COG4948: L-alanine-DL-glutamate epimerase and
FT                   related enzymes of enolase superfamily, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K01856"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03554"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45426"
FT                   /db_xref="GOA:A0A0H3KJM4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJM4"
FT                   /protein_id="BAG45426.1"
FT                   /translation="MIATAATIESVETLLVDVPTIRPHKLSVATMNCQTLVLVRIRCTD
FT                   GIEGVGEATTIGGLAYGEESPESIKINIDTYFAPLLRGMDATRPGAAMARARKLFQGNR
FT                   FAKCALETALFDAQARRVGVPLSELFGGRVADAVDVAWTLASGDTKRDIAEAEAMLDAR
FT                   RHRAFKLKIGSNAVDDDVAHVIAIKRALGERGDVRVDVNQAWTETDAIRACARLADAGV
FT                   SLVEQPIAASNRAGLQRLTQLAHVPIMADEALHGPIDAFALAQTRAADVFAVKIAQSGG
FT                   LQGAAHVAAIASAAGIDLYGGTMLEGAAGTLASAQLFSTFASLKWGTELFGPLLLTEEI
FT                   LVEPLRYEDFKLHLPATPGLGIAFDWARIERMRRTAR"
FT   CDS_pept        386188..387084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catR"
FT                   /locus_tag="BMULJ_03555"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /note="CatR protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03555"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45427"
FT                   /db_xref="GOA:A0A0H3KPB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPB5"
FT                   /protein_id="BAG45427.1"
FT                   /translation="MELRQLRYFMAVAEEMNITRAAERLHITQPPLSRQLQAIEEELGL
FT                   PLFVRGARPLKLTDAGRVFYAQARRVVEQADELGPLTRRLAQLSERIVIGFVPSTLYGA
FT                   LPDVIRAFREAQPDVELSLVEMFTLEQLGALKGGRIDVGFGRLRFDDDQLVREALIEEK
FT                   LIAAVPVGHPLADPDRPLTLADLANETLIVYPSTPRPSFADQQLSALRDGALVPAAVHE
FT                   VRELQTALGLVAAKVGVSLVPESVEGVRVKGVVYRRLPEPVATSPIIMSRRLHGESAAT
FT                   AKFCAIAREMIVPAGHA"
FT   CDS_pept        complement(387263..388222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="andR"
FT                   /locus_tag="BMULJ_03556"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="AndR protein"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03556"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45428"
FT                   /db_xref="GOA:A0A0H3KK48"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK48"
FT                   /protein_id="BAG45428.1"
FT                   /translation="MSPTPFEPLALRAHRLFESRDLDETRERISRVMQPHALLPSGRVC
FT                   GASHMDFVRLGGLGIGTIAFGDAMRVQVDAVDGYYLLMFCLSGHADVRAMGRQLGVDAQ
FT                   TGVLCAPGERFDALLSADCEQFVLRIDAATVRTLTGDPRATLDPVLHVSDAALAAWRDQ
FT                   LMLVARSPDLLERARTNPRVASQLEHLLIDLLIEGHPPSVLPAARHDPVPGFVRRAQEF
FT                   VDAHYAQPLQLADIVRAADVPERTLRDAFLQFRGTSPMQYLRAKRLEHARELLLGATPE
FT                   RRIADIALDCGFTHLGRFALAYRERFGESPSDTLAGRS"
FT   CDS_pept        388431..389699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="andAc"
FT                   /locus_tag="BMULJ_03557"
FT                   /product="large terminal subunit of anthranilate
FT                   dioxygenase"
FT                   /note="COG4638: Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K05708"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03557"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45429"
FT                   /db_xref="GOA:A0A0H3KTH9"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTH9"
FT                   /protein_id="BAG45429.1"
FT                   /translation="MEQTESPVRFAARDDADVVFPHDDGSRVPYKVFSSRAVYDREQER
FT                   IFRGPTWNFVALEAEIPNPGDFKSTFVGDTPVVVTRTDDGTLAAWVNRCAHRGAQVCRK
FT                   ARGNASSHTCVYHQWSFDNRGNLLGVPFRRGQKGMTGMPADFDPKQHGLRQLRVDSYRG
FT                   LVFATFSDEVAPLPDYLGEQMRPWIDRIFHKPIEYLGCTRQYSKSNWKLYLENVKDPYH
FT                   ASMLHLFHTTFNIFRVGMKARSIPDANHGLHSIITVTKTGDDTSAAYKQQNIRSFDEGF
FT                   HLEDESILDLVSEYDEDCTNHIQPIFPQLVIQQIHNTLVARQILPKGPDNFELIFHFFG
FT                   YTDDTPELRALRIKQANLVGPAGYISMEDTEATELVQRGTVRDGDATSVIEMSRGNPDQ
FT                   QDTVITESLIRKFWVGYQKLMGY"
FT   CDS_pept        389717..390202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="andAd"
FT                   /locus_tag="BMULJ_03558"
FT                   /product="small terminal subunit of anthranilate
FT                   dioxygenase"
FT                   /note="KEGG, K05709"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03558"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45430"
FT                   /db_xref="GOA:A0A0H3KJM6"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJM6"
FT                   /protein_id="BAG45430.1"
FT                   /translation="MDNLTEDMNTWFAIYMLQNRYIGHLDNNRLEQWPEMFTEDCTYEI
FT                   VPKENADLGLPVGIVHCTNRRMLRDRVVSLRHANIYEEHTYRHMTSGLTIVAQRDGEID
FT                   TESNYVVVQTRSNGESNVYQAGKYYDTVVRTPEGWRYRTKRVIYDTSRVQTLLATPI"
FT   CDS_pept        390220..390546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="andAb"
FT                   /locus_tag="BMULJ_03559"
FT                   /product="ferredoxin subunit of anthranilate dioxygenase"
FT                   /note="COG2146: Ferredoxin subunits of nitrite reductase
FT                   and ring-hydroxylating dioxygenases, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K05710"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03559"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45431"
FT                   /db_xref="GOA:A0A0H3KJN0"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJN0"
FT                   /protein_id="BAG45431.1"
FT                   /translation="MTEATLAEWHPLGTLDEFSEDEPAARVAGQKPIAVFRIGDELFAM
FT                   HDLCSHGHARLSEGYVEDGCVECPLHQGLIDIRTGAPKCAPITEPVRTYPIRIVDGQVE
FT                   VNVG"
FT   CDS_pept        390536..391756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="andAa"
FT                   /locus_tag="BMULJ_03560"
FT                   /product="ferredoxin-NAD+ reductase"
FT                   /EC_number="1.18.1.3"
FT                   /note="COG0446: Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases, Sinorhizobium meliloti"
FT                   /note="KEGG, K00529"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45432"
FT                   /db_xref="GOA:A0A0H3KPC1"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPC1"
FT                   /protein_id="BAG45432.1"
FT                   /translation="MSADPFVIVGAGHAARRTAEALRARDPGVRIVMIGAERELPYDRP
FT                   ALSKDALLGDGGEQRAFVRDAGWYDAQRIALRLGTRVDAIERDAQRVRLDDGSSLPYAR
FT                   LVLATGSRVRPFAGPVDDGVALHYVRTVADARALRAQLAPGRRVAVLGGGFIGLEVAAA
FT                   ARQLGCDVTVIDPAARLLQRALPEVVGTYARQLHDGRGVAFRLATTPRAVRRTAGGGAI
FT                   VDTDGGDVQADVVVVGIGVVPNVELAHAAGLDVDNGIRVDAGCRTADPAIFAAGEVTMH
FT                   FNPLLGRHVRIESWQVAENQPAVAAANALGADDTYAELPWLWSDQYDCNLQMLGLFGSE
FT                   HAIVVRGDPASGAFTAFGLAHDGRIVAVAAANAGRDIGASRRLIAAGATPDPARLADPA
FT                   VNLKAFL"
FT   CDS_pept        391870..393156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03561"
FT                   /product="putative membrane protein"
FT                   /note="COG2733: Predicted membrane protein, Salmonella
FT                   typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03561"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45433"
FT                   /db_xref="GOA:A0A0H3KK53"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK53"
FT                   /protein_id="BAG45433.1"
FT                   /translation="MTSDKALELKRSKRRALWLLLAAVAVFVTTIFLPRGPWIDGVKAV
FT                   AEAAMVGALADWFAVVALFRRVPIPFVSRHTEIIPQNKDKIADNLAVFVREKFLGPDAL
FT                   AAQIRQHDPAQRLGAWLGEPANTEALGGYATKLMSFALDMTDDARIQSFVHDAFRAAID
FT                   RIDLSQSAGAILDTLTKDGRHQALLDDAIAQIVAVLGKDENRDVIAGFIVEWLKTQYPK
FT                   VEKIMPTHWLGENGAELVANAVSRVLEAVAADPEHELRQRFDRIVHTLTERLKHDRAFI
FT                   DKGEEIKRYIRDGDAFNAYLKDLWVQLRAWLKADLARPDSALHRQAATLGGWLGARLAE
FT                   SSALRASLNEHIERAVHEMAPDFADFLMRHIRDTVRNWDAREMSRQIELNIGKDLQYIR
FT                   INGTLVGGLIGLGLYLVSLVPRWAGGWLH"
FT   CDS_pept        complement(393196..393495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03562"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG3636: Predicted transcriptional regulator,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03562"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45434"
FT                   /db_xref="GOA:A0A0H3KTI5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTI5"
FT                   /protein_id="BAG45434.1"
FT                   /translation="MSKISTRPWDSAEHLKTDDDMAEYFEACLQEGGDDPAFIAHALGV
FT                   IARARGMSQVARDAGLSREGLYKALSHDGNPSFGTILKVIKALGLQLHGAKAHA"
FT   CDS_pept        complement(393499..393816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03563"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3657: Uncharacterized protein conserved in
FT                   bacteria, Xylella fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03563"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45435"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJN2"
FT                   /protein_id="BAG45435.1"
FT                   /translation="MPYLAPTFSIRTTAVFDAWFAGLQDRTAKRRIQARIDRLSMGNLG
FT                   NWKSVGSPVYEMRIDHGPGYRVYFVRRRTIWVVLLCGGDKSTQRDDIRAAHAMLEHLDL
FT                   E"
FT   CDS_pept        394179..395819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="BMULJ_03564"
FT                   /product="acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0028: Thiamine pyrophosphate-requiring enzymes"
FT                   /note="KEGG, K01652"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03564"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45436"
FT                   /db_xref="GOA:A0A0H3KJN5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJN5"
FT                   /protein_id="BAG45436.1"
FT                   /translation="MKASDLFVKALEAEGVEYVFGIPGEENLDLLESLRRSKIRLVLTR
FT                   HEQAAGFMAATYGRLTGRTGVCLATLGPGATNFVTAAAYAQLGGMPMLMITGQKPIKSS
FT                   KQGHFQIVDVVGMMQPLTKFTRQIVSIGNIPSAVREAFRRAEEERPGAAHLELPEDIAH
FT                   EEGDGKPIPRSFSRRPIAEQKAVAHAVDAIQAARHPLLMIGAGGNRKTTCKMLLEFVDK
FT                   TGIPFFTTQMGKGVIDETHPLWLGNATLSDGDFVHRAIEHADCIINVGHDVIEKPPFFM
FT                   RADDKTVIHVNFLGAQVDPVYFPQIEVVGDIANAVWQMKEAIAPQPHWDFERFAMIKEH
FT                   FDAHLQKGQHDPRFPMYPVRIVNDLYNALPVDGIVCLDNGMYKIWFARYWRAHEPNSLL
FT                   LDNALASMGAGLPSAIATKIVHPQRKVIAVCGDGGFMMNSQELETAVRLGLDIVVMILR
FT                   DDAFGMIRWKQENMNFPDFAMTLKNPDFVSYAQSYGAHGHRVESADALEPLLRECFASP
FT                   GVHVIDVPVDYSDNERVLNREIKRLSAQL"
FT   CDS_pept        395848..397281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03565"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Aquifex aeolicus"
FT                   /note="KEGG, K00155"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03565"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45437"
FT                   /db_xref="GOA:A0A0H3KPC8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="PDB:5JRY"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPC8"
FT                   /protein_id="BAG45437.1"
FT                   /translation="MLKETYPYYLANAAVYANTDLEVTDKYSGKVATRVALADAKAIDA
FT                   AIGAAVDATKPMRELPAYKRQAVLDHCVARFRERFDELAEALCIEAGKPINDAKGEVTR
FT                   LIDTFRVASEEAVRIDGEVLNLEISARAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHK
FT                   VAPALAAGCPFVLKPASRTPVGALIIGEVLAETDLPKGAFSVLPAHRDGADLFTTDDRF
FT                   RLLSFTGSPAVGWALKEKAGKKKVVLELGGNAAAIVDADQLDRLDYVVDRLAFGAFYQS
FT                   GQSCIGVQRILAHADIYDALRDKLIAKTRSLKMGDPKDPSTFVGPMISESESRRLSGWM
FT                   DAAVAAGAKIVAGGKVDGAMFEATLLENVGRDQDLYRKEAFGPIAILEKFDRFDDALAR
FT                   VNDSDFGLQAGVFTDSLAHTQQAWDELEVGGVVINDVPSFRVDNMPYGGVKDSGLGREG
FT                   IRYAIEDMTEPRLLVVRRR"
FT   CDS_pept        397482..399065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03566"
FT                   /product="CPA1 family monovalent cation:H+ antiporter"
FT                   /note="COG0025: NhaP-type Na+/H+ and K+/H+ antiporters,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K03316"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03566"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45438"
FT                   /db_xref="GOA:A0A0H3KK57"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK57"
FT                   /protein_id="BAG45438.1"
FT                   /translation="MSPVSAFKLILLSFLAIVALEYVAKRLRLPPAAALLVGGIGIAFI
FT                   PGLPPINLDPDLVLVVFLPPLLMDGAYFSVWQEFKRNVGGILLLAIGAVVFTTFAVGVA
FT                   VHWAVPSLPWAACFALGAIVSPPDAVAAKAVLERVALPRRLMVLLEGESLLNDAAGLVL
FT                   FRFAVAAALTGAFSLQHALIGFAELGLGGVVVGFVIGRLVVCFLKLLDDDYLVITVAVL
FT                   AGWIAYIAGEMVEVSGVIATVTAGMIVGWHQHEVFSAAVRTRGTAFWQVIVFLLEALVF
FT                   VLIGLSLRGAMLRLGGLDQVIATMLPPVGAVLVAVVLSRFAWIYAVEALKWPVRGITRR
FT                   GDAPDWKAATVMSWAGMRGVVTLAIALSLPDAMPGRDVILVAAFAVILVTVLLQGTTIG
FT                   PLIRLLRLPQRHERAAHHLTEPQAWARVEAAQLAAIQPLVHDENGVVIHPRLLEQYTYR
FT                   AALTERLKDEPAFPDSARAAHYDVVLAAIAAGRAELLRLHRSDRIHDEMLHALERDLDL
FT                   QEVAAYHARG"
FT   CDS_pept        399521..400612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03567"
FT                   /product="putative hybrid response regulator"
FT                   /note="contains signal receiving and histidine kinase
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03567"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45439"
FT                   /db_xref="GOA:A0A0H3KTK4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTK4"
FT                   /protein_id="BAG45439.1"
FT                   /translation="MKESSGESASDCLQSGLSVLLVDDQPFVGEVIRRALRSEHDIDLH
FT                   VCTDAHRAMAVARDVKPTVILQDLVMPEIDGLDLVRAWRADADTARVPIIVLSAKEEPI
FT                   VKREAFVAGANDYLVKLPDAMELTARIRYHSNSYLMSRQRDEALDFLSHDMRSPQTSIL
FT                   ALLDVYRAEHGDMPAIMERIAGHARRALALADGFIHLTRAQSERRAHELVSLNEIVLDA
FT                   ADQLWEKANGFGSRVVAHVPDTDCTTMGDRMMLTRAVANLIDNALKYGPAGTDVHCTLA
FT                   ADDGAWLIGVEDAGPGIAPEQRAAATESFVRLESAHGAARSGFGLGLAFVRATAARHRG
FT                   QILMRNSARGFMVALRLPAQAQR"
FT   CDS_pept        400730..402406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03568"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="COG0840: Methyl-accepting chemotaxis protein,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K03406"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03568"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45440"
FT                   /db_xref="GOA:A0A0H3KJQ5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJQ5"
FT                   /protein_id="BAG45440.1"
FT                   /translation="MATVTPRATNESLPPTIGAVRLTLGNRILLSFGVLFVLMLVTAGV
FT                   SYERLRAINTEAVSIERDSLPGVYLAASLRGSVNETFMALQQATFVDTDSEAVHRDLAR
FT                   VADATKEIDTLSADYQATTFRDDDRARFATFRAAYDRYLPLLNDAAQKSRLSRDDAVAA
FT                   YAKVLPAWTETVRYANTLVQENRKFADESAKQIRNSVQDTEIVLAAALGIVLLSALALG
FT                   YGLYRTITVPMARLVEVHDVMRTGNLTQRLNLRRRDEFGTLETGFNRMADELTELVARA
FT                   QQSSLQVTTSVAEIAATSREQQATANETAATTTEIGATSREIFATSRDLLRTMNEVAGV
FT                   AEQSATLAGVSQSGLTRMGETMRSVMDAAGSVNAKLAILNEKALNINQVVATITKVADQ
FT                   TNLLSLNAAIEAEKAGEYGRGFAVVATEIRRLADQTAVATYDIEQTVKEIQSAVSAGVM
FT                   GMDKFSEEVRRGMLDVQQVGGQLSQIIAEVQTLAPRFQMVNEGMQTQANGAEQITQALS
FT                   QLSEAAQQTAESLRQSSQAIDDLTLVANQLRTSVSRFKVDA"
FT   CDS_pept        402403..402915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="BMULJ_03569"
FT                   /product="purine-binding chemotaxis protein"
FT                   /note="COG0835: Chemotaxis signal transduction protein,
FT                   Pseudomonas aeruginosa"
FT                   /note="CheW protein"
FT                   /note="KEGG, K03408"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03569"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45441"
FT                   /db_xref="GOA:A0A0H3KJQ6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJQ6"
FT                   /protein_id="BAG45441.1"
FT                   /translation="MTRAESQNGAHALFLMFELDGERYALDAAGIDAVLPLATAKAVPG
FT                   APDWIAGLLIHEGEPVPVIDVPMLALGRRAHALRSTRLVMVRYRGAAAEAGRRIGLIVE
FT                   RATQTMRIDRAAFRASGMATPRTRWLGSVASTRDGIVQLVSVADLLDDVARLHLFDGLS
FT                   GREGDSA"
FT   CDS_pept        402912..404351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="BMULJ_03570"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /note="COG1352: Methylase of chemotaxis methyl-accepting
FT                   proteins, Ralstonia solanacearum"
FT                   /note="CheR protein"
FT                   /note="KEGG, K00575"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45442"
FT                   /db_xref="GOA:A0A0H3KPG0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPG0"
FT                   /protein_id="BAG45442.1"
FT                   /translation="MRDFDSRFRGWLLRETGIDPDSLGNDFLIRAVTERVHAVLAADGE
FT                   RLPSSVRPPVTPEALDAYWQRLNGCADERRALIELFVVPETWFFRDREAFATVARLAVQ
FT                   RVAASPSRVVRVLSAPCSTGEEPYSVAMALLDAGLEPDDFAIDAIDLSARAIEHARVGS
FT                   YGRNAFRGTSTEFRARYFTPVADGWLLDERVRACVQFRQANLVEPLSDTGIRYDFVFCR
FT                   NVLIYFDREVQDRVIRSLDACMTEDGMLFVGPAETGVAMRHGMRSARIPLAFAFHRERS
FT                   GAAADGCATRRATPMPAAAPYRRAERFAPAPSAWSGPAPLAFAAPVAPIGGLATVHAAD
FT                   VDTAMADGPAAARARAADLPAPARPVAAMPVTDTPADDAHTPTLEDAQALANAGAFDEA
FT                   ERVLAQFSARVGPHADAFYLLGLIADARGRAADASDFYRKALYLRPTHHEALTHLATLL
FT                   DAGGDRAGAQWLLERARRSAG"
FT   CDS_pept        404398..405141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="BMULJ_03571"
FT                   /product="purine-binding chemotaxis protein"
FT                   /note="COG0835: Chemotaxis signal transduction protein,
FT                   Mesorhizobium loti"
FT                   /note="CheW protein"
FT                   /note="KEGG, K03408"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03571"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45443"
FT                   /db_xref="GOA:A0A0H3KK83"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK83"
FT                   /protein_id="BAG45443.1"
FT                   /translation="MNRDAAATDDTTIDVDDCWNRIGTLGDRSCERLADCLRCLNCPVY
FT                   AYHAAKLLERPLGRAEMAEAAQRMRASDVAHAPRDGADTRDAALAFRVADEWLALPIRV
FT                   LREIAGTRPIHSLPHRRHPAVRGVVNVRGTLRIAISIGALLGLDAGGAERGRGEGRTDG
FT                   RTDGRTDGRFTRLLVAAHHGEPVVFPVDEVEGVLRFGASDWVPVPATVGRASAGLSRGV
FT                   LSWRGKSVGLLDDDRLFDAVTRSMR"
FT   CDS_pept        405138..407438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="BMULJ_03572"
FT                   /product="two-component system sensor kinase"
FT                   /note="COG0643: Chemotaxis protein histidine kinase and
FT                   related kinases, Mesorhizobium loti"
FT                   /note="CheA protein"
FT                   /note="KEGG, K03407"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03572"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45444"
FT                   /db_xref="GOA:A0A0H3KTK5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTK5"
FT                   /protein_id="BAG45444.1"
FT                   /translation="MSNDDDLSHLSLLELYREETRTQTQALSERLLALEAGEPDAAALE
FT                   ACMRAAHSLKGAARIVGVPLGVDIAGRMEECFVAAQAGTIALSAAHVDVLLAGVDLLVR
FT                   VGDPHAAPVSPAEIDAFAAALTGADGAHTMRMPAAAPTPPVVASREHDAAANEPAGVSI
FT                   AAPSPGAPHAAAEPAQANRTAGAGAMRRVRADTLNRLLSLSGESLVESRWLKPFAESML
FT                   RVKRAQRDAARALDLVYEQFADELDAGVLASMNEVRHMLNDLQRSFAERMDEFDRFERR
FT                   STHIAEQLYDEALQCRMRPFGDATRAYPRIVRDLARSLGKQVRFSIVGEATQVDRDILD
FT                   LLDAPLGHLLRNAIDHGVESPEARRARGKPAEASVTLEARHSAGSLLVSVIDDGPGVDM
FT                   DALRAAIVRQHLTDDETAARLSDPELLEFLLLPGFSMRDAVTDVSGRGVGLDAVQEMVR
FT                   SVRGAVRIFNEPGAGMRFVLQLPLTLSVIRSLLVDVGGEPYAFPLAHVRRTLELAHEDI
FT                   DVLEGQPHFPFDGRRAGLVAAHQLLDAGEPDASRASTAVVVVGGEPELYGVAVDRFLGE
FT                   RMLVVQPLDSRLHKIQNIAAGALLENGDPVLIVDVEDLIRSVDKLVRGGQLAKLTRDPQ
FT                   LAHADRRRRVLVVDDSLTVRELERKLLEKRGYDVTVAVDGMDGWNAVRGEAFDLVVTDV
FT                   DMPRMDGIELVTLIKNDPLLQRVPVMIVSYKDRDEDRRRGLDAGADYYLAKSSFHDEAL
FT                   LDAVHDLIGDARG"
FT   CDS_pept        407435..408460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="BMULJ_03573"
FT                   /product="chemotaxis family response regulator"
FT                   /note="COG2201: Chemotaxis response regulator containing a
FT                   CheY-like receiver domain and a methylesterase domain,
FT                   Pseudomonas aeruginosa"
FT                   /note="CheB protein"
FT                   /note="KEGG, K03412"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03573"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45445"
FT                   /db_xref="GOA:A0A0H3KJR1"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJR1"
FT                   /protein_id="BAG45445.1"
FT                   /translation="MNIGIVNDLPLAVEALRRVLAQRPDHRVLWVASDGDEAVDFCVAH
FT                   PPDLVLMDLVMPRLDGVAATRAIMARAPCAILIVTASVSANTSSVYEAMGAGALDAVDT
FT                   PTLALGLSADAPPQPLLAKIDQIGRLLDSRAPAFVPLRPPVGAQRQPTLVAIGASAGGP
FT                   TALATLLRTLPADFPAAIVIVQHVDQAFALGMAEWLDGHTRLPVRVARHGCTPRAGEVL
FT                   LAATNDHLCLSSRGVLGYTREPADTPYRPSIDVFFDSVAECWRGDALGVLLTGMGRDGA
FT                   LGLKAMRAKGCYTIAQDEATSAVYGMPKAAAAIGAASAILPLDRIAPQLIARVARRAAR
FT                   P"
FT   CDS_pept        408715..409956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03574"
FT                   /product="putative chloride channel protein"
FT                   /note="COG0038: Chloride channel protein EriC, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03574"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45446"
FT                   /db_xref="GOA:A0A0H3KJR0"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJR0"
FT                   /protein_id="BAG45446.1"
FT                   /translation="MFFSTSADLFATVRYVCRWLALSALLGALAGSASALFLIALDWAT
FT                   GTRVAHPWLLRGLPAAGFATGWVYHRFGQPVARGNNLLIDEIHDPKALVPKRMAPLVLV
FT                   ATVVTHLFGGSAGREGTAVQMGGALADRVTHAFRLDREHRRVLLMGGIAAGFSSVFGTP
FT                   LAGAVFGLEVLAIGRLRYDALLACVASAIVADVVCRAWGVHHTVYAVPFVPAVSAAGLA
FT                   ATVVAGIAFGVVGRLFAHATHALAAGFRRTIRYAPLQPVLGGVLVAAAATALNVPQYLG
FT                   LGIPTIEAAFRGPLPVYDFAGKFAFTVVTLASGFKGGEVTPLFYIGATLGNALGQVLAL
FT                   PVPVLAALGFVAVFAGAANTPIASTIMAIELFGADIGVYAIVACVVAYLFSGHAGIYRA
FT                   QRVAVGKGAQAGPE"
FT   CDS_pept        complement(410075..411955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03575"
FT                   /product="phosphate-transporting ATPase"
FT                   /EC_number="3.6.3.27"
FT                   /note="COG1132: ABC-type multidrug transport system, ATPase
FT                   and permease components, Mesorhizobium loti"
FT                   /note="KEGG, K06021"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03575"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45447"
FT                   /db_xref="GOA:A0A0H3KPG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPG5"
FT                   /protein_id="BAG45447.1"
FT                   /translation="MRRATTHDQKPPPSGRPRIPGRLRFTFRYWRRQPARIAVVASFAL
FT                   LAALADVLTPLFAGRLVDALSAGLADRAAAWHAALVAFGTLAALGIGATLLRQGVYLNI
FT                   ITLTLKMMSEIAAASFHRVQRFSTDWHANSFAGSTVRKITRGIWALDLLNDTVLIALLP
FT                   SVTMLVGATVLLGTHWPVMGLVVGAGSLLYITVTVAVSLGIVAPAARLGNLWDTRMGGA
FT                   LADAVSCNAVVKAFGAETREEARLARVIGKWRQRTRRTWVRGTLNGGLQGAMLVAMQAA
FT                   MIGVALRLWANDEASVGDIAFALTMFFMLQGYLRDVGMHIRNLQRSVNDMEELVALERQ
FT                   PLGIEDRPNAPAIRIGEGEIRFEHVTFRYDNHPEPLYDDFSMRIAPGERVGLVGHSGSG
FT                   KTTFIKLIQRLYDVSGGRIVIDGQDIAQVRQDSLRSQIAIVQQEPVLFHRTLAENIAYA
FT                   RPDASRADIERAARLASAHDFIAALPDGYDTLVGERGIKLSGGERQRVAIARAFLADAP
FT                   ILILDEATSSLDSESEVLIQQAMERLMVGRTTLVVAHRLSTVRALDRLLVLDRGKVIEE
FT                   GSHDALIRIDGGVYRRLFERQALELAKGLADPPPRVADDQAGPLGQRATA"
FT   CDS_pept        412380..413261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03576"
FT                   /product="putative iron-dependent peroxidase"
FT                   /note="COG2837: Predicted iron-dependent peroxidase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K07223"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03576"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45448"
FT                   /db_xref="GOA:A0A0H3KK87"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK87"
FT                   /protein_id="BAG45448.1"
FT                   /translation="MSDVQHGILAPIDTAARYLTFTNSNDGNVAAALAALRECVDGRDT
FT                   VVGFGHSLAAYIGRPIPGLTEYPAFAVNDRTLPATPADIWVWLRGDDRGDLVLRSRAIE
FT                   RALAPAFVLQDAVDGFRYSNDRDLSGYEDGTENPVGDAARAAAIVSGQGAGLDGGSFVA
FT                   VQQWLHDFDRMERIAPHDMDHIVGRRRSDNEELDDAPAFAHVKRTAQESFEPEAFMLRR
FT                   SSPWSDARRAGLYFVAFGHSFRAFDVQMRRMSGADDGIVDGLFRFTRPLTGAYFWCPPM
FT                   KDGKLDLSAFGL"
FT   CDS_pept        complement(413355..413756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhfA"
FT                   /locus_tag="BMULJ_03577"
FT                   /product="putative redox protein"
FT                   /note="KEGG, K07397"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03577"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45449"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTK8"
FT                   /protein_id="BAG45449.1"
FT                   /translation="MSLIHAAATLDADAPDYVVRVQAGSHALTGDEGEREGGRNVGPAP
FT                   YEFVLAGLAQCTAATLRMYMQRKQWPAVRIDVHTELHADREGLQYVRRTVALDGTLDDA
FT                   QRQRLAEICEKTPVTLFIKRGTRIETTLR"
FT   CDS_pept        414173..415234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03578"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03578"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45450"
FT                   /db_xref="GOA:A0A0H3KJR5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJR5"
FT                   /protein_id="BAG45450.1"
FT                   /translation="MAQAARLGEAFNLANRLQAFGADYQPKYVSESGGLVTSSSGVRIA
FT                   VDPLGDEHARRAIAFFHLHGERASVRRDEALHRRLSEIRRHARWIVDAMDLPALAAPSV
FT                   PTRRNGSASQAPEARHAVSRAAELQQADTAVFTAVLDMFRADLGDSVAEEIASNLLRPV
FT                   EQRYVQSMWAFRELSASPPIRMSAQRLRVQSVERVSIAQIARTAAMSERNFLRRFKKEI
FT                   GVTPTEFLQHVRLERACHMLVHTMLPADKVARRTGFGSGERLAKLFRQRMLMSPTEFRV
FT                   AERERMLANGAALPAPEIARVDGVPPSHRIVRDDAHEKTGRISVKSPYRDFEPRFPCAS
FT                   SPPPLLRRSARRK"
FT   CDS_pept        415183..416499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03579"
FT                   /product="Nramp family metal ion transporter"
FT                   /note="COG1914: Mn2+ and Fe2+ transporters of the NRAMP
FT                   family, Ralstonia solanacearum"
FT                   /note="KEGG, K03322"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03579"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45451"
FT                   /db_xref="GOA:A0A0H3KJR3"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJR3"
FT                   /protein_id="BAG45451.1"
FT                   /translation="MRFLPTTATAPFCPSEVKGSITIEAGASRWLKLKRFFGPGLLVAI
FT                   GYMDPGNWATDIQAGSQFGYALLWVVALSSVSAIFLQMLAARLGLVAGRDLAQASYDRY
FT                   GPFGRVVQWLTAEVSIIACDIAEVLGCALAFKLLLGVPLAWGIVLTALDTVIVLGLQGK
FT                   GVRQIEAIVLALIATMAFCFVAQVAITPPDWRAVAAGLVPGAPSHDRHDAIVLALGIVG
FT                   ATIMPHNLYLHSSVVQTRRVIGGARGTIRDTLALVRIDTCVSLFVAMLVNAAILIVAAA
FT                   AFHATGQTHVTDIEQAYSLITPIAGGAAALLFGIALLASGQSSTLTGTIAGQVIMDGFL
FT                   HMKIPCYQRRLITRGLALVPALIGVLWLGEHSVGQLLVWSQVLLSLQLPFAMWPLIRSV
FT                   SDRATMGEHTIGRGMQALAWVLFAAITGTNLLLIGGVAG"
FT   CDS_pept        416580..417170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03580"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45452"
FT                   /db_xref="GOA:A0A0H3KPH0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPH0"
FT                   /protein_id="BAG45452.1"
FT                   /translation="MWSQISNIGDAALTLPIALTCAGWLAVSNWRLAVRWIALLAAGMA
FT                   LVGATKILYAGCGVALPAFDFRMISGHTMLSTSVWTVALAMLWHAFRPGSAPGVAAGLA
FT                   IGAITAVARVFDDSHTVPEVIAGWLLGALVALVFVRAYVRAPKRSFSPGAAAVCLLLVS
FT                   GIAYGHRAPFQQMIDTHSPQLCAFVHPAQAGRS"
FT   CDS_pept        417283..418071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BMULJ_03581"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Caulobacter vibrioides"
FT                   /note="KEGG, K00059"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03581"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45453"
FT                   /db_xref="GOA:A0A0H3KK92"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK92"
FT                   /protein_id="BAG45453.1"
FT                   /translation="MTAVSPRLAGKCAYITGAAGGLGRAIARQMVEQGARVFLTDVADR
FT                   AALDAFAAELNAGHATPVAFAAEQDVRDEARWQTLLAQANDAMGALSVLVNNAGVGSLA
FT                   APAQIELDEWRRVMAVNVESIVLGCKHALPYLSASRPASIVNISSVAAFKVEPDFTAYN
FT                   ASKAAVASLTKSIAIDCARRELDVRCNSIHPAFIRTGIMEPLFRTLGERDATRRLARGI
FT                   PLRRLGEPDDVAHAAVYLASDESRFMTAAELVLDGGMCAV"
FT   CDS_pept        418248..418751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03582"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTL1"
FT                   /protein_id="BAG45454.1"
FT                   /translation="MRTNGKRHACAARGRLTRCGGASVWQAACAALGAVLTIANAAAAP
FT                   AAASSGVVRFTGALVDRYDVTLDRAPVATVDRQRTAATLRVDAQGRRLPGAQLTLIGAD
FT                   GAPLAEPARSRVQAVWREAGRSRAVPVERGMQRVGPHGGTLTLAVPDDAGGAPVPVIVR
FT                   IAHP"
FT   CDS_pept        complement(418783..419835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03583"
FT                   /product="putative permease"
FT                   /note="COG0628: Predicted permease, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03583"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45455"
FT                   /db_xref="GOA:A0A0H3KJS0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJS0"
FT                   /protein_id="BAG45455.1"
FT                   /translation="MDSGHDHQKFFYFLLFAVTVGLCWVLAPFFGAVFWGTILAILFQP
FT                   VQRWLAARFGKRRNLAALLTLTLIILIVILPLVFVTATLVQEIAYVYQELKDAQPNYSK
FT                   YFQDVIHALPTSVQHLLAKYGLTNIPGIQKKLTDGAAAISQFAAAQALSIGQNTFQFIV
FT                   SFGVMLYMVFFLLRDGGEIGRRVRRALPLDEEHKNLLLAKFTTVVRATVKGNIAVALVQ
FT                   GILGGLIFWILGIQGVVLWGALMAFLSLLPAIGASLVWVPAALYFLATGAVWKCVILVA
FT                   FCVGVIGLVDNLLRPILVGKDTKMPDWVVLISTLGGMALFGINGFVIGPLVAALFMASW
FT                   DIYARAEQEA"
FT   CDS_pept        complement(420071..420655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03584"
FT                   /product="putative lipoprotein"
FT                   /note="COG2930: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03584"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45456"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJR7"
FT                   /protein_id="BAG45456.1"
FT                   /translation="MQKSLAMKAAAAVMLGSLALAGCTTTPNKSDTASTSASKRESIDA
FT                   SVNATLSRLYSTVPGSRDLVAKARGVLVFPNVLQAGFIVGGQSGNGALRVGGSTVGYYN
FT                   TSSLSVGLQAGAQSKAIVFLFMTQQALDEFRNSDGWSAGAGASVALVKTGANGAVDTNT
FT                   ATAPVQVIVLTNAGLMGDVSVNGTKVTRLHI"
FT   CDS_pept        complement(420708..421094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03585"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03585"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45457"
FT                   /db_xref="GOA:A0A0H3KPH5"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPH5"
FT                   /protein_id="BAG45457.1"
FT                   /translation="MALTDSIEHKLDRGLSEVRRTGRRVGRTTRSAARDLQADVQDDLR
FT                   GLVDELEDLLKNDGDGDIAALRKRVQARLDEARSTLDYASGTAAARLRDSAERVSQVVH
FT                   ENPWQTAGVVAGLAFVAGLLLARR"
FT   CDS_pept        421677..422030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03586"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45458"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK98"
FT                   /protein_id="BAG45458.1"
FT                   /translation="MSYMLLIVEPTDQRAERTLEEGQALYARMVDFAESLKARGVLRAV
FT                   ESLERSERGTRVQVRDGETRIVDGPFAEAKEMVGGFFLVDVETRDEALDIARACPAAQW
FT                   CTVEVRAVGPCFL"
FT   CDS_pept        422180..422602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03587"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3795: Uncharacterized protein conserved in
FT                   bacteria, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03587"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45459"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTL3"
FT                   /protein_id="BAG45459.1"
FT                   /translation="MRFMIMVRANAVSESGALPDDRLVEAMTVYHEELAKAGVLLDATG
FT                   LQPSAQGWRVRYTRGKGTVIDGPFAETKELIAGYTLIQVRSREEALEWTRRFPAPFGAE
FT                   MDAEIEVRPLLELDDLTPSDAVERFRDIQAGLGHAV"
FT   CDS_pept        422628..423044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03588"
FT                   /product="predicted lactoylglutathione lyase"
FT                   /note="COG3607: Predicted lactoylglutathione lyase,
FT                   Bacillus halodurans"
FT                   /note="KEGG, K07032"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03588"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45460"
FT                   /db_xref="GOA:A0A0H3KJS3"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJS3"
FT                   /protein_id="BAG45460.1"
FT                   /translation="MHNAIFVNLPVTDLPRAQTFYRALGFAIEPAYTTDQAACLRIGDA
FT                   IFAMLLVRPFFQTFTDKTIVEPATHVQILPCLSCESRDEVDRVVAAARAAGGTVPDAPD
FT                   EYPGMYGHAFTDPDGHAWGLIHVEPGAHAAAEAS"
FT   CDS_pept        423041..424309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03589"
FT                   /product="ECF subfamily RNA polymerase sigma-70 factor"
FT                   /note="COG4941: Predicted RNA polymerase sigma factor
FT                   containing a TPR repeat domain, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03589"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45461"
FT                   /db_xref="GOA:A0A0H3KJS2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJS2"
FT                   /protein_id="BAG45461.1"
FT                   /translation="MTHDATHRAIEAVWRIEAPKIIARAARVVRDVGVAEELAQDTLVA
FT                   ALEHWPVDGVPDNPAAWLMTAVKRRALDRVRQEALHATKRSQLGHELDALEAHVVPDIA
FT                   DALADARDDDIGDDLLRLIFTSCHPVLSTDARVALTLRLLGGLTTGEIARAFLTPEPTI
FT                   AQRIVRAKRTLAAARVPFEVPAADARPARLASVLEVIYLIFNEGYAATAGDDWMRPALC
FT                   DEALRLGRVLAGLAPNESEALGLVALMELQASRMHARTDAQGRPVLLLDQDRSRWDPLL
FT                   IRRGLAALERATKLGGVRGPYALQAALAACHARARRAADTDWAQIVALYDALVEVAPSP
FT                   VVELNRAVAVGMAFGPAAALELVDALRDDPALARYHWLPSVRGDLLAKLGRADEAKAEF
FT                   RRAAALTRNERERELLLKRATDA"
FT   CDS_pept        424497..424919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03590"
FT                   /product="putative oxidative stress-related rubrerythrin
FT                   protein"
FT                   /note="COG1592: Rubrerythrin, Sulfolobus solfataricus"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45462"
FT                   /db_xref="GOA:A0A0H3KPH8"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPH8"
FT                   /protein_id="BAG45462.1"
FT                   /translation="MAELKGSKTEENLKAAFAGESQANRRYLYFASKADVEGQNDIAAL
FT                   FRSTAEGETGHAHGHLEYLETVGDPATGLPFGSSRLNLESAIAGETHEYTDMYPGMAKT
FT                   AREEGFDEIANWFETLAKAERSHANRYTKALEGLVD"
FT   CDS_pept        425009..426346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpC"
FT                   /locus_tag="BMULJ_03591"
FT                   /product="glycerol-3-phosphate dehydrogenase subunit C"
FT                   /EC_number="1.1.5.3"
FT                   /note="COG0247: Fe-S oxidoreductase, Sulfolobus
FT                   solfataricus"
FT                   /note="KEGG, K00113"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03591"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45463"
FT                   /db_xref="GOA:A0A0H3KKA3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKA3"
FT                   /protein_id="BAG45463.1"
FT                   /translation="MPHKEGSLEAPTRHPLDWQSDAFYDQAAIDAEMTRVFDICAGCRR
FT                   CVSLCGAFPSLFDLVDDTPSGDIEEVPKQAFGNVVDQCYLCDLCYMTKCPYVPPHAWDV
FT                   DFPHLMLRAKAARYKRGEVALRDKVLSNTDALGHLAGIPVVTQTVNAVNRTPPARHALE
FT                   AVLGVDRRAWLPEFAPRTFRRSAARSSAPPVRDGERTPGKVAVYATCYVNFNEPGIGHD
FT                   LLAILAHNDIPYELVTREACCGMPMLEQGNLAGVAAKKAANVPVLERYARDGYALLGAI
FT                   PSCVLMYKSELPLMFPDDAAVRAVADAFWDPFEYLIARHRDGLLKTDFTQALGTVSYHV
FT                   PCHARVQNIGRKTADALSLVPDTRVKVVERCSGHAGTFGVKKAFHADAMRIGGPVFAAM
FT                   AEPQPDVIASDCALAGHHIAQGIDEKGLPAAPLAHPLTLLRRAYGI"
FT   CDS_pept        426371..426952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03592"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03592"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45464"
FT                   /db_xref="InterPro:IPR021890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTL6"
FT                   /protein_id="BAG45464.1"
FT                   /translation="MTLTRDSLLTLEAYAKIRKAEHARLVAYKRRRAVPLGNHLRFLFE
FT                   DETTIRYQIQEMLHIEKIFDEAGIEGELEAYLPLVPDGTNLKATMQIEYEHEAERRAAL
FT                   ARLIGIEDRVYVQVDGHAPVYAIADEDLERDNAQKTSAVHFVRFELSAPMRAALKGGAA
FT                   LSIGCDHPAYTLPAQPIDRDVTASLVGDLR"
FT   CDS_pept        427565..428497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03593"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45465"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJS7"
FT                   /protein_id="BAG45465.1"
FT                   /translation="MFFDELNDEEWFRLSPLIADEPIRLNRRGRPRAEPRVVANAVLWI
FT                   LTTGEAWSKLPGRYPSGPTCRRRYEEWLANGTLLQMIDVLTQFSGRTFAYVPPPPAPAA
FT                   PACPAEPAPEAARLRGVFWQNPESWQLPVAQSSAWNGEGASQVAPRDEEEAPRRTSFAV
FT                   PGSPLRHARVSSASFGSAEPQIDEYRGYTIYGIAQPVQNLMYRAWAEIVQDDRRVERSG
FT                   LIGPRFTDPEEAEQYALDWARQWVDRHGASDTPLRAPQNEVIAGLSALARAESDIKRFI
FT                   AERRSSGALAESRNDPVQGDRHEYAYRVG"
FT   CDS_pept        complement(428598..430124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="BMULJ_03594"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.22"
FT                   /note="COG0836: Mannose-1-phosphate guanylyltransferase,
FT                   Yersinia pestis"
FT                   /note="KEGG, K00971"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03594"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45466"
FT                   /db_xref="GOA:A0A0H3KJS5"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJS5"
FT                   /protein_id="BAG45466.1"
FT                   /translation="MNAPTVTADTHDVAAAAPAVGTRVAVQPVILAGGSGTRLWPMSRE
FT                   HYPKQLIGLLGDHSLLQSTALRLDGLTAGHPLNDDVLIVCGEDHRFTTAEQLRLTGKRA
FT                   SILLEPIGRDTAPALTLAALKIVASGDDAVMTVMPADHAVADLPRFHAAVAAGVHCAAQ
FT                   GRIATMGIVPDRAETGYGYIRVGAPLGDAGTGTLDVRRLDRFVEKPHLELAQQYVASGE
FT                   YWWNSGIFIVRASVWLNAIRELEPAIYAACEQAIAQGRDDGDFFRVDRDAFAASPSNSI
FT                   DYAVMEPLANRPSLCESVVVPLDAGWSDVGSWDAIWQILPKDDADNVGRGHVLFENADS
FT                   TFAHAESRLVACVGTHNLVVVETPDAVLVADKSRVQDVKKIVGRIKAEHGAEATDHRKV
FT                   HRPWGHYDSVDMGERFQVKRIVVKPGARLSLQMHHHRAEHWIVVRGTARITRGDETFLL
FT                   SENESTYIPLGVSHRLENPGKMPLELIEVQSGAYLGEDDIVRFDDTYGRQ"
FT   CDS_pept        430555..431928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wcaJ"
FT                   /locus_tag="BMULJ_03595"
FT                   /product="putative colanic acid biosynthesis UDP-glucose
FT                   lipid carrier transferase"
FT                   /note="COG2148: Sugar transferases involved in
FT                   lipopolysaccharide synthesis, Escherichia coli K12"
FT                   /note="KEGG, K03606"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03595"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45467"
FT                   /db_xref="GOA:A0A0H3KPI2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPI2"
FT                   /protein_id="BAG45467.1"
FT                   /translation="MLSVLARVIDIAMVVAGALLAAALHRGNVWFSDLQRTMVLFDCLL
FT                   VVVCFPAFGIYQSWRGKRLVGLMGRVAFAWLVVELAGILMSFSFHQSGELSRLWLGYWA
FT                   IATVTLLAGSKACVHAVLRRLRRGGFNLKAVAIVGGTPAARRLIAQMRARPEAGFNPVC
FT                   VYDEDAAPGDVALDDVRIERQFESLVWLVRSRAIRELWLTLPISEERRIHQIVTVFRHD
FT                   FVNIRFIPDVRSLSFFNQEVVEVLGVPAINLAASPITDVRILPKFVFDRMFALAALVML
FT                   APLMLVIACLIKATSPGPVFFRQKRKGIDGHEFEIYKFRSMKVHQEAAGTVTQATKNDS
FT                   RVTPVGRFLRRTSLDELPQFINVLKGEMSVVGPRPHALAHDDIYKDLVKGYMFRYRIKP
FT                   GITGWAQINGYRGETDQIEKMMGRVKLDLYYMQNWSFWLDIKIVALTLWKGFTGSNAY"
FT   CDS_pept        431990..433402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="BMULJ_03596"
FT                   /product="UDP glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COG1004: Predicted UDP-glucose 6-dehydrogenase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00012"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03596"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45468"
FT                   /db_xref="GOA:A0A0H3KKA8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKA8"
FT                   /protein_id="BAG45468.1"
FT                   /translation="MNLTIIGSGYVGLVTGACLADIGHDVFCLDVDQAKIDVLNDGGVP
FT                   IHEPGLKEVIARNRAAGRLRFSTDVEAAVAHGDVQFIAVGTPPDEDGSADLQYVLAAAR
FT                   NIGRYMKGFKVIVDKSTVPVGTAERVRAAVAEELAKRGDDSMFSVVSNPEFLKEGAAVD
FT                   DFTRPDRIVIGCDDDVPGERARELMKKLYAPFNRNHERTLYMDVRSAEFTKYAANAMLA
FT                   TRISFMNELANLADRFGADIESVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRT
FT                   ADEHGHTLQILKAVSSVNAAQKRVLAEKIVARFGEDLTGRTFGLWGLAFKPNTDDMREA
FT                   PSRELIAELLSRGARVAAYDPVAQREARRVLALDLADRPAWLERLSFVDDEAQAARDAD
FT                   ALVIVTEWKAFKSPDFAALGRLWKAPVIFDGRNLYEPDTMSEHGIEYHPIGRPGSRQAV
FT                   AARAPGAARASA"
FT   CDS_pept        433444..433887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="BMULJ_03597"
FT                   /product="protein-tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="COG0394: Protein-tyrosine-phosphatase, Salmonella
FT                   typhimurium LT2"
FT                   /note="KEGG, K01104"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03597"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45469"
FT                   /db_xref="GOA:A0A0H3KTL7"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTL7"
FT                   /protein_id="BAG45469.1"
FT                   /translation="MFRNILIVCHANVCRSPAAEMLFKSHAASRGGPRATFHSAGVRAN
FT                   DGDGIDPVMRRLLAERGVDATTHRSRRLSRRIVRDADLILVSERAQIAAVEAIDPFARG
FT                   KVHLLGKWEDAEIADPHGGPEADYRESYSLIERLVQGWLQKLC"
FT   CDS_pept        433881..435059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wza"
FT                   /locus_tag="BMULJ_03598"
FT                   /product="polysaccharide export outer membrane protein"
FT                   /note="COG1596: Periplasmic protein involved in
FT                   polysaccharide export, Ralstonia solanacearum"
FT                   /note="KEGG, K01991"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03598"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45470"
FT                   /db_xref="GOA:A0A0H3KJT1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJT1"
FT                   /protein_id="BAG45470.1"
FT                   /translation="MLKRSMRPVALAVALTTFLSACATAPGNYLDSSNLKDDGRQGQPE
FT                   TYPVHYIDAKLVMDQLQKQQVEHPLPPGRYTDPSQYVYHVGPQDILGVTVWDHPELTTP
FT                   QGQSFSSGGNTTQTVAGALQQPYTSALPGQADPYGQTVAADGTIYFPFVGRIRAAGKTV
FT                   GQIRDELSSRLARYVKNPQIDVRVLSFRSQKVQVTGEVKQPGPLAVSDVPLTLVDAISR
FT                   SGGSTAEADLQRVRLTRDGKLYTLDANGVLDRGEVQQNVMLQPGDIINVPDRSDSRVFI
FT                   MGEVKTPVTVPMLKGRLTIADALTAGGGILDTDANPRKIYVMRGMRDNPTKPEVFRLDM
FT                   TQPDALMLSSRFPLQPLDVVYVSTAGSVQFNRVLQQVLPTIQTIFYMRQITR"
FT   CDS_pept        435125..437350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03599"
FT                   /product="protein-tyrosine kinase"
FT                   /EC_number="2.7.10.-"
FT                   /note="COG3206: Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis, Ralstonia solanacearum"
FT                   /note="KEGG, K00903"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03599"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45471"
FT                   /db_xref="GOA:A0A0H3KJS9"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJS9"
FT                   /protein_id="BAG45471.1"
FT                   /translation="MVNTQAKHSYADPTAKTDEEDVVLGQLLQVILDDIWLLLGIAVAV
FT                   VALAGLYCYVAKPVYQADVHVRVEGNDNTTQALTQTQTGAMINSGPQQAPTDAEIEIIK
FT                   SRGVVAPVVEQFKLNFSVVPKTIPLLGSLTARLATPGEPARPWLGLKSYAWGGEVADID
FT                   SINVVPALEGKKLTLTAGPNGNYVLTDENGMRLLTGRVGESAQGGGVTLLVQKLVARPG
FT                   TQFTVTRYNDLDAITGFQSGIQVSEQGKQTGVVQISLEGKDPEQTAAIANALAQSYLHQ
FT                   HVIAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQRTSGSINASDEAKVYLEGSVQ
FT                   YEQQIAAQRLQLASLAQRFTDSHPLVIAAKQQLAELQGEKEKFSNRFRSLPATEVKAVQ
FT                   LQRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLIDSALRPGAPVKPKKVLILSAAVF
FT                   LGLILGTGVVFLRRNLFQGIEDPDRIERAFNLPLYGLVPQSAEQAKLDAAAEKSGGRTR
FT                   PILASLRPKDLSVESLRSLRTAMQFAMMDAKNRVIVLTGPTPGIGKSFLTVNLAVLLAH
FT                   SGKRVLLIDADMRRGVLDRYFGLTAQPGMSELLSGQSALEEAVRETPVQGLSFIAAGTR
FT                   PPNPSELLMSARLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMH
FT                   TAGEIADAIKRLRTAGVDLEGGIFNGVAPKTRGYGRGYAAVHEYLSA"
FT   CDS_pept        437413..438372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03600"
FT                   /product="putative glycosyltransferase"
FT                   /note="COG0463: Glycosyltransferases involved in cell wall
FT                   biogenesis, Nostoc sp. PCC 7120"
FT                   /note="involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45472"
FT                   /db_xref="GOA:A0A0H3KPI6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPI6"
FT                   /protein_id="BAG45472.1"
FT                   /translation="MKISVLVPTYRRPADLARCLLALQRQQRLPDEVIVVARPEDDATH
FT                   ERLADPAVGGGLPLRIVPVDVPGQVAALNKGLDTASGDIVAITDDDAAPRVDWLARIEA
FT                   AFAADPRVGAVGGRDWVHEKGRVLDESRECVGRLTLSGKIIGNHHLGVGGAREVDTLKG
FT                   ANMSYRRAAIARLRFDTRLRGAGAQTHNDTAFSMEVQRAGWKLMYDPAIAVDHYPAERF
FT                   DDDRRDAASLNAIANGAYNLQLTLREHLPPLRREIAWWWWTLVGTRVYPGLAHLLLALP
FT                   TSRRARVLAHWRAVRRGARDARRTTVAPRRAAMPPVTP"
FT   CDS_pept        438419..439558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03601"
FT                   /product="putative glycosyltransferase group 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03601"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45473"
FT                   /db_xref="GOA:A0A0H3KKB1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKB1"
FT                   /protein_id="BAG45473.1"
FT                   /translation="MTATKVHVHLFYGADPRTYRKGDNIGCLYGYHHAESDEFRLTYSA
FT                   DRREPRVVGIARRALKAALGFDIVHAWRNRAALLNADVIWTHTEQEHLAAALILKLAGA
FT                   QGKRPLLLAQSVWLFDKWQSFGGPRRWLYRKLLARADVLTTLARDNAALCRRYLGRDAE
FT                   FVYYGLNTQDFPIRDPQPWQPHRPLRIAAIGNDRDRDWRTFLAAFGGDERYEVRLATRR
FT                   RVPRAWHAPNVAIGSASGLAKQHELYAWADVIVVPLRPNFHASGITVMLEAAALGKPMI
FT                   VSDVGGLTDYFPHDTAAYVPPFDAQAMRDAADRFAAEPLAALACARAAVERLRACDLTT
FT                   QAFAEQHVRITRELLRRRRTPAAAAGVAMPLADSRPSSR"
FT   CDS_pept        439555..441021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03602"
FT                   /product="probable glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03602"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45474"
FT                   /db_xref="GOA:A0A0H3KTL8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTL8"
FT                   /protein_id="BAG45474.1"
FT                   /translation="MSTLAAEHAPARKRSRFAEPTQWAGQAALWTITAALIAAHQGRVL
FT                   TFAFPVLAIAVGIWLYFKSPARYVGFMWWVWFLSPEVRRLADWSKGAFTPTSLIQVAPL
FT                   AVTMIAAFGLLRHYRVLAQRRGIPVLLILFGLTYAYLVGIVSSGLMAATYDLANWLYPV
FT                   LIGFHIMVNARNYPAYRDVLLSTFIWGMLVMGVYGIVQYFVMPQWDVLWMVGSQMGSQG
FT                   EPVPYGVRVFSTMNSSGPFAFAMMGALVFVLVAPQKIRWFAGAAGFVSFALCLVRSTWG
FT                   GWVIALAIQLVQSSNRVRMRILISGVVLVGLCVPLLTVGPVADRLGQRLQSIVNLKDDR
FT                   SYDDRNKFYATFAETAFTDVAGEGMGATGASTKLSSDSGELGKYGSFDSGVMNVPFVLG
FT                   WPGTLLYLAGFVMLLGRTVRASFRLRDDKFVGACLSLCLSVFAMLVFTNSLIGTGGLLL
FT                   FTAIFSILSAAHWQRLQRLPAAARLRGDDH"
FT   CDS_pept        441018..442202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03603"
FT                   /product="putative glycosyltransferase"
FT                   /note="COG0438: Glycosyltransferase, Nostoc sp. PCC 7120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03603"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45475"
FT                   /db_xref="GOA:A0A0H3KJT4"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJT4"
FT                   /protein_id="BAG45475.1"
FT                   /translation="MRIAIVTHVVRHNDGQGRVNYEIARAALAEQCEVTLVASHVAPEL
FT                   LADPRVRWVPVKVGRFWPSNLVRQQVFALKSAWWLRTHRDAYDVLHVNGFISWIKADVN
FT                   TAHFVHGGWFKSPYYPFALTKGLWSAYQYVYTRVNTALERWAYRRSRAITAVSQKVADE
FT                   IAALGIDRSKIGVIYNGVDGSAFAGAQADRAAFDLPPDAFLLLFVGDLRTPRKNLGTVL
FT                   KALTKLPEHVHLAVAGYLPGSPYPDEARALGLGARVHFLGLVKNMPTLMRSVDAYVFPS
FT                   RYEAMSLSLLEAMAAGLPVVTARTAGGAEIITRDCGIVLDDPDDPDALAQAIDLLAASR
FT                   DTCRAMGAAARELMTRFGWAHMGAQYVALYRRIGQPPQPSAFARVEHAVTQEQS"
FT   CDS_pept        442202..443368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03604"
FT                   /product="phosphatidylinositol alpha-mannosyltransferase"
FT                   /EC_number="2.4.1.57"
FT                   /note="COG0438: Glycosyltransferase, Nostoc sp. PCC 7120"
FT                   /note="KEGG, K08256"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03604"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45476"
FT                   /db_xref="GOA:A0A0H3KJT2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJT2"
FT                   /protein_id="BAG45476.1"
FT                   /translation="MSSSSRPIKSLQIGMHWFPERAGGLDRMYYSLVGALPGAGVEVRG
FT                   LVAGSPKVADDTGGAIQGFGPASQPLARRMLAARRALRDEIRSARPDVISSHFALYTFP
FT                   GLDVTRGIPQVSHFQGPWADESQVEGAASLGQRAKRYLEQAVYARSSRLIVLSQAFGQI
FT                   LTQRYGIDPSRVRVIPGCVDTAQFDTPLTPAEARQRLQLPQDRPIVLAVRRLVRRMGLE
FT                   DLVDAIGIVKRRHPDVLLLIAGKGKLAEELQQRIDAAGLQDNVKLLGFVPDQHLAALYR
FT                   AATVSVVPTVALEGFGLITVESLASGTPVLVTPVGGLPEAVAGLSSDLVLPSTGADAIA
FT                   EGLGAALSGAIALPDEAACKRYAREHFDNAVIARRVAGVYEEAIHAAG"
FT   CDS_pept        complement(443532..444761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03605"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03605"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45477"
FT                   /db_xref="GOA:A0A0H3KPJ1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPJ1"
FT                   /protein_id="BAG45477.1"
FT                   /translation="MTSSCSSGAAACGAGPCANRLSTARVALLATCCAASVANVYYAQP
FT                   LLDAIARDFTVPAAAIGAVVTATQLGCALALLFVVPLGDRLNRKRLLAVQLVLLAAACV
FT                   GVAAASTRIALLVGMVAVGLLGTAMTQGLIACSAALAGAGERGRVVGAAQGGVVIGLLA
FT                   ARSVAGAVTDVAGWRAVYLVSGALAIAMLVVLSRLLPDTDAPRERIGYAALLRSMASLL
FT                   RDERPLRVRGAIALLMFAAFSIFWSALVLPLSAPPHAMSHTQIGAFGLVGALGAAAAAR
FT                   AGRLADRGYGQATTGAALALLVASWLPLAFGQTSIALLIVGIVLLDVGGQAVHVVNQSM
FT                   ILGVRPDAHARVVGCYMLFYSAGSGLGAIASTSMYAYAGWSGVCVLGATVSTAALVVWA
FT                   ATLERKRAPA"
FT   CDS_pept        444829..445386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03606"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1733: Predicted transcriptional regulators,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03606"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45478"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKB5"
FT                   /protein_id="BAG45478.1"
FT                   /translation="MQLVVRRARGPRTNRRCRRVGAGRPAEEKMARQKSLADSHCPVAR
FT                   ATDIVGDRWALLIVRDAFDGVRRFGDFRTSLGVASNILSDRLRMLVEAGVFDVVPASDG
FT                   SAYQEYVLTKKGEGLFPVIVMLRQWGEANLFARGEPHSVLVDRKTGRALRKLALRHDDG
FT                   RPLKPADTFVKKVGDAGDATPR"
FT   CDS_pept        complement(445444..446877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmr"
FT                   /locus_tag="BMULJ_03607"
FT                   /product="methylenomycin A resistance protein"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Caulobacter vibrioides"
FT                   /note="KEGG, K08166"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03607"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45479"
FT                   /db_xref="GOA:A0A0H3KTL9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTL9"
FT                   /protein_id="BAG45479.1"
FT                   /translation="MDTATPAFPRTLARIVATVSVGFVVTQLDVTIVNIALAHMAAALH
FT                   LSVAGLQWVVDAYTLAFAVLMLSAGALGDRFGARRLYVAGLALFALASLACGAAVAPAM
FT                   LIAARAVQGVGAAAMLPNSLALLNDACRHDPALRARAVGAWTAAGSVSIAAGPVLGGAL
FT                   IAAFGWRSIFLVNLPLCAAGLAAAFAWTPVDRAAASPAPQARTLDVRGQLVAIAMLTAL
FT                   TGAVIEWRPLGLAHPVVAGGFVLAVLAAAAFIAIESRTATPMLPLALFRRRTFSAAVLF
FT                   GICVNLTYYGTVFVIALYLQRVRGESALQAGLAFLPLTGGFLLANLASGRAVARYGPRA
FT                   PMLAGALVAALGYGSLHFVDGSTPLPALLVPFVLIPSGMGFAVPAMTTAVLASVEPARA
FT                   GIASAVLNTARQAGGAIGVAAFGAVAGSGGAVPVVDGLRIDTGVSVALLIAAALLATRV
FT                   RPDAHRDAHGGRRPLQTTD"
FT   CDS_pept        complement(447043..447813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03608"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03608"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45480"
FT                   /db_xref="GOA:A0A0H3KJU0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJU0"
FT                   /protein_id="BAG45480.1"
FT                   /translation="MERIASPAVSLRRYDACEASDVHDFHQIVLGVDGAMVMAVDGVGR
FT                   RIDRHAAWLIPAGARHDYAGLGDNRQLVLDLPAASLAVPQRLFDRARAVAIDPSLSALV
FT                   ARVAAAAAQLDDAPAADAQHARRFQWQAAARLCDALLDDAGIGAPASGLDFARIDRWLR
FT                   ARLAEPLRIADLAAHCGYGMRRFHQLFVEAFGETPHRYLLRLRLDTALVLLADGRHPLV
FT                   DIAGLVGFADQSTFTHAFTKRFGVAPGRWRGERH"
FT   CDS_pept        complement(447845..448186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03609"
FT                   /product="peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="COG0545: FKBP-type peptidyl-prolyl cis-trans
FT                   isomerases 1, Ralstonia solanacearum"
FT                   /note="KEGG, K01802"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03609"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45481"
FT                   /db_xref="GOA:A0A0H3KJT6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJT6"
FT                   /protein_id="BAG45481.1"
FT                   /translation="MSVITTASGLKYEDLTEGTGAEAQAGQTVSVHYTGWLTDGQKFDS
FT                   SKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGVRGAGGVIPPNATL
FT                   VFEVELLAV"
FT   CDS_pept        448754..449665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03610"
FT                   /product="putative metal-dependent hydrolase"
FT                   /note="COG3687: Predicted metal-dependent hydrolase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K07044"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45482"
FT                   /db_xref="GOA:A0A0H3KPJ3"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPJ3"
FT                   /protein_id="BAG45482.1"
FT                   /translation="MKSAAAATAADVMPVRRDLRFDLPVERAKDWHGLGSHVTHFFNAL
FT                   SLLFPAGERFFMDSVRHYRDRIDDPVLKRQVLGFIGQEAMHTREHVEYNELMQANRLPA
FT                   RKLDRRVWKVLGFMKRVLPHSVQLAHTVAAEHYTAMLADWILRDPTRLDGSVDGYRQMW
FT                   IWHALEETEHKAVSFDVWNSVMAPGLRRYLIRIGVYLVTTLTFWPTVFLMHVTLLWRDR
FT                   AAPHPLRGLLRTIAFLYGPRHGLFPRIAGEWLSYFRPAFHPWDHDNRHHLARVDALVAA
FT                   YGDHDRAAAGRGRTAALASAAR"
FT   CDS_pept        450096..451577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03611"
FT                   /product="sigma54-dependent DNA-binding transcriptional
FT                   regulator"
FT                   /note="COG2204: Response regulator containing CheY-like
FT                   receiver, AAA-type ATPase, and DNA-binding domains,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03611"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45483"
FT                   /db_xref="GOA:A0A0H3KKB9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKB9"
FT                   /protein_id="BAG45483.1"
FT                   /translation="MVARSPDANRNAAPEMPPVSVTAPEAGRRLFAIMRTPDEPLLAQL
FT                   RGLGWEVSVAKTAGAAQNMTSGVGVAAGLIDFSGFTSRDYPALKACLSQPAIGWISIAQ
FT                   AGVTIGPAVRELIRSYCFDYVTLPLPYEWISHVLGHARGMAALDRVDGAAYAASIGEHG
FT                   MIGNCEAMQQLFSTIRKVAKTDASVFISGESGTGKELTALAIHERSGRGKGPFVAINCG
FT                   AIPHHLLQSELFGYERGAFTGATQRRAGRIESANGGTLFLDEIGDMPVESQASLLRFLQ
FT                   EGRIERLGGHESIAVDVRIISATHVDLDGAVEAGRFRADLYHRLCVLRIHEPPLRARGK
FT                   DIDILAHYVLQKYKADSGRKISGFTSAALDAMRRYEWPGNVRERINRVRRAIVMAESRL
FT                   LTPHDLGLDTPGETEPVTLEQARALAERVAIENALLRNDHRINKAAAELGISRVTLYRM
FT                   MIEHGLNEHDNAVDHGENGGKDATPPDDAGHCRVG"
FT   CDS_pept        452110..452358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03612"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTM0"
FT                   /protein_id="BAG45484.1"
FT                   /translation="MNDRHTPRPAGRDRSESGHRRSAVRVAAGRHAPTGHLSAPRARRI
FT                   RLSAGHPRRGGAFPFASRLRKGMCARAPMPRRPLFAY"
FT   CDS_pept        complement(452392..453174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03613"
FT                   /product="polar amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0834: ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain,
FT                   Salmonella typhimurium LT2"
FT                   /note="KEGG, K02030"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03613"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45485"
FT                   /db_xref="GOA:A0A0H3KJU4"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJU4"
FT                   /protein_id="BAG45485.1"
FT                   /translation="MKRLIAAVSIALLAVSAGPAVAKDWTTIRFGTDASYAPFESKAPD
FT                   GKLVGFDIDLGNEICARLKAKCVWLENDFDGMIPALKAKKFDAVLSSMSITPQRAEQIG
FT                   FTTKIYNQPTRLVVKKGSPLLPTAESLKGKSIGVEQGTTQEAYAKAYWAKQGANVVSYQ
FT                   NQDGVYADLTAGRLDAALQDEVQAAIGFLKSPRGAGYQFVGPELVDEKVLGIGAGIGLR
FT                   KEDTDLKAKIDRAILDMVKDGTYKRLASKYFDFDIYGG"
FT   CDS_pept        453421..453840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03614"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45486"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJT8"
FT                   /protein_id="BAG45486.1"
FT                   /translation="MSQPAYDPHSALPQASVAQMSAAGLRAFFNIARDWGLTIDEQIVL
FT                   LGSPGRSTFFKWKSAPDAARVPRDTLERLSLLLGIYKSLQILLPQPAAADAWVKRPNDA
FT                   APFGGKRALDRMLAGNVGDLVAVRQYLDAMRGGWA"
FT   CDS_pept        453837..454538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03615"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45487"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPJ7"
FT                   /protein_id="BAG45487.1"
FT                   /translation="MTSATDTTIWPTTTLDWAPAYRVIPTRFPAINLFDRVASAEDFDA
FT                   LYALESLTNDRIRNEVGTLELVPPGERRYGQGWGPIMAAFTHLNPQGSRFSDGSYGVFY
FT                   CARGRDTAIAETRYHSALFLAATKEPPMRQQMRLYTVIARGDVVDVRTWPQRDPALLDP
FT                   LDYSAGQALGRAVRRAGGLGIVYPSVRDPHGECLAAFRTTLLRDCHHAAYLEYNWNGSA
FT                   IDAVFELNQVG"
FT   CDS_pept        complement(454631..455362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pphA"
FT                   /locus_tag="BMULJ_03616"
FT                   /product="serine/threonine protein phosphatase 1"
FT                   /note="COG0639: Diadenosine tetraphosphatase and related
FT                   serine/threonine protein phosphatases, Escherichia coli
FT                   O157:H7"
FT                   /note="KEGG, K07313"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03616"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45488"
FT                   /db_xref="GOA:A0A0H3KKC3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKC3"
FT                   /protein_id="BAG45488.1"
FT                   /translation="MSASALLHRHPANVAGRDFVVGDLHGCVDALRALLREVRFDPARD
FT                   RLFSVGDLVDRGPASETALELLDRPWCHVVRGNHEEVLSLVARGKLPADAWRGIGGDWG
FT                   ADLPPERLRAYAARVDALPLVRVIGEGATRFNVLHAEFFGSDADLDTGDYPPDVRERLI
FT                   WGRDLVQGLVDPGWQAGLSLTCSGHTPVRVPQRIGAQWFIDTGAFAPAGRLTLAEPRTG
FT                   QTWSITQAAARERGAAAWPLP"
FT   CDS_pept        455772..456425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03617"
FT                   /product="putative membrane protein"
FT                   /note="COG4291: Predicted membrane protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03617"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45489"
FT                   /db_xref="GOA:A0A0H3KTM1"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTM1"
FT                   /protein_id="BAG45489.1"
FT                   /translation="MTLYPQVLRNRPRLVSAFVAGALAALVLPASTRPTARALIGWDCA
FT                   IWLYLLLMWGRMVTAHHHKVREIAIREDQSATTVLTVICLATVASVAAIAIELATVKSV
FT                   GFRAGLGHYAVTAATLFGAWFLIPTIFTLHYARLYYGSPSGDRVLRFPDRSIEPDYWDF
FT                   LYFSFTIAVASQTADISLAGRSARRAVLAQSILSFYFNMAVLGLSINVAAGLLS"
FT   CDS_pept        complement(456444..457148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03618"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="COG0500: SAM-dependent methyltransferases,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03618"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45490"
FT                   /db_xref="GOA:A0A0H3KJU9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJU9"
FT                   /protein_id="BAG45490.1"
FT                   /translation="MSLPASAAKFDPARAHEYATQSRIALAGYDACHELAACMLAATIG
FT                   ARDAHILVAGAGGTGQEICVTAALEPHWRFTAVDPSAPMLALARSNVDAAGFAARTQFV
FT                   EDGVDTLPDTPAFDGATLIGVLHHVPGDAAKAALLRAIARRLKPGAPLAIAGNYRRYAD
FT                   HPQLLDAWQQRWRMKGTTPDAVRAQLAKILQGADPPASEDAVFDLLRKAGFDAPVRFFA
FT                   SLFWGAWVAIRR"
FT   CDS_pept        457750..459393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treZ"
FT                   /locus_tag="BMULJ_03619"
FT                   /product="maltooligosyltrehalose trehalohydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /note="COG0296: 1,4-alpha-glucan branching enzyme,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01236"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03619"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45491"
FT                   /db_xref="GOA:A0A0H3KJU1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJU1"
FT                   /protein_id="BAG45491.1"
FT                   /translation="MSDCPHDPYAQHYSYCLPFGAQPCGVGCTAPRTHFRVWAPGSTQV
FT                   DLELDTGSGPTTIPMNAAGRGWFEIFAACGAGARYRYRLDGRLSIPDPASRSQPDGLNG
FT                   PSEVVDPRAFTWRNAFWHGRAWEDIALYAIRPHAVGGFDGVRRRLPALARLGVTALELL
FT                   ASPHDSLPFAPLAAEGGPDALKALIDAAHGFGLAVLLELDYARFGSGTDALRHYAAPFF
FT                   HRRDDPREAPPLALDHPDVCDFFCDNALYWIHEYRCDGLRLRDADRIGTSWLCEIADRV
FT                   RAAVPADRLIHLVLGSERHPVHLADTHFDAQWNSCGERALHRLTGGDVSHHEGISTHQS
FT                   IHTLARALTAAGAAFQPRPSGEAMTGDALSLTSLVLSDGAWRHGESERAAGLAALGLSL
FT                   LTPQIPLIFDETARDAERAHFVQSALAVRAKLIAPRLSDCRPQFARALRSGSSGDADAL
FT                   LASWRLADDETLSLALNLSPDPVPFDAPAGQVVFETPPRARDRIDEGELPPYSLVAWLT
FT                   GDVNRYALTHDARRIDFGMTVRAPRAGLNA"
FT   CDS_pept        complement(459430..460014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BMULJ_03620"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="COG0352: Thiamine monophosphate synthase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00788"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45492"
FT                   /db_xref="GOA:A0A0H3KPK0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPK0"
FT                   /protein_id="BAG45492.1"
FT                   /translation="MKPALPRRYVITPEPASASAADCDAFLDRLSAVLARGDTLVQLRV
FT                   KSFDAAAFARLAADALARCEAAGAQLMLNGPIDAHGVLQLEHAGWHLDGATLRATQQRP
FT                   LPADRLLSAACHDADDLRLAARAGADFVTLSPVLPTLSHPGAPTLGWAQFGAWAAQAAM
FT                   PVYALGGMTHAHLDEARRRHAYGIAGIRGFW"
FT   CDS_pept        complement(460037..461380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03621"
FT                   /product="putative membrane protein"
FT                   /note="COG1253: Hemolysins and related proteins containing
FT                   CBS domains, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03621"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45493"
FT                   /db_xref="GOA:A0A0H3KKC7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKC7"
FT                   /protein_id="BAG45493.1"
FT                   /translation="MLQIFALIGALFLVALNGFFVAAEFGLVKLRATRVKTLARKHGLR
FT                   GRILGVVHGRLDAYLSACQLGITLASLGLGWIGEPAFAQLIGPLLDVLGVHSERVVHLI
FT                   SLVFAFSLISFLHIVVGELAPKSMAIRQAEKVGLWVALPLYAFYWAMYPAIWLLNTSAN
FT                   AVLRLAGLSADHGGDAHYSTDELKLILRSRRSTAGNTAPPGRGAYSNDEWNTLAHSLDF
FT                   SSMTVSDLMRPAHEMIGLRRDLPLPDNMEIVARHRFSRYPLFTDASRERVSGLIHLKDL
FT                   LLARHAGAALDDLSDYVRPVQYVQPDMPALDLFRRFRKGAPHFALVGNKGEKPIGFLTL
FT                   DNLLGALVGQIHDEFRQGDADWTRLDDGTLMGKGSLPVVSLEQALGIDIDEGRAESVGG
FT                   LVIQALNDLPSEGQRVSFDRFDVVVKKMNGPRIVLVRVYPKVAKEADE"
FT   CDS_pept        complement(461459..462235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03622"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03622"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45494"
FT                   /db_xref="GOA:A0A0H3KTM2"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTM2"
FT                   /protein_id="BAG45494.1"
FT                   /translation="MSVSVDPVADLLRERAAHYAAQAALFLRDQALSTASHDLRSPLNA
FT                   MHSWGYVLERQLANADPNLQRALAGIRTGIEQQVKLIDDVLDAPRAETRTLAVSPQTFA
FT                   LRPLLDDTLALVRFALADARGVTIDATLPDDAPSLCADRERIAQALWTMLTVAVEASAA
FT                   GSRVTFACTREGAQYVVRVLGSVNAAALVDPALPHMLESFARREMLRERDAKRVAWTLA
FT                   ICQRVALAHDGTFAHDPFADGATVAITLGLRAGTPA"
FT   CDS_pept        complement(462307..463230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03623"
FT                   /product="drug/metabolite transporter (DMT) superfamily
FT                   permease"
FT                   /note="COG0697: Permeases of the drug/metabolite
FT                   transporter (DMT) superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03623"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45495"
FT                   /db_xref="GOA:A0A0H3KJV6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJV6"
FT                   /protein_id="BAG45495.1"
FT                   /translation="MKPETRQHLRANLLMLAAAAIWGSAFVAQRLSLDVIGPFLFTGLR
FT                   FLLGALVLVPLLNFNAASRAQLAAIRRDPALLLPGVALGALLAVSISLQQIGLQYTRIA
FT                   NAGFISSLYVVIVPLMGVFARHRIGVGTWFGALLAAIGLYFLSIDEHFSVLYGDWFQLA
FT                   GAVIIAAHVMAVGHLAKRHDPLVLAFLQFVVCGALCLAVGIAVEPVSVAMLRGALPTVL
FT                   YGGLLSVGVGYTLQVVAQRDAAPAHAAVIFSMEGVFAAVAGWAALGETLTLRALVGCAL
FT                   MLAGLLACQLLPNGDARKKDEDALPA"
FT   CDS_pept        complement(463280..464137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03624"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03624"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45496"
FT                   /db_xref="GOA:A0A0H3KJU7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJU7"
FT                   /protein_id="BAG45496.1"
FT                   /translation="MKVLDLDAVRAFVLVADLASFTRAADALGITQSAVSLKLKRLEAH
FT                   LGKSLLARTPRVVKLAVDGETFLPAARALLDAHDRALGAIAAGTRRLSLGVSEHVAVPD
FT                   LPAVLTSLHRQDPGLSLEMHLGSSSNLLAQYDERRFDAAIVRHEPGEDPPRDDGVPLFT
FT                   EPLAWLAAPDWAPRADEPLPLAVLAGPCGVRAAALRALDQAGLPWRERFTGGGVAAVAA
FT                   AAAAGLAVCPLARRVAPRTLVDVGAKFGLPPLPRSQVVLYSRVRDPRTAAALRRFADSL
FT                   AIPA"
FT   CDS_pept        464248..464631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03625"
FT                   /product="tautomerase enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03625"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45497"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPK5"
FT                   /protein_id="BAG45497.1"
FT                   /translation="MPFTRIAVREGKPAAYRAALVDGVHRALMHTFNVPEDDIFMVVTE
FT                   HAAENFVFGRHYYDIERSDDLVMIQITANNTRTLEQKRALYRTIAENLAAQPGVRPQDV
FT                   FVSLVEVLKEDWSFGNGIAQYAV"
FT   CDS_pept        464753..466519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03626"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3025: Uncharacterized conserved protein,
FT                   Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03626"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45498"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKD3"
FT                   /protein_id="BAG45498.1"
FT                   /translation="MSRVLEIALCLSLEGWPMAASNRARGAPRDFGAELVRAWRICPQV
FT                   RMRRGHERVTIEPCRVVEAEPSPGASWWTWVESNAQGTRVVAARTRAFAPGVTQRELFD
FT                   AEHAGIAVSACGDGSASPDDAAVEPAPEPQPNAAAKAQRRSAAKARNAACTTSAAQTET
FT                   QVQGKGASAAAATTGDGARAAPNADGPAGMQPDTQGVTLVSERRRGRWADDSGVVVEMT
FT                   LDDIAVHDGDARPRRYVELRLAAPDWDTPEARTAALRALFAAARELSGAWPAFAQLTSV
FT                   IDRACAGELGAAVPIKARLVDLTGIRSQRAALFALSGDIAAQWLGNEGGVLDRDDPEFV
FT                   HQMRVALRRLRTLMRFFPHFADRRWKDTFGVDLRWLAGLLGTVRDWDVFATETLPALIA
FT                   ADGGSADWSGTLDVARAQSATARVELRQALHSARYARLTLGWLEWLSTLAFPSAADDEM
FT                   TPLPRHAAKRVRQLFGHLYAVPSLASLDTAARHRVRIDAKRLRYALEFFASLASRRTRG
FT                   ETAKTLARVQSVLGEANDTIVALHHLEQLAAPPYQIGFVRGYGAALERRAAHDAEALLA
FT                   SLRPPKLRGKSA"
FT   CDS_pept        466565..467401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modE"
FT                   /locus_tag="BMULJ_03627"
FT                   /product="molybdate transport system regulatory protein"
FT                   /note="COG2005: N-terminal domain of molybdenum-binding
FT                   protein, Ralstonia solanacearum"
FT                   /note="KEGG, K02019"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03627"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45499"
FT                   /db_xref="GOA:A0A0H3KTM4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTM4"
FT                   /protein_id="BAG45499.1"
FT                   /translation="MSDAPSSPSSAEPLALGGELWLRAGEQTLGGATRIALLAAIGDTG
FT                   SITRAAKAVGLSYKAAWDAIDTMNNLAGEPLVVRSTGGKGGGGTTLTPRATSLIAAFRT
FT                   IEREHRRFIAAASAAVAGFDVDWALLGRIGMKTSARNQWVGKVKSIVRGTVNDEVTLML
FT                   PGGQAIVAVLTHDGAQTLGLHAGAHACALVNASSVVLAADDGGPAPKVSARNRLRGTVE
FT                   SVDGGAVNSEVTLALDGGGTLTAVVTNDSVEALQLVAGRRAFALFKASSVLLAMTE"
FT   CDS_pept        complement(467524..468225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="BMULJ_03628"
FT                   /product="molybdate transport system ATP-binding protein"
FT                   /note="COG1118: ABC-type sulfate/molybdate transport
FT                   systems, ATPase component, Ralstonia solanacearum"
FT                   /note="KEGG, K02017"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03628"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45500"
FT                   /db_xref="GOA:A0A0H3KJW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJW0"
FT                   /protein_id="BAG45500.1"
FT                   /translation="MSLVVDIRKTYATAERRFTLDVSFTATTQRVVLFGPSGAGKSMTL
FT                   QAIAGLLAPDAGTIALNGEPLFDAARRIDVPTRARRVAYLFQDYALFPHLNVRQNIAFG
FT                   LTAGLRNPRATALPPEVAYWLRAFDLEPLAAQYPSQLSGGQKQRVALARALVAQPRILL
FT                   LDEPFAALDGAMRQRMRHELAELQGRLDIPMVLISHDPDDVAAFGDQVVQLNDGRVQPA
FT                   APHAGWPTRVM"
FT   CDS_pept        complement(468317..468994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BMULJ_03629"
FT                   /product="molybdate transport system permease protein"
FT                   /note="COG4149: ABC-type molybdate transport system,
FT                   permease component, Ralstonia solanacearum"
FT                   /note="KEGG, K02018"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03629"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45501"
FT                   /db_xref="GOA:A0A0H3KJV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJV1"
FT                   /protein_id="BAG45501.1"
FT                   /translation="MQDAWIPLLLSLKVAGWATALDVVLGVAAAFALARWRSPLRDVVD
FT                   SLLTLPLVLPPTVLGYYLLVLLGRRGVFGAWLDRLGIELVFTWQGAVIASMVVAFPLIL
FT                   KSARAAFEGVDPHLERAARTLGLGEAAVFFRVTLPLAARGILAGALLAFARALGEFGAT
FT                   LMIAGNLPGRTQTLSVAIYAAVQAGDDSTANFLVLVTSITCVLVLLATGWLVPSRARRS
FT                   QPT"
FT   CDS_pept        complement(469005..469805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="BMULJ_03630"
FT                   /product="molybdate transport system substrate-binding
FT                   protein"
FT                   /note="COG0725: ABC-type molybdate transport system,
FT                   periplasmic component, Ralstonia solanacearum"
FT                   /note="KEGG, K02020"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45502"
FT                   /db_xref="GOA:A0A0H3KPK9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPK9"
FT                   /protein_id="BAG45502.1"
FT                   /translation="MRSSVRPLRRTLLRLLPIAALGAGIAFSAPASAADELVVSAAASL
FT                   TNAFKAVGDAYEQQHPGTKVLFNFGASDVLMQQIAKGAPADVFASADQKAMDRAADEKV
FT                   IVPGTRRDFAANSLVLIVPADSHATPPASLRDLTAPGVKRIAYGDPASVPVGRYTEGAL
FT                   RAAGVWDAVSAKGVLAANVRQSLDYVARGEVDAGFVFGTDAAIMPGRVKVALTVPTQTA
FT                   ITYPIAIVKDSRHAAQAQSFVDFVASPQGQAVLAKFGFKPAAGK"
FT   CDS_pept        complement(469927..470625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03631"
FT                   /product="PAP2 family PA-phosphatase-related
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03631"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45503"
FT                   /db_xref="GOA:A0A0H3KKF5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKF5"
FT                   /protein_id="BAG45503.1"
FT                   /translation="MFDLPPRLWITITAFGGAGLTLPLAITIAIWLVLGYSWQRAAGWL
FT                   AVLATAIGVVALTKIAFLGWGIGVRAWDFTGFSGHAMLSTAVYPVAIFLALIRARTPVR
FT                   VAGIALGLAAGVAVGVSRVALDAHSPSESVTGCIVGAAAALVFIAASWRAVPHRWSVPA
FT                   VVASLALVTVALHGITVPSHRWVTQVALHLSGHERPFVRARWKANPNYHPASQPSSLQR
FT                   TESVQQTLHT"
FT   CDS_pept        470873..471982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03632"
FT                   /product="poly(3-hydroxybutyrate) depolymerase"
FT                   /note="COG3509: Poly(3-hydroxybutyrate) depolymerase,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03632"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45504"
FT                   /db_xref="GOA:A0A0H3KTM6"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTM6"
FT                   /protein_id="BAG45504.1"
FT                   /translation="MTKSLTKMWLGGMKRVLSPAAKRAARDARRLTRDVLDAAASPAAS
FT                   EVSMPRESRVRPRAAAWAAGEWTRGEHPMAPALGRLVQQLAYALYVPPGHRREAMPLVV
FT                   MLHGCQQTADAFAQGTRMNLLADKHGFAVLYPEQSMRAHSHGCWHWYEDTDRAGRGEAD
FT                   AVASLVDALVDEHGFDASRVYVAGLSAGAGLASLLALHHPDRFAAVALHSGPALGEANS
FT                   GISAMDVMRRGLRENPAAVVDALVDADSYPGMPALIVQGDGDRVVAPKNADELAVQFMR
FT                   LNGLADSRGALRGGERVETRQAGARIVDVRRDGESVVRLCHVKGLDHAWSGGDEAVPFH
FT                   AAVGPDASAMVWSFFETHRRTVATERRTD"
FT   CDS_pept        472055..472231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03633"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45505"
FT                   /db_xref="InterPro:IPR021946"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJW6"
FT                   /protein_id="BAG45505.1"
FT                   /translation="MYLLSHLFLMLTKNAEQAAKERAEAYLSEATDIYDLEFRMRKIDR
FT                   EAAMNRPYSFGAR"
FT   CDS_pept        complement(472348..472767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="BMULJ_03634"
FT                   /product="osmotically inducible protein"
FT                   /note="COG1764: Predicted redox protein, regulator of
FT                   disulfide bond formation, Ralstonia solanacearum"
FT                   /note="KEGG, K04063"
FT                   /note="OsmC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03634"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45506"
FT                   /db_xref="GOA:A0A0H3KJV4"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJV4"
FT                   /protein_id="BAG45506.1"
FT                   /translation="MNILYKTSATSTGGRDGRAVSEDHKLEVKLAAPRELGGTGAEGTN
FT                   PEQLFAAGYSACFLSAMKFVAGQSKQTLPADTQVTAQVGLGPNDAGGFALDIELRVSLP
FT                   GIDKADAQALVEKAHQVCPYSNATRNNVPVRLTVV"
FT   CDS_pept        complement(472914..473366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03635"
FT                   /product="MarR family transcriptional regulator"
FT                   /note="COG1846: Transcriptional regulators, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03635"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45507"
FT                   /db_xref="GOA:A0A0H3KPL4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPL4"
FT                   /protein_id="BAG45507.1"
FT                   /translation="MDRLPPLPQTLDEQLCFALYSTSHAMTKAYKPLLDKLSLTYPQYL
FT                   AMLVLWERDDLAVKDVAARLDLDPATVTPLLKRLEALGYVERVRSAADERIVNVRVTAA
FT                   GLALKEQARSVPAELFCAMQQTPEFLIRLRSDLQQLRDALSAANER"
FT   CDS_pept        complement(473581..474387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03636"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03636"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45508"
FT                   /db_xref="GOA:A0A0H3KKG7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKG7"
FT                   /protein_id="BAG45508.1"
FT                   /translation="MQLIEVPAKTGYVWFRQGIWLFRRNPLAFITLFFTYLLAITLVSM
FT                   VPIVGAALPLLFIPGIAVGFMAACRDTVAGKSVMPTILVDGFRSYGSVATQRLLVLGVI
FT                   YVVSMILVFAASSVMDGGVLFHLMMGATGDANPAPEALAAQGTLGALLFATLLYVPVAM
FT                   LFWFAPVLIAWHDIPPAKALFFSIVSCWRNRGAFLVYGLLWFGVALGTSLGLSLLLQAL
FT                   GAAAYALTIMMPVTIIIVTMLYCSFYATYRGCFGVQEPGAATTSGR"
FT   CDS_pept        complement(474378..475376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="BMULJ_03637"
FT                   /product="homoserine kinase type II"
FT                   /EC_number="2.7.1.39"
FT                   /note="COG2334: Putative homoserine kinase type II (protein
FT                   kinase fold), Ralstonia solanacearum"
FT                   /note="KEGG, K02204"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03637"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45509"
FT                   /db_xref="GOA:A9ANP0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ANP0"
FT                   /protein_id="BAG45509.1"
FT                   /translation="MAVFTAVSDSDLAQWMRHYALGDVVAFRGIPSGIENSNFFLTTTR
FT                   GEYVLTIFEKLTAEQLPFYLDLMRHLAGHGVPVPDPVPRDDGALFGTLHGKPAAIVTKL
FT                   DGAAELAPGVEHCIEVGQMLARMHLAGRDYPRRQPNLRSLPWWQENVPAIVPFVTDAQR
FT                   ALLEGELAHQARFFGSEDYAALPGGPCHCDLFRDNVLFAHAAPDTGHAVRLGGFFDFYF
FT                   AGCDKWLFDVAVTVNDWCVDLATGVLDTARADALLRAYQTVRPFTAEERRHWSDMLRAG
FT                   AYRFWVSRLYDFYLPRAAEMLKPHDPGHFERILRERIAHTPALPEIQTACN"
FT   CDS_pept        complement(475482..475877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03638"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTM8"
FT                   /protein_id="BAG45510.1"
FT                   /translation="MKPLILVAAAAAFVAASAAFAAGGTPSADAQAQAEANEAAGLPDL
FT                   RQINRPAAEVTSKVDFSDIRRTPSFHEKSKNGTEVTEYRDRGKPVEIDVKSNFGTRYQM
FT                   SSTPDTSPKPHDAGVPITRLPSVNLRY"
FT   CDS_pept        476007..477533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="BMULJ_03639"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="COG0775: Nucleoside phosphorylase, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K01241"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03639"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45511"
FT                   /db_xref="GOA:A0A0H3KJX3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJX3"
FT                   /protein_id="BAG45511.1"
FT                   /translation="MKNDLSRGHRMLTPESPPVEAFDDPIAAVARLSAIYDTNTGFLRD
FT                   AFARYRRHETIAEHVRACYPFVRIRTDVNTNVDSRRSYGFVAGPGVFETTVTRPDLFAN
FT                   YYREQLRLLAKNHHVKIEIGVSSQPIPVHFAFPEGIHLEGELDRDSLLAMRDIFDTPDL
FT                   SYLDDRIVNGTFEPAPGEPHPLALFTAARVDFSLHRLRHYTATSPTHFQNYVLYTNYQF
FT                   YIDEFVKLGRTMMTESDDPDVRAYRSQYSAFVEPGDVVTYNANLGSEAAEGAAPPRLPQ
FT                   MPAYHLKRADGSGITMVNIGVGPSNAKTITDHIAVLRPHAWVMLGHCAGLRNTQRLGDY
FT                   VLAHGYVREDHVLDADLPLWVPIPALAEVQLALERAVADVTQLEGAELKRVMRTGTVAS
FT                   VDNRNWELRDHREPVQRLSQSRAIALDMESATIAANGFRFRVPYGTLLCVSDKPLHGEL
FT                   KLPGMADQFYRAQVDQHLQIGVRAMEILRTNGLDKLHSRKLRSFAEVAFQ"
FT   CDS_pept        complement(477603..478310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03640"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45512"
FT                   /db_xref="GOA:A0A0H3KJV9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJV9"
FT                   /protein_id="BAG45512.1"
FT                   /translation="MLSLIFMHAVRRGLCDGNPAREVGAAKERKRDRYITDDELDAVRA
FT                   AIVAGADYKTSSARSILCLVDLAYQTAQRIGDLLALNWQNVSDEGISFHPSKTVNSSGV
FT                   RLLIEMTPDLRETLDRARGGKVTAIGPVICTHTGGRFTYIGAYSAWKRACERARSTYEK
FT                   ECAKKGIEPNPLYLTGMHFHDLRAKALTDLKRQRGAAAAQSLAGHTTESMTAHYTKARE
FT                   VERVQPVPLTRAS"
FT   CDS_pept        complement(479637..482432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03641"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03641"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45513"
FT                   /db_xref="GOA:A0A0H3KPL8"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPL8"
FT                   /protein_id="BAG45513.1"
FT                   /translation="MASIDELKQRIDLHDLADRLGLKRGRGGDKALYHSPQHEDRSPSL
FT                   SIYVNHPKHGTGWRDHSAGVGGSCIDLVIHARGGTVADAVRYLHDAYGIPLDRPAPAER
FT                   REKTTVEYIADRCFAERDQVREYLGGRGISAAAIDAAIAARTLGFNTWTSSKVAAGEVG
FT                   HGGPAAAFIVRAPSDGRVVAVDMRYVDPALNGGVKTQTQGDKAGYGWTADPRRLDKAKR
FT                   VFIVESAINALSIDTCTLPGAAALALRGLGNVDALDFTPLRGKQVVICMDNDEPFADGH
FT                   PRAGHRPGPEAAWALYERLTALNISAVLVDQAGWLADLADGEKQQKPINDVNDYLQLRG
FT                   PADLQRALDQLEPWLIAGLAGDATRRGRPRIFLPSHDFAQYWRFRVRPDFTSYITKMDK
FT                   NEESGVETPVMTDLCGFRIAGISRVSVASATSTMTGDADQAPTVYFAVSVQAPRHGAQL
FT                   IRRVMLDDQLHNVDQWGKFGPIWAPAPFKRMVNILERGADLGARQAANFVGLAWRDGRL
FT                   IVNEGPDCYFTEADKQCPYHNLTFPSGPIGDARRVIAAYQTTFKQNAATIPLVWALGGH
FT                   LKALLGFWPHITIQANKGAGKSTLIKRLERSLAFTMFSGQSLQTEFRLLTSISHTSHPV
FT                   GWEELSARRQDVIDKAVGLLQENYQYTVTRRGADMTEYLLCAPVMLAGEDVPVRSLLGK
FT                   LVRTTLTGKRGPLLPDDLPRFPVRQWLEFLTGLDKRAVLDQYATLRDKALANCRASGED
FT                   DGAKRMAGNYAAVALAWRYLCEFAGMDPTEGDFPRDLLAEMNGHIAETSADREPWVWIM
FT                   ETVLSEIDGGNYKHPYTFDMVDGEFCLLLRTGHVMDHIAHTSALRDKWNGLPVKSDRVF
FT                   KAQLKHAGVVVGEKEVERRIYTRRVPYLTPISLERLADFGLHVSIREDLATDATEQRGR
FT                   A"
FT   CDS_pept        complement(482435..482695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03642"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03642"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKH1"
FT                   /protein_id="BAG45514.1"
FT                   /translation="MSRLDASSHDATLRAAIVAAANPLHFNNRPGSVARQCALGLFVAA
FT                   LSDRLALGFPESADALRALVFSPATPNNPADHTQQQSEQQQ"
FT   CDS_pept        complement(482692..483051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03643"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03643"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTN3"
FT                   /protein_id="BAG45515.1"
FT                   /translation="MTIESAIRYELLTSAGLRTVTGEHVVIPNDVGATFGIHAEPYLAD
FT                   GHPEKWVVTHLASGMQAGTGTSRTAAITNATTNVERNRPRLRTMLDEATAARTDLQFAT
FT                   YQLARNRLAILGEAA"
FT   CDS_pept        complement(483056..483250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03644"
FT                   /product="putative phage-encoded membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03644"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45516"
FT                   /db_xref="GOA:A0A0H3KJX7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJX7"
FT                   /protein_id="BAG45516.1"
FT                   /translation="MKPYVFGISVLLMLSLSLTGAYYLTTDVLRLFDVRYARPIAFVGG
FT                   VAVMVALVVALGWSVPPRG"
FT   CDS_pept        complement(483293..483496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03645"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03645"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45517"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJW3"
FT                   /protein_id="BAG45517.1"
FT                   /translation="MRAPLTDVDLRAAWHRLRMVGDFDTSIRHRAVRLVVESAARAMQD
FT                   REQARLRRASDVKRRAANDVDE"
FT   CDS_pept        complement(483500..483694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03646"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03646"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPM0"
FT                   /protein_id="BAG45518.1"
FT                   /translation="MQTPTPAHVTTLTSSLDFNQRVAYLQKLCATDVRADVFVASARAL
FT                   GFAVSWDLARGTPLLAWMH"
FT   CDS_pept        complement(483784..484032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03647"
FT                   /product="bacteriophage transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03647"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45519"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKH4"
FT                   /protein_id="BAG45519.1"
FT                   /translation="MKLKCHHCGSRAVIRTSRTLSALVREAYCQCTNIECATTYKIHVA
FT                   TVHTIAPSLTPNPAVYLPLGKVDRLPRDPRQLPLIDA"
FT   CDS_pept        complement(484042..484320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03648"
FT                   /product="putative bacteriophage DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03648"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45520"
FT                   /db_xref="GOA:A0A0H3KTN4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTN4"
FT                   /protein_id="BAG45520.1"
FT                   /translation="MQPPALIEPALRHALHGPKRHEVQAALGWDDSEVSRFLSGGKGIV
FT                   IDKIDTLVAAVGFVCVTRKYLDAVATLGEVGMFCQCARQGRGECSRP"
FT   CDS_pept        complement(484324..484560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03649"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03649"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJY2"
FT                   /protein_id="BAG45521.1"
FT                   /translation="MLRKKAPVTRSPRGVLSSKPVYMRLMPDERRALEELSTLLNRSTS
FT                   SVARLVYLEGVERYRAKVTGPAAQLHASSFAGR"
FT   CDS_pept        484616..485098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03650"
FT                   /product="phage XRE family transcriptional regulator"
FT                   /note="COG1396: Predicted transcriptional regulators,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45522"
FT                   /db_xref="GOA:A0A0H3KJW7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJW7"
FT                   /protein_id="BAG45522.1"
FT                   /translation="MRMQQKTNRMVSIGDRLRDERKRTSLSQRAFAERGGVTEKTQVLY
FT                   EKGERVPDAIYLEKIAAAGVDVLFVLTGHRNSAELSPDEEVLVTGYRSLDAKGRAGVLG
FT                   MIAGMTQQPTESAPAKVAKVRQNFEGASIGQQVTGDVTAPFSINMGSAGRKKKREG"
FT   CDS_pept        485155..485901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03651"
FT                   /product="putative bacteriophage-encoded membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03651"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45523"
FT                   /db_xref="GOA:A0A0H3KPM4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPM4"
FT                   /protein_id="BAG45523.1"
FT                   /translation="MNQKFDGEIGQVAGGDVKSNSAQTSVNVHFHGGEPKAAETEFINN
FT                   KQRAAIAHRVFKIQKQTGTEALMVYRRLKTVFDYESIERMPRSKYKPAISYLDSWLRNG
FT                   NLGNPPGSAALQKVKHPSPAAPTARRESPSPHVQFASPAAATFSPAAPMATAVPVQQNS
FT                   RASRRGAMALVGIAVIVAAATVYLYVERHPAGVRQQVEAAEPPQCEYGGNRYSLGGVVM
FT                   QAGIRQRCVADADHGVRWERATGGRR"
FT   repeat_region   486466..486470
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  486471..487680
FT                   /mobile_element_type="insertion sequence: ISBmu23"
FT                   /note="IS5 family"
FT   repeat_region   486471..486486
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu23, terminal inverted repeat"
FT   CDS_pept        486558..487550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03652"
FT                   /product="ISBmu23 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03652"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45524"
FT                   /db_xref="GOA:A0A0H3KKH9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKH9"
FT                   /protein_id="BAG45524.1"
FT                   /translation="MQRQIGFAEAESAGKKRVTKRQRFLAEMEKVVPWSRLLSVIGPYY
FT                   PKGERGRPPIGLERMLRIYLLQQWYGLSDEGLEDALYDSIAMRAFAGIDLARENVPDAT
FT                   TLLKFRRLLVEHALTRKLFDEIGIELCERGLMMKEGTLVDATIFEAAPSTKNAGKSRDP
FT                   EMHQTKKGNDWYFGMKAHVGVDADSGLVHSVVTTAANEPDVSQAHALLHGHEQEAFGDA
FT                   GYTGVDKREEMKGKTVKWHVALKRGKIRAMQEGPLKDLVIAVERTKAQIRARVEHPFHV
FT                   VKNLFRHRKVRYKGLARNTAQLFSLFALANLVIAKNQLLSTHGSNPSCV"
FT   repeat_region   487665..487680
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu23, terminal inverted repeat"
FT   repeat_region   487680..487684
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(487854..489005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03653"
FT                   /product="probable bacteriophage protein D"
FT                   /note="COG3500: Phage protein D, Salmonella typhimurium
FT                   LT2"
FT                   /note="KEGG, K06905"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03653"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTN8"
FT                   /protein_id="BAG45525.1"
FT                   /translation="MNLADLPGADLVQKTVLADDRVPRAIYSITLNGKDISHKFDGRLI
FT                   SMTLQDNRGFEADQLDISLDDSDGALEIPSRGVRLKVAIGWAGAANGLVDKGEFVVDEV
FT                   RHTGTPDVLTIRARSVDLRAGLSIKKERSWHRQTVGAIVRAIASQNKVEARISKALDGQ
FT                   LVDHIDQTAESDANLLSRLAKMFDAIATVKNGKLLFIKAGEATTASGKPLPAITITRDV
FT                   GDRHEFGVADRDTYSGVQAFYLNTRTAKKQSTTVKRRRRRTTKKKPIDKSGDVLFGTAE
FT                   NVKVLRHTYANKSNATRAAKAEWEKLQRGVAEFSIVLALGRPELMTELPVTVRGYKRVI
FT                   DDCKWIVARVTHTLDGNGGFTSDLDLEVKASEVPEIDTSTDIE"
FT   CDS_pept        complement(489002..489430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03654"
FT                   /product="probable bacteriophage protein U"
FT                   /note="COG3499: Phage protein U, Ralstonia solanacearum"
FT                   /note="KEGG, K06906"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03654"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45526"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="InterPro:IPR016912"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJY5"
FT                   /protein_id="BAG45526.1"
FT                   /translation="MMMALGLFVFSLSTLPYQELKRRRGWRYASNNRVGRKPARQYVGE
FT                   DEETIVLSGVLLPELTGGDLSLSVLEAMADQHTAWPLIEGTGHIYGMFTIDNIDTTRTL
FT                   FFPDGAARRIDFTVALTRNDDIDMLGIVTDAIKEAISL"
FT   CDS_pept        complement(489444..492206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03655"
FT                   /product="putative bacteriophage membrane protein"
FT                   /note="COG5283: Phage-related tail protein, Salmonella
FT                   typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03655"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45527"
FT                   /db_xref="GOA:A0A0H3KJX0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJX0"
FT                   /protein_id="BAG45527.1"
FT                   /translation="MSDRSLRLEVVLKALDQASRPIREITGRNRTLVKDLRDTRARLKE
FT                   LSDTQRRIGEFREMRTGLANTSAKLADAQKKVKELAKSLHAYGPPSQQMIAELAKARQA
FT                   SSRLGIAFKKQSAGVDELRNRLVRAGVDTSKLSQHERTLRNDIAATTDAIDAQTRRLDA
FT                   LNHRQQRIAAARTKMGAMRGAAAEMAIGGYAARSTGQHILDDLREPLAEAKKIQNERGR
FT                   IQGLGLGDHATQDAERYVRGMKTPGVAIADNMTLMRDAMSIFADEHHAQMVMPTLAKMK
FT                   FANEAMFGAGQGHENEEKFMNMLKVIELRGGTKSEAAFIKEANMVQQVLTATGGRVGGD
FT                   EWRNFIQTGKVAAKQMRQDAFYYQMEPLIQEMGGHAAGTGVQAAYSNLMQGKTTVRAAK
FT                   RLVELGLVDKKSVEYNTIGNVKRIKPGALIQGELFNASPFEWMEKVLLPKLKAKGITSD
FT                   AKILEEFSTIMTNGNGANLFATMYMQREQIHKNEKLNRGAYGIDQLHALGQKQTEGREL
FT                   IALEKVRNLRTVIGEQVLPVYNRALELTTTVLERLLGFAKQYPNFTRAVAIGAAGLGVL
FT                   LAVLGTLTIALAGILGPLAIVRFSMSMLGIQGGVLVRALGAIGKTLLLVGRVALMSPIG
FT                   LVIAGIALAALLIVKYWEPIKAFFSGFWQGITDGLKPLAPLVSRAFAILGAAFAPLKPL
FT                   ADWLTGALKGVWDWLTRLLVPVDASKKSLDAATGAGRAFGTWLADIIAGLAQASARFAE
FT                   FGSNLMSGLVNGITNGLGAVKTAIQSAGDSVVGWFKERLGIHSPSRVFAALGGWTMAGL
FT                   EQGLRNGQDGPLATVRELGKRIVAAGAGIGITGAAIAGGAPLTVDNRPPLTAAAVARTP
FT                   ASTPAPITINVYASPGMDANALAQKVLQLMRQEQAAQAARDRSRLRDRD"
FT   CDS_pept        complement(492203..492322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03656"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03656"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45528"
FT                   /db_xref="InterPro:IPR009493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPM9"
FT                   /protein_id="BAG45528.1"
FT                   /translation="MADIALVFHWSPDAMAAMPLSELMDWRERARERYERGDE"
FT   CDS_pept        complement(492322..492633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03657"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03657"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45529"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKI3"
FT                   /protein_id="BAG45529.1"
FT                   /translation="MQSKQSAVITLDTPIKRGEQEITAVTLNKPLAGALRGVALTDVLQ
FT                   LDVIALSKVLPRISDPVLTTQDVLRLDPADLVQLGTEVAGFLVPNSSKADASLEPSTT"
FT   CDS_pept        complement(492666..493175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03658"
FT                   /product="probable bacteriophage tail tube protein FII"
FT                   /note="COG3498: Phage tail tube protein FII, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06908"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03658"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45530"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTP1"
FT                   /protein_id="BAG45530.1"
FT                   /translation="MALPSKLKNFNVFEDGTSFVGEVTEIQLPKLTRKMEAYRGGGMNA
FT                   EIDIDLGMEKMELGLTMGGFMKEMFKTWGTSKVDGVTVRFAGSYQRDDTEEVDAVEVYV
FT                   RGRYKEIDPGKAKAGDNADQTGTMSLSYYRLVCNGETLIEIDVPNFVEVVGGVDRLAQQ
FT                   RRAIGL"
FT   CDS_pept        complement(493205..494377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03659"
FT                   /product="probable bacteriophage tail sheath protein FI"
FT                   /note="COG3497: Phage tail sheath protein FI, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06907"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03659"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45531"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJZ1"
FT                   /protein_id="BAG45531.1"
FT                   /translation="MPSDYHHGVRVIEINEGTRPIRTVSTAVIGLVSTADDADAATFPE
FT                   NRPVLITDVQAAIGKAGTKGTLARSLDAIAAQTSPLIVAVRVPTGKDPDTTTSNVIGTT
FT                   TADGQYTGMKALLAAKSRLGVKPRVLGCPGLDTLPVASELATIAQKLRGFGYISAFGAQ
FT                   TKEEATTYRANFGQRELMTIWPDFVNWNTTTNAEDITWATARALGMRAKIDEEIGWHKT
FT                   ISNVVVNGVTGISRDVFWDLQDPNTDAGYLNSHEVTTLVNADGYRLWGSRTCSEDKLWA
FT                   FENYVRSAQVIADTMAEAHMWAVDQPMSRTLMRDIVDGVNAKFRAWKTAGYLIDGECWF
FT                   DPGANDKDSLKAGQGFIDYDFCPAPPLEDLTFRQRITDRYLVKFAQSIAV"
FT   CDS_pept        complement(494488..495237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhdJ"
FT                   /locus_tag="BMULJ_03660"
FT                   /product="putative adenine-specific DNA-methyltransferase"
FT                   /note="COG0863: DNA modification methylase, Xylella
FT                   fastidiosa 9a5c"
FT                   /note="KEGG, K07319"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45532"
FT                   /db_xref="GOA:A0A0H3KJX8"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJX8"
FT                   /protein_id="BAG45532.1"
FT                   /translation="MQHPISADLINRIHLADATSVLRALPDGCIDLTFTDPPYSSGGTT
FT                   SASRSQTPSSKYIGGDVKTVYPEFQHDSKDQRSWTFWCMTWLAEVYRVSRNEAHLVCFV
FT                   DWRQLPSLTDAIQAAGFTWRGVAVWDKTNGRTRPRAGGFAQQAEFLVWATKGAVRRADV
FT                   YLPGVFSERLAHPKRHMTEKPAQLAREVVRLAPAGGVVLDPFTGSGTFLDAAKQGGLNW
FT                   IGCELEPAYHQVATARLAGLDTLGVAA"
FT   CDS_pept        complement(495215..495397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03661"
FT                   /product="putative Mu-like prophage protein Com"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03661"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45533"
FT                   /db_xref="InterPro:IPR019294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPN3"
FT                   /protein_id="BAG45533.1"
FT                   /translation="MQDIRCASCNRKLGAGEYIRLTIKCPRCRAMNVLRAERPLPAGHR
FT                   ASDTRESPHATPHLR"
FT   CDS_pept        complement(495544..496422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03662"
FT                   /product="probable bacteriophage tail fiber assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03662"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45534"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKI8"
FT                   /protein_id="BAG45534.1"
FT                   /translation="MLIHQYDAETGQYISSHLADVDPKNPDRWLVPAFSTLDPLPERSP
FT                   RTWPFYRNGAWKLLPDHRGQVLYRQDTGEPAEILAAGTTPEAQGLTEIPRPSPEHVWRD
FT                   GGWVIDPARVAQRAREAAMIEFESRMARARQMNAGKADAYAAGLLSVEEAYYFRAWSAY
FT                   QLDLVRAIQADGFPDALRWPEDPVPFEIACTPALAEFETRMAKAKRFFDGKADAYAAGE
FT                   LSDEEQYNYRVWSAYAEHLKHALNRETFPNVVWPQEPAPYVAPPAPESNAPAGAGESRE
FT                   APTRAEKEIAT"
FT   CDS_pept        complement(496432..498042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03663"
FT                   /product="probable bacteriophage tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03663"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45535"
FT                   /db_xref="InterPro:IPR005601"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTP3"
FT                   /protein_id="BAG45535.1"
FT                   /translation="MAGNLINITDAGRAALVAAGNTGTVARRVTEVGLGTAAFTFDKGM
FT                   KTMPAERKRVTTFGGENVAPDTVHVVIQDDTDDQYSLFAYGLYLDNGVLFGVYVQDTPI
FT                   LEKSPAAMMLLASDIVFKSIDASQLQFGPATFLNPPATMDRKGVVELATTEEVAAGTDA
FT                   TRAVTPATLKPRLDAKANLSGADFTGRISTRDVLHLASAPGGTGAILGAGNGDGASAST
FT                   TNVALRSWYGIGFAPTIDGMPVPRTEFSHWFDTRTGNTGFRGTLDVGGLITAQTPPSGD
FT                   ASKRVPTTEWVVAAIASAGIGTIVFEPRTSVRAGFLKLNGALVNRSDYPALWAYAQASG
FT                   ALVAESAWGQNNWGCFSTGDGATTFRLPELRGEFLRCWDDGRGADSARGIGTFQSFQNA
FT                   WHAHGASSAAVGDHTHGAWTDAQGWHGHHGWTGGGGGHNHNNGIFSRLLRPPYGGSLTG
FT                   SDQAGSGSEQAVGAGDSADIAWSGDHAHEFNTEGSGTHSHNVGIGGAGAHAHAITVNGD
FT                   GGNEARPRNIAMLAMIRAY"
FT   CDS_pept        complement(498045..498599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03664"
FT                   /product="probable bacteriophage tail formation protein"
FT                   /note="COG4385: Bacteriophage P2-related tail formation
FT                   protein, Xylella fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03664"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45536"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJZ5"
FT                   /protein_id="BAG45536.1"
FT                   /translation="MSKLPRSLLPPNATALERRLAEANADVRDIPVELDTLMDPDRIPL
FT                   RFLPWLAWHMGVDTWRDEWPEQVKRARVKSAIRIARKKGTADAVRAVCASFGANVVMRE
FT                   WFEMTPRGVPGTFEIVMTVGAREGVPATAQYVADVRAEVDRAKRGTAHYIFKQGYSAIG
FT                   TQLLGAGARAAVYHRLSLSDT"
FT   CDS_pept        complement(498592..499497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03665"
FT                   /product="probable bacteriophage baseplate assembly
FT                   protein"
FT                   /note="COG3948: Phage-related baseplate assembly protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03665"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45537"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJY4"
FT                   /protein_id="BAG45537.1"
FT                   /translation="MRTTPIDLSQLPAPDIVEELDYETILAEKKARLVSLYPKEQQDEI
FT                   AAALELESEPMVKLLQEGAYEKMLLLALINEKARGILLAYAKGTTLEHIGALFDVERLL
FT                   ISAGDPDTGVDPVYEDDDSLRERIQLAPRGFSVAGPDDAYVFHARAADGRVKAATAYSP
FT                   SPCVMIVTILSREGDGTASEELLGIVRKALEKKRPQADEVIVQSAKIVRYGIRATLRFF
FT                   NGPDRAVAIAAARKNTQQFADAMHRPGSEITLDGLYASMRVAGVQKVLLDTPANGVPIA
FT                   IDEAPYCTGIELIDGGVADE"
FT   CDS_pept        complement(499494..499871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03666"
FT                   /product="probable bacteriophage baseplate assembly protein
FT                   W"
FT                   /note="COG3628: Phage baseplate assembly protein W,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K06903"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03666"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45538"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPN7"
FT                   /protein_id="BAG45538.1"
FT                   /translation="MIGMNARTGRTVANQAHIEQSAADILFTPLGTRVMRRDYGSLLPE
FT                   LIDGPVNPLMRMRVMAASVMALARWEPRIQVNQVDFASTGIDGGAVLELHGERTDGPRA
FT                   GTPFSMRLPTMGGRATGRGTA"
FT   CDS_pept        complement(499868..500500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03667"
FT                   /product="probable bacteriophage baseplate assembly
FT                   protein"
FT                   /note="COG4540: Phage P2 baseplate assembly protein gpV,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03667"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45539"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="InterPro:IPR040629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKJ4"
FT                   /protein_id="BAG45539.1"
FT                   /translation="MDDFADLNRRLESLLREGTVIDVDHDARRVRVESGGLQTDWIRWL
FT                   AQRTGATVEWDPPSIGEPGLLLCPSGEPTTGLFLPGVYCDGHDAPSSNPNEHVRVYADG
FT                   ARVAYDAGTGHLTVTGIKTATVQGSGTLTFDMPKVVFTGDVTIEGAGTVMKLLSYMAGL
FT                   AGEGGDVGTVLRGNITHEGGTLRSNGVSVDQHDHVDSMGGTTSKGHG"
FT   CDS_pept        complement(500701..502581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03668"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03668"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45540"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTP6"
FT                   /protein_id="BAG45540.1"
FT                   /translation="MKIQSVRIKNFRTLKDVAIPFDSVTTLIGPNGTGKSTVLRALDWF
FT                   FNGRPGLLTERDCSFGASDEDIEVQVTFDDLTEKDRAELGKYAPEGTTTFTAWKRRSKD
FT                   GAESISANSKSYPPFNDIRSKGSAGDKKVEYNRLRESDPSLGLPPWSSVDAANQAMTTW
FT                   EANHTDQLIDAPESLQTNFFGFNSGGKMSGLFDFVLVTADLRASEESLDGKSSIIGRIL
FT                   ERSVDRAAADEEIAKIVEESRAKQQSVYAEKFKAQLEEMTAQLNDVVSSYSPGRAVTVS
FT                   PAEVELKAPRTTFEVAVLDGTTETAVERQGHGFQRTLLISALQLLAQSGAASAEGVICL
FT                   AIEEPELFQHPIQAQTFAKVLRSLAEDASKRIQVTYATHSPYFLEARHFHQIRRLTRSS
FT                   DEIPAVTVHRATVDDVKTKLKGTVDADQVARQLDGVVTSRLSIALFATRVLLVEGDTEA
FT                   AVFYGIGDRDAVGCLESQGLSIVSAGGKGGIPLAHAILTSLGIPTYVLFDGDAGFEERA
FT                   TAAGKKPAAIESDRTKFSTENRRLLKYFGEDEVDFPPEKIGTQVATLSDHLETYLESNW
FT                   TDWRTSCEAIEATAGIQLAKNQYAYRTATVEAKGTVPEMLKQILAKASGT"
FT   CDS_pept        complement(502764..503213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03669"
FT                   /product="probable bacteriophage tail completion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03669"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45541"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK02"
FT                   /protein_id="BAG45541.1"
FT                   /translation="MADRLSRVEEWASGLLGQLTSAQRARLAKELAAELRRRQSRRIAE
FT                   ARNPDGSRYAPRKPQARRKKGRIRRAMFAKLRTARFLKTTSSADASVLHFTRDVERIAR
FT                   VHQDGLRDRVRRDGPIVQYPTRELLGLADVDVDRIAEIVLESLSQ"
FT   CDS_pept        complement(503213..503623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03670"
FT                   /product="probable bacteriophage tail component protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45542"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJY9"
FT                   /protein_id="BAG45542.1"
FT                   /translation="MNKPNSLRAALTAALPEFARNPDRLHLFIEHGSIAVTAAQSLSFE
FT                   YAYTLDIVVTDYAGHSDHLIVPIIAWLKVHQPELLLNRDLCRDGFKFQAELLDNGKSDV
FT                   EILLKLTERVGVTERPDGYEIRHFGEPPIAGT"
FT   CDS_pept        complement(503620..504111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03671"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03671"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPP0"
FT                   /protein_id="BAG45543.1"
FT                   /translation="MTISTRLFVAGAIALAGAAAVIAIQHARLVGASQRVNALERDVRN
FT                   RTAERDAARRDVKVVTQYVDRVQVVREKGDTIVKEVPVYVDREADRACVVPVGFVRVHD
FT                   AAAANVPVGDPGSADAAAAGVTLSAVAATVAGNYTTCHENAEQLIALQARVRDVEQEAP
FT                   "
FT   CDS_pept        complement(504108..504908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03672"
FT                   /product="putative bacteriophage-encoded
FT                   peptidoglycan-binding protein"
FT                   /note="COG3409: Putative peptidoglycan-binding
FT                   domain-containing protein, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03672"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45544"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR024408"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKJ9"
FT                   /protein_id="BAG45544.1"
FT                   /translation="MYKTLHLGDRGADVAYLQRQLVAAGARIDADAIYGSATRGAVVAF
FT                   QASHGLVADGIAGPKTWAALAAGRRDPRHLTDADLQCAADRLQADLAAVRAVNEVESRG
FT                   AGFLPDGRPVILFERHVMYRQLAAAGLDADALAAKYPGVVNPKRGGYAGGAAEYARLAS
FT                   ASQISAACALEAASWGAFQIMGFHWNALGYPDVFAFVDAMKISEAEQLEAFVRFILGDK
FT                   ALLAALRGRKWAKFAELYNGEAYAENLYDVKLERAFDRYSRVAA"
FT   CDS_pept        complement(504901..505221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03673"
FT                   /product="bacteriophage transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03673"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45545"
FT                   /db_xref="GOA:A0A0H3KTP8"
FT                   /db_xref="InterPro:IPR008473"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTP8"
FT                   /protein_id="BAG45545.1"
FT                   /translation="MLTAVYVLLCAALALRLVIFRRRGSAHRPLASCLAYALAVAAGAA
FT                   PIRAAFGVLPPADLADTVLVGVLCLAVYGVRGNVVELFHRGNPRDSLIARVLQFKPRGR
FT                   HV"
FT   CDS_pept        complement(505221..505595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03674"
FT                   /product="bacteriophage transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03674"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45546"
FT                   /db_xref="GOA:A0A0H3KK07"
FT                   /db_xref="InterPro:IPR032637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK07"
FT                   /protein_id="BAG45546.1"
FT                   /translation="MAEPISTSSATVAALGVATLSLFPGVDANVVMGAFAGSLLFVMTS
FT                   ADPSIPKRVAFFVISFVAGCLTAELFAAGLDAVLPARIEVHAGIGALIASALVVKLLLW
FT                   LIAQADAPDRLLNVFKGRDK"
FT   CDS_pept        complement(505598..505810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03675"
FT                   /product="putative bacteriophage tail protein X"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03675"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45547"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJZ2"
FT                   /protein_id="BAG45547.1"
FT                   /translation="MWVRALQGETVDALCWRALGRTRGVVEAVLDLNRDLAQYGPILPH
FT                   GLLVELPDEVPRAAQSGAERLQLWD"
FT   CDS_pept        complement(505810..506052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03676"
FT                   /product="probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03676"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45548"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPP4"
FT                   /protein_id="BAG45548.1"
FT                   /translation="MRAMFRIRRLAQDRVVDGRRIAAPFQVQRRVAWLFWREIAVCRNR
FT                   ETASLMLHSAARARRLASLKPLLVARYDANGRELS"
FT   CDS_pept        complement(506052..506528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03677"
FT                   /product="putative bacteriophage head
FT                   completion/stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03677"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45549"
FT                   /db_xref="GOA:A0A0H3KKK3"
FT                   /db_xref="InterPro:IPR009225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKK3"
FT                   /protein_id="BAG45549.1"
FT                   /translation="MSFVSTPPLSQPSETPAPPITNDAFYPDVSLEHARDTMRLDGTVT
FT                   DARLRHELLAAIASVNDDLRAARSAWREAGITRLADVPADQLDGESVLLQHYRRAVYCL
FT                   AKATLIERYRDYDTTGDGARRADELEPQSDELRRDARWAISDIVGRPRVTVELI"
FT   CDS_pept        complement(506633..507319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03678"
FT                   /product="endonuclease subunit of bacteriophage terminase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03678"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45550"
FT                   /db_xref="GOA:A0A0H3KTQ1"
FT                   /db_xref="InterPro:IPR010270"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTQ1"
FT                   /protein_id="BAG45550.1"
FT                   /translation="MTNPFRQHFQRTVAAKAARGTPASVGGLRDDSAYTLMLAQLDEHR
FT                   RALKAVESLERKADLKRQFLPAYDAWVAGVLDGAAGAPDDVLMTIMVWRVDVGDFRGAL
FT                   KIGAYALRHDLPLPDQYKRSTPCLLVEEFAEAALRAHRAGEPIQVEPLLDIEQLTALAD
FT                   MPDEVRAKLHKAIGYGLAASHPANALDHLRRALQLFANVGVKKDIERLERELKNFASGG
FT                   QRGPDG"
FT   CDS_pept        complement(507316..508341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03679"
FT                   /product="putative major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03679"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45551"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK12"
FT                   /protein_id="BAG45551.1"
FT                   /translation="MRNDTRALYSRFVQRIQELNGISDATVKFSVDPTVQQTLETKTQE
FT                   SSAFLNSINVIGVTEMEGEKVGLGVSGPSASRTDTSKRERETRDIATLDSQRYRAEKTN
FT                   YDTHITYQRLDAWAKFPDFQARLRDAIIRRAALDRIMIGWNGVRAAADTDLAANPLLQD
FT                   VNIGWLQQYRNNAKERVFSGVKIGKGEQFKNLDAVVTLANNELLEPWYVEDPNLVVICG
FT                   RELLQDKYFPVVNKDQPPTEALAADVITAQKRIGNLPAVRVPYFPPRALMITRLDNLSL
FT                   YWQIGARRRALIDNPKRDRIENFESSNDAYVIEEFGAGCVVEDIRFVDTDPAPDAPAGG
FT                   A"
FT   CDS_pept        complement(508379..509200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03680"
FT                   /product="putative bacteriophage capsid scaffolding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45552"
FT                   /db_xref="GOA:A0A0H3KJZ6"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KJZ6"
FT                   /protein_id="BAG45552.1"
FT                   /translation="MAQDTKKTKFFRIATEGATTDGRTIDRAMLEQMARTYDPAVYGAR
FT                   INMEHIRGLYPDGAFRAYGDVIALKAEEQDGKMRLFAQLSPTKDLIAMTTEQRQKVYTS
FT                   MEVDPDFAGTGEAYLVGLAVTDNPASLGTEMLAFSAKNRAFDTRKLRPDNLFSAAIEAD
FT                   IELEDDAPTRSGDAARSLFSKVRSLLNRKEVSDDQRFSDLSQSVVAVAESQSQVLDQVE
FT                   QFSSELADVKRALKDAEARHSDLVQKLSRTDSDRQQRPMSTGGDNAALTDC"
FT   CDS_pept        509350..511116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03681"
FT                   /product="ATPase subunit of bacteriophage terminase"
FT                   /note="COG5484: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03681"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45553"
FT                   /db_xref="GOA:A0A0H3KPP8"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPP8"
FT                   /protein_id="BAG45553.1"
FT                   /translation="MTALPIDSSDVDPRRRARDLYWQGYRIARIAEMLGEKPATLYSWK
FT                   RRDRWDDTEPVDRVALSMEAQLIRLVVKEKKEGRDFKEIDLLTRQLDRLRARPANDAKL
FT                   SDSGSAGGSRRSRRADERNAFSDEQIEKLNDAFLESIFDYQRNWYRAGFKERIRNVLKS
FT                   RQIGATWYFAREALLDALNTGRNQIFLSASKAQAHVFRQYIVQFAKDAVDVELKGDPIV
FT                   LPNGATLYFLGTNARTAQSYHGNLYFDEYFWVPRFQELRKVASGMAIHDQWRQTYFSTP
FT                   SSLAHDAYPFWSGKLFNRGRPKDQHVSIDISHAALAAGRSCQDGQWRQIVTVEDAVRGG
FT                   CNSGARPLFNLDRLRLEYSPEEYANLLLCQFIDDSLSVFPLTVLQPCMVDTWEVWDDFK
FT                   PLYLRPFGDEEVWIGYDPSHTGDSAGCVVIAPPKRPGGKFRVLERFQWHGLDFEAQAAQ
FT                   IEALTRRYRVTYIGIDTTGIGQGVYQLVTKFFPAATPFHYSVEIKTALVMKAQNVIRKG
FT                   RLEFDAGWNDLAASFMAIKKTITPSGLQVTYKASRSEEASHGDLAWACMHALANEPLEG
FT                   ATATNTGFMEIF"
FT   CDS_pept        511116..512168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03682"
FT                   /product="bacteriophage capsid portal protein"
FT                   /note="COG5518: Bacteriophage capsid portal protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03682"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45554"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR030935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKK7"
FT                   /protein_id="BAG45554.1"
FT                   /translation="MSRKYRRGAGRRAHDRTEPVADMQSASATRAEVFSFGDPIAVLDR
FT                   RELLDYVECMRMGNWYEPPLPLDGLARSFRAAPHHSSAIYVKRNILVQSYIEHPLLPRA
FT                   DFSRFVLEYLVFANSYLERRTNRLGQPMALKCSLAKYTRVGVEPDQYWFVTNVREPHAF
FT                   PAGAIYHLYEPDLNQEIYGLPEYLSALNSTWLNESATLFRRRYYKNGSHAGFILYMTDP
FT                   ADKQEDVDNLRAALKNAKGPGNFRNLFMYAPKGKKDGIQLLPIGEVAAKDEFWNIKKVT
FT                   VEDQLAAHRVPPQLMGIIPSNAGGFGDVHKAAEVFNELEIEPLKARLREVNDWLGIEVV
FT                   RFRDFEPTKG"
FT   CDS_pept        complement(512639..513658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03683"
FT                   /product="probable reverse transcriptase"
FT                   /note="COG3344: Retron-type reverse transcriptase, Nostoc
FT                   sp. PCC 7120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03683"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45555"
FT                   /db_xref="GOA:A0A0H3KTQ5"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTQ5"
FT                   /protein_id="BAG45555.1"
FT                   /translation="MAKSQTTRKQYTKNRSPFFRLESRRKLATLLATTLKSLEELAGLP
FT                   SNQRYKMFFEQESGRYITEPIGELRRVHKRIAKLLCRVSPPDFLQSATKGRSYKTNAEA
FT                   HIGGQNIIKLDIKEYYPSVTFGAIYHFFLNNLKCSQDVATLLTKICTVSACGRTHLPTG
FT                   SSLSPILSYWAYSHLFDEINSLCAAKGCTMTLYIDDITVSGPNADKLLLAEIRNRIDAT
FT                   GLVAHKFKASQGMPIKVTGVIVLRDGITLPHDRARDIRKLQAELATTSPEEVDPTLSKL
FT                   VGKLNEAQQFVATYGEIKRAVLRQHSNAWNRIVTERATQSRRAMLRRRRKTAVKKASG"
FT   CDS_pept        complement(513615..513938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03684"
FT                   /product="XRE family transcriptional regulator"
FT                   /note="COG1396: Predicted transcriptional regulators,
FT                   Nostoc sp. PCC 7120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03684"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45556"
FT                   /db_xref="GOA:A0A0H3KK19"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK19"
FT                   /protein_id="BAG45556.1"
FT                   /translation="MLGRALKAMRQFHNQSQGALANTLGISNSYLSEIESGKKEPTLEI
FT                   LNRYSTVFNVPLSSILAFSETLDGSQSVSKVKSFVAKKMLKVLEWISENGEISNDKKAV
FT                   HEK"
FT   CDS_pept        514805..515368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03685"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK01"
FT                   /protein_id="BAG45557.1"
FT                   /translation="MIDEQFRFPRVHVCVAAIGDSGEALLIRGLLESLGASVSLHWVGV
FT                   PQDLLLVLNDPAPPGRYLILSGHGDASGIVFGEYSEDIDTSLLSDGRLPAAALCGKVRL
FT                   PGRIVISTACETGSPDFGRAFVGGGAAAYIAPTGLPDGADAVLFVHRLFHLILTRGLPI
FT                   DEALRHARAYDEESLMFVGYGEAV"
FT   CDS_pept        complement(515481..515972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03686"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1683: Uncharacterized conserved protein,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03686"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45558"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPQ4"
FT                   /protein_id="BAG45558.1"
FT                   /translation="MNRILVSACLAGLPVRYDGSAKTLADTLLQTWRDEGRLVVVCPEV
FT                   AAGFGTPRRPAEIRLHRSGDDVLAGAASICDDAGTDVTAMFIDGAHHALRQAAAHGCRY
FT                   ALLADGSPSCGSSFIYDGTFSGNRHAGAGVTTALLERHGIRVFAPSRLAELAALIERHG
FT                   "
FT   CDS_pept        complement(516222..516491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03687"
FT                   /product="probable membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03687"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45559"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKL1"
FT                   /protein_id="BAG45559.1"
FT                   /translation="MKRSLIALAFAGLGLSLSGLAHAVNVDVNIGTPAPVVVAPAPVVV
FT                   VGWHGDRYWDGHRYWERREWEEHQHRHGPGRYHCPPGHAKKGEC"
FT   CDS_pept        complement(516846..517589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03688"
FT                   /product="predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /note="COG1611: Predicted Rossmann fold nucleotide-binding
FT                   protein, Ralstonia solanacearum"
FT                   /note="KEGG, K06966"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03688"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45560"
FT                   /db_xref="GOA:A0A0H3KTQ7"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTQ7"
FT                   /protein_id="BAG45560.1"
FT                   /translation="MIPSLRSLADQERATAKKARASWQMFTIMAEFIEATEYLSEIRPA
FT                   VSIYGSARLKPDTPHYKLAVQIARKLSDAGFAVISGGGPGIMEAANKGAHAGKAPSVGL
FT                   NIELPHEQAGNHYQDISLRFRHFFTRKVTFVKNSDAVIVMPGGFGTLDELSEVLTLIQT
FT                   KKSRLVPIILVGSEFWKGLLQWFRDQLIPMGLINPEDMDLMQVIDDPDQVLDAVLAFYE
FT                   DGGEEEGEGSDDQPPRPEEDRMFYL"
FT   CDS_pept        517606..520359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BMULJ_03689"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0749: DNA polymerase I - 3'-5' exonuclease and
FT                   polymerase domains, Ralstonia solanacearum"
FT                   /note="KEGG, K00961"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03689"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45561"
FT                   /db_xref="GOA:A0A0H3KK24"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK24"
FT                   /protein_id="BAG45561.1"
FT                   /translation="MPEERNLEGKTLLLVDGSSYLYRAYHAMPDLRGPGGEPTGALYGI
FT                   INMLRRMRKEVSAEYSACVFDAKGKTFRDDLYADYKANRPSMPPDLALQVEPIHGAVRA
FT                   LGWPLLMVEGVEADDVIGTLAREAERRGMNVIVSTGDKDLAQLVSDRVTLVNTMTNETL
FT                   DRDGVLAKFGVPPERIVDYLALIGDTVDNVPGVEKCGPKTAVKWLTQYGSLDGVIEHAG
FT                   EIKGVVGDNLRRALDFLPLGRKLVTVETACDLAPHLESIDASLKSDGEARDLLRDIFAR
FT                   YGFKTWLREVDSAPAEGGGADAPDGEPAPVIAVDTPREYETIQTWEQFDAWFAKLEAAE
FT                   LTAFDTETTALDPMVARLVGLSFAVEPGKAAYLPVAHRGPDMPEQLPLDDVLARLKPWL
FT                   ESPDRKKVGQHLKYDAQVLANYGIELNGIEHDTLLESYVLESHRTHDMDSLALRHLGVK
FT                   TIKYEDVAGKGAKQIGFDEVALAQAAEYAAEDADITLQLHRALYPQIAREPGLERVYRE
FT                   IEMPVSLVLRKMERNGVLIDDARLQAQSNEIATRLVDLEAQAYALAGGEFNLGSPKQIG
FT                   QIFFEKLQLPVVKKTPSGAPSTDEEVLQKLAEDYPLPKLLLEHRGLSKLKSTYTDKLPR
FT                   MVNPSTGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTAEGRRIREAFIAAPGHRIVSAD
FT                   YSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNADQRRIAKVINFGL
FT                   IYGMSAFGLASNLGITRDAAKLYIDRYFARYPGVAQYMEDTRATAKERGYVETVFGRRL
FT                   WLPEINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVDGWLTRDKLASRMIMQVHD
FT                   ELVLEVPDDELSLVREKLPEMMCGVAKLKVPLVAEVGAGANWEEAH"
FT   CDS_pept        520642..521976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="BMULJ_03690"
FT                   /product="NADH dehydrogenase"
FT                   /note="COG1252: NADH dehydrogenase, FAD-containing subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03885"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45562"
FT                   /db_xref="GOA:A0A0H3KK03"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK03"
FT                   /protein_id="BAG45562.1"
FT                   /translation="MHRIIIVGGGAGGLELATRLGDRYGARGNRPARALVTLVDRNPTH
FT                   IWKPLLHEVAAGSMDPFTQELEYAAQARWHGFEFQQGELAGLDRAAKRITLSPVNDSDG
FT                   AELLPARELEYDTLVIAIGSTTHFFGVQGAPENAIALDTVGEAERFRKRLIAACMRAEH
FT                   QAPAAVAPGEPAEPRIQVVIVGGGATGVELSAELRNTAQVLSVYGLHKLDPRHDVGIVL
FT                   IESGPRILPALPERVSSATAELLEKLGVRLMLGERVTEVAPGAVHTASGKAVRADLTVW
FT                   AAGIKAPAVLAHLDGLQVNKLGQLDVRRTLQTVTDDNVFALGDCAACAWPGSERNVPPR
FT                   AQAAHQQASFLLKAIACRLDGRPLPEFTYRDFGSLVSLGHFSAVGNLMGGLIGGNMLIE
FT                   GLFARFMYMSLYRLHIAALHGYPRMILDTVAHWLRRTTLPRVKLH"
FT   CDS_pept        522205..523080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03691"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="COG0412: Dienelactone hydrolase and related enzymes,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01061"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03691"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45563"
FT                   /db_xref="GOA:A0A0H3KPQ8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPQ8"
FT                   /protein_id="BAG45563.1"
FT                   /translation="MLKPEVDSLVPHVPFSRRKFMQAALGGTFAAAVLPVSAQTITTDS
FT                   AGLDVDTVEIRSGDASVPAYRAQPVDKTNLPVVIVIHEIFGVHAHIADVCRRFAKLGYL
FT                   AIAPDLFARQGNASKYSTIKDLYDNIINKVPDRQVTEDLDATVAWAGKNGGDLTRLGVT
FT                   GFCWGGRQAWLYAEHNPHVRAAVAWYGFVEGKTDEMTPFNPVDHASLLKVPVLGLYGEK
FT                   DQNITQASLADMRKAIQTSDSKLARESEIVVYPDAGHAFFADYRPSYVKADAEDGWKRA
FT                   IAWFHKYGVM"
FT   CDS_pept        complement(523136..524005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseA"
FT                   /locus_tag="BMULJ_03692"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="COG2897: Rhodanese-related sulfurtransferase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01010"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03692"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45564"
FT                   /db_xref="GOA:A0A0H3KKL5"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKL5"
FT                   /protein_id="BAG45564.1"
FT                   /translation="MPHTHYTTLISAANLAERLAAAPGSVALFDCRFDLVDPDAGEAAY
FT                   AAGHIAGAQYLHLDRDLSGRKTGTNGRHPLPTRDALATLLASRGLKQGQQVVAYDAQGG
FT                   AYAARLWWLLRWLGHDSVAVLDGGLQAWQAAGQPLTTDVPQPAPGDFRAAAPLESTVDA
FT                   ATVLANLSTPTRVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLTADGRFKTGH
FT                   ELRETFTALLAGTEPNRVILQCGSGVTACHNALAMEVAGLHGASLYPGSWSEWSADPSR
FT                   PIATGATP"
FT   CDS_pept        complement(524109..525215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03693"
FT                   /product="ring-hydroxylating dioxygenase large subunit"
FT                   /EC_number="1.14.15.7"
FT                   /note="COG4638: Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00499"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03693"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45565"
FT                   /db_xref="GOA:A0A0H3KTR0"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTR0"
FT                   /protein_id="BAG45565.1"
FT                   /translation="MSNLSDALQLKSAHSQLPVTAYFDEALLAREIETLFKKGPRYVGH
FT                   ELMVPEAGDYFALPSEKEGRVLVRNQANEIELLSNVCRHRQAIMLNGRGHTQNIVCPLH
FT                   RWTYDLEGQLLGAPHFPDKPCLNLGKTPLQNWQGLLFEAEGRNVARDLANLGTKHHFDF
FT                   SEYQFDHVEVHECDYNWKTFIEVYLEDYHVVPFHPGLGNFVSCDDLKWEFGDWYSVQTV
FT                   GVHNALAKPGSATYRKWHEQVLKFRDGVPPEFGAIWMVYYPGLMIEWYPHVLVVSWLIP
FT                   RGPQKTTNIVEFYYPEEIALFEREFVEAERAAYMETAVEDDEIAMRMDAGRRALMERGE
FT                   SQVGPYQSPMEDGMQHFHEFLRRQLGDL"
FT   CDS_pept        525486..525767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="BMULJ_03694"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /note="KEGG, K03602"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03694"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45566"
FT                   /db_xref="GOA:A9ANA4"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ANA4"
FT                   /protein_id="BAG45566.1"
FT                   /translation="MAKTASPGATPPGNGAEPLPDNYETALAELETLVARMEGGALSLE
FT                   DSLAAYRRGAALVAFCQQQLEKVEQQVRVLDGATLKPAAATDGEDDDL"
FT   CDS_pept        525764..526648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="BMULJ_03695"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /note="COG0142: Geranylgeranyl pyrophosphate synthase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00795"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03695"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45567"
FT                   /db_xref="GOA:A0A0H3KK30"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK30"
FT                   /protein_id="BAG45567.1"
FT                   /translation="MTFEQWMRSVLDRVEDALGHYLPADTVVPARLHEAMRYAVLGGGK
FT                   RVRPLLCHAAGELTGATEAARNAAAAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVQ
FT                   YDEPTALLVGDALQSQAFVALTDAAALSPVQQAALVRELALASGSLGMAGGQAIDLASV
FT                   GIKLTREQLETMHRMKTGALLRAAVRMGALAGETPSADTMAALDVYAGAVGLAFQVVDD
FT                   ILDVTTDSATLGKTAGKDAANDKPTYVSILGLDASRELAAQLRAEAHDALKPFGARAQR
FT                   LAELADLVVNRVS"
FT   CDS_pept        526731..528635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="BMULJ_03696"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="COG1154: Deoxyxylulose-5-phosphate synthase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01662"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03696"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45568"
FT                   /db_xref="GOA:A0A0H3KK09"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK09"
FT                   /protein_id="BAG45568.1"
FT                   /translation="MYDLLKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLS
FT                   SNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDEMPTLRQLGGISGFPRR
FT                   SESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGV
FT                   SEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVLSVAPPVLELAR
FT                   KLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELRGPQFLHVVTKKGQ
FT                   GYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDEAERDSRVVGITPA
FT                   MREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLI
FT                   HDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHT
FT                   ALQQPNPTAVRYPRGAGTGVATVKEFTELPIGKGEVRRRTSQPEGKRIAILAFGTMVAP
FT                   SLAAAEELDATVANMRFVKPLDAALVRELAETHDFLVTAEEGCVMGGAGSACVEALMES
FT                   GVIRPVLQLGLPDQFIDHGDPAKLLSLCGLDGVGIAKSIRERFLNPATGVAGQAKRVA"
FT   CDS_pept        528791..529600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03697"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1469: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K09007"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03697"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45569"
FT                   /db_xref="GOA:A9ANA1"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ANA1"
FT                   /protein_id="BAG45569.1"
FT                   /translation="MNQMNPAFVMPDVQSTVDTRQIPIQRVGVKAVRHPLTVLTESGDV
FT                   QPTVGVWNLDVRLPAEQKGTHMSRFVALLEENRAPLTIERFRAMIASMLEKLEAEAGRI
FT                   EVTFPYFVNKTAPVSGVQSLLDYEVTLAGESRNGDTRLFLKVLVPVTSLCPCSKKISQY
FT                   GAHNQRSHVTIDAELAADVPVEALIRIAEEEASCELWGLLKRPDEKFVTERAYENPKFV
FT                   EDLVRDVAARLDADARIVAYVLEAENFESIHNHSAYALIERDKRHAA"
FT   CDS_pept        complement(529705..530745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="BMULJ_03698"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="COG0533: Metal-dependent proteases with possible
FT                   chaperone activity, Ralstonia solanacearum"
FT                   /note="KEGG, K01409"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03698"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45570"
FT                   /db_xref="GOA:A9ANA0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ANA0"
FT                   /protein_id="BAG45570.1"
FT                   /translation="MLVLGIESSCDETGLALYDTQRGLLAHALHSQIAMHRDYGGVVPE
FT                   LASRDHIRRALPLLEEVIAKSGARREDIDAIAFTQGPGLAGALLVGASIANALALAWNK
FT                   PTVGIHHLEGHLLSPLLVAEPPPFPFVALLVSGGHTQLMRVTDVGVYETLGETLDDAAG
FT                   EAFDKTAKLIGLGYPGGPEVSKLAETGTPGAVVLPRPMLHSGDLDFSFSGLKTAVLTQM
FT                   KKFEAAQLSGDALARAKADLARGFVDAAVDVLVAKSLAALKKTKLKRLVVAGGVGANRQ
FT                   LRAALSAAAAKRGFDVHYPDLALCTDNGAMIALAGALRLARWPEQANVDYAFTVKPRWD
FT                   LASLAR"
FT   CDS_pept        530876..532096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03699"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2081: Predicted flavoproteins, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K07007"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03699"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45571"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPR2"
FT                   /protein_id="BAG45571.1"
FT                   /translation="METYDIAVIGAGAAGMMSAAVAGQLGRRVVLIDHAPRLAEKIRIS
FT                   GGGRCNFTNLHAGPDNYLSANPHFARSALARYTPRDFLALLKQHRVTWHEKHKGQLFCD
FT                   HGSDAIIDMLKHECDAGGIAWRRPVVVDAVRHAADDGFTLDTQQAGPIRARALIVATGG
FT                   LSIPKIGATDFGYRLAKQFGHKLVDTRPALVPLTFAQQDWAPFAALSGVSLEVRVSTGD
FT                   KKRGGEFVEDLLLTHRGLSGPGILQISSYWHPGEPIRIDLVPQRDTVAELLEAKRTSKR
FT                   QIGSLLADWVPSRLAHVWLDTHRVAADARLADLPDKVLRQIGDALAGWTLTPNGTEGYK
FT                   KAEVTKGGVDTRELSSATMMSARVPGLFFVGEAVDVTGWLGGYNFQWAWASGQAAGKAA
FT                   AEFARGA"
FT   CDS_pept        532172..532384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="BMULJ_03700"
FT                   /product="small subunit ribosomal protein S21"
FT                   /note="COG0828: Ribosomal protein S21, Neisseria
FT                   meningitidis Z2491"
FT                   /note="KEGG, K02970"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45572"
FT                   /db_xref="GOA:A0A0H3KKM1"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKM1"
FT                   /protein_id="BAG45572.1"
FT                   /translation="MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAER
FT                   KRKKAAAVKRHYKRIRSQMLPKKLY"
FT   CDS_pept        532557..533003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03701"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1610: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K09117"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03701"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45573"
FT                   /db_xref="GOA:A0A0H3KTR3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTR3"
FT                   /protein_id="BAG45573.1"
FT                   /translation="MSLKEQISDDMKAAMRAKESERLATIRLLMAAIKQREVDDQVTLD
FT                   DAGITAVIDKMIKQRKDSISQFQAAGRDDLVAKEQAELTVLSAYMPAQLSDAEVAAEVQ
FT                   AAVAQTGAAGPQDMGKVMGVLKGKLAGRADMTAVSAQVKAALSK"
FT   CDS_pept        533071..534939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="BMULJ_03702"
FT                   /product="DNA primase"
FT                   /note="COG0358: DNA primase (bacterial type), Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K02316"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03702"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45574"
FT                   /db_xref="GOA:A0A0H3KK34"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK34"
FT                   /protein_id="BAG45574.1"
FT                   /translation="MIPHSFLQDLLNRVDIVDVVGRYVQLKKGGANFMGLCPFHNEKSP
FT                   SFTVSPTKQFYHCFGCGAHGTAIGFLMEHAGLTFPEAVQELAQSVGLTVPHEPSTRGGG
FT                   GAGGDYPAPVSKSVATALSDVMATACDYYRKQLRGAPAAIQYLKNRGLTGEIAARFGLG
FT                   YAPDGWQNLEAAFPNYRDDALVESGLVIVSEKTDAQGAARRYDRFRERIMFPIRNVKGQ
FT                   VIGFGGRVLGSGEPKYLNSPETPLFNKGSELYGLFEARLAIRERKYVLVVEGYMDVVAL
FT                   AQLGFPNAVATLGTACTPIHVQKLLRQTDTVIFSFDGDSAGRRAARRALEACLPHAADN
FT                   RTIRFLFLPPEHDPDSYVREFGADAFSDQVERAMPLSQFLLNEAIAGKALDQPEGRAKA
FT                   LFDAKPLLQALPANALRAQIMHMIADRLDIPFEEVAALSEVDARIAAAPRQAPARSDRR
FT                   RVTESEKRALRTLVMHPRIALALDDEQVATLRALPRIGELFAEVVDHARALGDGAEFRL
FT                   LSDVLRTSPNSATYEEIFREILDYDENVRDLLLQNPDDEAVAERQREQERIAGEELQAA
FT                   VLKMRYDACCDRLDRLARQSAFTPEELAELKHLNEQRTDMKRRLGL"
FT   CDS_pept        535029..537443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="BMULJ_03703"
FT                   /product="RNA polymerase primary sigma factor"
FT                   /note="COG0568: DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32), Ralstonia solanacearum"
FT                   /note="KEGG, K03086"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03703"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45575"
FT                   /db_xref="GOA:A0A0H3KK14"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK14"
FT                   /protein_id="BAG45575.1"
FT                   /translation="MAKTTGGKKATGKGSTEPTKKVTAAKSASSARTTSSATSTPAGKK
FT                   TAAGTAQAAPAPAARTRAAARPDSGPAKPAAKRASAKSARDAAAAADETAVRTTHAPTV
FT                   QPAVVQQPRVDIAGTANSMTKKLNEVSVDDDANQSDEQPAAAAAPGKSKVRDRRAKEKA
FT                   LLKEAFATSTPGTAEELEERRVKLRALIKLGKERGFLTYAEINDHLPDNFTETEALEGI
FT                   IGTFNDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVR
FT                   MYMREMGTVELLTREGEIEIAKRIEDGLRHMVMAISACPTTIADILAMAERVANDEIRV
FT                   DELVDGLLDPNASDTDTDGFSAKEAEEIENEDEEVEEEEEEEEEEDDDGAAQATANAAQ
FT                   LEALKRASLEKFALISEWFDKMRRAFEKEGYKSKSYLKAQETIQSELMTIRFTARTVER
FT                   LCDTLRAQVDEVRQVERQILHIVVDKCGMPRSEFIARFPGNETDLDWAEKIAAEGHSYS
FT                   AILSRNIPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLRL
FT                   VISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIAD
FT                   QARTIRIPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEP
FT                   ISMETPIGDDDDSHLGDFIEDTNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMRF
FT                   GIEMSTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN"
FT   tRNA            537572..537647
FT                   /locus_tag="BMULJ_03704"
FT                   /product="tRNA-Met"
FT                   /note="anticodon CAT"
FT   CDS_pept        complement(538694..539662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ophA1"
FT                   /locus_tag="BMULJ_03705"
FT                   /product="FAD/NAD(P)-binding oxidoreductase"
FT                   /note="COG1018: Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03705"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45576"
FT                   /db_xref="GOA:A0A0H3KPR5"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPR5"
FT                   /protein_id="BAG45576.1"
FT                   /translation="MTTPQEDGFLRLKIASKEKIARDIWSFELTDPQGAPLPPFEAGAN
FT                   LTVAVPNGSRRTYSLCNDSQERNRYVIAVKRDSNGRGGSISFIDDTSEGDAVEVSLPRN
FT                   EFPLDKRAKSFILVAGGIGITPMLSMARQLRAEGLRSFRLYYLTRDPEGTAFFDELTSD
FT                   EWRSDVKIHHDHGDPTKAFDFWSVFEKSKPAQHVYCCGPQALMDTVRDMTGHWPSGTVH
FT                   FESFGATNTNARENTPFTVRLSRSGTSFEIPANRSILEVLRDANVRVPSSCESGTCGSC
FT                   KTALCSGEADHRDMVLRDDEKGTQIMVCVSRAKSAELVLDL"
FT   CDS_pept        539901..541247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ophD"
FT                   /locus_tag="BMULJ_03706"
FT                   /product="phthalate transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Yersinia pestis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03706"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45577"
FT                   /db_xref="GOA:A0A0H3KKM8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKM8"
FT                   /protein_id="BAG45577.1"
FT                   /translation="MAHSTLHSGDISLSAVADSAAEEATYRKITLRLMSFLFLCWVLNY
FT                   LDRVNVSFAQLQLKHDLGLSDAAYGLGVSLFFIGYILLEVPSTLLLRRIGARKTVTRIM
FT                   LLWGAISTAMAFMTAPWQFYLARTLLGAAEAGFWPGIILYLSYWYPSKRRARITSRFLL
FT                   AIAVAGIVGGPLSGFILQNFMDVWGFRNWQWLFFLEGVPAVIAGVVAYFYLIDRPQDAK
FT                   WLTEDQKRIVIDALDEEGRSKPHNSPSTLLAALRDPRVYVIAAGWATVPICGTILNYWT
FT                   PTIIKQSGVSNLLQIGFLSALPYIVGAVAMLLIARSSDLRLERRWHFVLSTTAGATGAV
FT                   LLTVLTHNSVAAIACLSLVSVSYFAAAAIIWTIPPNYLQGAAAAGGIGVISSLGQVGAF
FT                   FAPIVLGWVKSVTGSFSAGILLVAALVFIGGIVVFFCVPRERQAQRSGA"
FT   CDS_pept        541294..542286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ophC"
FT                   /locus_tag="BMULJ_03707"
FT                   /product="4,5-dihydroxyphthalate decarboxylase"
FT                   /EC_number="4.1.1.55"
FT                   /note="KEGG, K04102"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03707"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45578"
FT                   /db_xref="GOA:A0A0H3KTR5"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTR5"
FT                   /protein_id="BAG45578.1"
FT                   /translation="MSKLQLSIAVGNYDRMRPLIDGDVQIDGVDPVFMLQDPEEIFFRA
FT                   FRHADYDICELSLSSYSVKTAAGTSPYIAVPVFPSRAFRHSSVYVRSDRGIDRPEDLKG
FT                   KRIGVPEYQLTANVWVRLFLEEEYGVKASDIRWVRGGYEDPTRVEKISLKLPDGVVLEN
FT                   APEGQTISNLLADGEIDGVIGPRAPSCFDRGHPKVKYLFDDPQKSAAEWYERRKVFPIM
FT                   HTLGIRKTLADQHPWLPGAIAKAFEQSKEVALARLSDTSATKVTLPFIEDQLRNARRLM
FT                   GHDFWSYGFANNEHVIDRFLAQHHAEGLSSRRLQPAELFHPASLERFKI"
FT   CDS_pept        542484..543080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03708"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03708"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45579"
FT                   /db_xref="GOA:A0A0H3KK38"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK38"
FT                   /protein_id="BAG45579.1"
FT                   /translation="MAAARTAGKGKGGVMSDDPILRHWREAVPDDRLAHLVKDAGRAMI
FT                   RGLQMRLAQHEVSFGHWAYLRVLWVTDGLTQKELSDETGTTTPTTFSAVSAMEKLGYVE
FT                   RRYEPGNRKNTHVYLTPRGRSLKKKLVPLAEEVNEISVRGLKTTEINVARKVLLTIIEN
FT                   MARDESESDDPALRIPSTREVGNLIAARGEEIGQD"
FT   CDS_pept        543232..544068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="BMULJ_03709"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="COG0157: Nicotinate-nucleotide pyrophosphorylase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00767"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03709"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45580"
FT                   /db_xref="GOA:A0A0H3KK18"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK18"
FT                   /protein_id="BAG45580.1"
FT                   /translation="MTRAAMTRNVRDALAEDIGEADWTSLLIDPDASAEAVLTVREPAL
FT                   LCGRPWFDETFQQVDPRITIEWLVGEGERMHEGQAVCRIAGLARGMLTAERTALNFIQL
FT                   LSGVATETSLMTQIVEGTSARILDTRKTLPGLRLAQKYAVRVGGGENHRRGLYDGILIK
FT                   ENHIAAGGGIASTLRATEALGAGVPVQVEVETLDELKEALAGGAAAILLDNFSIEAMRE
FT                   AVRVTAGRAELEVSGGVTEQTLRTIAETGVDRISLGKLTKNVRAIDFSLRFAEFAG"
FT   repeat_region   544093..544100
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  544101..545455
FT                   /mobile_element_type="insertion sequence: ISBmu12c"
FT                   /note="IS256 family"
FT   repeat_region   544101..544128
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12c, terminal inverted repeat"
FT   CDS_pept        544157..545416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03710"
FT                   /product="ISBmu12c transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45581"
FT                   /db_xref="GOA:A0A0H3KPR8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPR8"
FT                   /protein_id="BAG45581.1"
FT                   /translation="MPRKRKEEVPVEPGKGLNLDPELIKQLVPGTLDRASINEQFAALK
FT                   KAIFERALGGELTHHLGYEKGEAKPVGRTNHRNGTSRKRIATDNDLLDVEIPRDREGTF
FT                   DPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDE
FT                   VREWQQRPLEPMYPVVFFDALRVKIRDEGVVRNKAIYLALGVRRDGTRDVLGLWIEQTE
FT                   GAKFWLRVVNDLKLRGVQDILIAVVDGLKGFPEAINTVFPETTVQTCIVHLIRNSLDFA
FT                   SWKDRKSVAAALKEVYRAPSAEAAAVALDAFDTSPWGTKYPPIAALWRRAWDQVIPFYA
FT                   FAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHD
FT                   WKSAMTQFALLYPERFNIGI"
FT   repeat_region   545428..545455
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12c, terminal inverted repeat"
FT   repeat_region   545456..545463
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(545591..546766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ophB"
FT                   /locus_tag="BMULJ_03711"
FT                   /product="cis-phthalate dihydrodiol dehydrogenase"
FT                   /note="COG0673: Predicted dehydrogenases and related
FT                   proteins, Brucella melitensis"
FT                   /note="OphB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03711"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45582"
FT                   /db_xref="GOA:A0A0H3KKN4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKN4"
FT                   /protein_id="BAG45582.1"
FT                   /translation="MEQRRLRIGVAGLGRAFSLMLPTFLRDSRVQLVAACDPRDEARRQ
FT                   FAADFAAPTYADVAELANDPNVEIIYVASPHQFHAQHTEIAAAKGKHVLVEKPMALAAA
FT                   DCDRMIAACRAANVHLIVGHCHSFDTPYLRTRELISLGDFGAVKMIQAVNYTDYLYRPR
FT                   RPEELATAEGGGAVFSQAAHQVDIVRMLAGSRATRLRASVGRWDPSRPTEGAYSALIWF
FT                   ENGAYASLSYNGYGHFNTDEWSGWIGEMGDRTSPDTYGSARRRLETLASSSDEARLKAA
FT                   GTYGGSAYKPPTATADEPQRFHQHFGPVIVSCERADLRPLPDSIVVYGDELRETLPLAA
FT                   PAVPRAEVIDELYGAVVDGRGPLHDGEWAKGTLEICIAILKSSDTGTDVTL"
FT   CDS_pept        complement(546783..548114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ophA2"
FT                   /locus_tag="BMULJ_03712"
FT                   /product="phthalate dioxygenase oxygenase"
FT                   /note="OphA2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03712"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45583"
FT                   /db_xref="GOA:A0A0H3KTR8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTR8"
FT                   /protein_id="BAG45583.1"
FT                   /translation="MLTHQENELLCRVEGDAPMGQLMRRHWTPVCLIEEVSEPDGAPVK
FT                   ARVFGEDLVVFRDSEGNVGVLDEYCPHRRASLVYGRNEDSGLRCLYHGWKFDVAGNVLE
FT                   MVSEPAASSMTDKVKHKAYPVQEWGGMVWAYMGPQDAIPEFVPPAWAPTADTRVSIAKA
FT                   LLPCNWAQILEGAIDSAHSSSLHSSDFVPARVGGAEATDKNWLRPSTDKAPRLQVERTD
FT                   YGFRYAALRRPIFNANTHDYVRCTVFVAPGTVLIPPNNLYNVANINVPMDDTNTAFYFI
FT                   AWGDPETTPENETWRKFLRQQVGVDLDQYYRPLRNHDNRFWQDRQAMKAGNFTGISGFP
FT                   NQDIAMWVTMGPIANRSDERLGGSDLAIVEFRRRMLDAITEFQQGDGTIGTGAKAIPRE
FT                   VCSYQAVVPKEIDWRTYAARYVSKKNPEPADQPSALATDYQVKQ"
FT   CDS_pept        548511..548891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03713"
FT                   /product="hemerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03713"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45584"
FT                   /db_xref="GOA:A0A0H3KK42"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK42"
FT                   /protein_id="BAG45584.1"
FT                   /translation="MDDVHKEFYEVALRLVTCTDASALAAIEEFEKHAVSHFEQEDEWM
FT                   RTTNFPPRDCHIDEHEAVLKSVRDVKAAVEAGQAGCGLVHDIGMHLYNWFPGHADYLDS
FT                   ALAAWMTKQTMGGKPVVLRRTI"
FT   CDS_pept        549091..549669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03714"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03714"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK22"
FT                   /protein_id="BAG45585.1"
FT                   /translation="MHQQHAQIPRDTEQTILPSEGAGLVLRQACLAAAIFSWKPVLQRQ
FT                   TRARRGCWRHCYWRTTCRCSVRISLGQKCVTLRLLLGGGTAEHAGPGAAERDRPPYRSR
FT                   YARCLEIAERRCPHREVRGPQSAGRVLADQSTRPVKYQLQQLPIVTRAAWPRHEAGDAF
FT                   VAVSPRELFETAPTPPRVQRRVRSSGVPR"
FT   CDS_pept        complement(550187..551176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tas8"
FT                   /locus_tag="BMULJ_03715"
FT                   /product="oxidoreductase"
FT                   /note="COG0667: Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases), Xylella fastidiosa 9a5c"
FT                   /note="related to aryl-alcohol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03715"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45586"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPS3"
FT                   /protein_id="BAG45586.1"
FT                   /translation="MEYKHLGRTGLKISRLALGTMNFGELTDEATSFAIMDEALGAGIN
FT                   FFDTADVYGGPQAPDMDKGYGVSEDIIGRWLAQGGGRRERIVLATKVYQPMDTGPNDRR
FT                   LSAYHIRRACEASLRRLKTDHIDLYQMHHVDRFTPWDEIWQAMETLIRDGKITYVGSSN
FT                   FAGWHIATAQCTAASRNLLGLASEQSLYNLTQRAIELEVIPALRHFGIGLIPWSPIGMG
FT                   LLGGVLKKLADGRRATAQLQQQIDELRPQLEAYEALCAQLNEAPSDVALAWLLHNPAVT
FT                   AAISGPRTVEQLRQNLRAPSLTLSAETLAKLDAIWPGPGGEAPEAYAW"
FT   CDS_pept        complement(551226..552275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="BMULJ_03716"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="COG1064: Zn-dependent alcohol dehydrogenases,
FT                   Xylella fastidiosa 9a5c"
FT                   /note="KEGG, K00001"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03716"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45587"
FT                   /db_xref="GOA:A0A0H3KKN9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKN9"
FT                   /protein_id="BAG45587.1"
FT                   /translation="MTVKAYGAYAGDKALESMDIVRRAPGAHDVKIDIAFCGVCHSDIH
FT                   QVRAEWAGTLFPCVPGHEIVGRVSAVGANVSGFKVGELVGVGCIVDSCRHCADCDEGLE
FT                   NYCDHMVGTYNGPTADAPGHTLGGYSQEIVVHERYVLRIRHDEAQLAAVAPLLCAGITT
FT                   YSPLRHWKVGPGHKVGIVGIGGLGHMGIKLANAMGAYVVAFTTSGSKREAAKALGAHEV
FT                   VVSRNADEMSAHAKSLDFILNTVAAPHDLDAFFTLLKRDGTMTLVGAPASPHPSPQVFN
FT                   LIMKRRSLAGSMIGGIPETQEMLDFCAEHGIVSDIEMIRADQINDAYERMLKGDVKYRF
FT                   VIDSSSLAQ"
FT   CDS_pept        complement(552301..553524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03717"
FT                   /product="major facilitator family transporter"
FT                   /note="COG2814: Arabinose efflux permease, Xylella
FT                   fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03717"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45588"
FT                   /db_xref="GOA:A0A0H3KTS0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTS0"
FT                   /protein_id="BAG45588.1"
FT                   /translation="MSTELCDTPAREFPAQQTSPTQPAFWGGVFAMTICVFALIASEFM
FT                   PVSLLTPMATDFHVTEGLAGRGIAISGAFAVLTSLFISSVAGSMNRKTLLLTLTVLMAL
FT                   SGAVIAVAPNYVTYMVGRALIGVVVGGFWSMSAATAMRLVPAADVPRALAIFNSGNALA
FT                   TVIAAPLGSYLGSVIGWRGAFFSLVPIALIALVWQWKSLPEMPVNARRAQSVRIFSLFR
FT                   RRIVTLGMLASGMFFMGQFALFTYVRPFLETVTRVDVSTLSLILLVIGITGFIGTALIG
FT                   GVLKRSFYPTLIAIPVLMAAVAAALMIVGDRTTAVVVLLGSWGLLATAAPVGWWGWVAR
FT                   TFPDNAEAGGGLLVAIVQLAIASGSTGGGLLFDSHGYRGTFLASVVLLLIAAFLTFLTS
FT                   RSDTASAS"
FT   CDS_pept        553733..554626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03718"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Xylella
FT                   fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03718"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45589"
FT                   /db_xref="GOA:A0A0H3KK46"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK46"
FT                   /protein_id="BAG45589.1"
FT                   /translation="MARRNLNDLLAFVTIAREGSFTRAAATLGVTQSALSQTIRAMEES
FT                   LQIRLLSRTTRSVSPTPAGERLLQAIGHRLDEIDAELDALTELREKPAGTVRITCGDYM
FT                   LHSILLPKLAPMLQEYPEIKLEFDVNYGFRDIVADRFDAGVRLGSTIDKDMIAVPIGPA
FT                   LRMAVVGSPAYFANRPIPKKPQDLMHHNCINQRMPTSGGLYVWDFERRGQKLNVRVDGQ
FT                   LIFNTTQPQVDAALGGLGLTLLPEDELMPHIVSGRLVRVLEDWCPRFDGYHLYYPSRRQ
FT                   PSPAFSMVLDALRIRG"
FT   CDS_pept        complement(554735..555283)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03719"
FT                   /note="inactivated putative transporter"
FT   repeat_region   555297..555302
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  555303..557999
FT                   /mobile_element_type="insertion sequence: ISBmu3"
FT                   /note="IS21 family"
FT   repeat_region   555303..555351
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu3, terminal inverted repeat"
FT   CDS_pept        555586..557136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03720"
FT                   /product="ISBmu3 transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45590"
FT                   /db_xref="GOA:A0A0H3KK26"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK26"
FT                   /protein_id="BAG45590.1"
FT                   /translation="MPAHRMSMRKLKEVLRLKWACGLSHRQISRAIGISVGAISAYAAR
FT                   ASAAGLDWATVEPLADDELEIRLDLPEETAVPTRRVEPDYAAMHRDLRRKGVTLQLLWE
FT                   EYVEAHPGQRTYRYTQFCQRYKDWAAALKRSMRQQHRAGEKLFADFAGQTVPILGRDGG
FT                   IAFKAHVFVAVLGASNYTYACATRSEAMPDWIGSLIDALEFYGGVPELLVPDNPKALIA
FT                   KADRYEPVLGNTTQDFVNHYATAMLPARPRKPQDKAKVEVGVQIVERWILARLRNHRFY
FT                   SLAELNKAIGKLITDLNRRPFKKLDGNRREWFERLDRPALRPLPTRRYEIATFVKCRVN
FT                   IDYHVEVDHHYYSVPHSLVRQEVYARVTRHGVEILHRGKRVAAHARSRLRNKHTTLPEH
FT                   MPAAHRAHMEWTPGRLLNWGASVGPGAEAIVKHLLTNRPHPEMGYRACLGLLSLSRKYG
FT                   KERLEAACQRALVIGSPTRRSVLSILESGLDRQPMLPIPPAEWHSPDHENVRGPEYYH"
FT   CDS_pept        557152..557901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03721"
FT                   /product="ISBmu3 transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03721"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45591"
FT                   /db_xref="GOA:A0A0H3KPS6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPS6"
FT                   /protein_id="BAG45591.1"
FT                   /translation="MLMQQTLTQLKSLKLDGMARAFEEQTALTASTSLSFEERFGMVVE
FT                   RELAWRDTRRLERLLKSAKLKNPQACIEDIEYRQSRGIDKSVVAALAGCDWIRNAQNLI
FT                   LTGPTGAGKTWIACAFGQQACRQGFSVMYVRVARLFEELKIAHGDGSFTRRLAQLAKMD
FT                   VLLLDDWGLQDLDQGARNDLLEVLDDRVGTRSTIITSQLPLEHWHAWLQDPTLADAILD
FT                   RLVHQAHKLPLKGESMRKTNAKQSSAS"
FT   repeat_region   557952..557999
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu3, terminal inverted repeat"
FT   CDS_pept        complement(557957..558634)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03722"
FT                   /note="inactivated transporter"
FT   repeat_region   558000..558005
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(558639..558866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03723"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03723"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45592"
FT                   /db_xref="GOA:A0A0H3KKP4"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR017284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKP4"
FT                   /protein_id="BAG45592.1"
FT                   /translation="MPHVIVKAWPGKTEEQKRRLAEAITRDVMDILGYGEESVSVGFEE
FT                   IPSDRWKKEVYGPDIEARSETLYKKPGYRM"
FT   CDS_pept        complement(559134..559544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03724"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1917: Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03724"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45593"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTS3"
FT                   /protein_id="BAG45593.1"
FT                   /translation="MELKRAGSQPSRKGPEEWFTGTVRLDPINAPPPPARVSCASVTFE
FT                   PGARTNWHTHPLGQTLIVTAGCGWTQCDGEPRVEIRAGDVIWCPPGHKHWHGATSTTAM
FT                   THIAIQEALDGKNVEWLERVTDEQYLGSGESK"
FT   CDS_pept        559660..560562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03725"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03725"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45594"
FT                   /db_xref="GOA:A0A0H3KK50"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK50"
FT                   /protein_id="BAG45594.1"
FT                   /translation="MKEDFNDLVGFMTVARERNFTRAAAQMGVSQSALSRTVAGLERRM
FT                   GLQLLTRTTRSVSLTEAGDRLLSAIAPRFEEIEAEVDSLRAMTNQPSGTVRITTTDYAA
FT                   KSYVWPRLQSLLRQYPELKIELVNDYGLSDIVADRYDIGVRLGDQVAKDMVAVRIAPDM
FT                   TMTVVGSPSYLQSKPHARTPQDLTLHNCINLRLPTRESLLPWELRKGRRELKVRVEGQL
FT                   TFNNVYQMVEAALGGFGLAYVPKDLVEDKVRAGRLCWVLEDWYPTFVGHHAYYPNRRKS
FT                   SRAVELVIEALKTGYQRKA"
FT   CDS_pept        560952..561440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03726"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK29"
FT                   /protein_id="BAG45595.1"
FT                   /translation="MCRSRAERRTLLREAGYIGNAVLGTSASYRGLRVGFTWGFGGVAG
FT                   AFTQNEVMSLGLAYNNGPFAFGAGYLFAKNPNFSLFGTSATSNAPAAANALNITSPVFS
FT                   GYAAAASQRVFGAGASYQIGKATIGTLLTSTQLNDIGGTPVNGAAPAIGVVGTLSAAR"
FT   repeat_region   561454..561482
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu24, terminal inverted repeat"
FT   CDS_pept        561529..562383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03727"
FT                   /product="ISBmu24 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03727"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45596"
FT                   /db_xref="GOA:A0A0H3KPT0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPT0"
FT                   /protein_id="BAG45596.1"
FT                   /translation="MEIRVLARQGLGIREISRELGLSRNTVRKYLRSCAEQDRAPRSGR
FT                   TQKLDPFKVYLHDRVRAAHPAWLPATALLIEIRAMGYDGGLTRLRVYLRSLKSIKAPEP
FT                   LVRFETDPGQQMQVDWIVFRRGKLPLSAFVATLGYIATQMGIRTRFISAADLVIALAAA
FT                   SRQDRLAEFLKRNISQPRLLIIDEVGYLPLARDDANLFFQVIAKRYEKGSVIMTSNLPF
FT                   GQWDQTFAGDQTLTAALLDRLLHHSHVLQIKGESYRLKDKRKAGVIRSRASESADQQLE
FT                   IHA"
FT   mobile_element  561529..562383
FT                   /mobile_element_type="insertion sequence: ISBmu24"
FT                   /note="IS21 family, this IS seems to have undergone
FT                   internal deletion leading to fusion of two ORFs. The
FT                   N-terminal half and the C-terminal half shows similarity to
FT                   1st and 2nd Orfs of IS21 family Insertion sequences,
FT                   respectively."
FT   repeat_region   562486..562514
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu24, terminal inverted repeat"
FT   CDS_pept        562549..562869
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03728"
FT                   /note="truncated protein"
FT   CDS_pept        complement(563220..563441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03729"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03729"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKP9"
FT                   /protein_id="BAG45597.1"
FT                   /translation="MSFHYVPIARTDLNWEDSAINRKQRYVVREIHNDFSELEHNRPVL
FT                   LHVRLRHPPDATATYSGLYRIKACEIDR"
FT   mobile_element  complement(563612..564966)
FT                   /mobile_element_type="insertion sequence: ISBmu12b"
FT                   /note="IS256 family"
FT   repeat_region   complement(563612..563639)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12b, terminal inverted repeat"
FT   CDS_pept        complement(563651..564910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03730"
FT                   /product="ISBmu12b transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45598"
FT                   /db_xref="GOA:A0A0H3KTS5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTS5"
FT                   /protein_id="BAG45598.1"
FT                   /translation="MPRKRKEEVTIEPGKGLNLDPELIKQLVPGTLDRASINEQFAALK
FT                   KAIFERALGGELTHHLGYEKGEAKPVGRTNHRNGTSRKRIATDNDLLDVEIPRDREGTF
FT                   DPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLDMYGIEVSPDFISTVTDAVIDE
FT                   VREWQQRPLEPMYPVVFFDALRVKIRDEGVVRNKAIYLALGVRRDGTRDVLGLWIEQTE
FT                   GAKFWLRVVNDLKLRGVQDILIAVVDGLKGFPEAINTVFPETTVQTCIVHLIRNSLDFA
FT                   SWKDRKSVAAALKEVYRAPSAEAAAVALDAFDTSPWGTKYPPIAALWRRAWDQVIPFYA
FT                   FAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHD
FT                   WKSAMTQFALLYPERFNIGI"
FT   CDS_pept        complement(564934..565308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03731"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45599"
FT                   /db_xref="GOA:A0A0H3KK54"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK54"
FT                   /protein_id="BAG45599.1"
FT                   /translation="MSDAISNTATPMVSQRNPKTNESASDAILRHWREAVPNDRLAHLI
FT                   KDAARAMVRGLHMRLAQYEVSFGHWAFLRILWEEDGLTQKELSVEAGVMTPTTFTAVSA
FT                   MEKLGYVERREPIRTFVCEA"
FT   repeat_region   complement(564939..564966)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12b, terminal inverted repeat"
FT   CDS_pept        complement(565416..566480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03732"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03732"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45600"
FT                   /db_xref="GOA:A0A0H3KK33"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK33"
FT                   /protein_id="BAG45600.1"
FT                   /translation="MRHIPSTSLVAGALVLASIPAHAQSSVTLYGITDVGIEYANHVPS
FT                   GKTSSSAVRQQSGNLAGSRWGLKGAEDLGGGYKAIFVLEGGFNLNNGTLGQSGRLFGRK
FT                   AYVGVSTPYGTVTLGRHQNLLYELMYKYDALTFNPSYSAQSMDSQFVNRADNSIRYGLN
FT                   IAGVTFAMLYSNGFDSTIPNGAQVPGATKVGREMSAAILYDRGPVSIGLTYDQLQGTSI
FT                   ATQSNTQSRALLGASYDFGMVKALAGVRWLDTRNTDTPPSSMLYWGGLTYHVSAPLFVS
FT                   ASVYHTQFRNPHGGPTMGALLVDYFLSKRTELYAEGAYVNNRSYSNVGIRGTGVDITTG
FT                   ADQTGVTVGIRHTF"
FT   CDS_pept        complement(566563..567345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="BMULJ_03733"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   ATP-binding protein"
FT                   /note="COG1116: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, ATPase component, Sinorhizobium meliloti"
FT                   /note="KEGG, K02049"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03733"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45601"
FT                   /db_xref="GOA:A0A0H3KPT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPT5"
FT                   /protein_id="BAG45601.1"
FT                   /translation="MSNIIINGLTKSFDTPTGPITVLDNIDLTVQEGEFVCLLGPSGAG
FT                   KSVTLNCISGFLPPTSGSVMVDGTPVTTARPRYGYVFQQPRLLQWRTVEENLIFALRAE
FT                   SGRPVKDEARRVRDVLDLVNLTGYEHFYPHQISGGMQHRVGIARAYIRDSGLLLMDEPF
FT                   GALDEITARKLRAELVSTWMKNRRTVVFVTHDIIEACYLADRIVVYTPKPTRIASVINV
FT                   DLPRPREYGSQQMHALESEVLGVFEQSMKEFMETAGST"
FT   CDS_pept        complement(567351..568163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="BMULJ_03734"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   permease protein"
FT                   /note="COG0600: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, permease component, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K02050"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03734"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45602"
FT                   /db_xref="GOA:A0A0H3KKQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKQ3"
FT                   /protein_id="BAG45602.1"
FT                   /translation="MKAAVSPTGGTTTSYRQALNRAQRKRIAGTIASFAVLLIGWQLFS
FT                   LTQPSYVFPSLPHIAQDMASFANDGTLWRATWATLKSVVAGSIASLVVGTLAGFALKRH
FT                   EAFFGPLLNFAQTVPYVVWALMSMIWFGLSQASVIFTIFIAGFTIIAYNVSAGLHQIDR
FT                   QLLEMAESVSANRLMTFRHITLPSLTPYLVSGSRTMIAICWKIVVLAELFAGGASGGGI
FT                   GYNLYVGWEFNRTNEVFAWTVWLVVLMLLTDWLIIAPIDRFATRWKRG"
FT   CDS_pept        complement(568193..569176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03735"
FT                   /product="putative ABC-type transport system periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03735"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45603"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTS8"
FT                   /protein_id="BAG45603.1"
FT                   /translation="MRNPLRAWSHLVIAASISVTTVAFAQSTTIRVGYTITTDITSAAL
FT                   FSAQKKGLFKQAGLDVQTQPFVQSSQKYDAFKGKAIDVDINAGGIEAAQLFSAGVPIVV
FT                   LKAVQPADFWAVVVKTGSTAKGPVDFKGKPYGVVSLAGTNFGATYLAFKIENVDLMRDV
FT                   KVSVLPPAGLIAALQNGTIDGATLYEPYLSQAVHSGTVKEIFRPITLYRRHYGATLFAL
FT                   NVTARKDFYLANRTAVNKFLSILDSEARSLPANLPAASQALSEAVPALKESPDQVQALL
FT                   KPYAGDYIPDQNEPVFLKQVQAYYDRLYDIKQIPRQVNVADFWVMP"
FT   CDS_pept        complement(569609..571423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03736"
FT                   /product="thiamine pyrophosphate-requiring pyruvate
FT                   decarboxylase"
FT                   /note="COG0028: Thiamine pyrophosphate-requiring enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03736"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45604"
FT                   /db_xref="GOA:A0A0H3KK58"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK58"
FT                   /protein_id="BAG45604.1"
FT                   /translation="MNSLAEDQAANAHQTEGTVAEDRENYWGSDGIAELLQSLDIPFLC
FT                   LNPGSSFRGLHDSIVNHTGNTNPEFLLCLHEEHAVAIAHGYAKVKGSPLAVALHSNVGL
FT                   MHASMAIYNAWCDRVPMLVLGAHGPADAAKRRPWIDWIHTSQDTAALVRPFVKWDNQPL
FT                   SVDAAYEAILRAFQITRTQPSAPVYVCLDVTFQETRLEGRPRIPDAARYAPPAPPYPRP
FT                   ADIDQAVQVLSHGKRPVMLIGRVSRDTVEWRERIELAERLGATVLTDLKTAASFPTDHP
FT                   QHPHPPAFFVNGPSAEALRQADVVLALDWVDLAGTLKAAWPQSPVSAHVISVSLDHTLH
FT                   NGWSFDHQGLPAVDIAIASDTGITVRELLAALPQDRQLNNEVSSRVRPARLPAEGSGIS
FT                   METLASTLRAATRSMDVSLLRLPLGWSGELWDFHSPLDYLGYDGGAGIGSGPGMAVGAA
FT                   LALAGTGRLPVAILGDGDFLMGNTALWSAAHFDVPLLVIVANNQSFYNDEVHQERVALE
FT                   RGRPVENKWIGQRISSPLVDLAAMARAQGFTATGPVVDSNALSVALAEAISKVLEGGQV
FT                   LVDVHVKPGYAPSMSRGMTASATDKATR"
FT   CDS_pept        complement(571450..572937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03737"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03737"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45605"
FT                   /db_xref="GOA:A0A0H3KK37"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK37"
FT                   /protein_id="BAG45605.1"
FT                   /translation="MSMNPMAETPPSEYSCLPRSRGLFYAGDWHEPLSATYRETLNPAN
FT                   GLPVASVAHASADDAEAAIERAHEAWLDWRGTAPAKRQRMLHEAASLLREHAEEFAMID
FT                   AINTGNPVAEMVGDAMVAADSLDFFAGLVPMLKGETIPVDGNSLHYSLREPLGVVARIV
FT                   AYNHPLMFAAGKVAAPLAAGNTVIVKPPEQAPLSCLRLAEVLRDVFPPGVLNILPGGRE
FT                   CGQTLASHPLVKKVTLIGSVNTGRAILRGAADTIKPTLLELGGKNALIAFPDADIKALI
FT                   HGIARGMNFTWAGQSCGSTSRVFLHDSIHDQVLESVATYVRETYVPGVPTDAATTMGPL
FT                   ISAQRRDEVMDFIASATREGARLVTGGKAPDTPELRGGYYIEPTIFSDVTASMRIAREE
FT                   IFGPVMSVFRWKDEEELFKVVNGTEFGLTASIWTSALSTAHRAASRVEAGYVWINQTSR
FT                   HYLGVPFGGVKHSGLGREECLEELLDFTATKSINIQL"
FT   CDS_pept        complement(572971..573963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ophC"
FT                   /locus_tag="BMULJ_03738"
FT                   /product="4,5-dihydroxyphthalate decarboxylase"
FT                   /EC_number="4.1.1.55"
FT                   /note="KEGG, K04102"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03738"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45606"
FT                   /db_xref="GOA:A0A0H3KPT9"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPT9"
FT                   /protein_id="BAG45606.1"
FT                   /translation="MSKLQLSIAVGNYDRMRPLVDGDVQIDGVDPVFMLQEPEEIFFRA
FT                   FRHADYDICELSLSSYSVKTAAGVSPYIAVPVFPSRAFRHTSVYVRADRGINRPEDLKG
FT                   KRIGVPEYQLTANVWVRLLLEEEYGVKPSDVTWVRGGYEDPTRVEKINLKLPPDVHLEN
FT                   APEGKTISGMLETGEIDALIGPRAPSCFDRGHPQIKYLFEDPHTSAAEWYRRTSIFPIM
FT                   HTLGIRKDLAERHPWLPGAVVKAFEKSKAIALSRLNDTSATKVTLPFVEDHLRAARKLM
FT                   GPDFWSYGFAANENVINRFLKQHFQEGLSERLLEAKELFHPSSLESFKL"
FT   CDS_pept        complement(574012..575346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ophD"
FT                   /locus_tag="BMULJ_03739"
FT                   /product="putative phthalate transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03739"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45607"
FT                   /db_xref="GOA:A0A0H3KKQ8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKQ8"
FT                   /protein_id="BAG45607.1"
FT                   /translation="MTDSALGYGQLSGRAVADTHEVEETYRKVTLRLMTFLFLCWVLNY
FT                   LDRVNVSFAQLQLKQDLGLSDAAYGLGVSLFFIGYILLEVPSTLLLKRIGARRSVTRIM
FT                   LLWGGISTAMAFMTAPWQFYLARTLLGAAEAGFWPGIILYLTYWYPAKRRARITSRFLL
FT                   AIAAAGVIGGPLSGLILQNFAGVWGFRNWQWLFFLEGLPAVIAGVVAFFYLTDRPEEAH
FT                   WLTDDQKRIIIVDIEADQRAKPHNAPSKLLAALRDPKVYVMAAGWATVPLCGTILNYWT
FT                   PTIIKQAGINNLLHIGLLSTLPYIVGAVGMLIIARSSDLMLERRWHFIASTTAGAAGAA
FT                   TLTLLTHNWPAAIVCLSLVSISYFAAAAIIWSIPPTYLTGDAAAGGIGVISSLGQVGAF
FT                   FGPIVLGWIKSVTGSFAAGLILVAVLVFVGGVAVLLGVPGKKAAA"
FT   CDS_pept        575709..577256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilJ"
FT                   /locus_tag="BMULJ_03740"
FT                   /product="twitching motility protein"
FT                   /note="COG0840: Methyl-accepting chemotaxis protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K02660"
FT                   /note="PilJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45608"
FT                   /db_xref="GOA:A0A0H3KTT2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTT2"
FT                   /protein_id="BAG45608.1"
FT                   /translation="MRRLGFRQQMWIPLVLSLICLVAVATFGVLQNRVSSLRERELTLS
FT                   QAADFATGITQHYADLAGRGVMSVAEARAAALTQLREVRFGKDGYIAVIDPGMHSVVNP
FT                   SKPETEGRYLGDYRDENGHYIYREMVAVAEHGQEGLVDYYTHRPGATEIVRKRSYVKAY
FT                   RPWNLIFVTGAYLDDIDRAFARSALVTVIFVVVTGLVLSGVVLLVNRVLMRMLGGSPEY
FT                   AKAIVHATATGDLSIGIARHPNDSDSLIAGIADMQARLRALIGRIQQGADAITLSMEEV
FT                   AAGNADLAQRTEEQAAALQQTSATMAGLRDAIQRTASDAKSAAFCAEDAFSSVRRGSQE
FT                   VVAVATTMERITESSNEIADILIMIESISFQTNILALNAAVEAARAQEHGRGFAVVASE
FT                   VRALAQRSSTASKDIESLISQSDVHVNEGSRLADGANQCMAQILDTVHKVDELVKNIAG
FT                   ECEVQGAGVTEISKALSQIEEVTQRNAALVEQSAAGAQLVHEKARELVSSVSAFRLV"
FT   CDS_pept        complement(577747..578163)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03741"
FT                   /note="inactivated ISBmu26 transposase"
FT                   /note="middle part"
FT   mobile_element  complement(577747..578163)
FT                   /mobile_element_type="insertion sequence: ISBmu26"
FT                   /note="Inactivated ISL3 family, no terminal inverted repeat
FT                   or target site duplication have been identified."
FT   CDS_pept        578223..578858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03742"
FT                   /product="ISBmu27 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03742"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45609"
FT                   /db_xref="GOA:A0A0H3KK64"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK64"
FT                   /protein_id="BAG45609.1"
FT                   /translation="MVLTEAQLVALERAKHEKEVHGEFESECPGYCGAQDTFYVGSLKG
FT                   VGRVYQQTFVDTYSKVAFAKLYDRKTPLPAADLLNDRVVPFFDGFGIPLLRVLTDRGTE
FT                   YCGNPEHHEYELYLALEDIDHTRTKAKSPQTNGIVERLHKTMLNEFYRIVFRKKIYDSI
FT                   ATLQTDLDAWLDQYNNEREHQGRWCYGKTPMRTFLDSLDLAKEKLIPH"
FT   mobile_element  578223..578856
FT                   /mobile_element_type="insertion sequence: ISBmu27"
FT                   /note="IS481 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   mobile_element  578914..582014
FT                   /mobile_element_type="insertion sequence: ISBmu28"
FT                   /note="Inactivated IS21 family, probably disrupted by
FT                   ISBmu27 insertion followed by frame shift mutation in orfA.
FT                   No terminal inverted repeat or target site duplication have
FT                   been identified."
FT   misc_feature    578914..579072
FT                   /note="ISBmu28 transposase OrfA, interrupted by ISBmu27
FT                   insertion, N-terminal part."
FT   misc_feature    579072..579362
FT                   /note="ISBmu28 transposase OrfA, fragment"
FT   CDS_pept        579096..579362
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03743"
FT                   /note="inactivated ISBmu28 transposase OrfA"
FT                   /note="inactivated OrfA, C-terminal portion"
FT   CDS_pept        579369..579737
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03744"
FT                   /note="OrfB, inactivated by ISBmu4 insertion, N-terminal
FT                   portion"
FT                   /note="inactivated ISBmu28 transposase OrfB"
FT   misc_feature    579369..579712
FT                   /note="ISBmu28 transposase OrfB, interrupted by ISBmu4
FT                   insertion, N-terminal part."
FT   mobile_element  579713..581569
FT                   /mobile_element_type="insertion sequence: ISBmu4"
FT                   /note="IS110 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        580159..581520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03745"
FT                   /product="ISBmu4 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03745"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45610"
FT                   /db_xref="GOA:A0A0H3KHX3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KHX3"
FT                   /protein_id="BAG45610.1"
FT                   /translation="MASISNAPVRHRTVGIDLAISAVQVAQIFDDGRAIGKPIRFRLTS
FT                   TDLRRFVSAIKSGVGADTPITAVMEPTGMAWFPVANWLQRAGIKVIRVKGQRVKALRKY
FT                   LSEHAKTDAADAHVLGAIPGFGGRGLDPVHVPGPEQHSLQRLTKQRHRYQELVCSARRR
FT                   VLDLIRWACPALEPVLPDTVTQLTLAILGELLDPRKVVAMRRDVLARFLSQHASGNHPK
FT                   SGPFIDSLVEKLKAAAEETIELHGDSVDFTALQFEVAQEVEHLRLWDRHVRAIEREVEQ
FT                   IYQRVHPSDALRSIPGIGATLAPLLIGVLGYAKRFRNEDHIRGFCGMFPTRSSSGGIEK
FT                   PGQRLTKSGSDRVKRALYIAADVARKIDPDLAAVYWRLMVNKGHHHKQAICAVATRLIN
FT                   RIYRVLKTGEPYVLRDQEGNSISVQEGKRIVAAQFKVPLEVRQSRRNQPMPEPA"
FT   misc_feature    581570..582014
FT                   /note="ISBmu28 transposase OrfB, interrupted by ISBmu4
FT                   insertion, C-terminal part."
FT   CDS_pept        581583..582014
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03746"
FT                   /note="OrfB, inactivated by ISBmu4 insertion, C-terminal
FT                   portion"
FT                   /note="inactivated ISBmu28 transposase OrfB"
FT   CDS_pept        582182..582535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03747"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45611"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPU2"
FT                   /protein_id="BAG45611.1"
FT                   /translation="MRAVQMRPDSWRQLINDEDHGGPMVAIMMLHHEHDPDPEMRPPLL
FT                   TPEKREDALRTMVAGLPHIYGYFEPRRRPLQNTGAQRSMHRVELKIGRNEPCPCGSGRK
FT                   YKHCCVDKPLTLH"
FT   CDS_pept        complement(582447..583526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03748"
FT                   /product="ISBmu29 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03748"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45612"
FT                   /db_xref="GOA:A0A0H3KKR3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKR3"
FT                   /protein_id="BAG45612.1"
FT                   /translation="MKDDSTLYVGLDVHKDSITVAYALGSGEVEVFGKIGATKADIDRL
FT                   CKRLQSKASRICVVYEAGPCGYGLYRQLIQKGFDCMVCAPSLIPKKPGERVKTDRRDAV
FT                   KLVRLLRAGDLSAVYVPSVEDEAFRDLARAWVSAKDDLKRARQRLKAFLLSHGVRYTGR
FT                   ADWGPAHRRWLSAYAFDSAWQQLAFEELRRTIEDRLAQCERLEVALREAVLNWHFYPAV
FT                   LGLQTMRGVQFTTAVGMLAELGDLSRFAHPRQLMAWLGVTPSEHSSGDKRRLGSITKTG
FT                   NSYARKLLVEAAWSYRHPARVSPEIQRRHEGIPKPIVDRAWEPCIARTPLNAASAACPR
FT                   NNACTFAQNRKDTVHCARF"
FT   mobile_element  complement(582447..583526)
FT                   /mobile_element_type="insertion sequence: ISBmu29"
FT                   /note="S116/IS110/IS902 family, no terminal inverted repeat
FT                   or target site duplication have been identified."
FT   CDS_pept        583819..584079
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03749"
FT                   /note="inactivated phage membrane protein"
FT   CDS_pept        584378..585220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03750"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45613"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTT4"
FT                   /protein_id="BAG45613.1"
FT                   /translation="MLKKRPDVPRGICMTLAAVFIRRVPNRQNRDELVVVADTTLTGGQ
FT                   RFDQGTKILQLPRGDALFCFAGLTYYAYPLAMQLASAIGSYNRSVEQRHPLRRVVQHAS
FT                   RIFAQSFKLIHHTPSDGLPVDMPASFLFGGFSWHDNDFKIWKIAMDRQGRRFPLEDINR
FT                   RYAFIGTAEALPEAEERLAAMLNARGKTEQDLDMEPFEVIRDIIRAGKYDDIGGVPQIA
FT                   KVFRYMTTHFYATLWPCPDGRTRPHAFGRPLHGWEKTSWTMFDPDTLHFNAVRPPDPA"
FT   CDS_pept        complement(585536..586732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="BMULJ_03751"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03751"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45614"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK67"
FT                   /protein_id="BAG45614.1"
FT                   /translation="MIDGRLNQEFKQREAGTFRQLRAAGSDTLLLYANGHSLGTATRSH
FT                   GYARYLTGWNSANQPAAIIMQQSRRPVVYVPNIFMKFLADEYYDNLDVRFVPPTCFGTT
FT                   VGQHINDLVGKGGKVGYIGRNESTFAFERQLTGECTSVEFFDFERSVDALRTIKSEYEI
FT                   CQHRAAAELCDRLFALAFAEARSGKAAFQIQADLQREALYSGADFCTTWITAGPVADYS
FT                   RFLPVECRRIPQDNDQYVVGIMLLYQGHWGHAIRMGNLGAPNRAQSDAFDTVTAMHDAM
FT                   FAHIRAGAPIRDLQEVAEDVLTTRAPAGHKIFKFRFAHPLGHSYADPLPDGIQPFPQQY
FT                   EQGPVYTGDFRLKPGMLLEIHPNFFAHDYAGAAIGDMVLVTDDGLEPLTAYPRQLLLL"
FT   CDS_pept        complement(586782..588050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03752"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03752"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45615"
FT                   /db_xref="GOA:A0A0H3KK45"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK45"
FT                   /protein_id="BAG45615.1"
FT                   /translation="MKSSKFLTIATIFLVVALDAKAQSTVTLYGIIDEAVVLQSNSRIA
FT                   AGNAPTGGYGTGKSKVFLDATSGLSGSRWGLKGTENLGGGLSVIFQLENGLNLNNGALG
FT                   QGGLEFGRQAYVGLNDERLGKITLGRQYDSVVDFIGPLTLATRIGSSYAAPPGDLYNTS
FT                   NAQRVNNAIKYTSPRLNGLLFDALYSFGGVSGSMARNQIYSVGSDFLSGPIRLSAAFLK
FT                   VNQPNVSFFSNSAIAANTLGTSTTSISTPVYSGYANANSYQVAAAGGQFSTGPVTLSAA
FT                   YLNAQFRGLGSSLSNAGNGVPAGKASGNAIFNTLELNVISFITPALQIGAAYSFTRASS
FT                   VAGLRDATARTSAGSGGANYNQFAISSDYALSKRTDAYAMASLQLASGTDSTGGKAVAA
FT                   IDTLTPSANNRQAVLRVGLRHKF"
FT   CDS_pept        complement(588112..589440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03753"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03753"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45616"
FT                   /db_xref="GOA:A0A0H3KPU6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPU6"
FT                   /protein_id="BAG45616.1"
FT                   /translation="MDTPNSNVAERDTRVTADLHADPVSTSHPMRRLALASMIGTTLEW
FT                   YDFALYNAMAALIFNRVFFPSFSPLAGTLMAFSTYAVGYFARPIGGTIFGRLGDRLGRR
FT                   DVLTLTLTIMGATTFLMSLLPGYATIGVASPLLLVTLRFIQGVALGGEWAGAVLLSAEH
FT                   GAHANRGLNGSWAQVGPSAGTLLATAGIGLTTWCFTDSDFVSWGWRVPFVVSAVLVVFG
FT                   LWLRRSVPETPDFAKLKAGNETAQFPITEVFTSHKRALLIACMSKFGPDVIYNLNVTFS
FT                   LTYATQILHLGRTAALIAVWIGAALNAVAVPYFGALSDRLGRRAVYGAGIAAAALWTFS
FT                   FFPLLNSGWQSALVIGVAVGLICHAAMFGPQAAFITEQFPTRVRYTGASLAVTLAGLLS
FT                   GSTPVILLTLLTTFHSPIPLSLYATALLVLSGASLILGRRKPG"
FT   CDS_pept        complement(589446..589988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03754"
FT                   /product="NHL repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03754"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45617"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKR8"
FT                   /protein_id="BAG45617.1"
FT                   /translation="MLLELGKFSSPNWIEPFNHPTDVAVANDGEIYVTDGYGNARVHRF
FT                   AADGTYIGGWGQHGNKTGEFSCPHGIWIDEDVGRVLAVDRDNDRVQVFDRSGQYLSEWT
FT                   GFRRPMDIWGTPNGTFYIVDQAPGLSIVDRNGRLRARARMYPTYSHGIGGDANGNLFVA
FT                   AQGPSRVVRLERLDNEE"
FT   CDS_pept        complement(590489..591412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03755"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03755"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45618"
FT                   /db_xref="GOA:A0A0H3KTT7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTT7"
FT                   /protein_id="BAG45618.1"
FT                   /translation="MNTRFLETFVWLATLKSFRLTADKLHATQGAVSSRIASLEQDLGV
FT                   RLFDRGSKEVTLTRDGSKALKYAERILSLAEEMRSDLGDPDRVSGIVRIGVIESIVHSW
FT                   LSGLITRLGREFPNLTIELTSDTSLKLREQFLAGLLDIILQTDVLAVEHVSNVELGKLS
FT                   MSWVSSPSLGLSGEALEDTDLAAFPIVSFSRGSGPHRSLENYFRNVPSGPPKINCVTSV
FT                   AAIIKLTVDGFGIAVLPRAIIRPELENGQLALLNVSRDFPDLELVGSYRAGVDSLLIER
FT                   IASMSQETAREFARKSGRDVATFGAS"
FT   CDS_pept        591886..592551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03756"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03756"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45619"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK70"
FT                   /protein_id="BAG45619.1"
FT                   /translation="MSTTFDNDADTRPAQLLVWTDIADEDEADFNRWYDREHMAERIGI
FT                   PGFTLARRFRSTDGDRPYLALYQTTSLDTFYSDAYRQVFSNQTDWSYRTFARMVNTVRR
FT                   VGAIEARYGKGEGGFLGLFTLPSRQLEPSGVALEIAIRLDHAVTRDGVVSGAVMRSEPS
FT                   LSTALSGSTTTLPESESVVWLEGTDHDSVAAQIAWVANALDRPPGETATFSLLWSLRG"
FT   repeat_region   592755..592758
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  592759..593968
FT                   /mobile_element_type="insertion sequence: ISBmu2"
FT                   /note="IS5 family"
FT   repeat_region   592759..592774
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   CDS_pept        592845..593837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03757"
FT                   /product="ISBmu2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03757"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45620"
FT                   /db_xref="GOA:A0A0H3KT61"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT61"
FT                   /protein_id="BAG45620.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   repeat_region   593953..593968
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   repeat_region   593969..593972
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        594040..594654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03758"
FT                   /product="peptidylglycine monooxygenase"
FT                   /EC_number="1.14.17.3"
FT                   /note="KEGG, K00504"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03758"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45621"
FT                   /db_xref="GOA:A0A0H3KPU9"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPU9"
FT                   /protein_id="BAG45621.1"
FT                   /translation="MYITAQDDLFVVTYDAHQVLHFDPNQELVKALGTFNEPHWEAPFN
FT                   HPTDVAVGAEGDIYVADGYGNAQVHRFASDGSYLNGWGTPGISAGEFSTPHAIWVLPDE
FT                   RVLVVDRDNDRIQVFDRNGAVLDEWRGLVRPMDIWADPEGQRIYVTEQAPRITCLDSAG
FT                   VVIGRARTFGIYPHGIWGAPDGSLYVAEQGYPHQIVKYERI"
FT   CDS_pept        594773..595921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="BMULJ_03759"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683: ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01999"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03759"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45622"
FT                   /db_xref="GOA:A0A0H3KKS2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKS2"
FT                   /protein_id="BAG45622.1"
FT                   /translation="MKSIELKRTLIGATALLATFTVSVAHADDVIVKIGHVAPLTGSAA
FT                   YQGKDSENGAQLAIDEINQKGLVIAGKHVHLVLDPQDDAGDPRQATQVAQKLIDDGVVA
FT                   VVGHMNSGTSIPAAAVYSAAGVPQISPAATNPDYTRQGFKTTFRLVATDAKQGPALASY
FT                   AVNSLHAKRFAIADDATAYGQGLATEFEKTVKAAGGVVVAREASNDKAIDFKAILTRIK
FT                   SERPDVIMYGGMYATGGPLLKQASALGIKNPVLGGDGVCTEQVVELAGDAVKQLVCSEP
FT                   GLALSKMPKGAVFAQRYEARFHGSVQQHAPFSYDAVYVIVDAMKRANSVEAAKLLAALP
FT                   ATSYDGVTGHIAFDSHGDLRQSSITLYDYRSNKKSVLDAVQM"
FT   CDS_pept        596023..596973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="BMULJ_03760"
FT                   /product="branched-chain amino acid transport system
FT                   permease protein"
FT                   /note="COG0559: Branched-chain amino acid ABC-type
FT                   transport system, permease components, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01997"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45623"
FT                   /db_xref="GOA:A0A0H3KTU1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTU1"
FT                   /protein_id="BAG45623.1"
FT                   /translation="MDIFIQQVINGLVLGSVYAIIALGYTMVYGILGIINFAHGDVLMV
FT                   GAMVALSCIGLLQNHFPDLGSVPTLCIALSAAAVVCAAVGYTIERVAYRPLRKAPRLAP
FT                   LITAIGVSILLQTLAMMIWSRNPLAFPQLLPTDPINVIKATDTTPGAVISMTEIVIVVV
FT                   AFLVMAGLLLLVHKTKLGRAMRAIAENPGVASLMGVNPNFVISATFMIGSALAALAGVM
FT                   IASEYGNAHFYMGFIPGLKAFTAAVLGGIGNLGGAMVGGVILGLIEQLGAGYIGNLTGG
FT                   VFGSNYQDVFAFIVLIIVLVFRPSGLLGERVADRA"
FT   CDS_pept        597002..598171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="BMULJ_03761"
FT                   /product="branched-chain amino acid transport system
FT                   permease protein"
FT                   /note="COG4177: ABC-type branched-chain amino acid
FT                   transport system, permease component, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01998"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03761"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45624"
FT                   /db_xref="GOA:A0A0H3KK82"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK82"
FT                   /protein_id="BAG45624.1"
FT                   /translation="MTSIQPIEPSTTLIPQRNFTKKLTVGIITAAFVIAAPFVIGMAGG
FT                   NYWVRVLDFAMLYVMLALGLNVVVGFAGLLDLGYIAFYAVGAYTTALLSSPHLSSQFEW
FT                   IAHFAPNGLHVPFVLIIPCAMALAALFGVLLGAPTLRLRGDYLAIVTLGFGEIVRIFMN
FT                   NLDRPVNITNGPKGITGIDPIHVGDFSLAQTHSLFGLSFPSVYSYYYVFVLCALLVIWV
FT                   CTRLQHSRIGRAWAAIREDEIAAKAMGINTRDVKLLAFAMGASFGGLSGAMFGAFQGFV
FT                   SPESFTLPESIVVLACVVLGGMGHIPGVILGAVLLAVLPEFFRSTIGPLQHMIFGDEIV
FT                   DTEVIRQLVYALAMVLIMLYRSEGLWPSPKHEDKIAKIAKRNGKKPVRA"
FT   CDS_pept        598192..598968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="BMULJ_03762"
FT                   /product="branched-chain amino acid transport system
FT                   ATP-binding protein"
FT                   /note="COG0411: ABC-type branched-chain amino acid
FT                   transport systems, ATPase component, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01995"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03762"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45625"
FT                   /db_xref="GOA:A0A0H3KK52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK52"
FT                   /protein_id="BAG45625.1"
FT                   /translation="MSDNKIRLSVKGVNKRFGGLQALLDVGLQIEEGTIYGLIGPNGAG
FT                   KTTFFNVITGLYTPDSGEFKLDGTPYTPSAVYQVAKAGIARTFQNIRLFGGMTALENVM
FT                   VGRHVRTKHGLVGAVFQTPAERGEEREIKERALELLEYVGVAQYADYTSRNLSYGHQRR
FT                   LEIARALATDPKLLALDEPAAGMNATEKVELTKLLDKIRADGKTILLIEHDVKLVMGLC
FT                   DEMTVLDYGKVIAEGLPQDVQKDPKVIEAYLGAGGH"
FT   CDS_pept        598980..599684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BMULJ_03763"
FT                   /product="branched-chain amino acid transport system
FT                   ATP-binding protein"
FT                   /note="COG0410: ABC-type branched-chain amino acid
FT                   transport systems, ATPase component, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01996"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03763"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45626"
FT                   /db_xref="GOA:A0A0H3KPV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPV3"
FT                   /protein_id="BAG45626.1"
FT                   /translation="MLKIKGLHVNYGGIQAVKGVDLEIQKGELVTLIGANGAGKTTTMK
FT                   AITGLKPYSAGDIEYMGQSIKDVPAHELLKRGLAMVPEGRGIFARMSIVENMQMGAYLR
FT                   SDTDGIKKDVERMFGFFPRLKERATQLAGTLSGGEQQMLAMARAVISKPKLLLLDEPSM
FT                   GLSPIMVEKIFEVVREISKEGITLMLVEQNARLALQAADRGYVMDSGAVTMSGDAKQML
FT                   DDPEVRAAYLGE"
FT   CDS_pept        600392..600580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03764"
FT                   /product="putative ABC-type antimicrobial peptide transport
FT                   system ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03764"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45627"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKS9"
FT                   /protein_id="BAG45627.1"
FT                   /translation="MGDPPGGQQQRLLIAHVLTRRPGFLLLDEPVANLDVRSVSGIVGV
FT                   LRRLWVGQGIAMLLRFA"
FT   CDS_pept        600963..602336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03765"
FT                   /product="amidase"
FT                   /note="COG0154: Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03765"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45628"
FT                   /db_xref="GOA:A0A0H3KTU4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTU4"
FT                   /protein_id="BAG45628.1"
FT                   /translation="MRSINTVIGQLRSGRLRYETLLQETLDKAATAKSAGDCSYVELFA
FT                   APKLLEEARAWQARADADRSLPALAGLPVSVKDLFDVEGSVTAAGSALLRSAPPANGDA
FT                   AAVQRLREAGAIIVGRTNMSEFAYSGLGVNPHYGTPTNPVGAGRIAGGSSSGAAVAVAR
FT                   GLCAASLATDTGGSIRIPAALCGIAGFKPTAQAVSRDGVLPLSRSLDSVGPIASTAECC
FT                   SIVHQVLTGGEPDTSTLRLDTLRLAVVTDYLLDELDPMVSRAFDRALALLTAAGASVET
FT                   VAFPELNAIRAGGYNAKIVAAEAFAFHRSWLASHAHLYDPRVHTRLLAGKDLPAADYLD
FT                   ALDARAELINAARRRLAAFDAWLMPTVAIVAPKIGDLDDDNAFFRANAAMLRNPSVVNL
FT                   LDGCALTLPIPSDNPLPQGLSVCGLGGADADVLAIGRSIEADWRRNSRGTDLCDPIVA"
FT   CDS_pept        602367..603056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03766"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03766"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK86"
FT                   /protein_id="BAG45629.1"
FT                   /translation="MTLSSTVTAVNKPAQLLVWTDIASEHEDDFNEWYDREHMQERIAI
FT                   PGFTLARRFHAPTGPRRYLALYRTENLDVFRSEAYRRIFSNQTAWSNRVFERMVDTVRC
FT                   VGRIESQYGEGEGRSLSLVKVPALRLETPAVGDSLDAQLREAVKRPGIVAGAVMRSEPS
FT                   LSGPLTGGGAAQTASIGVIWLEGSSTHALVREMREIARTVDCEPSDVATFDLLWALRRS
FT                   PDAGDDR"
FT   CDS_pept        603076..603915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03767"
FT                   /product="peptidylglycine monooxygenase"
FT                   /EC_number="1.14.17.3"
FT                   /note="KEGG, K00504"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03767"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45630"
FT                   /db_xref="GOA:A0A0H3KK59"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK59"
FT                   /protein_id="BAG45630.1"
FT                   /translation="MSAASPQFFTTDGTYHYRVVRPWQQGEVGVVSQVVVGARGEIVLL
FT                   DRSPACLRVFSPDGALLRTVVHPLLTSGHGMCATADGGLWVVTYDAHQVLRFDAHYELV
FT                   QTLGTFNEPTWNRPFNHPTDVALDSGGRLYVADGYGNACVHRFAADGTLELTWGRPGTG
FT                   RGEFSTPHGVWVLPDRRVLVADRDNDRVQVFDEDGEWRDEWKPLVRPMDIWATADGSRI
FT                   YVTEQAPRVTCFDDSGRVLGRARTFGIYPHGIWGDVGGNLYVAEQGYPHQIVKYERL"
FT   CDS_pept        604063..605487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03768"
FT                   /product="AAT family amino acid transporter"
FT                   /note="COG1113: Gamma-aminobutyrate permease and related
FT                   permeases, Pseudomonas aeruginosa"
FT                   /note="KEGG, K03293"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03768"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45631"
FT                   /db_xref="GOA:A0A0H3KPV6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPV6"
FT                   /protein_id="BAG45631.1"
FT                   /translation="MQPAEIGTPLRRTLGARHINLMALGATIGVGLFLGSATAIRLAGP
FT                   SILLGYAFVGVFVFFVMRALGEMAVAHPVAGSFNRYAYEYIGPRAGFVTGWTYWFMWIL
FT                   CIMAEVTAVAIYMKFWFPGMPAWVWSLAALATMGLLNFVAVRAFGELEFWFAAIKIVTI
FT                   VFMILSGIGIIGFGFGNGGVATGIGNLWRHGGFLPNGMWGLASAIPMVVFAYLGVEIIG
FT                   LTAGETKNPEKSLARAVNSVFWRIAIFYIGALFIIMSLYPWNAIGTQGSPFVLTFERLG
FT                   IRGAAGIINFVVLSAALSSCNSGIFGTARIVFNLAQQGQAPRIFAHTSKSGIPACAVVL
FT                   TLVAALLGVLLNYVAPKGLFEWLTAIGTFAGLFSWAIILVAHYRFRRQRVAQDNRMLMP
FT                   WWPYSSYCTLAFLAVLVAFMLKFDETRVAVIVGPLWLAFLWIVYGLSAKNGASRQGVPS
FT                   PSASFAVEGVTRDIRD"
FT   CDS_pept        complement(605789..606373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03769"
FT                   /product="ISBmu25 truncated transposase"
FT                   /note="C-terminal portion"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03769"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45632"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKT3"
FT                   /protein_id="BAG45632.1"
FT                   /translation="MSRSALANLSDVSLVAIDETSYRRGHEYLTLVSDMKARRVVFVTP
FT                   DRDAKTIERFASYLGQHRGTPEQVTSVSIDMSPAFSISVDEHLPNARVTFDKFRVVANA
FT                   SKALDTVRRQQQKADPERQHALDAAQGRQQTESCAIDGLEALGSSTLPSVPPAHGCIAS
FT                   NCERFLNASKSMSPPRVCASDARTSCAQKSN"
FT   mobile_element  complement(605789..606373)
FT                   /mobile_element_type="insertion sequence: ISBmu25"
FT                   /note="Inactivated ISL3 family, no terminal inverted repeat
FT                   or target site duplication have been identified."
FT   CDS_pept        606643..607413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45633"
FT                   /db_xref="GOA:A0A0H3KTU7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTU7"
FT                   /protein_id="BAG45633.1"
FT                   /translation="MRTARDRNISFGLRQFSLRLDALHDQFDVVLVHLSDAWATAFTAN
FT                   GFDAHDALKALGARYAIPTQVINDRVFTFRLKASLAWRLAIALFTKAGGIPWKLAPLVG
FT                   VPEDTAYIGLAYALRGDPKSVQFVTCCSQVFDADGGGMQFVAFEAKEQVADPREARRNP
FT                   FLSRSDMRAVMARSLSLYLGRNGGRLPRRLVVQKTTSFKDEELQGVFDGLSTVPEVECI
FT                   EIGSSATWRGVRLKQGKKGGPRSVPDRAPVPRGT"
FT   mobile_element  607612..609696
FT                   /mobile_element_type="insertion sequence: ISBmu30"
FT                   /note="IS66 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        607612..607965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03771"
FT                   /product="ISBmu30 transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03771"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45634"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK90"
FT                   /protein_id="BAG45634.1"
FT                   /translation="MLSFADDLRVYLYREPIDFRCGINTLAALVEDSMRLDPLARAVYA
FT                   FHNRKCDRIKLLLYERTGFWLLLRRLEQDRFVWPRRHQEVIELTTQQLHWLLDGIDIDA
FT                   LRRHPVRHYQHAS"
FT   CDS_pept        608056..609696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03772"
FT                   /product="ISBmu30 transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03772"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45635"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK63"
FT                   /protein_id="BAG45635.1"
FT                   /translation="MNNAPDLKRVPRAVQGYIHALEARVAGDAKHIDELNLRVEQLEEQ
FT                   VRLLQAERFAPKSEKRKDRVFDEAEQIARTEPCDEDDEGVQPALPDTGLPPASQPERRK
FT                   AGRKPLPAYLRREPVEYDLPEDQRGCPCCGNPMHRIGEDVSEQLHVEVKWTVRKNVRSK
FT                   WACRHCERHAERTPVVLAPMPVQPIPGSHADASVIATVATAKYVDGMPLYRMQEALARW
FT                   QIPVSRGTLAHWVIRPSGLHYSRLYDALRKTLLSQPLIHGDETTVQVLKEPGRSAQSKS
FT                   YMWCYRSAQDCAEPGVLFEYQPGRGQEHPKKFLGDYSGMLMSDGYSAWRTLKKATHFGC
FT                   MAHARRLFVKADKAATKRTDSCKQKTPNARVAKALEYFQALYRVEALAKDDLPAGLTRA
FT                   DYTYDLRQKHSAPLLEAFKAWLDELAPKVAPQSLLGKAIAYTRNQWEYLSRYVTDGCAP
FT                   IDNNVIERDVRPFATSRKSWLFSDTVDGAKASATVYSLVLTCRACGVEPYDYLLHVLTE
FT                   LPQRAPDADVTDLLPFNYARQQQTKAQTG"
FT   CDS_pept        complement(609830..610219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03773"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03773"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPW1"
FT                   /protein_id="BAG45636.1"
FT                   /translation="MRWNFNSGRSWQMPGSPELQQCCGSTGVGSNVIGAFPLPANTRMP
FT                   IDNCTHTFDELSATVLPAHLERLKAALQSSLPATTFVGFKSARRELLAKLGHSTDFPGC
FT                   YVFIDVDRPVYVGISRGVVKRKREL"
FT   CDS_pept        complement(610200..611516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03774"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03774"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45637"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKT9"
FT                   /protein_id="BAG45637.1"
FT                   /translation="MVLPVNEELLNTRSMLNPVAPIGVGTPEVESMVSYFCRLAMSHCI
FT                   STTELHRIVDRTMQWQLSEKYDWCQVGLSGMSDAAERMADALSKLTGIGNLDSLTLLSW
FT                   RDVIAQSSPKPTSSRWCPQCLSEDRETGRTYFRLAWDVGTVTACTKHKIRLSHACPDCG
FT                   GTNTRHSSAFVMPGWCTACGIFLGSSEQSTPATPAEVWIASQVGAMLAAQNTLASRPTR
FT                   SELLGSIREIVNRLDNGKNALFARRIGLSKTTVHHWLKGGGAPTLPGLLRIAAQTGLAL
FT                   PSLLTGDLAEWSPTSSQIHELDPVLPTQTRRATRQLHDWDRIRSQLAALAQSTTVVSVE
FT                   ETARSLNVSVRELYIHANEEACSLGRRWLEHRKWCGEQSRHTARKLIETACAEILAEGK
FT                   AVNLRELIARFPNGSANRFNGILKRLKEIQEKRNAVELQ"
FT   CDS_pept        complement(611519..612634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03775"
FT                   /product="probable ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03775"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45638"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTV1"
FT                   /protein_id="BAG45638.1"
FT                   /translation="MHHRLHRSLQPAVRSPNHSSRRQRTTLLILRTFEQTMQQTNDTTL
FT                   LAIDAARALSEKRIKHTRIAQVMEELNTLIYPESQDSILLVCGPTGAGKTTLSRYLVAS
FT                   TLERASSQMEANRGVIPAVYVEAPASGESDFSWRLFYHRILAQLGDNLESPKVMYGIDP
FT                   QTGRFARPRGNSLAALRTAVEQGMRERQVQFLVIDEAAHIIRQTRGTHKLEVQLDTLKS
FT                   LANQCGTQIVLVGAYDLYRLVSLSAQLARRTHVLHFERYRDDRPEDVRAFNRCVLAFEK
FT                   TLPHLWGGELTQYTKGLLENTLGCIGTLSSVLIRAAKFTERVGYWSVDSLERALLTEAQ
FT                   RKRILEEILDGETAVGPSFTRVMPKFKRAAA"
FT   CDS_pept        615297..615644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03776"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45639"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK94"
FT                   /protein_id="BAG45639.1"
FT                   /translation="MIDGSVVYDRTCLKIRARTLPRPGTNREKGMGVVRPQEEAQNESA
FT                   YGRWEDRARDLVMSAMAQRNLSYKGLALRLERIGIEESAAQINRKINRKRFSAAFLLAC
FT                   LVAMDVESVPI"
FT   CDS_pept        617417..618070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03777"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03777"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK68"
FT                   /protein_id="BAG45640.1"
FT                   /translation="MEAVIPLNIDPFIAVGHLTRLGQFQTSKQTKDLSADFPMLSCPIA
FT                   AADAHFVPSVGGVSCGMGFGNVSAFGSPLITMRLQLNGTQIYWLADLTDPEVWAAYDRW
FT                   KRVGRVPISLNFDASSKRECVFCVPEVSRKPSGLEELRIHAGKPLTDYVWETMITLSTS
FT                   GLLQCQATTDLPDVRLECVLVNVLVTKRLEPFVRGRLHDTKPTGMPSSELQDLI"
FT   repeat_region   618537..618541
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  618542..625900
FT                   /mobile_element_type="insertion sequence: ISBmu1b"
FT                   /note="This unit of insertion sequences is consisted of
FT                   ISBmu1, ISBmu7, and, ISBmu4. ISBmu1 has experienced
FT                   insertion of ISBmu7 close to the right terminal inverted
FT                   repeat. ISBmu7 has experienced insertion of ISBmu4. These
FT                   insertions of ISBmu7 and ISBmu4 are inferable by the target
FT                   site duplications. Because two terminal inverted repeats
FT                   and two ORFs of ISBmu1 are preserved, this unit may be
FT                   transpositionally active."
FT   repeat_region   order(618542..621104,625849..625900)
FT                   /note="This copy of ISBmu1 experienced insertion of
FT                   ISBmu7-ISBmu4 complex to the very close to the right
FT                   terminal inverted repeat, resulting in target duplication
FT                   of GCTGGC."
FT   repeat_region   618542..618592
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu1, terminal inverted repeat"
FT   CDS_pept        618740..620272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03778"
FT                   /product="ISBmu1b transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03778"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45641"
FT                   /db_xref="GOA:A0A0H3KVF0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVF0"
FT                   /protein_id="BAG45641.1"
FT                   /translation="MANRRFELFEYRQVLVRMRQGDSDRDIARGGLMGRKKLTTVRREA
FT                   EARSWLDPVQPLPDDATIAGVFGRTPHLPHTCVSTVEPYREQVREWLAAGVQGTTIHAA
FT                   LQRNHGYAGSYCAVKRMLRHLAAERSVATTTILDFAPADAAQVDFGAGPVLTVEGIAVR
FT                   TWIFVMTLCWSRHQYAEIVLDQTVETWLASHRRAFEWFGGCPDRVIIDNAKCAIIRACR
FT                   YEPAVQRSYAALAEGYGFRIDACPPHDPQKKGVVESGVKYVKKSFVPLREFRDLADANR
FT                   QLREWVMQQAGTRIHGTVHERPLTRFGVERPLLAALPDVPPVLSVWKEVAVHRDGHVVY
FT                   KHALYSAPFTLVGKSLWLKATDTVIQLFHRHELVATHPRQRAGGRHTVRDHQPPEAQAW
FT                   LEHDPQWCLARAKEIGPSCHGVILALFNDKVLVNLRGAQGIIRLRQKVGDQRLEAACER
FT                   ALAFSSAKYSTIKGILDKGLDSEPVPRPASAPTGAYQNGGRFGRDLQSLLIH"
FT   CDS_pept        620277..621065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03779"
FT                   /product="ISBmu1b transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03779"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45642"
FT                   /db_xref="GOA:A0A0H3KQP3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQP3"
FT                   /protein_id="BAG45642.1"
FT                   /translation="MNPSPELNSILKQLRLSGILDSLEQRNRQAIDGQLAYTEFLAMLL
FT                   HDEVARREHKKLGTRLLRAGFAMGKTLETFDFDRLPTLNRSHVHDLATGRYLDEKVAIL
FT                   IAGPTGTGKSHLAQALGHCAARQGRDVLFISQTELLKRLNAARATGAYDRKFQQYARVP
FT                   LLIVDDFALKPLRTPQDEDFHDLVAARYEHAATILTSNLDFGEWGAAFPDNRILGTATL
FT                   DRLRHGAYRLVLEGDSYRTPKPMPDPPQNAVAKNGKKPQP"
FT   repeat_region   complement(621099..621104)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(621105..625848)
FT                   /mobile_element_type="insertion sequence: ISBmu7b"
FT                   /note="IS21 family, interrupted by ISBmu4 insertion."
FT   misc_feature    complement(621431..621926)
FT                   /note="ISBmu7 transposase, OrfB, interrupted by ISBmu4
FT                   insertion, N-terminal part."
FT   CDS_pept        complement(621431..621925)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03780"
FT                   /note="inactivated ISBmu7b transposase OrfB"
FT                   /note="inactivated by ISBmu4 insertion, C-terminal portion"
FT   mobile_element  complement(621927..623783)
FT                   /mobile_element_type="insertion sequence: ISBmu4"
FT                   /note="IS110 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        complement(621976..623337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03781"
FT                   /product="ISBmu4 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03781"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45643"
FT                   /db_xref="GOA:A0A0H3KHX3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KHX3"
FT                   /protein_id="BAG45643.1"
FT                   /translation="MASISNAPVRHRTVGIDLAISAVQVAQIFDDGRAIGKPIRFRLTS
FT                   TDLRRFVSAIKSGVGADTPITAVMEPTGMAWFPVANWLQRAGIKVIRVKGQRVKALRKY
FT                   LSEHAKTDAADAHVLGAIPGFGGRGLDPVHVPGPEQHSLQRLTKQRHRYQELVCSARRR
FT                   VLDLIRWACPALEPVLPDTVTQLTLAILGELLDPRKVVAMRRDVLARFLSQHASGNHPK
FT                   SGPFIDSLVEKLKAAAEETIELHGDSVDFTALQFEVAQEVEHLRLWDRHVRAIEREVEQ
FT                   IYQRVHPSDALRSIPGIGATLAPLLIGVLGYAKRFRNEDHIRGFCGMFPTRSSSGGIEK
FT                   PGQRLTKSGSDRVKRALYIAADVARKIDPDLAAVYWRLMVNKGHHHKQAICAVATRLIN
FT                   RIYRVLKTGEPYVLRDQEGNSISVQEGKRIVAAQFKVPLEVRQSRRNQPMPEPA"
FT   CDS_pept        complement(623759..624139)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03782"
FT                   /note="inactivated ISBmu7b transposase OrfB"
FT                   /note="inactivated by ISBmu4 insertion, N-terminal portion"
FT   misc_feature    complement(623784..624139)
FT                   /note="ISBmu7 transposase, OrfB, interrupted by ISBmu4
FT                   insertion, N-terminal part."
FT   CDS_pept        complement(624136..625620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03783"
FT                   /product="ISBmu7b transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03783"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45644"
FT                   /db_xref="GOA:A0A0H3KYW7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYW7"
FT                   /protein_id="BAG45644.1"
FT                   /translation="MRLYMKYRLKEGPPQAAARAGFSAATGYRIEEDPRLPSQKKAPRG
FT                   RRRADPLAAIFDTEIVPLLQSAPGIRPIAVLDEMLRRHPDLPGNVRRTLERRIRDWRAL
FT                   HGEEHDVMFRQVHQPGQLGLSDFTEMDSLGVTVAGVTLDHRLYHFRLACSGFEHAHVIL
FT                   GGESYVALAEGLQNAIWALGGAPREHRSDSLSAAFRNLDADARKDLTTRYDALCAHYGM
FT                   QPTRNNRGVAHENGSIESPHGHLKSAVRDALLLRGSHDFDDLGSYRRFIDEIVGRINAR
FT                   NGKRIEVERALLQPLPVQRTCDYEETRVYVTTTCGFVLRKVFYTVPSRLIGHHLRVRLY
FT                   DDRLELFLGGTALMTLQRGRAGPNGKHGHVINYRHVIHALRRKPMALLNLVYRDQVFPR
FT                   EAYRLSFDRLLEQLPERQACRTMVELLSLAHEHNCEAQLAEALQQCLDDGQLPDLDALC
FT                   SRFEAKPTSSMPEVNIQLAALSDYEALLDMATEVAA"
FT   repeat_region   complement(625849..625854)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   repeat_region   625851..625900
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu1, terminal inverted repeat"
FT   repeat_region   625901..625905
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   repeat_region   complement(626062..626068)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(626069..628753)
FT                   /mobile_element_type="insertion sequence: IS408"
FT                   /note="IS21 family"
FT   repeat_region   complement(626069..626114)
FT                   /rpt_type=INVERTED
FT                   /note="IS408, terminal inverted repeat"
FT   CDS_pept        complement(626167..626916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03784"
FT                   /product="IS408a transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03784"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45645"
FT                   /db_xref="GOA:P55923"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55923"
FT                   /protein_id="BAG45645.1"
FT                   /translation="MLMQHTLTQLKALKLDGMARAFEEQSTLTASTSLSFEERVGMLVD
FT                   RELAWRDTRRLERLLRAAKLKNPQACVEDIEYRQTRGLDQRIVATLAGCDWVRNAQNLI
FT                   LTGPTGAGKTWLACAFGQQACRQGFSVFYVRVARLFEELKIAHGDGSFTRRLAQLAKID
FT                   VLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHAWLQDPTLADAILD
FT                   RLVHQAHKLPVKGDSMRKKTKSESADA"
FT   CDS_pept        complement(626933..628489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03785"
FT                   /product="IS408a transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03785"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45646"
FT                   /db_xref="GOA:Q51649"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51649"
FT                   /protein_id="BAG45646.1"
FT                   /translation="MPTPRMSMRKLKEVLRLKWACGLTHRQISRAIGISVGAVSKFAAQ
FT                   ASQAGLDWAAAEAMSDDELDARLRPAATNAAATTTRRIEPDYTALHRELRRKGVTLQLL
FT                   WEEYAEANPGQRTYRYTQFCQKYKDWAKSIKRSMRQQHRAGEKLFADFAGPTVPVLASD
FT                   GGVEFEAHVFVAVLGASNYTFACATRTETMADWIGSLCDALEFIGGVPELLVPDNPKAL
FT                   IARPDRYEPGLGTTTQDFVNHYGTAMLPARPRKPQDKAKVEVGVQIVERWVLARLRHYR
FT                   FYSLAELNKAIAELIADLNQRPFKRLEGNRREWFERLDQPVLRPLPVRRYEIATFQKCR
FT                   VNIDYHVDVGGHYYSVPHSLARQEVWARITRHGVEILHGGKRVAAHARSRLKGKHTTIA
FT                   EHMPAAHRAHMEWTPGRLLNWGASVGPGAEAVVRHLLTNKPHPEMGYRACLGLLSLARK
FT                   YGKHRLEAACQRALKIGSPTRRSVLSILEAGLDLQPSLPTTPAEWRSPEHENVRGPDYY
FT                   H"
FT   repeat_region   complement(628707..628753)
FT                   /rpt_type=INVERTED
FT                   /note="IS408, terminal inverted repeat"
FT   repeat_region   complement(628754..628760)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(628847..629059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03786"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03786"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45647"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK73"
FT                   /protein_id="BAG45647.1"
FT                   /translation="MHFDELFNVDSNGGLTPKVPIDVNGTQMTPGVTFGGGVQFGGFAF
FT                   GQAVGHDFGVRRLQNGFVQLVKVYN"
FT   CDS_pept        629083..629358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03787"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03787"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45648"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPW6"
FT                   /protein_id="BAG45648.1"
FT                   /translation="MSTATGALIAVQWPATGRWTRLSKALRMIAASGPTESKMPPQKLV
FT                   LDFPASHHSPPSSRLRSRLAPASFLSISFVHVLGNVGDPTCGHNGT"
FT   CDS_pept        complement(629587..630858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03788"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45649"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKU7"
FT                   /protein_id="BAG45649.1"
FT                   /translation="MAKRHYDWTNGPAELEPHSLTKHQVLVDYLIRYFQQRLLNARGRD
FT                   RFRITLVDGFCGGGRYLLKGTGELVLGSPLRLLQAVKEASFKINQDRPKAILFDVQFIF
FT                   IDKDKKALGHLREVLRQEGYERAIGDTIHIMHAEFGVAVDEVLARVAQHTPRSGTALFF
FT                   LDQYGYAEVPASLIRKIFASARDAEVVLTFHVSSFATYTNDELARKISSTLQVDIFKRL
FT                   GGRSIDEIKQNEADWRRFIQAALYEALVDGCGAGFFTPFFIRGTGAGHGEYWLVHLSQH
FT                   HRAQDVMKQVHWQHSNHFVHYGGAGLDMLAPQTMGFLQDFDGGFRFDDIARAKSDKELV
FT                   VQLARRIFDQTNPKPFSLVFSETCNGSPATASMYKDALAILVSEGEATVRSVDGKPRYR
FT                   ARYMRDTDVVDKPKQFKLFLGNNP"
FT   CDS_pept        complement(630889..631746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03789"
FT                   /product="bacteriophage protein"
FT                   /note="COG4422: Bacteriophage protein gp37, Mycobacterium
FT                   tuberculosis CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03789"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45650"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTV8"
FT                   /protein_id="BAG45650.1"
FT                   /translation="MGKDSRIEWTHHTFNPWWGCVKVSAACDHCYAETWAKRLGEGLWG
FT                   PHTPRRFFSDAHWKEPVKWDKDAARDKVRRRVFCASMADVFENRPDLIAERRRLLDLID
FT                   QTPNLDWLLLTKRIHLVRKQLPKGYDFPKNVWLGTTVEDQATANKRIKHLLEFSSPSVR
FT                   FLSCEPLLSAVDLSPYLVRNEKGNRVDWVIAGGESGPHARPMDPAWPAALQRQCARAKV
FT                   PFHFKQWGHWAPVEQVADVLKKSTPIRVIRQDGTEVSVAAIGKGKAGRVLAGKHWDQFP
FT                   RIVV"
FT   CDS_pept        631825..632778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45651"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKA2"
FT                   /protein_id="BAG45651.1"
FT                   /translation="MQWNGFPHSTTEARGGEDVKDEEKVVPDPLDGLPAMVVGRWVTEE
FT                   KHRIIKRYIDASWAARQKFTSQRTYIDLFAGTGRVKIKHTDTFQDGGPLAAWQIAQQKR
FT                   GVFSDFFIADANPEFLAACDTRLRERGAPLKSIAGRADETIDWVLPQLNDRGFHLALLD
FT                   PFNAGHLHFSIIEKLATKPTMDIVVHLSTGDIQRNIATGLEADHSPLDNFAPGWRHVVM
FT                   KQSSKHAMRDAFIGYWRALVSKAGMHVCDTMYPVRNSKESTMYWLCLIARHPLADKLWR
FT                   GACQLETSLSELLCVRHKLMAKEPRYATQTQGRSDD"
FT   repeat_region   632680..632687
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  632688..634042
FT                   /mobile_element_type="insertion sequence: ISBmu12b"
FT                   /note="IS256 family"
FT   repeat_region   632688..632715
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12a, terminal inverted repeat"
FT   CDS_pept        632744..634003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03791"
FT                   /product="ISBmu12a transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03791"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45652"
FT                   /db_xref="GOA:A0A0H3KK76"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK76"
FT                   /protein_id="BAG45652.1"
FT                   /translation="MPRKRKEEVTIEPGKGLNLDPELIKQLVPGTLDRASINEQFAALK
FT                   KAIFERALGGELTHHLGYEKGEAKPAGRTNHRNGTSRKRIATDNDLLDVEIPRDREGTF
FT                   DPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDE
FT                   VREWQQRPLEPMYPVVFFDALRVKIRDEGVVRNKAIYLALGVRRDGTRDVLGLWIEQTE
FT                   GAKFWLRVVNDLKLRGVQDILIAVVDGLKGFPEAINTVFPETTVQTCIVHLIRNSLDFA
FT                   SWKDRKSVAAALKEVYRAPSAEAAAVALDAFDTSPWGTKYPPIAALWRRAWDQVIPFYA
FT                   FAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHD
FT                   WKSAMTQFALLYPERFNIGI"
FT   repeat_region   634015..634042
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12a, terminal inverted repeat"
FT   repeat_region   634043..634050
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(634326..634922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03792"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPX0"
FT                   /protein_id="BAG45653.1"
FT                   /translation="MLATAEQVFDDRSGVRTDVGGPVDQPLRIPLRGGSPMIRRRPCSV
FT                   CRGIDARFAVESVLGLLWNPCSVCCGISVRFGVEYAITDAGSAKEQLFRRLRQAVLGTR
FT                   SAGELAVFQGYYERYGVSLGDRLPALIPQVYLHYDPYTRRQRGDEQFLARQRMDFLLML
FT                   EQGVRIVIEIDGRHHYAVQDASAPDRFIANAQRYA"
FT   mobile_element  634962..635927
FT                   /mobile_element_type="insertion sequence: ISBmu31"
FT                   /note="Inactivated IS21 family. No terminal inverted repeat
FT                   or target site duplication have been identified."
FT   CDS_pept        634962..635153
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03793"
FT                   /note="inactivated ISBmu30 transposase OrfA"
FT                   /note="inactivated OrfA, C-terminal portion"
FT   CDS_pept        635169..635927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03794"
FT                   /product="ISBmu30 transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03794"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45654"
FT                   /db_xref="GOA:A0A0H3KKV2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKV2"
FT                   /protein_id="BAG45654.1"
FT                   /translation="MLHHPTVERLHELRLFGMAAALADQQSQNSIDQLGFEERLGLLVE
FT                   REASERQSRLLAARLRRAKLRFPDAVPEDINYREPRGLDRALLARLLTGEWIRARQSVI
FT                   LVAPTGLGKSWLACALVNQACRHGFSACYLRMPKFNEEMAIAHGSGGYAKLLSQWAKTD
FT                   ILVMDDLAMAPLSDPARRDLLEVLDDRHGRRSVIVTSQIPVDSWHAAIGDPTLADAILD
FT                   RLVHNAHRLTLSGESMRKRRNGLTTEDEKE"
FT   CDS_pept        complement(635860..636552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03795"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTW2"
FT                   /protein_id="BAG45655.1"
FT                   /translation="MTNSNQEAPAELYAQTADTMCAYMDDCDFDETHLTGNRLWLALEY
FT                   AYRPHPRFWRDFDIATVVDAMSRRARNWREKLEKAGRSADALQRQLEETVRRNAFDEAN
FT                   AEMLMALPVPERPKTSHAAFDWILATLAEIGLTAELGFAERDGYDCGTDALLVLHRLQH
FT                   AQRGCVFHANRAAVPRQTEQAFHAKPSEDSTAKRALRTWRRGVSSFTPSRPRWSNHFGA
FT                   CASTRPIV"
FT   repeat_region   636732..636735
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  636736..637971
FT                   /mobile_element_type="insertion sequence: IS407a"
FT                   /note="IS3 family"
FT   repeat_region   636736..636761
FT                   /rpt_type=INVERTED
FT                   /note="IS407a, terminal inverted repeat"
FT   CDS_pept        636804..637067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03796"
FT                   /product="IS407a transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03796"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45656"
FT                   /db_xref="GOA:P24580"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24580"
FT                   /protein_id="BAG45656.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   CDS_pept        637091..637924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03797"
FT                   /product="IS407a transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03797"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45657"
FT                   /db_xref="GOA:P24577"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24577"
FT                   /protein_id="BAG45657.1"
FT                   /translation="MSAIREKVNISERRACRLVGLSRSVLHYDAKPDHENEVLAARLVE
FT                   LAHERRRFGYRRLHALVEREGTHANHKRIYRLYREAGLAVRRRRKRQGVMIEREQLALP
FT                   GAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVDIVVDHGISGLYVARALDRAARF
FT                   RGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAGKPTQNAYIESFNGKFRDECLNE
FT                   HWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEFAAKHRATADAPAAFQELV"
FT   repeat_region   637947..637971
FT                   /rpt_type=INVERTED
FT                   /note="IS407a, terminal inverted repeat"
FT   repeat_region   637972..637975
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(638274..638924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03798"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKA6"
FT                   /protein_id="BAG45658.1"
FT                   /translation="MTQRTPTPKATPTLLDPEAEEALRAAVGAAAMLGREKTQALLRLP
FT                   DAELGRLFKYGIAQVANLYTSVTFDGGWFSRQTKEAARSMKDGQPEEGASEFAFPTSER
FT                   HALVSERKLLPAAEVCRDLGITRQALSNAVAAGRIFAVDIGARRYYPAFYVHKDFDRRA
FT                   LETVSQLLGSLPGWSKWQFFTTPKVSLRKLTPLQALSRGKLDLVERAAKAFAE"
FT   CDS_pept        complement(639143..640444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03799"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03799"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45659"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK79"
FT                   /protein_id="BAG45659.1"
FT                   /translation="MSETSIAMRSILNPLAPLGVGTPDTESLMSYFCRLALSHCVTTSD
FT                   LARKVTNATGGKFNPKWNWKSVSPSGISGTAEKWSQALTELTSIDCRNNLTLLPWRKVI
FT                   AETGLISTCSRWCPACFAEDRATGGTPYTRLAWDIGMVTSCTRHETKLSHVCPACGRRE
FT                   TGHRSAYIVPGWCTKCGAFLGNNAHSDPTPEETWIANQVGGMVARQATLETTPSLETLR
FT                   NCIQTLVMHLDGGRNAIFAGRIGVNKSTAHYWLRKGGTPTLSALLRIALHAGIDLPKLL
FT                   TGDLTGWSVSCIETRRCALSLPERKRRKSPLVNRSELLRAHLVALNESKEPISVREAAR
FT                   RLDVHPRQLYQSANDETRTIGERWKNIQRYRAERNREIAREAIQAAYFKIQAEGKCVNL
FT                   RELRNHVPNAILGSVRDIFALIEEVEERIGPVRP"
FT   CDS_pept        complement(640441..641475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45660"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPX3"
FT                   /protein_id="BAG45660.1"
FT                   /translation="MPTRNDSTILGANDTVNAISGKRIRHTRVIDIMSELDTLIYPESQ
FT                   DSILLVCGPSGAGKTTLAKYMVNMALERARPLMQSNRGVIPAIYIEAPSNGESVFSWRL
FT                   FYEKILAQLGDDRELPKVAYGVNADTGLLFRPRGTSRNTLAALRTAVERGLRERQVQFL
FT                   VIDEAAHIIRQTSGSRRLEIQLDTLKSLANLCGTQIVLVGSYDLYQLVSLSGQIARRTH
FT                   VLHFERYHDDSPEDVRAFNSCISSYEKALPALWEGKITRYSSALLSNTLGCIGTLSRVL
FT                   TRSAKLSGGTWSLDALKRALLTEAQRKRILEEILDGESAIGPSFTRILPAIRRVATSPV
FT                   GGNE"
FT   CDS_pept        complement(642040..642744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03801"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKV7"
FT                   /protein_id="BAG45661.1"
FT                   /translation="MRDLCRARLSHFTDLSSQRRGNANPPLSEATEYLLHSNADSMNIM
FT                   DSSNQDATNTYNEIGRTVVSFMVDCGMKDADVNPSHLSLAFEYAYEPLSRFWRDFDLAT
FT                   VMEAVSARFPDWHSAAQARNQSAAQVLREVDDILHANATDEANAEMLMALPVQVRPTEA
FT                   QAATDWICAELQKRGLESERRFAERDGWRCGERALEVARSLEQAAVGIQCERVGTRTAR
FT                   MVRDRMLAAGRV"
FT   CDS_pept        complement(642751..643419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03802"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45662"
FT                   /db_xref="InterPro:IPR041487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTW5"
FT                   /protein_id="BAG45662.1"
FT                   /translation="MQCTAHSTIGGYPIASTVDSCNRWQFMPEDRIIRFRRRCERNQLT
FT                   YGPPIDELDRDVIDTQYVYSITADTLRRRLGRAGYNRASLENEFQDYEKSTGKRLHLTG
FT                   EFAEAHDEAFPGSLYDWLDALAKTVKAGVTPARRAAEGLKPTGNLLVDIITGSDKPAFN
FT                   DVEPEHGLPGFPCSSFNNMAIALLEVTAGNAVCELDVTSFILHQGDITFDDMLGRRNEV
FT                   "
FT   CDS_pept        complement(644067..644954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03803"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03803"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45663"
FT                   /db_xref="GOA:A0A0H3KKB0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKB0"
FT                   /protein_id="BAG45663.1"
FT                   /translation="MPRFPDDTDSRPCPLVTDLKTLGQAVQRTRLASELTLLDAADYIG
FT                   VTVNVLARIEAGRSVGTVHLFKVLKEFGLATLIMSKADADDALQAVGHTVNWVEIAAKQ
FT                   SATRATGTKPALIPERTTPTLFLDYDGTLHAGHAYIDDGGQITLDSGRPVLEFAPILTE
FT                   ILRPYPAVKIVLTTSWLQRLSTERVIAYLPPDLARRVVGTTRDMKPRFSYLRSGSGKTD
FT                   VIASYAQGKGLRNWLALDDSVFDAHLFGRELVSNFVLLDSALGISDEKALERLRRWLTG
FT                   IDDRRTGRSSYRRP"
FT   CDS_pept        646456..646836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03804"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03804"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45664"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK85"
FT                   /protein_id="BAG45664.1"
FT                   /translation="MDGNAKQPNFADGLEVGSTYMYEEDAWFGFGTEGVLNENLNKLAG
FT                   FVGYDWQMPGADDPGPFRELFRWGGKGTIGPVVSAKLVADFNEWDQRAIALEDQDFYEF
FT                   YRHIRSMFEFAMKNGCVFLRCS"
FT   CDS_pept        647050..647532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03805"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45665"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPX7"
FT                   /protein_id="BAG45665.1"
FT                   /translation="MAVDFVARKGLIKLDGMFDADFWAKRPNNVADVIGNPDCPRIDDG
FT                   LEIGAAYEFEEEKTFTVCRKEGDFYKFMEQLAEMVGYHWRMAGADGTGPFRELFRHPGQ
FT                   FGTIGPVTSAKLAADFSAWDEYAQEIEKRGFYAWFTSMRKMFEYAMNDGGVWHQYD"
FT   CDS_pept        647799..648194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03806"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45666"
FT                   /db_xref="GOA:A0A0H3KKW1"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKW1"
FT                   /protein_id="BAG45666.1"
FT                   /translation="MCHRAALRRLAAWSARFAKIPDATLVYNNSPSFGWTPNFCRQAYE
FT                   AMKVEGKDVLAYERGRLMSVDTIRPHWRSCHSNSPLAARDRVFWLESAFATALSENRPA
FT                   RARLPRENPGHPRCCMQRGATISCAYK"
FT   CDS_pept        648484..649152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03807"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03807"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45667"
FT                   /db_xref="GOA:A0A0H3KTW8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTW8"
FT                   /protein_id="BAG45667.1"
FT                   /translation="MCEDVSELAEDAAERQRLYERHRDDLSKRQISNAENLDKSILTYS
FT                   GAGLALSLGFLKDFIPIRQAEFAWTLYGSWIFFTLAMVLVILSYVLSLKVVSLQLDRAE
FT                   RYYLKSEEKALGEETRWDFCANHVNHWMSAVAFAIALIFTTFFVSVNLRGANVTGKNTV
FT                   TTSLTHDGVTGIAMQKVQGPAGTVQRGLTGLPMQAVKPAAPSNPAPAAPSTGNTGKSGS
FT                   "
FT   CDS_pept        649402..652416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03808"
FT                   /product="superfamily II helicase"
FT                   /note="COG1204: Superfamily II helicase, Methanosarcina
FT                   acetivorans str.C2A"
FT                   /note="contains a putative peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03808"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45668"
FT                   /db_xref="GOA:A0A0H3KKB3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKB3"
FT                   /protein_id="BAG45668.1"
FT                   /translation="MALKGIFVGINKQLDPNIDELTGAVRDATALNALFLDSIPGFSAR
FT                   LLVDEAATKDNVSEAIFGTLANAADDDVVVISFAGHGSPDGGIAVYDTLCTDLAGTTLS
FT                   MAAIGDAFKATRARAVLCILDCCFSGHAPARVLDVPAQPRSVFALEGVAGEGRILLAAC
FT                   TARQVAWEQPGTGHGLLTYAVIQAMTATSAEQISFPGVGDEIVQIARVEAERIGATQTP
FT                   VFLGNVQGGLVFPRLVLGANYHAAFPSTTVEQMAGPFEQLLDNGFPQSIVDHWVERFPG
FT                   GLNSLQLRAVNEFGVLTGRSLMTVAPTSSGKTMIGELAAIQSVITGKKAIFLLPYRAIV
FT                   SEKFEEFSERYGPSGLRIVRCMGDATDTIGDVLAGRYDLGFFTYEMFLNLALGAPHILN
FT                   RIGLVTVDEAQFIIDPRRGITVELILALLLRARTRGIHPQLIVLSAVIGSLNGFDQWLD
FT                   IPVLLSRDRPVPLIEGVLDRNGVFQYRDVDGMTKTDALLSPHSIRVRKTKPSSQDVIVP
FT                   LAQKLVGAGEKLIVFRNQRGKAQGCARYLSGELGKGAATATLHALPSQDLTSASHDLRE
FT                   CLRGGTAFHSTNLLRAEREAIERGFRDTEGGIWVLGSTTTLAAGINTPASTVILAEQEF
FT                   RGEDGRPFSIAEYKNMAGRAGRLGFNEIGKAIILAETPVERARLFQRYVEGTPEDVVSS
FT                   FAESAMPTWVLRLLSQVRGVKLVEIPGLLVNTFGGYAAARANPNWVAVVQPRVAAFVDR
FT                   LLQAGLAEKEGDDIVHLTMLGQAVGSSSLSFESGLRLVELLRSVDIATTPPLHILAHVQ
FT                   VLQEMSDVYTPLMTRGRAESARVNDVIVRFGPAMSRLLQRYGADEHTFWRRCKRAAILF
FT                   DWVEGVPVDSLERSYTANPFTAIRYGDIVSIADATRFHLRSAQRILSALFPKHQQFLDA
FT                   VDILLTRLEFGVPERALPLSKLCVPLNRGQCLALLQEGVQTAEAVSAMSDAQLLACVGQ
FT                   STFQRLRPQSEVGGA"
FT   CDS_pept        complement(652792..653502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03809"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03809"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45669"
FT                   /db_xref="GOA:A0A0H3KK91"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK91"
FT                   /protein_id="BAG45669.1"
FT                   /translation="MGNDGVVAVEKALSLLDCFKPGAESQSLAMLAQASGMHKTTVYRL
FT                   MNSLERMGYVVRSQAGNYSLGHRVLYLGKLFEQSFHLSSVVEPALHALAAQTKESASYY
FT                   VHDNGRRLCLFRAEPSEGLRETRVAGTTFPLDDTAISQVIRFWGLGEPIYDEPPALPLF
FT                   TAGARDVHTAAFAIPIFGAGDKFMAALTLSGPASRLTQAHETGELDRVQLDAAADLSRR
FT                   LGATAAFCEKFYGL"
FT   CDS_pept        653667..654365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03810"
FT                   /product="putative dimethylmenaquinone methyltransferase"
FT                   /note="COG0684: Demethylmenaquinone methyltransferase,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45670"
FT                   /db_xref="GOA:A0A0H3KPY0"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPY0"
FT                   /protein_id="BAG45670.1"
FT                   /translation="MSKPAVSSSPINRDIERVPPELVQAAARYQAAILADVAGRRGTVH
FT                   GRVRPLSPTMKVAGPAVTVEVRAGDNLAIHAALAVAKPGDVIVVDGKGDISCALLGEIM
FT                   ATQAKASGIAGIVIDGAVRDAHELANGDYPIFAAGLNPCGPTKSVAGRVNAPISLGGTA
FT                   VNPGDLVVGDADGVVVIARADVARIVDLAQKKLDAETARIAAIHKGDVRPGWIEKELRA
FT                   AGMLAEGEAL"
FT   CDS_pept        654365..655312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="BMULJ_03811"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COG0111: Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases, Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K00058"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03811"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45671"
FT                   /db_xref="GOA:A0A0H3KKW5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKW5"
FT                   /protein_id="BAG45671.1"
FT                   /translation="MQTASHKPVVLVTAADLAPQALEMLAQFDVVFAGKQPTEDDIVAL
FT                   CVKHKPVAIIVRYGKINARVMDAAENLQVISKHGSGIDVIDQDAAAARGIAVRAAVGAN
FT                   AAAVAEHAWALILACAKSVPQLDMRMREGHWDKATHKSVELDGRTLGLVGLGAIGRRVA
FT                   AIGVAFGMKVLAFDPFAKEAPAGVTLVPLDTLYAESDVVSMHCPLTADNRRMLNRDTLA
FT                   RFKRGAILVNTARGGLIDEAALAEALTSGPLRAAALDSFDVEPMTSPHPFQQLPNVILS
FT                   PHIGGVSDAAYVNMGKGAAANVLAVLDERAHSAA"
FT   CDS_pept        655333..656262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnl"
FT                   /locus_tag="BMULJ_03812"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="COG3386: Gluconolactonase, Ralstonia solanacearum"
FT                   /note="KEGG, K01053"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03812"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45672"
FT                   /db_xref="GOA:A0A0H3KTX1"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTX1"
FT                   /protein_id="BAG45672.1"
FT                   /translation="MFYLTSPDVREAEVFTRMPEKFRKPDVRTEWARANRGGMVTDSFL
FT                   EGPVWDPAGYLFVTDIPHGRVFRISPSGDWDLVVEYDGEPNGMKRFDASHLIITDYRNG
FT                   LMLLDIARGEIRPYLERRNTERFKGVNDLTFDSAGNIYFTDQGQTGLHDPTGRVYRLSP
FT                   DGKLDMLLGTCPSPNGLVLSRDEKVLFVAMTRGNAVWRMPLQADGSVSKVSQFFTSYGP
FT                   SGPDGLTVDLEGRLFVANPGLGRVWVLNHCAEPVEILTGPKGASLTSVCFGGPDMKTLF
FT                   ITESTSGSVLKADMSIAGPLPKQAAEKD"
FT   CDS_pept        656349..657728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03813"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03813"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45673"
FT                   /db_xref="GOA:A0A0H3KKB8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKB8"
FT                   /protein_id="BAG45673.1"
FT                   /translation="MTVSHALRAGDDAPHADAPPTGRLAAEDYASSERTLAKAFRRILP
FT                   FIFVCYVISYLDRTNVGFAALTMNKDLGLTAEAFGFGAGLFFIGYFLFEIPSNLIMQKV
FT                   GARVWIARIMITWGLFSMATAFVVGPKSFAAARFLLGLAEAGFTPGIYLYFTHWFPGKW
FT                   RAKATAAFLVGIPVANMIGSPISGALLGLGGLHGLRSWQWLLLIEGVPAVMLGIACLFV
FT                   LADRPEKAAWLSDEERASLAKRLAFEQRDIGAKHGSKLRDAMTNWRVFVLAFINFCGIV
FT                   GSLGVGLWMPQIIKQFGVEHAVVGWLTAIPYAIGAVVMLWWARVANRAASRIPYVAGAL
FT                   AVAAVALCASAFIHAPVFKLIALCVTVSGILAFQATYWAIPSGFLTGRAAAGGLALIVS
FT                   VGNLGGFVGPSMIGALKQFSGGFTVPLFAVSGVLLLGALTIAWLGDPGSGAGEAPAARK
FT                   T"
FT   CDS_pept        657775..658926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03814"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03814"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45674"
FT                   /db_xref="GOA:A0A0H3KK96"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KK96"
FT                   /protein_id="BAG45674.1"
FT                   /translation="MLSNQASQNARPSSRFVLGAVTVASAALGCGAVHAQSSVTLYGIV
FT                   DVGIEHINNTSTGGAQTREASGNLSGSRWGLKGVEDLGGGMKAIFQLEDGFNVNDGTTA
FT                   QSTKGLGPNAATTSRLFGRQAWVGLSYRGQQLTFGRQNSLFYEQAVAFDPMGASSRYSV
FT                   LSLDYAAAARIDNSAKYTGVFGPLTAQAMYSTRYDTGYGSEVPGAQLTGRFFSGALTFA
FT                   QGPFAASLSYEQRNSNTVATNTGTERRATAAASYALGPVRGFVGYRYLRASNAFLPANP
FT                   IRVANGAEASAAGLYWAGAQYTVSPAFVVTATAYYQDVHSTSADPWLAVLCADYLLSKR
FT                   TDIYATAGFARNKGGSALGVNGYGTVAPGHNQTGVVIGMRQKF"
FT   CDS_pept        658937..659983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03815"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3618: Predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03815"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45675"
FT                   /db_xref="GOA:A0A0H3KPY5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPY5"
FT                   /protein_id="BAG45675.1"
FT                   /translation="MQNVHAPHLPVRPEWLARRDEPVLEPALAIVDAHHHLWDRQTGRY
FT                   LADEFGADVRSGHRIVSTVYVQCRSMLRASGPDAFKPVGEVQFASGIAAMFDSGAYGPA
FT                   RCCEAIVGGADLSLGAELDAVLDTMLQVSGGRLRGIRNPLAWHASPDVRSSPVTPPRDR
FT                   MSDPAFRRGVTMLARYGLSLDAWVYHTQLEDLYELARACEDVTVVVDHFGGPLGVGPHA
FT                   GRHAEVHAQWKRQLARLAALPNTRLKLGGAGMTVFGFDFAACDLPPSSQELASAWRPYF
FT                   DTCVELFGVDRCMFESNFPVDKGMFSYRVLWNAFKRLASAMSADEKTALFSRTAASTYR
FT                   IAIPGDKP"
FT   CDS_pept        659980..661260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03816"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03816"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45676"
FT                   /db_xref="GOA:A0A0H3KKW9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKW9"
FT                   /protein_id="BAG45676.1"
FT                   /translation="MKTSATAATHDTASAAADKGFARISGMEWRSLSLAGLGWTFESYD
FT                   SFLLSLLLPTLALQFGLSKAQLGMFTSVTAAGQIAGGILFGFVSDRIGRVRTALLCIGI
FT                   YSLFSGLIAFAPDSHWFAALRFLGALGMGGTWTAGAALIAETWHPSRRGKGGALMQMGL
FT                   PIGAILAIAISGIVGAAHGGLAGDGWRLLFLIGASPFFILFWVARKTPESPIWLERKHA
FT                   RSSVRQADAAAHEKLNVRGLLTAFCFIFFLQYLYWGVFTWTPTFLVTVKHLDFVHSLKF
FT                   VLALQFGAITGFLLFSAWVDRIGRRPMFLAYLLVGAIAVGVYIVSANALLLMIAIFLTG
FT                   FSVNGIFAGAGPFLAEIIGNTASRGFFMGLAYNGGRLGGFIAPLIIGALASTSGGFVLG
FT                   LATTIVAFIAAAAVVLFAPETRGKALS"
FT   CDS_pept        661257..662495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03817"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Deinococcus radiodurans"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03817"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45677"
FT                   /db_xref="GOA:A0A0H3KTX4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTX4"
FT                   /protein_id="BAG45677.1"
FT                   /translation="MNVATQAGWVSRLFPALSEASLRRYLSGQVASVLGSWTQNVTLNL
FT                   LIYHLSGSAAILALLNFLLYGPQLIVAPVAGARIGSTNARRVTLCVLTTSLLLTSSLFA
FT                   LSLLGLLGVKLILAHALAIGVSSAVETPARQVLLLTSLRDATLTSNAVAMNTMVYNVGR
FT                   MVGPTIAGFVYPTLGPRASFAIYALALCFMAACVRSIRTASVNRPSRVESSLRDAVGYV
FT                   LSDAFSARYLPILACIGLFAGSYQTLVPLLADQGFHDAARFTGVFFACAGAGSLSAAVL
FT                   LSSAFGPGASRRFIAYAPWTAVGALTVLAATTDAVGSIPAFYALGFSLTFAATSTNATI
FT                   QRQCPEHVRGGLVGMYGMAYNGTMPFGYLLVGSASEALGVRHTFAAMAAVLACGVMAVI
FT                   AWQRFTDSRSGAQ"
FT   CDS_pept        662507..663829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03818"
FT                   /product="putative D-galactonate transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Brucella melitensis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03818"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45678"
FT                   /db_xref="GOA:A0A0H3KKC2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKC2"
FT                   /protein_id="BAG45678.1"
FT                   /translation="MQTGLMEVSAIERRTMRKVVWRLIPFLMMCYLLAFIDRGNVGMAS
FT                   LQMNQDLGMSAQVFGFGSSLFFISYFFFEVPSNLALQKYGARIWIARIMITWGIVSAAT
FT                   ALVHNATTFYVLRFLLGAAEAGFFPGVLLYLSYWIPAQYRARIVATFMVAIPAASFIGS
FT                   PISALLLQMDGVWDLRGWHWLFILEGVPTVLLGIACLFVLTNKPDNASWLDDDERAWLS
FT                   GALAAGHKTHKKVPSLPLTQLFRNRYVLCLALVDTCASAAGSTLSVWQPQLLKSFGLTV
FT                   MQTGLLNSVPYAAASVLMVYWGRHSDRVGERRWHTVVPMLLIGVGLFATSLSGSLLPTV
FT                   CMLCAVLVGAYSFKGPFWALATDMLSNSTVAAGLATVNAIANLLGGGLMVNVYGWVKSA
FT                   TGSYALALMPLAILTLVSVATLLLLTRNHSAGKLVGKTEAI"
FT   CDS_pept        663832..664764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03819"
FT                   /product="predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold"
FT                   /note="COG3618: Predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold, Yersinia pestis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03819"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45679"
FT                   /db_xref="GOA:A0A0H3KKA1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKA1"
FT                   /protein_id="BAG45679.1"
FT                   /translation="MVRSARRDFLRIAGAALASAALPSVAAADEAWSSGSERPAFRLPE
FT                   GAIDCHMHIYDDRFPIAPGTTLRPPNATVAQYRSLQARLGVKRNVVVTPSTYGTDNRCT
FT                   LAAIAQFGDDARGVAVVDSTVSDDELRSLDRGGIRAIRFNLSYPGATTLDMLAPLAARI
FT                   ADLGWHIELVVQGARLPGLERHLAMLPCPLVIDHIAHVPQPGGLSSAAFRAVQRLVEKG
FT                   NTWVTLSGPYVDSKTGAPAYEDVAPVAKALIDMAPERMLWGTDWPHPTQKTDKPDDASM
FT                   LDVIAGWIGRPDWQRLIFVTNPTKLYRFG"
FT   CDS_pept        complement(664802..668458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03820"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45680"
FT                   /db_xref="GOA:A0A0H3KPZ1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPZ1"
FT                   /protein_id="BAG45680.1"
FT                   /translation="MGSILSEQLKLVVLGGSAGSLDPLRAIVAALPSDPGFAVLVITHL
FT                   DPKEESRLPDILQADARMPVEKLVHLRKIEHDRIYVLPENAGVIALDGHFRLTRRQAGL
FT                   NLPIDGCLASLAQDPDVNGAAVILSGTGRDGAGGLVDLKASGGFVIAQQPQTAIHHGMP
FT                   TAAIDTGLVDEVLSLEDIAPCLVRRFGDPARSAEAADAQTADDDALGTAISIVQQKTGI
FT                   NLAYVKDVNLRRRFLRRVLLQKDRDVDAYLQLLRSDAREAEALRDDILIGVTAFFRDAE
FT                   FVNVLRQSVIPALLELKHDPIRVWVPACSTGEEVYTIATLLKEALDRDALHRRVQIFGT
FT                   DINEASIEIARAGRYSLASVDDVPEAFRERTFAATSGGYVVRKAIREMCVFARHNVLTH
FT                   APFSGMDLISCRNLLIYLRKEAQQHVLEVLHYACRPDGFLLLGRAEAVSGADGFEHAGA
FT                   PHLYRKVPAAKRQQGAFPIDALRPWASQGTAPPARRAQQADPVLEAANRTALERYAPPG
FT                   FVVDDKGDVVHFRGDVSGFVAPASGEASLALPRLLQPELNVTVRTALIEAKRTGQPVRR
FT                   ERVALGDTHFALEVLPLAAEDLVPHYLVTLERLPDDAPAPQNTNTGSPHSRVQELERTV
FT                   TTLSDELEATQAQLKSVVAEFESANEELRTANEEMLSTNEELQSANEELLLAKQELESA
FT                   NQELASLNDELKSRNEQLDRVNDDLSNLVEGIPLPVVVLDRQLRLRHFSPQAQALFGLP
FT                   DDSVGQPLAQLNSLFSAVDLERVVQSAVQGLADVEHEYQDSEGRWWLVNVRAYRTADDR
FT                   IDGAVLAFQDIHQLKSALGTAQSAQLDAERANTAKDNFLALVSHELRAPLNVISSWAAV
FT                   LMTASERGMPTDEQMSQRAVTTILRHCQLQAELIDDLLDVSRISSGRFSLDSKPVDFAA
FT                   AVRTVVESHRPVAAKKEIMLATSGLQSQAVVSGDARRLQQVASNLIGNALKFTPQGGRV
FT                   EVALTRLGALIELSVADNGIGVKPELLPRLFDRFMQSDTSRTRQYGGLGLGLSIVKHLV
FT                   TAHGGTVTASSEGEGRGTRLTVRIPLLQTAATEPGTVATAPAESARLDGLSVLLVDDDV
FT                   PAQEPLAHLLRGLGAQVQIASGAKEALACLAAGSFDILVSDLAMPGADGHALLRDVRSR
FT                   EGGRRRIYALALTGLASIHDRDAAIAAGFDDHLPKPVDVKVLLEKLSLGRGR"
FT   CDS_pept        669021..670601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03821"
FT                   /product="putative and unique signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03821"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45681"
FT                   /db_xref="GOA:A0A0H3KKX3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKX3"
FT                   /protein_id="BAG45681.1"
FT                   /translation="MTTYLLPHPVESAEQARDRLERAVDAAELGTFHCPLPLDRLFWNA
FT                   RCKAHFWLDPDTPDDEINIDTFYRILHADDRASVRAAVDAAVTHGGLFDVEYRTVSARG
FT                   DVRWLRAKGSAHVGTDGRPVRLDGITIDISAQKRLERERDALIESERIQRFAAQSASES
FT                   KDAFIAAVSHELRAPSTAILGWADMLGDAADDAAVVREGVAVIRRNILALTRLVDDLLD
FT                   ASRLGQGKFAIESAPVSIAECLNAALQDVAPIAETKGVRIAEPGADDGLVSGDAARLEQ
FT                   VFRNLLDNALKHTPSGGEIVPSLVVGPDTVQVRIADTGAGIPADRLERIFEPFLQIRHP
FT                   LHAQAGGLGLGLSIARSIVVMHRGEITAYSDGLGKGATFTVTLPRLAQARPRERILRDA
FT                   APSDTSIEGSDVLLVEDDADARDALATILRLKRAVVRTASSAEEARLAIRGGVPDLIVC
FT                   DLTMPEESGIDFARTLRRDGVDIPMIALTGHAREEDMRMATEAGFDAYLTKPIDTAHLV
FT                   AAIEKLVRR"
FT   CDS_pept        complement(670783..672261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03822"
FT                   /product="putative diguanylate cyclase"
FT                   /note="COG2199: FOG: GGDEF domain, Ralstonia solanacearum"
FT                   /note="contains GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03822"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45682"
FT                   /db_xref="GOA:A0A0H3KTX8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTX8"
FT                   /protein_id="BAG45682.1"
FT                   /translation="MQPRSSAPHYVVAVGVLIAFALMGLCILQLFQSRQDALDRARETS
FT                   RNLALVAERDITRNVELYNLSLEAVLQGLRRPDVMAASPALRRGVLFDHAMTAQYLGSM
FT                   LVLDAQGNIVLDSQNDVPRHGNFSDRKYFTVHRDRADVGLYVSDPFASRLRGGTPSIVL
FT                   SRRVSNPDGSFAGVALIAINLEYFHKLFAGLALGPHGSISLIGTDGIMVMRQPYELNTI
FT                   GRDISQAATFRRFRSAPEGSFLERSSIDGVRRLYYFKTLPNLPLIVMVAEAEQDIYAAW
FT                   HRRALTIGALVATFGAAFIALSVLLGAQLRRRMRAESELILLARTDGLTGLNNRRSFGE
FT                   VLDREWRRARRVRSVFSLLFVDVDRFKAYNDTYGHQAGDDALAAVARCIGENIRRPADV
FT                   AARYGGEEFVVLLPDTAENGAAQIAERIRIAINELGLEHVGSEFGRVTASIGLASWKPD
FT                   QDVEPDAIIKAADEALYYAKATGRNKVTQFEPTA"
FT   CDS_pept        complement(673342..674772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="BMULJ_03823"
FT                   /product="deoxyribodipyrimidine photo lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="COG0415: Deoxyribodipyrimidine photolyase,
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K01669"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03823"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45683"
FT                   /db_xref="GOA:A0A0H3KKC8"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKC8"
FT                   /protein_id="BAG45683.1"
FT                   /translation="MSVAIVLFRRDLRLSDHPALSAACARHDAVLPVYVHTPDEDAIWS
FT                   PGAASRWWLHHSLTSLDRALREQGGRLLAMQSDPTIAVPALARAVDAQGVYWTRRYEPA
FT                   AIARDAALKSTLRAQGIAAHSYPGALWQEPWTLATDAGQPYRVFTPFWRKLRTSLSDCH
FT                   PLPAARPRRWMTTDDSTAVEALGLLPRIRWDAGLADAWRPGEGGAWERLEQFVDEALAE
FT                   YGDARDAPARLGTSRLSAHLHYGEITPTQILRTLQERVARTSGSVRPDLEPFLRELGWR
FT                   EFAHHLLYHFPHTTDANFDARFDAFAWAPDDGEQLARWQQGRTGIPLVDAGMRQLWQTG
FT                   WMHNRVRMVVASFLTKNLRQHWRHGARWFWDTLVDADLANNTLGWQWVAGCGADAAPYF
FT                   RVFNPYLQAAKFDPDAAYLKRWLPELSRLPADVLHRPWKHSAALAACGYPTPMVDLAAS
FT                   REAALAAYAQLPRSHGGA"
FT   CDS_pept        complement(675031..676200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhC"
FT                   /locus_tag="BMULJ_03824"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /note="COG1063: Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases, Sinorhizobium meliloti"
FT                   /note="KEGG, K00121"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03824"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45684"
FT                   /db_xref="GOA:A0A0H3KKA7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKA7"
FT                   /protein_id="BAG45684.1"
FT                   /translation="MRALRWHGKHDVRCDTVPDPIIESGRDAIVKVSACAICGSDLHLF
FT                   DGLMPSMKHGDILGHEFMGEVVEVGKDNASLKIGDRVVVPFTIFCGECDQCRRGNFSVC
FT                   ERTNRNRNDADRVFGHTTAGLFGYSHLTGGYPGGQAEYVRVPFADRTHIRIPDGLTDEQ
FT                   VLFLGDILPTGWQAAVNCEIEPTDTVAVWGAGPVGQMAIRSALLLGARQVVVIDRVAER
FT                   LEMAERSGAIPIHFEQESVLDRLGELTHGKGPEKCIDAVGMESHATRSADAIYDRVKQA
FT                   MMLETDRPHVLREMIYVCRPAGILSIPGVYAGVLDKIPFGAAMNKGLTFRMGQTHVNRW
FT                   TDDLLARIRSGQFDPSFVITHTVPLEKGPDMYKVFRDKLDGCIKVVMKP"
FT   CDS_pept        complement(676288..676947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03825"
FT                   /product="O-methyltransferase family protein"
FT                   /note="COG4122: Predicted O-methyltransferase, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03825"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45685"
FT                   /db_xref="GOA:A0A0H3KPZ7"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPZ7"
FT                   /protein_id="BAG45685.1"
FT                   /translation="MTTTLTTAPLAPLLDSLFAQAQADGGHAVMNMPRDERERLMRSKT
FT                   EYRNLYGRLKDLWLPVSRETGVLLYQLARSMNARHIVEFGTSFGLSTLYLAAALRDNGG
FT                   GTLIGSEFEPSKVAKARAHLAAGGVDDLVEIREGDALQTLAGDLPDSIDLLLLDGAKAL
FT                   YNDVLDLVESRLRPAALIVADNADYCPEYLARVRDPRNGYLSVPFGADVELSMRLA"
FT   CDS_pept        677329..677976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="BMULJ_03826"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03826"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45686"
FT                   /db_xref="GOA:A0A0H3KKX8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKX8"
FT                   /protein_id="BAG45686.1"
FT                   /translation="MTTRRRTQIAFRKQPQQARSTELVAAILQAATQVLAKEGAARFTT
FT                   ARVAEKAGVSVGSVYQYFPNKASILFRLQADEWMQTTRMLGDILQDTRTPPLDRLRTLV
FT                   HAFLRSECDEAEVRSALADAAPLYRDSPEARSARAEGDRMIDAFMAEVLPSVPDATRKL
FT                   ATDLISTTLGSVGSSFSRVRRTRAEIHAYADELADMLCAYLRALPRTRKARA"
FT   CDS_pept        678139..678378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03827"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03827"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTY2"
FT                   /protein_id="BAG45687.1"
FT                   /translation="MSTLCMQALVRGKTVQVIVLPDESTAKIYIVDEDHRSHRPRTMSI
FT                   RQYVESGMSDEDIAQHVVDVVSTSIEQLERLRSR"
FT   CDS_pept        678952..679164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03828"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45688"
FT                   /db_xref="GOA:A0A0H3KKD4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKD4"
FT                   /protein_id="BAG45688.1"
FT                   /translation="MKNINGKTTGAAWGVAAGLLLAVIGLSLDLFRGVPRGAAVGNDFV
FT                   AYGVAMLGIFLTVYSTRELRRKRQY"
FT   CDS_pept        complement(679178..679477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03829"
FT                   /product="putative hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03829"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKB7"
FT                   /protein_id="BAG45689.1"
FT                   /translation="MTRAYTYRGYTIDVDCEFRLDDTPDADTMDDARFGFVAVVQVRAV
FT                   DTPSRVLAPIRLADDGGRLFTDSLAAVRAGRTAGEILVDDLLIGACAADRAARG"
FT   CDS_pept        complement(679804..681288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03830"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Caulobacter
FT                   vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45690"
FT                   /db_xref="GOA:A0A0H3KQ03"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ03"
FT                   /protein_id="BAG45690.1"
FT                   /translation="MKPLFPPRRPALALCTAACLLAGCTVGPDYRGAPAASDTPTFVRA
FT                   PATGIDAGAPAPSAWWHALHDRRLDALIAAALAHNPDLHAAQARLRAARAQLAQQRAAE
FT                   LPKASATVAAIRMREPDVSTLGALLPSNGSGQSGSAPATLGTGPLQLYSAGFDATWEID
FT                   LFGGTRRAIEAASAQADAVDADLADTQVSIAAEVATAYVDLRDRQQRLALSRRTAELQQ
FT                   QMLALTQQRRARGVAADADIERLTTQVENTRASLIPLDAQVTESLDRLAILTGREPGAL
FT                   DAELSTDEASLPTLPASAPVGDPAALLKRRPDIRAAERRLASSNAQIGEHIADYFPKVT
FT                   LLGDIGFSATDPAHLFRKQNASWIGAPYLQWNILDFGRTRGAVRAAEASRDEADANYRK
FT                   AVLGALQDANTALQRYGHQRDHVVALTKVQASATHSATLMSERYRAGVASMIDLLDTQR
FT                   ESLAARQNVIAAQAELIKDYVSVQKSLGLGWQAGDA"
FT   CDS_pept        complement(681296..682885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03831"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03831"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45691"
FT                   /db_xref="GOA:A0A0H3KKY1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKY1"
FT                   /protein_id="BAG45691.1"
FT                   /translation="MAEPTATVPPAPPHEGRASVTDWIAVAAGALGALMATLDISITNS
FT                   ALPQIQGEIGATGTEGTWISTGYLMSEIVMIPLAAWLTRVFGLRNFLLVNSALFIAFSM
FT                   MCGWSHSLAMMVVGRIGQGFTGGALIPTAQTIIRTRLPLSQLPVGMTLFGLIVLLGPLF
FT                   GPVLGGWLAENVSWSWCFFLNLPVCLLLMALLVFGLPSDRPQWSTFFNADWLGIAGLAI
FT                   GLSSLTVVLEEGQRERWFESQMIVTLSYVSLAGMILIALSQRFAKRPIMRLSLMRNPRY
FT                   ASVIVIVSAVGAGLYGVSYLLPQFLAIVAGYNAEQAGSIMLLSGLPAFLVMPILPRLLG
FT                   KVDFRILVISGLLLFCLSCMLDIDLTAQSVGHDFVWSQLIRGVAQMLAMMPLNQASMAA
FT                   VAREDSGDAAGLYNMARNLGGSIGLAIIGTVIDRRTTFHTAALRESVTANASIGQERLS
FT                   AYAANWFAQTGDLAYSKMRALGQLAQQIQIQAVVMTYSETFYLLGLALLACVPLALLLK
FT                   TPRTPQPMSSGH"
FT   CDS_pept        complement(682878..683996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrA"
FT                   /locus_tag="BMULJ_03832"
FT                   /product="multidrug resistance protein A"
FT                   /note="COG1566: Multidrug resistance efflux pump, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03543"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03832"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45692"
FT                   /db_xref="GOA:A0A0H3KTY5"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTY5"
FT                   /protein_id="BAG45692.1"
FT                   /translation="MSTPQDPPQKADRQENGTTPRNGVSKRRILLAIAVLAAIGGAVWF
FT                   GRWWTVGRFIESTNDAYLQADSMTAAPKVAGYVTDVYVRDNQPVKAGDPLVRLDVRPYR
FT                   VALDQANATVDARRADIARAQAEISQQRANLEQAQAQAKVSQINARHASDEYARYAPLA
FT                   ATGAETHERVAELKSARDQALATLAANDAAIAAARTQIASFGAQLQQARAQLEAAQASA
FT                   AQSRLDLDNTIVRATLDGRVGDRTVRVGQYVQPGTRLLTVVPVDAIYLVANFKETQIGR
FT                   MRVGQPVELHVDALPDDTLSGVVDSFAPGTGAQFALLPPENATGNFTKIVQRVPVRIRI
FT                   APNERARHMLLPGLSVTVDVDTRSARNENRHG"
FT   CDS_pept        684088..684939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03833"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator, Salmonella
FT                   typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03833"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45693"
FT                   /db_xref="GOA:A0A0H3KKD8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKD8"
FT                   /protein_id="BAG45693.1"
FT                   /translation="MSEAKKLRRTSTGGYARGDETRQRIIEAAIELFGERGFAGASTRD
FT                   IAAKAGVNAPALQYYFENKEGVYRACVESIAELGWAVFGPAVAQARAALDADADADTLI
FT                   DAFVDILTALAQRMFTVPKTLNQRMFFAREQNGQEPASASEILLKRMRKPLNDVATELI
FT                   ARISGRPVDDPVTRLRAMSLFGQLTVFHVAQRSALQLLGWESFDAPRAALLGETVADQT
FT                   RLLLQQWHAQRGAADALRGAHERRTRTPAKRAGKREAAGPAAADAPRASTRARRAKKPD
FT                   AT"
FT   CDS_pept        complement(684983..687475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03834"
FT                   /product="MscS family small conductance mechanosensitive
FT                   ion channel"
FT                   /note="COG0668: Small-conductance mechanosensitive channel,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K03442"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03834"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45694"
FT                   /db_xref="GOA:A0A0H3KKC1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKC1"
FT                   /protein_id="BAG45694.1"
FT                   /translation="MRHLLLGWLLAAFVTAVQAATPAPAAASAASSAEPALTPQQARQA
FT                   LAVLESPREREQVETTLRAIAAVGVLSAPAVPASAAAPASGASSAAAPAALTSNGLASM
FT                   LVRQGSRWAVDIGNALRDSLRSLLEVGSVGRWWQDTLGRTDARTDLARSLGLIVAVLVP
FT                   ALVGEWLVRRLLRRALAGLAARRAGAPRDTASDDDARADDAAPPHDTPPPDASDATQSS
FT                   SRGRGHARRHTTLLHRMPRAIVSLLLRSVPLLVFVGIAGLMMSFVTDDGTPVEAALGAL
FT                   IDIYVIGRLVTIVSRLFFQPDAHQLRLLHISDAWAAFAQRSIARIVIVVGACTAAVEIA
FT                   ANLGLTEAGHVALQKAVALVAHVMISVLILQCRRPVAARIRAIAHDRPTLAAVCNALAD
FT                   AWAPVAVFVVMALWFVWALDVHNGYRVLIALGGRSIAVLIGMRMVSIVVFGALARLFHE
FT                   RDDDRTLVHLHAYRYYPLLRRIVSAVIAVVTVVLLLQVWGVPVFRAFESGTIGHRLASA
FT                   LVTIAIAAAVALVVWEAANIAIERRLQRWTREGNLVRAARLRTLLPMLRTLLFVMIALV
FT                   VVLTGLSEIGVNVGPLLAGASIFGVALGFGSQKLVQDFITGIFLLMENAMQVGDWVTLA
FT                   GVSGTVEYLSIRTVRLRGGDGSLYTIPFSSVTTVNNTNRGLGNAAVKVSIAYGEDIDRA
FT                   VATLKEIGAALRDDPQYRDGILSDFSYWGVDQVDGAAIALAGQMQCRDSARWGVQREFN
FT                   RRIAQLFRERGIRIADPQRSLVAYAAGSQREDEGDGDGGVGADRQRSDENGGEHAAPDG
FT                   ATGQPPVDSSTPAPKPAQ"
FT   CDS_pept        complement(687725..688684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03835"
FT                   /product="favin-dependent monooxygenase"
FT                   /note="COG2141: Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03835"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45695"
FT                   /db_xref="GOA:A0A0H3KQ06"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR020020"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ06"
FT                   /protein_id="BAG45695.1"
FT                   /translation="MTTTARARPDIASRVFAAERLSIGLTLPLLRSGDIVADFNEQVEL
FT                   AALADTLGFRALWVRDVPLNSADYPDPVGHLDPWVLLGALASRTRDIALASGAIVLPLR
FT                   HPLHIAKGALSVATLSRGRFILGLGSGDRPPEYAAFGVDADTRRERYRRHWEIVAAALG
FT                   TPSRVLPDIAAPDAPEFVLLPDRADPVPLLAVGSGGQSVDWIARHSIGWMTYHRDPDTQ
FT                   RARHSMWRAAVDRLPTPAFRAFGVSMRLALDANPDAQPAALPLGYSTGRHALAGILEAM
FT                   RAAGVHHVTLNLGAERAVRDVMEELAAHVLPVFHGAQW"
FT   CDS_pept        689868..690761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03836"
FT                   /product="SIR2 family NAD-dependent protein deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="COG0846: NAD-dependent protein deacetylases, SIR2
FT                   family, Pyrobaculum aerophilum"
FT                   /note="KEGG, K01463"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03836"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45696"
FT                   /db_xref="GOA:A0A0H3KKY6"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKY6"
FT                   /protein_id="BAG45696.1"
FT                   /translation="MNDTDFPDPSVAAEPAALDALHAFVERHPRLLVLTGAGISTDSGI
FT                   PGYRDRNGQWTRSPPIQLHEFLGSDAARRRYWARSMIGWPVVGRAQPNRSHTALARLGR
FT                   AGRIERLVTQNVDGLHQRAGSVDVIELHGGIRGVTCIDCGAHHARATIQAQLEADNPAL
FT                   LGVQADAAADGDAHLEWSALDTFRVPACPTCGGLLKPAVVFFGENVPRERVALASQALD
FT                   AADALLVVGSSLMVYSGYRFCRWAQAQHKPIAALNLGRTRADPMLALKVEARCAPALEA
FT                   LTARLGLAHDDAEHAS"
FT   CDS_pept        690758..691399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03837"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03837"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45697"
FT                   /db_xref="GOA:A0A0H3KTY9"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTY9"
FT                   /protein_id="BAG45697.1"
FT                   /translation="MSAPNPATNPSARRSAPAAERNRGPILDVLRRVLPARGRVLEIAS
FT                   GTGQHVVHFAQALPALRWQPSDPDPLARESIAAWIAHTGVANVDAPLAFDVRDPSWPAA
FT                   PIDAIVCINMIHISPWASAQALFAGAARVLRPDGVLYLYGPYRRGGRHTAPSNDAFDLQ
FT                   LRSRDPSWGVRDLETVVALGADLGLDCTEVVEMSANNLSVVFRRVPRADQ"
FT   CDS_pept        691495..692907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="BMULJ_03838"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /note="COG0362: 6-phosphogluconate dehydrogenase,
FT                   Escherichia coli O157:H7"
FT                   /note="KEGG, K00033"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03838"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45698"
FT                   /db_xref="GOA:A0A0H3KKE2"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKE2"
FT                   /protein_id="BAG45698.1"
FT                   /translation="MGKQAIGVIGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAE
FT                   FPGRNLVPTYTLEEFVASLETPRRILMMVKAGEATDATIASLKPLLEKGDVLIDGGNTH
FT                   FTDTIRRNQELAQSGLHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKA
FT                   PSDGEPCVAYMGPDGAGHYVKMVHNGIEYGDMQLIAESYAVLKHVAGLTNEELGAVYTE
FT                   WNQGELDSYLIEITSKIFGKKDDETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPL
FT                   ITESVFARVLSSLKTERVAASKILSGPAAAPFDGDRAAFIEAVRRALYLSKVISYAQGF
FT                   AQLRTASEEYGWNLDLGTIAKIFRAGCIIRARFLQKITDAYAKDPALANLLLDPYFRGI
FT                   AEQYQASLRDVVVAAVKAGVPVPAFASAVAYFDSYRSERLPANLVQAQRDFFGAHTFER
FT                   TDKPGSFHANWS"
FT   CDS_pept        693107..693451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03839"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03839"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45699"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKC6"
FT                   /protein_id="BAG45699.1"
FT                   /translation="MKSLIATFAAAAVLAVPAVSFAQQNAPVTRAQVKAELVQIQQAGY
FT                   KLGSDRTTYPEGIQAAEARLNPQQSVAAADTTGYGAQPAAQQESGAPAAAKTGWQVKRI
FT                   ADGAPVYKGR"
FT   CDS_pept        complement(693549..693869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ11"
FT                   /protein_id="BAG45700.1"
FT                   /translation="MNNATFLSVQLNADDFAGATGIVERLNRHLLSATDVAEAADALVQ
FT                   LASVARLTAGPRHSVELPAVAIERLRDALDTLSGYDESWLRVLEPAAAPFIDPARGRRP
FT                   LH"
FT   CDS_pept        694246..694983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /locus_tag="BMULJ_03841"
FT                   /product="lipoprotein"
FT                   /note="COG0739: Membrane proteins related to
FT                   metalloendopeptidases, Ralstonia solanacearum"
FT                   /note="KEGG, K06194"
FT                   /note="NlpD protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03841"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45701"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKY9"
FT                   /protein_id="BAG45701.1"
FT                   /translation="MRKTIPIHASAVRWLPHAAFLAAAVALGGCTMTPWTDTWQPAPRA
FT                   STPASIATPGVLAGYYRVNPGDTLASIAGAYGQRVQDVASWNHMAATDAVTPGQVLRVA
FT                   PPAATSISPPPSAAAAQSGTLAWPATGVVTTPFTSGKTRGIVIAASGPDHTVRAAANGR
FT                   VVYAGSGVKAYGPLVILKHDNGLITAYGHNDKLLVNEGDAVRVGQPVAEMGTDASGRAT
FT                   FEFEVRQNGKVVDPMGFLPRNGG"
FT   CDS_pept        complement(695033..695671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03842"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03842"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45702"
FT                   /db_xref="GOA:A0A0H3KTZ2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTZ2"
FT                   /protein_id="BAG45702.1"
FT                   /translation="MSKAFFVTAYRLIAALLAVSTTAHSIADYWNLPSFHLGNYLSYFT
FT                   QLSSLYAAAMLAVGLGRITRPGSPRYESMRGAAVLYVLITAIVYELLLARLDALRHVTP
FT                   AFNNWVLHRIVPFVMLCDWLYVEPRSPIPRRSAFLWLGFPIVYLGYTLVRGAVEDWYPY
FT                   PFVDPRPHGYLPVAIQCSLIALGAAALALGIRWVGNHARQSGAATLKSG"
FT   CDS_pept        695884..696420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03843"
FT                   /product="putative cytochrome b561"
FT                   /note="COG3038: Cytochrome B561, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03843"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45703"
FT                   /db_xref="GOA:A0A0H3KKE6"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKE6"
FT                   /protein_id="BAG45703.1"
FT                   /translation="MRNILAQQVRYNKPAIFFHWVIFVLVALAYLAIEIRGPKGSDSRA
FT                   FWMNVHFTAGTLVLALSVLRVLWRAIGRTPAPVPQPALLKWLATLAHIALYVFIIAQPL
FT                   LGIMMVNLGGKPVSLDWLGVSFTLFGPDKALRPTIKEAHELIGNAFYFVIGLHALAALY
FT                   HHFIKRDDVLRRMAP"
FT   CDS_pept        696583..696951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03844"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03844"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45704"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKD2"
FT                   /protein_id="BAG45704.1"
FT                   /translation="MLHRHRHLTAWLGVFAIWFAIAAPLVSQWRVAQASAVDATICSAE
FT                   HGAHRSSDAGGAHAHGASLDACGYCGFFAHSPAIGGASAASFAPVPVSSVFVAAPQADA
FT                   THPDRYPRAYPRAPPERA"
FT   CDS_pept        697033..699174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03845"
FT                   /product="iron complex outer membrane receptor protein"
FT                   /note="COG1629: Outer membrane receptor proteins, mostly Fe
FT                   transport, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02014"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03845"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45705"
FT                   /db_xref="GOA:A0A0H3KQ16"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ16"
FT                   /protein_id="BAG45705.1"
FT                   /translation="MTIFSLRTPPASPSACARPAPRMLKLAVPALTAGVLSATAAAADA
FT                   DAPAHRADVPPDTPGMLLLPVEVVASPLSTPLVVVTDPKAPRQPLPASDGADYLKTIPG
FT                   FTSIRSGGTNGDPVLRGMFGSRLNVLANGMPTLGACPNRMDAPTSYIAPESYDKVTVVK
FT                   GPQTVLYGPGASAGTVLFERTTPRFERPGMRFDGSVVGGSFGRNDQNVDVTAGTPDFYG
FT                   RVIANHAHAQDYRDGNGRTVPSQWDKWNADAALGWTPDVHTRVELTAGTGDGYARYAGR
FT                   GMDGAHFRRDTFGLSFDKRHLGDVLDRIEARVYYNEADHVMDNYTLRQPDPASSMPMRM
FT                   ASEVRRRTLGARAAATWRFGDAFKLVTGVDAQSNRLDSRAAMGRQNYGDQPWDAQATMW
FT                   NAGAFGELTWYAAEAARVIGGARVDYASARDKRATTGGMMTSRPNPTFDDDRARVLPSG
FT                   FLRYERDLASLPVTWYAGIGHAERYPDYWELFSAKRGPAGSVNAFSAVQPEKTTQLDIG
FT                   AQYKSDRLDAWVSAYAGYVQDFILFDYASGMMGPTTRASNVNAQIMGGEAGVGWRPVAP
FT                   LRIETSVAYAWGRNATSGDPLPQMPPLEARVGLEYTRGAWSAGGLWRVVAPQHRYAVNE
FT                   GNVVGKDFGPSAGFGVLSLHAQYNVSKTVQISVGVDNLLNKAYAEHLNLAGNAGFGYPA
FT                   NAPVNEPGRTAWVRVSAKL"
FT   CDS_pept        699394..700488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="BMULJ_03846"
FT                   /product="triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="COG1075: Predicted acetyltransferases and hydrolases
FT                   with the alpha/beta hydrolase fold, Xylella fastidiosa
FT                   9a5c"
FT                   /note="KEGG, K01046"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03846"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45706"
FT                   /db_xref="GOA:A0A0H3KKZ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKZ3"
FT                   /protein_id="BAG45706.1"
FT                   /translation="MARSMRSRVVAAAVACAMSAAPFAGTTALMTLATTRTALAAIAPA
FT                   DDYAATRYPIVLVHGLTGTDKYAGVLEYWYGIQEDLQRHGATVYVANLSGFQSDDGPNG
FT                   RGEQLLAYVKQVLAATGATKVNLIGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEF
FT                   ADFVQSVLAYDPTGLSSSVIAAFVNVFGILTSSSHNTNQDALAALTTLTTAQAATYNRN
FT                   FPSAGLGAPGSCTTGASTETVGGNTHLLYSWAGTAIQPTNSAFGVTGASDTSTIPVIDP
FT                   ANALDASTLALLGTGTVMINRGSGQNDGLVSKCSALYGQVLGTHFKWNHLDEINQLLGV
FT                   RGAYAEDPVAMIRTHANRLKLAGV"
FT   CDS_pept        700492..701550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03847"
FT                   /product="lipase chaperone"
FT                   /note="COG5380: Lipase chaperone, Xylella fastidiosa 9a5c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03847"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45707"
FT                   /db_xref="GOA:A0A0H3KTZ6"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTZ6"
FT                   /protein_id="BAG45707.1"
FT                   /translation="MAARDGRASPMRRVAVYAVAGCAAVTAVVLWRGASPPRDIEVAHA
FT                   GSQAGERGAIALPSPAAPPAGASVPAPLAGSSAPRLPLDPGGHLAKSRAVRDFFDYCLT
FT                   AQSELDAAALDALVAREIAAQLDGTVAQAEALDVWHRYRAYRDALAKLPDAGAVTDKSD
FT                   LGALQLALDRRASIAYRTLGDWSEPFFGAEQWRQRYDLARLRIMQDRTLTDAQKAERLA
FT                   ALDQQMPVDERAAQQRANAQQAAIDRIAQWQKSGAAPDATRAALAQTLGADVAARVAQL
FT                   QQDDAAWQSRYADYAAQRAQIEAAGLSPQDRDAQIAALRQRVFTKPGEAVRAASLDRGA
FT                   AATATATTGTAQ"
FT   CDS_pept        complement(701575..703110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03848"
FT                   /product="DNA-binding protein"
FT                   /note="COG1167: Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00375"
FT                   /note="contains aminotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03848"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45708"
FT                   /db_xref="GOA:A0A0H3KKE9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKE9"
FT                   /protein_id="BAG45708.1"
FT                   /translation="MDTVIVADWLSARLDRTSSEPMYRQLLQLMQQVILTGELGPGTKL
FT                   PSSRTLAADLSIARNTVLHVYDQLTAEGYVLTTTGSGTYVADTRPDAAAMRAHGAGAAR
FT                   SDGGAATSATAAADAQGGLSMRGRQLIEHAGVSRRQWGAFMPGVPDVSEFPSRTWSRLQ
FT                   ARLWKEANPELLTYAPGGGYRPLRRALADYLRVARSVKCSPDQVIITTGIHQSIDLAVR
FT                   LLSDIGDRAWVEEPCYWGVRSVLQAAGLTLAPVPVDQEGLAPSASDMQHPPRLVLVTPS
FT                   HQYPLGMVMSLARRRMLLEYARQHRCWIIEDDYDSEFRYGSRPLASLQGLDDGGRVIYV
FT                   GSLGKMLFPGLRMGYMVVPEHLVDTFRTGLSELYREGQLMQQAVLAEFIMDGHLTSHVR
FT                   RMRTLYGERRQLLIDAIRARFGDTLPVMGDEAGLHLVLGLPDACDDRAVTQSAFEAGVI
FT                   VRPLTSYYSCADTAQRGLLLGYACVAHEGIGPAFDTLAAIIEQHLPRHATRAA"
FT   CDS_pept        703220..704362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="BMULJ_03849"
FT                   /product="spermidine/putrescine transport system
FT                   ATP-binding protein"
FT                   /note="COG3842: ABC-type spermidine/putrescine transport
FT                   systems, ATPase components, Ralstonia solanacearum"
FT                   /note="KEGG, K02052"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03849"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45709"
FT                   /db_xref="GOA:A0A0H3KKD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKD7"
FT                   /protein_id="BAG45709.1"
FT                   /translation="MKSDDVIVSFRGVRKTYDGETLVVKSLDLDIRRGEFLTLLGPSGS
FT                   GKTTCLMMLAGFEFPTGGEIRLDGELLNHVPPHKRNIGMVFQNYALFPHLTVEQNVAYP
FT                   LTVRKLPAAERAERVAHALKMVQMERFAKRYPAQLSGGQQQRIALARALVFEPKLVLMD
FT                   EPLGALDKQLREHMQYELKALHEKLGVTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDT
FT                   VDRLYESPCNEFVANFIGDSNRLRGTIARVDGEFCELRLGDGTRLVGRRIGDVAEGAAA
FT                   IACIRPERMSLAAHAANGQAPDRVNGDANGHANGAAANRLTGEARSLIYFGDHVRVRCA
FT                   LPGQDECFVKMPLGTGALDAFSPGAPVSLAFAPEHLRVFA"
FT   CDS_pept        704456..705502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="BMULJ_03850"
FT                   /product="spermidine/putrescine transport system
FT                   substrate-binding protein"
FT                   /note="COG0687: Spermidine/putrescine-binding periplasmic
FT                   protein, Ralstonia solanacearum"
FT                   /note="KEGG, K02055"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45710"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ21"
FT                   /protein_id="BAG45710.1"
FT                   /translation="MNGTGFAVRGTALALALAAIGASATAAELTVVNFGGANGDAQKVA
FT                   FNQPFEKATGNKVTAVEYNGEQAKVKAMVEAKHVNWDVVEVESGDLNRGCDEGLYEKLD
FT                   WSKIAKKSDLIPEAPQVCGVGFFVWSTALSYNADKLKTAPTGWADFWNVKKFPGKRGMR
FT                   KGARYNLEFALMADGVAPKDVYKVLGTKAGQDRAFKKLDELKPYIQWWEAGAQPPQFLV
FT                   AGDVVMSTAYNGRIDAAQKEGKNLKVVWNGSIYDLDYWAIPKGSPNKALAEQYIAYTLT
FT                   PKPQQAYAQHIAYGPANIAAIKSLDAKTLANLPNSPANGKNAVLEDIGFWTDHSDELEQ
FT                   RFAAWATK"
FT   CDS_pept        705594..706859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="BMULJ_03851"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1176: ABC-type spermidine/putrescine transport
FT                   system, permease component I, Ralstonia solanacearum"
FT                   /note="KEGG, K02054"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03851"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45711"
FT                   /db_xref="GOA:A0A0H3KKZ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKZ7"
FT                   /protein_id="BAG45711.1"
FT                   /translation="MNTMTIASSPTSTAALKRELKAAEARKRTMALLLIAPLAIFLLLV
FT                   FVVPIGTLLTRAVQNPEIAAALPNTVAALSHWDRKTPPSDAAYAALATDMTKVADSDAM
FT                   GALARRLNTEIPGYRSLVAKTARAMPLKGDADAALTPAQTRARLIELDARWDEVAYWQA
FT                   IAKNGSAYSPFYLLAALDHKQDGFGSIVHADPDQSIYLAIFGRTFVIGIAVTLFALLLG
FT                   YPLAYWISTLSERRANLAMILVLIPFWTSVLVRVAAWIVLLQNEGLINKALIGSGLLAH
FT                   PLALLFNRVGVYISMTHILLPFMILPLYSVMKSIPPTYQRAAVSLGSHPFAAFWRVYVP
FT                   QTYPGVGAGALLVFILAIGYYITPALLGGPNDQMVSYYVAYFTNVTINWGMACALGGLL
FT                   LAATLVLYAVYGRFTRTNVSLG"
FT   CDS_pept        706891..707727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="BMULJ_03852"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1177: ABC-type spermidine/putrescine transport
FT                   system, permease component II, Ralstonia solanacearum"
FT                   /note="KEGG, K02053"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03852"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45712"
FT                   /db_xref="GOA:A0A0H3KU01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KU01"
FT                   /protein_id="BAG45712.1"
FT                   /translation="MKLARPLFAPHMSFVERAWYVALRVLVVLTLLYLILPVLAIVPLS
FT                   FSSSTFLVYPIPGFSTRWYENLIASDEWRMAAKNSFIVAPSATLVATVLGTLAAIGLTK
FT                   AEFRGKGLLMAVLLSPMIVPVVVVGVGMYLFFAPLGLANTYTGLIAAHAALGVPFVVTT
FT                   VAATLQGFNQNLVRASLSLGANPVTTFFRVTLPVIAPGVMSGALFAFATSFDEVVVTLF
FT                   LAGADQTTLPRQMFTGIRENISPTIAALATILIVFSTSLLLALEWLRGRQARRAVA"
FT   CDS_pept        708131..709480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebQ"
FT                   /locus_tag="BMULJ_03853"
FT                   /product="multidrug resistance protein"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Escherichia coli K12"
FT                   /note="KEGG, K08169"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03853"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45713"
FT                   /db_xref="GOA:A0A0H3KKF3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKF3"
FT                   /protein_id="BAG45713.1"
FT                   /translation="MAAVLLAVALATLDTAIANTALPAIATDLHASPAASVWIINAYQL
FT                   AMVATLLPFASLGDIVGHKRVYVGGLAVFTLASLGCALASTLPQLTAARIVQGLGASAI
FT                   MSVNIALIRNLFPAHRLGRGVGFNALVVGVSFAVGPTIASLILSAAAWPWLFAVNVPLG
FT                   VLALAVAIPSLPEAVRGKHAFDPLAALFNVIAFSALIFALGEFAQRGPLRVVLVAAAVA
FT                   LAFGALLIRREAGHPAPMLPVDLFRRPVFALSAVTAVCAFAAQGLAFVSLPFYFETVLH
FT                   RSAVDTGFLMTPWSAVVALAAPIAGRLSDRYPPGLLGAIGLALLGAGMASLAALPAAPS
FT                   AIDIGWRMMLCGAGFGFFQSPNLKALMSSAPPERSGGASGIIGTARLIGQATGAALVAL
FT                   SFGIAGHHGPTLALVLGAAFACAASVASGLRLFARSHRAGVAVASERASK"
FT   CDS_pept        complement(709535..711274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03854"
FT                   /product="pseudomonalisin"
FT                   /EC_number="3.4.21.100"
FT                   /note="COG4934: Predicted protease, Clostridium
FT                   acetobutylicum"
FT                   /note="KEGG, K05998"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03854"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45714"
FT                   /db_xref="GOA:A0A0H3KKE1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKE1"
FT                   /protein_id="BAG45714.1"
FT                   /translation="MKRNVRFALPLPSHRRIAYAWPLLVAAGTAHAATDWVDTHTKAFL
FT                   TGPQLMARSAASSLELAAGETTDVVVSLKLRNADQLKQLARDVNRPGSARYRQYLTPER
FT                   FLADYAPTEAQVKSVVDYLRKSGFVNIEVAPNRLLVSARGTAGTVKTAFNTSLVRFQYA
FT                   GRSGFANASTAQVPRALGDVVGSVLGLQNVARAHPMLRIGNVSKPQTLAAGTATGHYPK
FT                   EFPGLYNATGVPTAAGVTVGIITIGGVSQTLQDLKRFASSNGYATVATQTVKTNGTGTS
FT                   GSYADDPDGQGEWDLDSQSIVGAAGGQVGKLVFYMADLNAPGNTGLTQAFNRAVSDNTA
FT                   KVINVSLGWCETDANADGTLDAEEQIFTTAAAQGQTFSVSSGDEGVYECNNRGYPDGAN
FT                   YTVSWPASSPHVLAIGGTTLYTTSAGAFSSETVWNEGLDSNGKLWATGGGVSTLLPAPA
FT                   WQSGSNRRLPDVSFDAAQSTGAYIYNYGQLQQIRGTSLAAPIFTGFWARLLAANGTGLG
FT                   FPAANLYRAIPANPSLVRYDVVSGNNGYQGYGYTAGTGWDYPTGFGSLNIANLNKLIQS
FT                   GGF"
FT   CDS_pept        711890..712213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03855"
FT                   /product="ArsR family transcriptional regulator"
FT                   /note="COG0640: Predicted transcriptional regulators,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03855"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45715"
FT                   /db_xref="GOA:A0A0H3KQ27"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ27"
FT                   /protein_id="BAG45715.1"
FT                   /translation="MSAAQDLLFRTLADPTRRALFERLCEEGELTVAALTAHAGVSQPA
FT                   VSKHLGVLKQAGLVIDRHEGRQTHYSARPHALAPLADWTNRMAGFWQDRFDALEDLLKR
FT                   MDQ"
FT   CDS_pept        712210..712647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03856"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3832: Uncharacterized conserved protein,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03856"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45716"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KL01"
FT                   /protein_id="BAG45716.1"
FT                   /translation="MNADRRTETRSVVVERELPHPPEKVWRALTQPHLLEAWLMASDFE
FT                   PVEGHAFRFRADWGEVDCEVLTIEPQRTLRYTWAAYGLESIVTWTLAPTSAGGTHLRME
FT                   QTGFRTDQEQAYRGAQAGWPAFFDALAQLLARGDDDTQARA"
FT   CDS_pept        712644..713081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03857"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5649: Uncharacterized conserved protein,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03857"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45717"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KU05"
FT                   /protein_id="BAG45717.1"
FT                   /translation="MTAADMSAQARIDALIAGIADWRGAMLAELRRTILAADAGIVEAW
FT                   KWMGSPVWECDGTIAVANAHKGKVKLTFMHGAQLPDPDRLFNAGLEGNARRAIDFVEGD
FT                   RIDARALKALVRAAIDYNRAHLKKNARAGAGAKATRSRNAA"
FT   CDS_pept        complement(713226..715943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="BMULJ_03858"
FT                   /product="aconitate hydratase 1"
FT                   /EC_number="4.2.1.3"
FT                   /note="COG1048: Aconitase A, Ralstonia solanacearum"
FT                   /note="KEGG, K01681"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03858"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45718"
FT                   /db_xref="GOA:A0A0H3KKF8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKF8"
FT                   /protein_id="BAG45718.1"
FT                   /translation="MAHNLHKTLKEFDSGSGKGKFYSLPQLGKELKTKIERLPVSIRVV
FT                   LESVLRNYDGKKITEEHIAQLANWQPTAKRVDEIPFVVSRVVLQDFTGVPLLADIAAMR
FT                   GVAQRTGKDPKKIEPLVPVDLVVDHSVQIDYFRQKDALDLNMKLEFQRNNERYQFMKWG
FT                   MQAFDTFKVVPPGVGIVHQVNLEYLARGVHKKSDGADTIYYPDTLVGTDSHTTMINGIG
FT                   VVGWGVGGIEAEAGMLGQPVYFLTPDVVGVELKGRLREGVTATDLVLTITEMLRKEKVV
FT                   GKFVEFFGEGTKSLSVPDRATIANMAPEYGATMGFFPVDEKTIQYFEGTGRTQAEIAAF
FT                   ENYFKAQKLFGIPKAGDIDYTKTLTLDLATVAPSLAGPKRPQDRIEIGNVKSTFSELFS
FT                   KPVAENGFAKKAEDLDAEYRTSNGITVKNGDVLIAAITSCTNTSNPSVLLAAGLLAKKA
FT                   VEAGLTVAPHIKTSLAPGSRIVTEYLTKTGLLPYLAKLGFEVAAYGCTTCIGNAGDLTP
FT                   ELNEAITKNDIVAAAVLSGNRNFEARIHPNIRANFLASPPLVVAYAIAGNITRDLMTEP
FT                   VGKGKGGRDIYIGDIWPSSEEIQSLLKFALDPEKFEKNYAHLTKKGDLWSKIEGESGQV
FT                   YDWPKSTYIAEPPFFGHDFSMQPAESIAAVKGARALGIFGDSVTTDHISPAGSIKEDSP
FT                   AGKWLKENGVQKADFNSYGSRRGNHDVMMRGTFANVRIKNLMIPAKEDGTRVEGGLTIH
FT                   QPSGEQLSIYDAAMKYIDEGTPTVVFAGEEYGTGSSRDWAAKGTQLLGVKAVIARSFER
FT                   IHRSNLVGMGVLPLQFKGADSVQSLGITGEETYDIEGLGDDFKPQQDVTLVIHRKNGET
FT                   QRVPVLLRIDTPIEVDYYKHGGILPFVLRSLLAA"
FT   CDS_pept        complement(716004..717458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="BMULJ_03859"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="COG2079: Uncharacterized protein involved in
FT                   propionate catabolism, Ralstonia solanacearum"
FT                   /note="KEGG, K01720"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03859"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45719"
FT                   /db_xref="GOA:A0A0H3KKE5"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKE5"
FT                   /protein_id="BAG45719.1"
FT                   /translation="MSAPVSNARPAPDTVLVDIVDYVLNAGAIDSALALETARHCLIDT
FT                   LGCGLEALSYPACTKLLGPVVPGTIVPNGAKVPGTSFQLDPVKAAFDIGATIRWLDFND
FT                   TWLAAEWGHPSDNLGGILATADWLSRTAVAAGKAPLAMRDVLIAMIQAHEIQGCLALEN
FT                   SFNAVGLDHVLLVKVASTAVVGRLLGLTRDELINAVSNAFVDGHPLRTYRHAPNTGSRK
FT                   SWAAGDATSRAVRLALIAKTGEMGYPSALSARTWGFYDVLFGGKPFRFQRPYGTYVMEN
FT                   VLFKIAFPAEFHAQTAVEAALQLHDALAAAGRSTDEIARITIRTHAAAIRIIDKQGPLA
FT                   NPADRDHCIQYMVAVPLLFGRLTAADYEDAVAADPRIDALRAKTICVEDPQFTKDYHDP
FT                   NKRSIANALTIEFANGSTLAEVAVEYPIGHRRRRADGIPLLVDKFRTNLARRFPAKQQQ
FT                   AILDVSLDQAKLEAMPVNEYVDLYMI"
FT   CDS_pept        complement(717482..717985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ31"
FT                   /protein_id="BAG45720.1"
FT                   /translation="MKKLLIATVIGALSATMLVSAPSVFAQGTTAKKTAKRPAPAKRII
FT                   PRSKKAQARAAAKVDPVPDGAVKWSCKDGLSFDLAGDMKRDQVVTVHWAKKNYKLPREA
FT                   TTTGADTFYDPAAGFKLVVIPSKAMLFTDANGGERLADECVTPEMAQGGAAPTQANELK
FT                   PAVN"
FT   CDS_pept        complement(718222..719229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="BMULJ_03861"
FT                   /product="citrate lyase beta chain"
FT                   /EC_number="4.1.3.6"
FT                   /note="COG2301: Citrate lyase beta subunit, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01644"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03861"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45721"
FT                   /db_xref="GOA:A0A0H3KL07"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040186"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KL07"
FT                   /protein_id="BAG45721.1"
FT                   /translation="MPALTPAQVLYDGASPPAILPCCDHYAGSEKLMRKSLALQAELGP
FT                   VFDITLDCEDGAAVGHEAAHAELVAELLGSAENRFGRVGARIHDFSHPHWRDDVRIILR
FT                   AARAPAYLTLPKIANAADAAEMCAFIEGTRRELGIAQPIPVDVLVETHGALAQAATLAA
FT                   LPMVGTLSFGLMDFVSAHHGAIPDTAMRSPGQFEHPLVRRAKLEIAAACHAHGKTPSHN
FT                   VTTEVRDMSVVAGDARRARDEFAFTRMWSIHPAQIRPIVDAFAPRTDEIALAAEILLAA
FT                   QAADWGPTRHGDTLHDRASYRYYWSVLRRARATGQPVPPEAAPLFGSSAAGDAT"
FT   CDS_pept        complement(719399..720385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="BMULJ_03862"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="COG0039: Malate/lactate dehydrogenases, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00026"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03862"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45722"
FT                   /db_xref="GOA:A9AMD5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AMD5"
FT                   /protein_id="BAG45722.1"
FT                   /translation="MAKPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVILQLLDLP
FT                   QAQAAVKGVVMELDDCAFPLLAGVVITDDPKVAFKDADVALLVGARPRSKGMERKDLLS
FT                   ANAEIFTVQGAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLPKKNFTAMLRLDHNR
FT                   ALSQLAAKSGKPVASIEKLAVWGNHSPTMYPDFRFATAEGESLLKLINDDEWNRNTFIP
FT                   TVGKRGAAIIEARGLSSAASAANAAIDHVRDWVLGTNGKWVTMGIPSDGSYGIPEDIIY
FT                   GVPVTCENGEYKRVEGLEIDAFSREKMDATLAELLEERDGVAHLLKN"
FT   CDS_pept        720685..721500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03863"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG2188: Transcriptional regulators, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03710"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03863"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45723"
FT                   /db_xref="GOA:A0A0H3KU09"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KU09"
FT                   /protein_id="BAG45723.1"
FT                   /translation="MTSNQANTANPTGAGSPGQPGASDSAPASAAAQSPTFSPLYQQIK
FT                   ALITQSLESGEWKPGEIIPSEVELAARYKVSQGTVRKAIDELAAENLVVRRQGKGTFVA
FT                   THNEERAQFRFLRLLADDGAEHAHVSRLLECRRLRAPAEIARQLELKPADPVVQVRRLL
FT                   EFEGEATVLDEIWLPGAMFRGLTFERLSEYKGPLYAMFETEFGTRMIRASEKIRAVAAE
FT                   PTVADLLHVPAGFPLLSVERVSYTYGDRPVEVRRGWYVTTGYYYQNDLS"
FT   CDS_pept        721672..722088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="BMULJ_03864"
FT                   /product="succinate dehydrogenase cytochrome b-556 subunit"
FT                   /note="COG2009: Succinate dehydrogenase/fumarate reductase,
FT                   cytochrome b subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00241"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03864"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45724"
FT                   /db_xref="GOA:A0A0H3KKG2"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKG2"
FT                   /protein_id="BAG45724.1"
FT                   /translation="MTDAVRKPRPEYRNIGFGDITMNYRLPLAAKLSILHRVSGALLFL
FT                   FLPFLLFLFDQSLTSELSFEVFKAFLSNIVVKLIVLVLSWAFFHHFCAGIRHLLMDVNH
FT                   DAVSKEGGKRTAVVVFVVSIALTIAMALKLFGAF"
FT   CDS_pept        722093..722461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="BMULJ_03865"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /note="COG2142: Succinate dehydrogenase, hydrophobic anchor
FT                   subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00242"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03865"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45725"
FT                   /db_xref="GOA:A0A0H3KQM5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQM5"
FT                   /protein_id="BAG45725.1"
FT                   /translation="MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFF
FT                   GAHDFSYEGWASIFSAQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLT
FT                   IVWLLACAGYAAQILWRV"
FT   CDS_pept        722465..724240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="BMULJ_03866"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /note="COG1053: Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00239"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03866"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45726"
FT                   /db_xref="GOA:A0A0H3KQ35"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ35"
FT                   /protein_id="BAG45726.1"
FT                   /translation="MAAIKTSLPRRKFDVVIVGAGGSGLRAALQLSRAGLSVGVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHFHFYDTIKGSDWLGDQDAIEFMCREAPNVVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVEAKT
FT                   QFFVEWMALDLIRDADGDVLGVTALEMETGDVYIMEGKTTLFATGGAGRIFAASTNAFI
FT                   NTGDGLGMAARAGVALQDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALK
FT                   FANVDCIKEPIPVVPTIHYQMGGIPTNIHGQVVGTSRDHKEPINGFYAVGECSCVSVHG
FT                   ANRLGTNSLLDLVVFGRAAGNHIVEQVKKQKEHKPLPADAGEFSLARLNKLDKSSSGEY
FT                   TQDVANDIRATMQKHAGVFRTSALLKEGVELMDGLKQRVEHIHLKDKSKVFNTARVEAL
FT                   ELENLIEVARATMVSAEARKESRGAHAHSDYEHRDDENWLRHTLWYSEGDRLDYKPVQM
FT                   QPLTVESVPPKARTF"
FT   CDS_pept        724262..724963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="BMULJ_03867"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /note="COG0479: Succinate dehydrogenase/fumarate reductase,
FT                   Fe-S protein subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00240"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03867"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45727"
FT                   /db_xref="GOA:A0A0H3KV32"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV32"
FT                   /protein_id="BAG45727.1"
FT                   /translation="MAKRIFEVYRYDPDKDAAPRMQTYELEIKHERMLLDALVKLKALD
FT                   ETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLIVDMT
FT                   HFFNQYHSIKPYLINDAPPPEKERLQSPEERDELDGVYECILCASCSTSCPSFWWNPDK
FT                   FVGPAGLLQAYRFIADSRDTATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIG
FT                   KIKELMVRRAV"
FT   CDS_pept        725049..725321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03868"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2938: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K09159"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03868"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45728"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KU12"
FT                   /protein_id="BAG45728.1"
FT                   /translation="MSDHSHQSDPHRRARLRWRARRGLLENDIVFERFFSRYEHDLTDA
FT                   DVGALSRLLDLSDNDLMDLLLARKEPEGDLDSPDVHRLLEMLRNV"
FT   CDS_pept        725375..726676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="BMULJ_03869"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="COG0372: Citrate synthase, Ralstonia solanacearum"
FT                   /note="KEGG, K01647"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03869"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45729"
FT                   /db_xref="GOA:A0A0H3KKG6"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKG6"
FT                   /protein_id="BAG45729.1"
FT                   /translation="MTPSDVKATLSFSDNSPSVELPIYKGTMGPDVIDIRKLYGQTGKF
FT                   TYDPGFMSTASCNSAITYIDGDKGELLYRGYPIDNLAQNADFLETCYLLLKGELPNAAQ
FT                   KKEFVDTVTKHTMVHEQMHFFFRGFRRDAHPMAILVAAVGALSAFYHDSLDINDPRHRE
FT                   VSAIRMIAKLPTLVAMAYKYSIGQPFVYPKNDLSYSANFMRMMFSNPCEEYQVNDVLVR
FT                   ALDRILILHADHEQNASTSTVRLAGSSGANPFACIAAGIACLWGPAHGGANEAALNMLE
FT                   QIGTPENIPEFIKQVKDKNSGVKLMGFGHRVYKNYDPRAKLMRETCYEVLNELGLHDDP
FT                   LFKLAMQLEKIALEDEYFVSRKLYPNVDFYSGIVQRALGIPTSMFTCIFAMARTVGWIA
FT                   QWNEMIADPEQKIGRPRQLFIGDTPREAKPLNAR"
FT   CDS_pept        complement(726760..727716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03870"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45730"
FT                   /db_xref="GOA:A0A0H3KKF4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KKF4"
FT                   /protein_id="BAG45730.1"
FT                   /translation="MKPQYEHVTFAPGCSIRVYHRQLARIPFEWHRHPEYELTLTLNSR
FT                   GRRFIGDHVARYADEDLVLVPPNLPHTWSSNARIDPDAPEVALVVWFDGDWVRRLADCC
FT                   AEYVPLRSLLRRAAPGLRFDTETARAMRARLPRLLDPSPRVRLAAALDTLADLAEAGGE
FT                   PLATAQAYERHDGDADAPEAERLDRVLDAIDRHFHEPLRIGALAAVAHLSERTLQRMFV
FT                   RHLGESVGRYVQRLRIAHACRHLVATDWPIATVAARCGIPNPANFNRQFLAARGMTPGA
FT                   YRQCFAQRGRAPDTDADAPPLDTRPPSLERRKRTPRK"
FT   CDS_pept        727788..728177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03871"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COG0346: Lactoylglutathione lyase and related
FT                   lyases, Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03871"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45731"
FT                   /db_xref="GOA:A0A0H3KQ40"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ40"
FT                   /protein_id="BAG45731.1"
FT                   /translation="MFSHVCVGVSDTARAYDFYAPLCAALGLRLKFREPDGWCGWMPAD
FT                   TDRPLFFFGRPLDGRAPEPGNGYTIAFDAPTRAHVDRCHALALQHGGTCEGPPGLRPHY
FT                   HRDYYGAYFRDPDGNKLCVVCHRPA"
FT   CDS_pept        728288..729538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_03872"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_03872"
FT                   /db_xref="EnsemblGenomes-Tr:BAG45732"
FT                   /db_xref="InterPro:IPR010856"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KL16"
FT                   /protein_id="