(data stored in ACNUC7421 zone)

EMBL: AP009387

ID   AP009387; SV 1; circular; genomic DNA; STD; PRO; 919805 BP.
XX
AC   AP009387;
XX
PR   Project:PRJDA19401;
XX
DT   04-JUN-2008 (Rel. 96, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Burkholderia multivorans ATCC 17616 genomic DNA, complete genome,
DE   chromosome 3.
XX
KW   .
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
XX
RN   [1]
RP   1-919805
RA   Ohtsubo Y., Yuji N., Tsuda M.;
RT   ;
RL   Submitted (17-APR-2007) to the INSDC.
RL   Contact:Yoshiyuki Ohtsubo Tohoku University, Department of Environmental
RL   Life Sciences, Graduate School of Life Sciences; Katahira 2-1-1, Sendai,
RL   Miyagi 980-8577, Japan
XX
RN   [2]
RA   Ohtsubo Y., Yamashita A., Kurokawa K., Takami H., Yuhara S., Nishiyama E.,
RA   Endo R., Miyazaki R., Ono A., Yano K., Ito M., Sota M., Yuji N.,
RA   Hattori M., Tsuda M.;
RT   "Complete genome sequence of Burkholderia multivorans ATCC 17616";
RL   Unpublished.
XX
DR   MD5; 1fcb3d9b52981799b6bd6b1df02e35ad.
DR   BioSample; SAMD00060926.
DR   EnsemblGenomes-Gn; BMULJ_05392.
DR   EnsemblGenomes-Gn; BMULJ_05393.
DR   EnsemblGenomes-Gn; BMULJ_05439.
DR   EnsemblGenomes-Gn; BMULJ_05440.
DR   EnsemblGenomes-Gn; BMULJ_05441.
DR   EnsemblGenomes-Gn; BMULJ_05514.
DR   EnsemblGenomes-Gn; BMULJ_05515.
DR   EnsemblGenomes-Gn; BMULJ_05575.
DR   EnsemblGenomes-Gn; BMULJ_05576.
DR   EnsemblGenomes-Gn; BMULJ_05615.
DR   EnsemblGenomes-Gn; BMULJ_05661.
DR   EnsemblGenomes-Gn; BMULJ_05662.
DR   EnsemblGenomes-Gn; BMULJ_05667.
DR   EnsemblGenomes-Gn; BMULJ_05668.
DR   EnsemblGenomes-Gn; BMULJ_05671.
DR   EnsemblGenomes-Gn; BMULJ_05708.
DR   EnsemblGenomes-Gn; BMULJ_05712.
DR   EnsemblGenomes-Gn; BMULJ_05714.
DR   EnsemblGenomes-Gn; BMULJ_05723.
DR   EnsemblGenomes-Gn; BMULJ_05736.
DR   EnsemblGenomes-Gn; BMULJ_05738.
DR   EnsemblGenomes-Gn; BMULJ_05740.
DR   EnsemblGenomes-Gn; BMULJ_05762.
DR   EnsemblGenomes-Gn; BMULJ_05767.
DR   EnsemblGenomes-Gn; BMULJ_05768.
DR   EnsemblGenomes-Gn; BMULJ_05774.
DR   EnsemblGenomes-Gn; BMULJ_05780.
DR   EnsemblGenomes-Gn; BMULJ_05789.
DR   EnsemblGenomes-Gn; BMULJ_05871.
DR   EnsemblGenomes-Gn; BMULJ_05887.
DR   EnsemblGenomes-Gn; BMULJ_05919.
DR   EnsemblGenomes-Gn; BMULJ_05926.
DR   EnsemblGenomes-Gn; BMULJ_05927.
DR   EnsemblGenomes-Gn; BMULJ_05969.
DR   EnsemblGenomes-Gn; BMULJ_05996.
DR   EnsemblGenomes-Gn; BMULJ_05997.
DR   EnsemblGenomes-Gn; BMULJ_06079.
DR   EnsemblGenomes-Gn; BMULJ_06080.
DR   EnsemblGenomes-Gn; BMULJ_06156.
DR   EnsemblGenomes-Gn; BMULJ_06157.
DR   EnsemblGenomes-Gn; BMULJ_06158.
DR   EnsemblGenomes-Gn; BMULJ_06159.
DR   EnsemblGenomes-Gn; BMULJ_06160.
DR   EnsemblGenomes-Gn; BMULJ_06161.
DR   EnsemblGenomes-Gn; EBG00001436989.
DR   EnsemblGenomes-Gn; EBG00001436990.
DR   EnsemblGenomes-Gn; EBG00001436991.
DR   EnsemblGenomes-Gn; EBG00001436992.
DR   EnsemblGenomes-Gn; EBG00001436993.
DR   EnsemblGenomes-Gn; EBG00001436994.
DR   EnsemblGenomes-Gn; EBG00001436995.
DR   EnsemblGenomes-Tr; BMULJ_05392.
DR   EnsemblGenomes-Tr; BMULJ_05393.
DR   EnsemblGenomes-Tr; BMULJ_05439.
DR   EnsemblGenomes-Tr; BMULJ_05440.
DR   EnsemblGenomes-Tr; BMULJ_05441.
DR   EnsemblGenomes-Tr; BMULJ_05514.
DR   EnsemblGenomes-Tr; BMULJ_05515.
DR   EnsemblGenomes-Tr; BMULJ_05575.
DR   EnsemblGenomes-Tr; BMULJ_05576.
DR   EnsemblGenomes-Tr; BMULJ_05615.
DR   EnsemblGenomes-Tr; BMULJ_05661.
DR   EnsemblGenomes-Tr; BMULJ_05662.
DR   EnsemblGenomes-Tr; BMULJ_05667.
DR   EnsemblGenomes-Tr; BMULJ_05668.
DR   EnsemblGenomes-Tr; BMULJ_05671.
DR   EnsemblGenomes-Tr; BMULJ_05708.
DR   EnsemblGenomes-Tr; BMULJ_05712.
DR   EnsemblGenomes-Tr; BMULJ_05714.
DR   EnsemblGenomes-Tr; BMULJ_05723.
DR   EnsemblGenomes-Tr; BMULJ_05736.
DR   EnsemblGenomes-Tr; BMULJ_05738.
DR   EnsemblGenomes-Tr; BMULJ_05740.
DR   EnsemblGenomes-Tr; BMULJ_05762.
DR   EnsemblGenomes-Tr; BMULJ_05767.
DR   EnsemblGenomes-Tr; BMULJ_05768.
DR   EnsemblGenomes-Tr; BMULJ_05774.
DR   EnsemblGenomes-Tr; BMULJ_05780.
DR   EnsemblGenomes-Tr; BMULJ_05789.
DR   EnsemblGenomes-Tr; BMULJ_05871.
DR   EnsemblGenomes-Tr; BMULJ_05887.
DR   EnsemblGenomes-Tr; BMULJ_05919.
DR   EnsemblGenomes-Tr; BMULJ_05926.
DR   EnsemblGenomes-Tr; BMULJ_05927.
DR   EnsemblGenomes-Tr; BMULJ_05969.
DR   EnsemblGenomes-Tr; BMULJ_05996.
DR   EnsemblGenomes-Tr; BMULJ_05997.
DR   EnsemblGenomes-Tr; BMULJ_06079.
DR   EnsemblGenomes-Tr; BMULJ_06080.
DR   EnsemblGenomes-Tr; BMULJ_06156.
DR   EnsemblGenomes-Tr; BMULJ_06157-1.
DR   EnsemblGenomes-Tr; BMULJ_06158-1.
DR   EnsemblGenomes-Tr; BMULJ_06159-1.
DR   EnsemblGenomes-Tr; BMULJ_06160-1.
DR   EnsemblGenomes-Tr; BMULJ_06161-1.
DR   EnsemblGenomes-Tr; EBT00001814640.
DR   EnsemblGenomes-Tr; EBT00001814641.
DR   EnsemblGenomes-Tr; EBT00001814642.
DR   EnsemblGenomes-Tr; EBT00001814643.
DR   EnsemblGenomes-Tr; EBT00001814644.
DR   EnsemblGenomes-Tr; EBT00001814645.
DR   EnsemblGenomes-Tr; EBT00001814646.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP009387.
DR   SILVA-SSU; AP009387.
DR   StrainInfo; 39670; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..919805
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /chromosome="3"
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395019"
FT   CDS_pept        51..764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05363"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="COG0412: Dienelactone hydrolase and related enzymes,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01061"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05363"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47200"
FT                   /db_xref="GOA:A0A0H3KU99"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KU99"
FT                   /protein_id="BAG47200.1"
FT                   /translation="MSQTSGSMITFRRPDGQELQGYLATPEKTDGAPAVVVIQEWWGLN
FT                   DQIRGVADRLARCGYFALVPDLYRGKSTVEEEEAHHLMTGLDFGDAASQDIPGAVQYLK
FT                   TRAERVAVTGFCMGGALTLLSLQFADADAGVTWYGFPPLDYLDPSKIKVPVMGHWGTQD
FT                   AFFTIDQVDALEKKLTDAKVDIEFHRYLAHHAFANETAVGPGRIAGTQFDPVWSQFAWD
FT                   RTLTFFGRTLWQKAA"
FT   CDS_pept        complement(1001..1954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05364"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05364"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47201"
FT                   /db_xref="GOA:A0A0H3KQ53"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ53"
FT                   /protein_id="BAG47201.1"
FT                   /translation="MDTLQMMRIFVRVAEEGSFTSAAQRLDITTAYASRSVAQLETHLR
FT                   TRLLNRSTRRIALTDAGQRYLDRCQRILAYIDEAEAEAADAQAKPSGRLHVHATTSFGQ
FT                   AYVVPAVVRYRQRYPSVAVELTLSQHVPDIIDEGYDVSLQLSTAELPDSGLVSQRLGEM
FT                   HSVLCASPAYLKERGTPRTVSDLEGHACLQIVTPIFPRDRWHLDGPNGRETFELPLPDF
FT                   QVNIADALGAGLRAGLGIGALPMSTALPAFASGALVRVLPEYRLQKLTVYTLYASRQYL
FT                   DAKIRTFVDFLRECVPEMLAADEAALCAAQDARANA"
FT   CDS_pept        complement(2213..3511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="BMULJ_05365"
FT                   /product="adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COG0104: Adenylosuccinate synthase, Caulobacter
FT                   vibrioides"
FT                   /note="KEGG, K01939"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05365"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47202"
FT                   /db_xref="GOA:A0A0H3KXQ9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXQ9"
FT                   /protein_id="BAG47202.1"
FT                   /translation="MANVVVVGAQWGDEGKGRIVDWLAARADVVARYNGGHNAGHTLVV
FT                   GGKTYKLALLPSGIVRGKRGVIGNGVVLDPEALLAEIGRMAELGLQVTPDNLSIAENAT
FT                   LVLPIHRALDEAQERLRREPIGTTLRGIGPAYEDKVGRRGLRVGDLAEPGRLADKLEAL
FT                   VDYHNAWFRGLGLEVCSRDAMFDRLMDIAPKILPFVRPVWADLNDATDRGEHILFEGSQ
FT                   AVMLDIDWGTYPFVTSSATVASAAAAGTGLGASKLGHVLGVTKAYATRVGGGPFLTELT
FT                   DATGEALRTRGQEFGVNTGRPRRCGWLDAAQLRQPVRVSGIDSLALTKLDVLDGFDSIE
FT                   LCVGYELDGARVEHLPASLEAQARARPVYERFDGWQRSVKGVRERAALPHAAQAFIARV
FT                   EAVAGVPVSMITTGAERDDTIVLRDPFDPAPRV"
FT   CDS_pept        3655..4560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05366"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05366"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47203"
FT                   /db_xref="GOA:A0A0H3KPP9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPP9"
FT                   /protein_id="BAG47203.1"
FT                   /translation="MARRLPPLNSLCAFEAAARLGSFTLAADERCVTHGAISRHVQQLE
FT                   TWLGKPLFERLNLRVVLTDAGRAYLAEVGASFDRIALATAQQFGQAQQRVLRVNAPATF
FT                   SLRWLVPKLSSFQVAHPTIEVRLSTSNEPIDKLRDSADLIIRGGPQTIDGYVADEFLSE
FT                   VRLPVCAPKLLERTPLRTPADLANFTLLHAATYPGMWPEWLAAAGCPNLVPRHALTLEH
FT                   FYLTLQGALDGLGVAMGPIALVADDIAEGRLVQPFSGPALPAWRYFIYVPATRIDDEAV
FT                   RAFRDWLKLAGCAENSNGLR"
FT   CDS_pept        complement(4729..5037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05367"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPB1"
FT                   /protein_id="BAG47204.1"
FT                   /translation="MRIQTKKLMLAATAAAFLLGSTAPVFAQTDASAPAAQDAKAAKQE
FT                   ARKAARAKRKAERKAARTKNTAELKKLEDAGYKPAANDPNYPQNLQNAEKKAAGSGQ"
FT   CDS_pept        6691..8007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA4"
FT                   /locus_tag="BMULJ_05368"
FT                   /product="replication protein"
FT                   /note="RepA4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05368"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47205"
FT                   /db_xref="GOA:A0A0H3KUA5"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUA5"
FT                   /protein_id="BAG47205.1"
FT                   /translation="MPRKPASKGSDKQVSLFQTPEPPDLLRKAVQAIHIAPKSGKIGLQ
FT                   QRKMFSSLIKNALRQEAFEPGRTSFSISIAALSHESGLNSNNTKYVKDTVNSLISTVVN
FT                   WDYLAADRSTVWKASGLLAGAELEQSVLKYSFSDQIRSELLNPEIYALIDMRIAREFRR
FT                   SHSLALWENTVRYEGIGITAKIPLPKFRDLILGQDKASQSYKEYKLFKSKVLVPCIQEV
FT                   NEVSDHTLELIEHKSGRSVEAVQFKVTRKPSADTVEEGDVKNEALVDEVAKFGIPRSEA
FT                   RRLITQYGVQRIKAAIAYTLNRTTKKNAAPIDNVAAYFRKALTHGYTLSDGQGAETGAA
FT                   VQESAQSKQEQIRDKYLAAKVEEAGAYFRELEIDDQTKLIERYNETVAGSKDLTLSPKK
FT                   KASKLAQTSFFRWLALDTWGEPTSDDLLEFLLKSSLATN"
FT   CDS_pept        complement(8094..9119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB4"
FT                   /locus_tag="BMULJ_05369"
FT                   /product="ParB family partition protein"
FT                   /note="COG1475: Predicted transcriptional regulators,
FT                   Ralstonia solanacearum"
FT                   /note="ParB4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05369"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47206"
FT                   /db_xref="GOA:A0A0H3KQ59"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ59"
FT                   /protein_id="BAG47206.1"
FT                   /translation="MAKDTTKEKKPTGNLHLAAGLLRGLAQENAALETRIPEPSSAAKT
FT                   GVDAAVAAAPGVTPPDALDLGAPQRVAVKDCIPNPFNPRVFYSESSLHELALTLKREGQ
FT                   IEPIKVTRLPEFPGKLVVIDGQRRLRATSINGDETINATFRTDHTPEQLYTIAYRANHD
FT                   HERQTIFDDAVAWKRLLDEKVFPDQNTLAEKIGKDKASISKTLSLNALPNTLLERMAAA
FT                   SDVVGLQAAYFLKLIFERLGEATADRLLTAVIDRKKSVRDLENFLRAQSDDTRKAGRTR
FT                   YSVRHDFALESRAIGQLKTYPDGRLDLQLKGVDATHQEALADKLKAVIDEYVAALAAAQ
FT                   Q"
FT   CDS_pept        complement(9112..9807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA4"
FT                   /locus_tag="BMULJ_05370"
FT                   /product="chromosome partitioning protein"
FT                   /note="COG1192: ATPases involved in chromosome
FT                   partitioning, Ralstonia solanacearum"
FT                   /note="ParA4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47207"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXR2"
FT                   /protein_id="BAG47207.1"
FT                   /translation="MAFKIAVSNQKGGTGKTTISVNIAAAFEAGGNKVALIDADPQGTS
FT                   VRWVTSGENTLPMTVLSLAPAGRGIGAEIKKQDANFDVIVVDCPGNLEDPRIASVLEVA
FT                   DFCLVPLSPSPADLYSTVAMIRMIESMRAVRNPNLSSALMLNSVNGKTKMREEILKILR
FT                   AEEIGEHLLDSQIAQREVYRQTFALGTTIHHHNRYLKGLKEARAEIEKLVTEMAQYIAS
FT                   TRATGAAHG"
FT   CDS_pept        complement(11065..12189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05371"
FT                   /product="putative Zn-dependent hydrolase of the
FT                   beta-lactamase fold-like protein"
FT                   /note="COG2220: Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05371"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47208"
FT                   /db_xref="GOA:A0A0H3KPQ3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPQ3"
FT                   /protein_id="BAG47208.1"
FT                   /translation="MASPFTFVQRALGLTAGKRSRAYGRRSTQHNGARFANVRPRPADG
FT                   FGKMLRIAWNMLVNKPQGTMPAAALPVDRLTVSELDEAPDRSLYRLGHSTLLIKLRGEW
FT                   WLTDPLFSERASPFRTLGPKRFHPTPIALEDLPPLRGVILSHDHYDHLDRETVLALAST
FT                   TGVFVTPLGVGDRLIEWGVDATKVHQLDRWQSVEIDGLSVTATPAQHFSGRSLFDGDST
FT                   LWASWVIVDDDLRVFFSGDTGYFDGFKAIGDRLGPFDVTLIETGAYDAQWPYVHMQPEE
FT                   TVQAHIDLRGRQLLPIHNGTFDLAMHRWQDPFERVTALAVARGVALSTPRMGERLDLDA
FT                   PHRGEQWWRAVPEEKSASGRKARRWRLCPAEAER"
FT   CDS_pept        12271..12909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05372"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator, Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05372"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47209"
FT                   /db_xref="GOA:A0A0H3KPB6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPB6"
FT                   /protein_id="BAG47209.1"
FT                   /translation="MNITSSPQRLTDRKRAAIVDAAIEEFLASGYDATSMDRIAAHAGV
FT                   SKRTIYNHFPSKDALFVAILQKLWNATQGDGTPAYRDDVPLREQLVALLNRKLKLLNDE
FT                   SFLALARVAIGAAMHSPDRARDMVARLGEREEDVTVWIREASAAGRLVVSDPVFAAQQL
FT                   HGIVKAFAFWPQLTMGQPPLDSQDRRKVAESAADMFLARYSRADGKDAR"
FT   CDS_pept        13035..13526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05373"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0655: Multimeric flavodoxin WrbA, Mycobacterium
FT                   leprae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05373"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47210"
FT                   /db_xref="GOA:A0A0H3KUB0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUB0"
FT                   /protein_id="BAG47210.1"
FT                   /translation="MKTLLIVYHTMTGGTRQMAEAAAAAARDESGVDVRLQRADATTPE
FT                   HVLSADAYLFATPENLAAMSGVMKDFFDRCYYPVLDRVNGRPYAAMICAGSDGQNALRQ
FT                   IDRIATGWRLNSVAPGLIVCTHAQTPERILAPKTIDADDLARCAELGAALAAGLALGIF
FT                   "
FT   CDS_pept        complement(13558..14142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05374"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47211"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ65"
FT                   /protein_id="BAG47211.1"
FT                   /translation="MVSPDDTARQDVTREEIHHRQIDMRGYRRSDGLFEVTACLTDRKP
FT                   VDFTPPGDARMIAAHAPIHDLGVTLVFDGDMIVRAVSTFIKSHPYAQCPGGGDSLQALV
FT                   GLRIGAGWNSEVRKRLPSCDTCTHLKEILTPLATAAYQTMVGFRPSSLNEYNGDGKPVK
FT                   IDSCYAYGASRDLVKRLWPEHHRPEAAKTGD"
FT   CDS_pept        14831..15487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proQ"
FT                   /locus_tag="BMULJ_05375"
FT                   /product="ProP effector"
FT                   /note="COG3109: Activator of osmoprotectant transporter
FT                   ProP, Pseudomonas aeruginosa"
FT                   /note="KEGG, K03607"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05375"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47212"
FT                   /db_xref="GOA:A0A0H3KXR6"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXR6"
FT                   /protein_id="BAG47212.1"
FT                   /translation="MGFEQLAELRAQLAAKAKQERNAKRPATRPDTGAKPSGDRPPRGA
FT                   KSGAGTKAATSAKAAPAKPSAPVDPVIVAIGKLQRRFPRAFPKNPAPKVPLKVGIWEDL
FT                   AREAQTLGLSEAELRDAMSTWCRGNRYWSCLVEDAVRVDLQGNEAGRVTRDDAARARHL
FT                   KSRRPGKGAAKPAKGAQQPKADAQTDAAVQQPAAADTQPSVESAPQVEQQAAGNE"
FT   CDS_pept        complement(16045..16416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05376"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COG0346: Lactoylglutathione lyase and related
FT                   lyases, Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05376"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47213"
FT                   /db_xref="GOA:A0A0H3KPQ7"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPQ7"
FT                   /protein_id="BAG47213.1"
FT                   /translation="MTDIASPNLPSRDFDATSRFYAKFGFVATWRDEDWMILRRRDLLL
FT                   EFFRHPDLDPAESWFSCCFRLDDVDAFFDEVIAAGIPETTTGWPRAHRPKREAWGGTVG
FT                   ALVDLDGTLIRLVQNGGGM"
FT   CDS_pept        complement(16483..17091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05377"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47214"
FT                   /db_xref="GOA:A0A0H3KPB9"
FT                   /db_xref="InterPro:IPR006975"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPB9"
FT                   /protein_id="BAG47214.1"
FT                   /translation="MKDSKPVDASACAAGAETLRSLLSGAVDQRNPDARLFAVLVAARA
FT                   RRNELALLGLSHAQLTRLLARHFPALSGDVAAELAAPFIVRSLPPAHAKFVATLHALLM
FT                   RDIGAAVAVDDADCVASIVAHGCLRGDHLWRDLGLDGRDAVAAMLDRYFPAVAARNVGQ
FT                   LRWKKFLAQEAAASLGLPPGPAPGCPGCEDFPVCFPPQR"
FT   CDS_pept        complement(17088..17513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05378"
FT                   /product="putative molybdopterin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05378"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47215"
FT                   /db_xref="GOA:A0A0H3KUB5"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUB5"
FT                   /protein_id="BAG47215.1"
FT                   /translation="MRTSARNQFTGQISAVKTGAVNDEITLRTPDGLEIVAVITHGSAA
FT                   SLGLSTGTKAFALVKASSVIVMVDVDASKVSARNCIAGTVASVAKGAVNSEVAIRTAGG
FT                   TEIIAIVTNDSVERLGLTSGSAATAMFKASSVIVGIE"
FT   CDS_pept        complement(17623..19131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="BMULJ_05379"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05379"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47216"
FT                   /db_xref="GOA:A0A0H3KQ69"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ69"
FT                   /protein_id="BAG47216.1"
FT                   /translation="MKRPGLRVAATLAPLAFALGACKSVGPDYTLPQQAYVNAPLANHA
FT                   LDDANGTLVSHDAVPGNWWQLYDDPALNDLVRSALTSNTDLRVAAANLARSRAALEVAN
FT                   QQGGFSGRTEAAVQRAQESAEQYLLENKLPVVNEGSVGINVSYEIDLFGKLRRGVEAAR
FT                   ADSEAVQAAADLARITVVADVVRAYVEACSAGEELEIAKQSVALQRQRVALSQRLRDVG
FT                   RGNQTEVTRGVTQVRTLAADIPRFESRRKIAQYQLAALLARAPADLPKAVTECARLPKL
FT                   RRPIPIGDGAALLRRRPDVREAERQLAAATARIGVATAALYPSISIGASAGSVGVAADL
FT                   FSSTTNRWSFGPLISWTFPVNGQRARVREAEAATGGALAHFDGVVLNALRETQSSVAAY
FT                   AADVQRADELRTAYESARSSADETHRLYRAGRESFIADLDATRTLTSVHAQVAAAEGQV
FT                   AADQVRLFLALGGGWEGDAMPAASQQETSSARPAAADGAANNAR"
FT   CDS_pept        complement(19128..20093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05380"
FT                   /product="putative multidrug resistance efflux pump"
FT                   /note="COG1566: Multidrug resistance efflux pump, Brucella
FT                   melitensis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47217"
FT                   /db_xref="GOA:A0A0H3KXS0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXS0"
FT                   /protein_id="BAG47217.1"
FT                   /translation="MKKPWLSAGQVLLTLIVVVVAALVLWRVIDYYMFSPWTRDGHVRA
FT                   DVIQVAPDVSGLITSVEVADNQAVTRGQVLFVIDRARYALAERLAEATLAQRRATLAQA
FT                   KREYARNLQLGNLVASEQVEESRTRVEQGEAAVQDAQVSLDTAKLNLQRTTVVSPVDGY
FT                   LNDRAPRVGEYVPAGRAVLSVVDRNSFRVDGYFEETKLRGIHIGQPVDIFVMGEPHSLR
FT                   GHVQSIVAAIEDRDRTQGSNLLPNVNPAFSWVRLAQRVPVRVALDEVPDDFRMIAGRTA
FT                   TVAVRAPDTQRRDRAQPAAPAAPVAPPASGTAASAAGASQ"
FT   CDS_pept        complement(20101..20313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05381"
FT                   /product="probable membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05381"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47218"
FT                   /db_xref="GOA:A0A0H3KPR1"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPR1"
FT                   /protein_id="BAG47218.1"
FT                   /translation="MIGEIDILGVFVPAPLVLMLIAYLINVAVRTVLDRIGFYRLVWHR
FT                   SIFDLGIYVFVFAAVVIVSHHFVAT"
FT   CDS_pept        complement(20348..22480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05382"
FT                   /product="putative fusaric acid resistance efflux
FT                   transporter permease protein"
FT                   /note="COG1289: Predicted membrane protein, Brucella
FT                   melitensis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05382"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47219"
FT                   /db_xref="GOA:A0A0H3KPC4"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPC4"
FT                   /protein_id="BAG47219.1"
FT                   /translation="MTYPSLRDWLFSGKTFAASMLALYLGLYFQLPRPYWAMASVYIVS
FT                   NPFVGATRSKALYRALGTALGAAAAIFFVPPFVETPLLFSVIVATWCGTLLYLAISDRT
FT                   ARSYVFMLAGYTMPLVALPTVTNPASVFDVAIARTEEIVLGIVCASVVGSTVFPNRLAP
FT                   TLIERTDAWFRDAAFYGRETLSGRIAGKALSACRQRLATTITGLEFLLSQLSYDHAHPR
FT                   VLSRAQALAGRMQLFLPLMSSLADPLIALMRDLHVRPPALDALLADAAAWFDAPLPTIK
FT                   PGTDGDMADDPVADRLRAGIAALQPTDEALASWDGALLSNALWRLRQVIDIWQDCRSLR
FT                   ALIANESGVWQPRYRHWRLGGTERFFDRGMMLFSTLTVVGAIVFACWLWIESGWHDGAG
FT                   AVTLVAVACSFFAALDEPAPMVFRFFLATAASVVFAGLYLFVVLPHVHDFPMLVLMFAG
FT                   PFILIGTLLPRPQFNMVTMLVAVNTATFVSIQGAYDADFFVFLNSNLAGVAGLLFAYVW
FT                   TRATRPFGAELAVRRLLRSGWEDVARSASTQPLEDQRNHAARMLDRVTQLLPRLGASDD
FT                   HRHPSIESFRDLRIALNALDLRRLRRKLSGDLSDAIDRVLAGVTDHYARCAAANARQPV
FT                   PPALLESIDDALRRVVGRNLPGAAPAPGDAPPAGHAIPVMHRRLRDALHALVGLRLSLY
FT                   PAASTRAPQTPDGAQA"
FT   CDS_pept        complement(22477..22956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyA"
FT                   /locus_tag="BMULJ_05383"
FT                   /product="MarR family transcriptional regulator for
FT                   hemolysin"
FT                   /note="COG1846: Transcriptional regulators, Brucella
FT                   melitensis"
FT                   /note="KEGG, K06075"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05383"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47220"
FT                   /db_xref="GOA:A0A0H3KUB9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUB9"
FT                   /protein_id="BAG47220.1"
FT                   /translation="MTNLHDLRLAVSSLLVLSARKWRRASDSMLTAYNVSEACATPLLI
FT                   AGRLGEGVRQGTLAEYVGIEGPSLVRLLDQLCAAGLARRDEDPHDRRAKTISLTAEGRA
FT                   VTEKMEEDLRVLRAQVLKGISRSDLEATLRVLTAFNGADAHASAPRAPHSAGSAS"
FT   CDS_pept        23360..24772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05384"
FT                   /product="transcriptional MocR family regulator"
FT                   /note="COG1167: Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05384"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47221"
FT                   /db_xref="GOA:A0A0H3KQ74"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ74"
FT                   /protein_id="BAG47221.1"
FT                   /translation="MGRTEVSTRWHDAIGAVHGIESKYKRLVKAIAADIESGVLAPGAR
FT                   LAPQRDVAASLGVSVQTVTNAYKELERQGLIRCEVGRGSFVAARVTESMSNYMLDTAER
FT                   ELVDFSIARIVHTPEHDAAWRAVCAELAGTEDQPWIRSFRPIAGLDAHREAGAAWLASL
FT                   NMPVHPESLLITNGAAHGIFLALASIVGPGDTVLCESLTDHGVIGSANVLGFTLKGLEM
FT                   DEHGIRPEHFEEMCDGERISALVCTPTLNNPTVSMMSDSRRRSIARIAARYGVYVIEDD
FT                   VYGPLPAKTATPIASMIPELGFYCTSMTKSVLTGLRTGYLAMPRRLALRVESVLRVSSW
FT                   MATSPIAEIATRWIADGTARRLVELQRQRLAVRQEMVKAALGPYLLGAHPNALSAWLRV
FT                   PDYWQADRLVRELRTRKIAVTSPDPFLVGGTERPNAVRVCIGAETTDAACNAALETMAG
FT                   VFEQYPHVHDFH"
FT   CDS_pept        24890..25861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="BMULJ_05385"
FT                   /product="threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /note="COG1171: Threonine dehydratase, Mesorhizobium loti"
FT                   /note="KEGG, K01754"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05385"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47222"
FT                   /db_xref="GOA:A0A0H3KXS4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR014333"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXS4"
FT                   /protein_id="BAG47222.1"
FT                   /translation="MSFLSLSDVYRARQRIAGRTCVTPLVASAALSARAGVPVHLKLET
FT                   LQPTGSFKIRGATNVLAELAAQRVTRVVTASTGNHGRAVAHAARALGLEAAVCMSSLVP
FT                   ANKVDAVAALGARVVIVGDSQDDAQAEARRLARDEGYAYVPPFDDPRIIAGQATIGVEI
FT                   LEALPDAGTLIVPLSGGGLFSGVAFAAKAIRPSIAVIGVSMARGAAMHASLAAGRPVDV
FT                   EEQPTLADSLGGGIGLDNRYTFDLTRALADDVVLLDERSIARGIAHAYREERLVVEGAG
FT                   AVGIAALLDEAVPRSRRDGPIVVVVSGANIDMAAHRRLIAEN"
FT   CDS_pept        25863..26867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ocd"
FT                   /locus_tag="BMULJ_05386"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="COG2423: Predicted ornithine cyclodeaminase,
FT                   mu-crystallin homolog, Agrobacterium tumefaciens strain
FT                   C58"
FT                   /note="KEGG, K01750"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05386"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47223"
FT                   /db_xref="GOA:A0A0H3KPR4"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR014334"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPR4"
FT                   /protein_id="BAG47223.1"
FT                   /translation="MAHPITLLGQAQLRTLVPLDRDAIDQVEAAFVSLATEPVAMPPIL
FT                   NLALPARHGEVDVKTAYLPRFDSFAIKISPGFFDNPSLGLPSLNGLMLVLSARTGLTEA
FT                   VLLDNGYLTAVRTAAAGAVAARHLARADARRVAVIGAGEQARLQLDALRLVRDVAHVTV
FT                   WARDAARAAQFAADVRSAHGIEASVARSVHAALADADIAVTTTPSREPLVHAEDLHPGL
FT                   HVTAMGSDAEYKTELAPSVFAAARYVCDRLQQTRVVGELRHAIEAGAVAADAVFPELGE
FT                   VIAGRCAGRTHRDEITICDLTGTGAQDTAIAVLALQRARAAGAGTIFHNDLTT"
FT   CDS_pept        26878..28086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="BMULJ_05387"
FT                   /product="X-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="COG0006: Xaa-Pro aminopeptidase, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /note="KEGG, K01271"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05387"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47224"
FT                   /db_xref="GOA:A0A0H3KPC6"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR014335"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPC6"
FT                   /protein_id="BAG47224.1"
FT                   /translation="MSAVIETYEAAPRLAFARSEYAARIAKTRAAMERAGIDLLIVTDP
FT                   TNMGWLTGYDGWSFYVHQCVLLPMDGEPVWFGRGQDANGAKRTVFMAHDDIVGYPDHYV
FT                   QSPHRHPMDYLSTEVIAARGWGALRIGVELDNYYFSAAAYASLQKHLPAARWVDATALV
FT                   NWQRAVKSPREIEYMRVAARIVERMHAHIVETIEPGMKKSDLVAQIYATGIGGADGFGG
FT                   DYPAIVPLLPTGADAAAPHLTWDDTTFERGAGTFFEIAGCYRRYHCPLSRTVYLGKPPA
FT                   HFIEAERAVVEGIEAGLAAAKPGNVCEDIANAFFAVLRRAGIEKDSRCGYPIGASYPPD
FT                   WGERTMSLRPGDRTVLEPGMTFHFMPGLWLDDWGLEITESILITETGVETFCNTPRKLF
FT                   VKE"
FT   CDS_pept        28091..29131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05388"
FT                   /product="deacylase"
FT                   /note="COG3608: Predicted deacylase, Mesorhizobium loti"
FT                   /note="KEGG, K06987"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05388"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47225"
FT                   /db_xref="GOA:A0A0H3KUC4"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR014336"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUC4"
FT                   /protein_id="BAG47225.1"
FT                   /translation="MRASPIVPTVDFDADGEQHGFLKLPYSRDDSAWGAVMIPVTVVKR
FT                   GDGPTVLLTGGNHGDEYEGPVALAKLAGSLKASDVTGRVIIVPFMNYPAFRAGRRTSPI
FT                   DAGNLNRSFPGRPDGTVTEKIADYFQRHLLPLATHVLDIHAGGRTLDFVPFAAIHVLDD
FT                   REQEARCERAMRAFGAPYSMRMLELDSVGLYDTAAEAAGKVFVSTELGGGGTSTAASVA
FT                   IAERGVRGFLEHAGVLATHPNEDDGVARTAPRTTTLLDMPDGACFTTSEHRGLLEMCCD
FT                   LGSEVEAGDVLARVHDIDRTGVAPVEYVAKRRGLLAARHFPGLVQAGDTIAVVADIVER
FT                   NIPVAA"
FT   CDS_pept        29144..29614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05389"
FT                   /product="AsnC family transcriptional regulator"
FT                   /note="COG1522: Transcriptional regulators, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05389"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47226"
FT                   /db_xref="GOA:A0A0H3KQ80"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ80"
FT                   /protein_id="BAG47226.1"
FT                   /translation="MIKLDRYDLAILRILERDGRITKSKLAEAVNLSISPAWERVRKLE
FT                   ESGVIRGYRADVDWVGAFSGSRIVVEVTLSRHTAPDMRRFEERVSAAPEVAQCYATGGG
FT                   VDYVLHVVARDIDQYQRFIDALLMEDLGIERYFTYIVTKVVKCESGGAPDWQ"
FT   CDS_pept        29738..31216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BMULJ_05390"
FT                   /product="NADP-dependent succinate-semialdehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K00135"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47227"
FT                   /db_xref="GOA:A0A0H3KXS8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXS8"
FT                   /protein_id="BAG47227.1"
FT                   /translation="MLPGHPVLFKSMCYVDGRWIHSDSAATVAVVNPADQAVIGHVPML
FT                   ERAQIVAAIDAAQRAYETWRWTPQAVRSAALLRWHALILRHLDDLAALLSLEQGKPLAE
FT                   ARGEIRYAASFVEWFANEAKRVAGRTIPTHIDGAQLGTVMEPVGVAALITPWNFPAAMI
FT                   TRKAAAAIAVGCTTVVKPAHETPFSALALAQLADEAGFPAGVFNVVLGEPQMAMETLVG
FT                   DARVRSVSFTGSTRVGRLVTETVARAGIRKVALELGGNAPFIVTEDADLDQAVRIAVAA
FT                   KFQTSGQDCCAANRIFVARPLYDAFVTRYADAVRELKTGPAFEPDVDVGPLMHQAAFDA
FT                   TVARVDDARARGARIVAGGRPHALGGWFYEPTVIADAGPGMRVYDEENFAPISAVCAFD
FT                   TLDEVVAKANDTEYGLAAYVCATRIDTIFQLVRRLDFAMVSVNGVKFTGAPIPFGGMKA
FT                   SGLGREGGIEGFEPFTETKYFCLGNLGLPVAAAA"
FT   CDS_pept        31237..32631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05391"
FT                   /product="putative
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotransferase"
FT                   /note="COG0161: Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05391"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47228"
FT                   /db_xref="GOA:A0A0H3KPS0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPS0"
FT                   /protein_id="BAG47228.1"
FT                   /translation="MTQSIDALLREDRAHFMHPSTHAYDHETGALPGKIVRGGQGIRIE
FT                   DHQGKRYIDAFAGLYCVNIGYGRTEVADVMYEQAKQLAYYHTYVGHSSDAIIELSSRII
FT                   DWAPAGMKKVYYGMSGSDANETQVKIVWYYNNVLGRPNKKKIISRERGYHGSGIVTGSL
FT                   TGLPSFHQHFDLPIDRVKHTVCPHWYRKAPVGMSETQFVAYCVDELEKLIAREGADTIA
FT                   AFIAEPVMGTGGIIEPPTGYWPAIQALLRKHDILLISDEVVCGFGRLGSKMGAQHFGIE
FT                   PDLITVAKGLTSAYAPLSGVIVGEKVWDVIARGSQEHGPMGHGWTYSGHPVCAAAALAN
FT                   LAILERENLVGNAAEVGAYFGAKLRDAFGAHPLVGEVRSVGMLAALEFMADKDARTPFD
FT                   PALKIGAQVSAAALQRGVIARAMPHGDILGFAPPLVMTRAEADEIVAIVREAVDEVAER
FT                   NLAVAG"
FT   CDS_pept        complement(34275..34760)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05392"
FT                   /note="inactivated permease of the major facilitator
FT                   superfamily"
FT   CDS_pept        complement(34779..35657)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05393"
FT                   /note="inactivated permease of the major facilitator
FT                   superfamily"
FT   CDS_pept        complement(35828..37528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dak1"
FT                   /locus_tag="BMULJ_05394"
FT                   /product="dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="COG2376: Dihydroxyacetone kinase, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /note="KEGG, K00863"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05394"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47229"
FT                   /db_xref="GOA:A0A0H3KPD1"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPD1"
FT                   /protein_id="BAG47229.1"
FT                   /translation="MKKLVNRPSDVVREMLEGIARQSPHLAMLGDEHVLVRRPLPEPSQ
FT                   RTVAVLSGGGSGHEPAHGGYVGDGMLSAAVCGEVFTSPSTDAVLAAIRATAGPNGALLV
FT                   VKNYTGDRLNFGLAAELARAEGIPVETVIVADDVSLRGRVERGQRRGIAGTVLIHKLAG
FT                   AAAARGLSLPRVAAIARDAAADLGTMGVALDGCTLPGADQSGFSLADDEIELGLGIHGE
FT                   KGVERTAPLPADALADTLLSGIVADLVLDRGERVALLVNGLGATPDMELAIVLRAAYEN
FT                   LSRRGIAVERAWAGTFLSALNMPGCSISVLRLDDERAALLDAPTQARAWPGGGAVNAQI
FT                   RIAAAAPQEPSPPPLDAAGRVWAERLRPALHAVAHTLIDHEATLTELDAAAGDGDLGAS
FT                   MRRAADAMLALPETAYATPAGALAALGAALRRAIAGSSGPFYATALLRASRRLAGLAQP
FT                   SARDWAAALRSAADAIAELGGARAGDRTMLDALVPAAAAFDRALDDGRDSAGAWAAAVD
FT                   AAERGAQDTARMTPRAGRASYLGERAIGTPDGGAIAVAYWLRALLPHVR"
FT   CDS_pept        complement(37772..38899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05395"
FT                   /product="sigma54-dependent DNA-binding transcriptional
FT                   regulator"
FT                   /note="COG1221: Transcriptional regulators containing an
FT                   AAA-type ATPase domain and a DNA-binding domain,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05395"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47230"
FT                   /db_xref="GOA:A0A0H3KUC9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUC9"
FT                   /protein_id="BAG47230.1"
FT                   /translation="MNRFLSDSWPSGADLAAADGDADSATAERSYAGAPASASSIRANA
FT                   AVFADPRSHALLERIRAVAPSDANVLIVGETGTGKELVARRLHQASRRRDGPFVAVNCG
FT                   ALSTTLVESELFGHEKGAFTGAFGAKAGWFETADGGTLFLDEIGDLPLPMQVKLLRVLQ
FT                   EREVVRVGARAGIPIDVRVVAATNVDLQQAVAAGHFRGDLFYRLAVVQLAVPPLRERPA
FT                   DILPLARHFVDDYRRRLGYGPRSIDARAARALESYDWPGNVRELENVIHHALLVSRHEM
FT                   LQHADLTIASAGTAAAAPHRGEPSAGAQAALEAALRALFDEGHGRLYERIEDTVMRVAF
FT                   EFSHRNQLQAARLLGISRNVLRARLIRANEIAALK"
FT   CDS_pept        39194..40147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05396"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Salmonella
FT                   typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05396"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47231"
FT                   /db_xref="GOA:A0A0H3KQ86"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ86"
FT                   /protein_id="BAG47231.1"
FT                   /translation="MELRQLRYFLSVVEHGSMGKAALELGVVTSALSQQISRLEGELST
FT                   RLLQRTSGGVIPTDAGLAFWRQAQLALRHIDDAALAARSARLSGHVSVGMAPSTASVLG
FT                   VAFMQAMRARYPDVRLHLVESLSGHLASMLSARQIDLAVLFREESAQRWSVQPLLDERL
FT                   FLIGAADLDGMPTRGSIRLTDLGKLPLILPSGTHGLRSLLSSAFKRAEYEPNIVAEVDG
FT                   LALLMDIVRTGIGATIQPGAALARRENATLTSVPVAEKYARRPNLIASISDDELSPAGL
FT                   AARVVLADVARQLVHEGRWPGARLRETDSSQKVKTR"
FT   CDS_pept        40211..41620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdh"
FT                   /locus_tag="BMULJ_05397"
FT                   /product="succinate dehydrogenase"
FT                   /note="COG1053: Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit, Salmonella typhimurium LT2"
FT                   /note="KEGG, K00238"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05397"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47232"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR012831"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXT2"
FT                   /protein_id="BAG47232.1"
FT                   /translation="MVDVLVIGGGNAALCAALMAREAGASVLLLEAAPREWRGGNSQHT
FT                   RNLRCMHDAPQDVLVDAYPEEEFWQDLLKVTGGITNEHLARLTIRASSSCRPWMQKHGV
FT                   RFQPPLSGALHVARTNAFFMGGGKALVNAYYRSAEALGVDIRYDTPVDAIELDGSRFVA
FT                   ARSGSRRFEAHACVLAAGGFESNREWLRDAWGQNARGEWPADNFLIRGTRFNQGVLLKH
FT                   MRDAGADMIGDPSQSHCVAIDARAPLYDGGICTRIDCVSLGIVVNRDAERFYDEGEDFW
FT                   PKRYAIWGRLVAQQPEQIGYSIIDSKAIGRFMPPVFPGEKADTLPELARKLGLPERRFV
FT                   DTLTRYNDACRVGTFDHTALDDCHTEGLTPPKTHWARRIDTPPFYGYALRPGITFTYLG
FT                   LKTNERAQVHFGGEASDNLFVAGEMMAGNVLGKGYTAGVGMSIGTAFGRIAGTQAARAA
FT                   LKTTEAGSAAV"
FT   CDS_pept        41607..42821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05398"
FT                   /product="4Fe-4S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05398"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47233"
FT                   /db_xref="GOA:A0A0H3KPS4"
FT                   /db_xref="InterPro:IPR012830"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPS4"
FT                   /protein_id="BAG47233.1"
FT                   /translation="MQQSDALATERTHRASPVDTKKTSHGGAARVIPIVPMSASETEVA
FT                   RQMQICNACRYCEGFCAVFPAMTRRLEFGKADVNYLANLCHNCGACYHACQYAPPHEFA
FT                   VNVPKAMAEVRLDTYTEYAFPAAFGALYKRNGLTLSVALAAGLALFLLLGTAWHGGLSR
FT                   DVAPANFYAVFPHTLLAAMFGSVFLFAMVALGVGVTRFWRDVSAGTTRASAPAVAEAAK
FT                   NALTLKYLDGGHGEGCNERDDAFTLARRRFHHLTFYGFMLCFAATAVATLYHYAFGLEA
FT                   PYPFFSVPVLLGTAGGVGLIAGPAGLLWLNLTRAPERGDPRQRPMDRGFIALLLLTSAS
FT                   GLALLAGRTTAAMPSLLAVHLGIVIALFATLPYGKFAHGIFRSAALLKSSIEKRQRNAS
FT                   SVGAD"
FT   CDS_pept        42876..44198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05399"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Salmonella typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05399"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47234"
FT                   /db_xref="GOA:A0A0H3KPD5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPD5"
FT                   /protein_id="BAG47234.1"
FT                   /translation="MSRTEPIAATSGVSPMTRAAAVLRVTSGNFIEQFDFFLFGFYATS
FT                   ISKIFFPSDSEFASLMLTFAVFGAGFLMRPLGAIFLGAYIDKVGRRTGLIVTLSIMASG
FT                   TILIACVPGYASIGLLAPALVLLGRLLQGFSAGAELGGVSVYLAEMATPGNKGFYTSWQ
FT                   SASQQVAIVMAAAIGYGLNQWLSAQQIGAWGWRVPFFIGCAIVPFLFLLRRSLQETAAF
FT                   EARRHHPQAREIFAMLLGNWRIVIGGMLLTAMTTTTFYLITVYTPTFGRSVLKLSTSDS
FT                   LMVTLLVAASNFIWLPIGGAISDRIGRKPLLVAISVLAIFTAYPALFWLADAPSFARML
FT                   IVLLWFSFFFGMYNGAMVAALTEVMPVEVRVAGFSLAFSLATALFGGFTPAVSTYLIQA
FT                   LHDKAAPGYWLSFAALCGLGATLALYRRRADSGVSAASSAG"
FT   CDS_pept        44429..45379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /locus_tag="BMULJ_05400"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="COG1893: Ketopantoate reductase, Pyrococcus
FT                   horikoshii"
FT                   /note="KEGG, K00077"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47235"
FT                   /db_xref="GOA:A0A0H3KUD3"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUD3"
FT                   /protein_id="BAG47235.1"
FT                   /translation="MKIAFLGAGALGCAIGATLTEAGHETWLVDRFAAHVAAMSRDGLQ
FT                   VDDERGTRRVKVRATMDPAEVGTVDLVIVLVKSFHTDAAMRGALALVGPETVVLSLQNG
FT                   LGHEDVLAEIVGRERVLAGKTYVGGVLRAPGHIQSGVTGKLTIVGELDGRITARVQAVA
FT                   DAFNGAGLTTRVSDNILGTMWDKLLINVATGAITGITRLTYGQLYDEPVLKATSLAAIE
FT                   EAMAAARAAGVRLSIAAAEDAWNMAAEGLPAAFKTSMLQSLEKASITEIDFINGAVVRW
FT                   GERLGVPTPVNATLVACIKGIERAMIDRQKEEVSA"
FT   CDS_pept        45376..45768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05401"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05401"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47236"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ90"
FT                   /protein_id="BAG47236.1"
FT                   /translation="MSAPKAYLEHVAIRVKDIHWHIRFFEDVLGMTMREVDGSREAPRQ
FT                   YWTLGGLQFISEPHYDGPEGRLAHLGVMCEDLDAAIAAAQAFGVTEMPQGRNWLRLPDG
FT                   LAIELIQAKPATCVAQALAINPRAEA"
FT   CDS_pept        45771..46232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05402"
FT                   /product="putative acyl dehydratase"
FT                   /note="contains MaoC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05402"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47237"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXT8"
FT                   /protein_id="BAG47237.1"
FT                   /translation="MSRIIEKYWDDAQEGDECISPTYTVTQQRILAYADLTGDHTPVHV
FT                   DEDYANASHFGCIVAHGLFGLSIADGLKTQSDYRFVPGMSLGWTWDFLLPIKVNDVLRV
FT                   KFRVGAMRASKSKPDWGIVVLPSELINQDGQVVQRGEHRLMIPRRPGAY"
FT   CDS_pept        46232..47452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05403"
FT                   /product="formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="COG1804: Predicted acyl-CoA transferases/carnitine
FT                   dehydratase, Pseudomonas aeruginosa"
FT                   /note="KEGG, K07749"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05403"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47238"
FT                   /db_xref="GOA:A0A0H3KPS8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPS8"
FT                   /protein_id="BAG47238.1"
FT                   /translation="MQARPLEGIRVVDYSHFLAGPYVGRCLAALGAEVIKVERPGGGDA
FT                   GRRHATILDDQQSAYFLQLNMGKRGVSVDMKDPRGKAFMQRLCDSADVFIENYRPGALD
FT                   KLGLGYAALSARNPRLVYCSISAYGHTGPDAHRAGFGLIAEAKSGIMQMIGNPGEPPPL
FT                   MRISLGDMYTGIHAVAAINAALFGRVTSGRGQHIDMALYDTLVSMHEYAVQCYTMQGVV
FT                   PEQTGHDMPTSTLYGVFRAADGDLVIAAQVDDAWKRFAAVVEQHGGPAGFGTDTRFHDP
FT                   NGRNAHREAILAVVKPWVGGRSVADVLALLDEVDVPCAKVQRIDEVVNDPQIVARGMVI
FT                   EQAHPRFGTLRLPNLPFRFSDCDTSIREVGPDLGQHNVEVAQSLGFSAAEIDAMQTDGV
FT                   LFSKRSA"
FT   CDS_pept        47452..48312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="BMULJ_05404"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="COG0169: Shikimate 5-dehydrogenase, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K00014"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05404"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47239"
FT                   /db_xref="GOA:A0A0H3KPD9"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPD9"
FT                   /protein_id="BAG47239.1"
FT                   /translation="MSDRYAVIGNPIGHTKSPLIHRLFAEETGQDIAYVAMEAPLEPDG
FT                   AFADTVSAFIAAGGKGMNVTAPFKLEAFAMADERSERATLAGAVNAMKFENGRVIAENF
FT                   DGVGLVRDIEVNLHQPMAGKRVLILGAGGAVRGALLPFIGARPAELVIVNRHPDKAQAL
FT                   VEQAGAGSALRACSYADLESMGRFDLVVNATSASLTGQLPPVPPSVFSASGSAYELAYG
FT                   KGLTPFLQLARSAGVQGIADGVGMLVEQAAEAFAWWRGVRPQTRALIDRLTVPLARHDE
FT                   DTARE"
FT   CDS_pept        48454..49359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05405"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05405"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47240"
FT                   /db_xref="GOA:A0A0H3KUD8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUD8"
FT                   /protein_id="BAG47240.1"
FT                   /translation="MGTAELPDLKLLQLFDLLYDVRSVTRAAEQLGQSQPTISIWLGRL
FT                   REHLQDPLFVRTPAGMTPTPQADALIGPCREILESLRRFSAWEISFDPATAKRRFRICM
FT                   TDASHITLLPKMLAHVRAQAPGIRLEAARIDGNTERALESGEADLAIGYVPWLGSGMYQ
FT                   QQLYMQDWVCLANPDHPRVRAKLTLKQYRREGHVIIAAGTGAQLLEQALLRENIDRDVV
FT                   LELPGMLGLGSIIQSTDLIATLPRNIGETLARVNGIAVHPCPFPVDKFAVRQHWHAKYH
FT                   HEAGNRWLRSVVADLFLDRS"
FT   CDS_pept        complement(49636..50025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BMULJ_05406"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="COG0599: Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K01607"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05406"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47241"
FT                   /db_xref="GOA:A0A0H3KQ95"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ95"
FT                   /protein_id="BAG47241.1"
FT                   /translation="MNEDEALFQKGLPIRREVLGPEYVDASMEKADAFMMAFQRATTAW
FT                   AWGWAWGDDTLDRKTRSLLNLAMLTAAGHTNELKLHVKGALNNGVSVEEIKATLLHATA
FT                   YSGIPHGLSAFKAAHEVLVSEGVLK"
FT   CDS_pept        complement(50041..51453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05407"
FT                   /product="NCS1 family nucleobase:cation symporter-1"
FT                   /note="COG1457: Purine-cytosine permease and related
FT                   proteins, Bacillus subtilis"
FT                   /note="KEGG, K03457"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05407"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47242"
FT                   /db_xref="GOA:A0A0H3KXU2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXU2"
FT                   /protein_id="BAG47242.1"
FT                   /translation="MTKQDSDGGVLAIESNSIEYVPPEARHGKPADLFTLWFCTNVAPL
FT                   AVISGATSVLVFHLDLVSAILAIVAGQCFGAIFHALTSAQGPLVGVPQMIQSRAQFGRY
FT                   GSLLVVGFTTLIYLGFFVSNIILAGKTLHTAMPAIPVPAATVVGAVLATLVGVIGCHFI
FT                   HRFNKIGAWFMGGALLIGIALMAPGLDAQIFERGHFDATNWFAMFGLCAIWQISFAPYT
FT                   SDYSRYLPTSAGFGKTFAYTYFGTSLGTIFAFLFGVLAVSTGHSTDAMQAVREQTGAFG
FT                   YVLILLFLVNIIGHNGMNLYGAVLSFITAAQTFRPHWVPGRNVRVAVSAVLLVASTAIA
FT                   LWASSNFIAIFLNAIFALRIVLAPWIAINLIDFYLVNNRHYRVAEIISSNGGMYGAFNA
FT                   KTTAIYVFGIAVQVPFMEESFFRGPWASILGGVDVSWMVGLVVTALVCYLFASRDDSRS
FT                   RSRCPAGAGALD"
FT   CDS_pept        complement(51552..53021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05408"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K00128"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05408"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47243"
FT                   /db_xref="GOA:A0A0H3KPT1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPT1"
FT                   /protein_id="BAG47243.1"
FT                   /translation="MNVHFQLYIDGQFEPGAATFGSIDPATGAVWAQMPEARTDEVNRA
FT                   VAAARRALTDRAWAGLTASARGKLLYRLADLVEQAAPRLAEIETKDTGKIIRETSSQIA
FT                   YVAEYYRYYAGIADKLEGSNIPVDKPDMQVWLERQPVGVVAAIVPWNSQLFLSAVKLGP
FT                   ALAAGCTVVLKASEEAPGPLLEFARIVHEAGFPPGVVNVVTGFGPECGAVLSSHPDVDK
FT                   VAFTGGPETARHIVRNTADNLAKVSLELGGKSPFIVFADTDIQSAVNAQVAAIFAASGQ
FT                   SCVAGSRLLIEASVKDRFLALLVERVSRIRIGSPGERETEYGPLCTERQLRHIEKVVER
FT                   SVRQGATVLAGGTKLERDGYYYAPTILDCTGVAHADSITTELFGPVLSVDTFESEQEAI
FT                   DKANGTAYGLAAGIFTTSLTRAHRVSKRVRAGIVWINTYRAVSPLVPFGGFGLSGHGRE
FT                   GGLSAALEYTTTKSVWLRTSDDPIGDPFVMR"
FT   CDS_pept        complement(53034..54071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05409"
FT                   /product="putative alkanal monooxygenase"
FT                   /note="COG2141: Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05409"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47244"
FT                   /db_xref="GOA:A0A0H3KPE3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPE3"
FT                   /protein_id="BAG47244.1"
FT                   /translation="MRFSLFVHMERVSDQTSQKQLYDEMVELCQIADRGGMHAVWTGEH
FT                   HGMDFTIAPNPFINLADLANKTKRVRLGTGTVVAPFWHPIKLAGEAAMTDIISGGRLEL
FT                   GIARGAYSFEYERLMPGLDAWSAGQRMRELIPAVKKLWEGNYAHDGEFWKFPSTTSSPL
FT                   PLQQPHPPIWVAARDPNSHEFAVANGCNVQVTPLHLGDDEVEKLVGHFNAACAKYSDVP
FT                   RPQIMLLRHTYVASNEDDAQRAADEINVFYNYFGAWFKNERPVSRGMIQPLSREEIAAH
FT                   PFYTPEAMRRNNVIGTPAEVIERLKTYEALGFDEYSFWIDTGMPFERKKASLERMIRDV
FT                   MPAFR"
FT   CDS_pept        complement(54083..55018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05410"
FT                   /product="FMN-binding monooxygenase"
FT                   /note="COG1853: Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47245"
FT                   /db_xref="GOA:A0A0H3KUE3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUE3"
FT                   /protein_id="BAG47245.1"
FT                   /translation="MSQAISQEASTINTRELRDAFGAFMTGVTIVTTARDDGQPLGFTA
FT                   NSFSSVSLDPALLLVSIAKTSSNFQTFSTAGHFAINILAEGQTELSNRFARPSENRFAN
FT                   VGWHLSAHRNPLIDDVSAWFDCTTHEVIDAGDHAIIIGKVEAFHSAGYAGLGYYRGGYF
FT                   TPAKLSTEVIAGPKVVVSAIIARDDKVLMIRTAEGKWTLPAKAIGREGADKALAELFRQ
FT                   YQPDASASFIYSVYNNTETHYQYISFLCSAPDEAAAAGEFVSLDDLDADAFQDSALASM
FT                   LERYRKESQLKSYGLYFGDHSTGTVRPLLS"
FT   CDS_pept        complement(55020..55838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05411"
FT                   /product="alpha/beta hydrolase"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05411"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47246"
FT                   /db_xref="GOA:A0A0H3KQ99"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ99"
FT                   /protein_id="BAG47246.1"
FT                   /translation="MTSRTLPLSNKRVAHYLDQGAGEPLVLIHGVGMQASAWYPQIDDL
FT                   SRDFRVISVDMPGHGRSDPLDTGAELPQFVQWAAEFIEALKVGPVNLAGHSMGSLIAAG
FT                   VAVTRPDLVKRVAVLNGVYRRTEQAREAVLQRAAELRSGTIDVDTPLKRWFNAEEAQQA
FT                   AARKVQSWLHSVDLAGYATAYHAFANGDEVYADAWHRIACPALVLTGSDDPNSTPEMAR
FT                   QMAQAAQDGKAVVIENERHMVNLTAPDTVNRALRTWLQTVPQAETLKSEV"
FT   CDS_pept        complement(55807..56409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05412"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47247"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXU7"
FT                   /protein_id="BAG47247.1"
FT                   /translation="MSLIRKSVLHVETLYVDGDKVAAKPLKMIGAAAVIKNPWAGRGYV
FT                   EDLSPEIRRLAPQLSEHLTQLILDEAGSGEAVEAFGKSAIVGLDGEIEHASALIHTLHF
FT                   GNTYRTAVGAKSYLAFNNTRGPANAPLLIPMMDKNDEGRRSHYLTLQFAIPDAPAADEL
FT                   VIALGAATAGRPHHRIGDRYKDLAELGNDVKNPAAVK"
FT   CDS_pept        56520..56810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05413"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47248"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPT6"
FT                   /protein_id="BAG47248.1"
FT                   /translation="MSAYWIAHVQVLDPVKYKDYTDLAPQAFKKFDAVFLARGGASQTL
FT                   EGDAFERHVVIRFPDMDTALACYHSVEYRTAKAKRDGHCRAQISIVEGLED"
FT   CDS_pept        56885..57631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05414"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG1802: Transcriptional regulators, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05414"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47249"
FT                   /db_xref="GOA:A0A0H3KPE7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPE7"
FT                   /protein_id="BAG47249.1"
FT                   /translation="MSPADFRRAAGHFVSRVPSMQDLKIDRNAKTLRELTLDKLRGAIV
FT                   QGYFRPGARLVERTLCDELGVSRTVVREVLRHLETEGLVETVSRQGPVVARLDPGQVGE
FT                   IYELRGLLEANAARACAEGATPEVVQRLREIRAVIEDAFEKEDLPRVLEYTERFYEALF
FT                   EAAGKHVSLTVVKTLNARINRLRALTIAMPGRGSDSNTEMNRLLDAIERRDGDAAAAAS
FT                   AAHIKRVAELAQSALAQQQDEAVDDR"
FT   CDS_pept        57820..58782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05415"
FT                   /product="putative nitrilotriacetate monooxygenase"
FT                   /EC_number="1.14.13.-"
FT                   /note="COG1853: Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K00492"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05415"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47250"
FT                   /db_xref="GOA:A0A0H3KUE7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUE7"
FT                   /protein_id="BAG47250.1"
FT                   /translation="MTESITEPIAQQPFDTSGFRRALGAFVTGVTVVTTIQPDGSPRGF
FT                   TANSFTSVSLDPPLVLVCIAKTASSHPVFSATQRFAVSVLAENQADVSGVFASKAQDKF
FT                   ARVPWDTRKTGAPVIRDAAASFDCVTHDVVDAGDHIILIGRVVDFAQTSASPLGYCRGA
FT                   YVNFSLSQDALSAAGRAQVGAILEHRDGLVLVDTPHGLRLPTGSRLEPASDAASLRGVL
FT                   TKLGLNAHLDFLFAVFESAGGREPGVHIYYRGRVMPTGSPWFDSSIRIVPLWQVPWDDI
FT                   ADTAVRSMLERYVRERRQDAYGIYVGDTEAGTVQPLAAA"
FT   CDS_pept        58930..59982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="BMULJ_05416"
FT                   /product="spermidine/putrescine transport system
FT                   substrate-binding protein"
FT                   /note="COG0687: Spermidine/putrescine-binding periplasmic
FT                   protein, Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K02055"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05416"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47251"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQA1"
FT                   /protein_id="BAG47251.1"
FT                   /translation="MSSRSIPRFAASRLASQLACIAPLAVLCAAPARAADPIVFTSWGG
FT                   TTQSSQQKDWAQPFTQASGIKVLMDGPTDYGKLKAMVESGNVSWDVVDVEGDFAYAAEK
FT                   AGLIEPIDYSVVKKADLDARFATPSAVGSFYYSFVLGYNKAKYTGAQPQNWVDLFDTKR
FT                   FPGKRTLYKWSAPGVLEIALLADGVAPNKLYPLDLDRAFKKLDSIKGDIVWWSGGAQSQ
FT                   QLLASGEAPIGMFWNGRLHALAQTGVPVGMSWNENLTAADMLVIPKGAKHRDAAMKFLA
FT                   AATSAEAQARFAANTGYAPINVKSAALMPPAIAKALPDQYKGSQINLDMKYWAENRDAI
FT                   AKRWYAWQSK"
FT   CDS_pept        60124..61008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="BMULJ_05417"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1176: ABC-type spermidine/putrescine transport
FT                   system, permease component I, Sinorhizobium meliloti"
FT                   /note="KEGG, K02054"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05417"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47252"
FT                   /db_xref="GOA:A0A0H3KXV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXV1"
FT                   /protein_id="BAG47252.1"
FT                   /translation="MPNVLSTVAHPAATPPRKRRDWRSVRLLAPAMLLLVIFFLLPVLS
FT                   LLLRSVLEPAPGLHNYAQLLGSTTYVRVFGNTFIVATVVTLVTLIVGFPMAWLLAIAPR
FT                   KLSSVLFAILLLSMWTNLLARTFAWMVLLQGTGPINRALMALGVIREPLSLVNNLTGVT
FT                   IGMTYIMLPFLVMPLHATLRGIDPSTLRAAAVCGASRWQAFWRILVPLAMPGVASGALM
FT                   VFVMALGYFVTPTLLGGPSYMMLAELIAQLVQELLNWGLAGAAAFVLLAVTLALYALQL
FT                   RFTGSAHAAAGGR"
FT   CDS_pept        61010..61810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="BMULJ_05418"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1177: ABC-type spermidine/putrescine transport
FT                   system, permease component II, Sinorhizobium meliloti"
FT                   /note="KEGG, K02053"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05418"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47253"
FT                   /db_xref="GOA:A0A0H3KPU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPU1"
FT                   /protein_id="BAG47253.1"
FT                   /translation="MLLDFDRLGALRWILVAVGAAVALFLLLPIVFIVALSFGDSQWLI
FT                   FPPPGWTLEWYRQLFTDAGWIDSLLTSAKLAIIVTMLSVAIGFLASLALVRGRFRGREA
FT                   VRGFFLTPMVLPVVVLAVALYAFFLRIGLNGTMTGFVIAHLIIALPFSIIAISNSLLSF
FT                   DTALEDAALICGASPLTVKLRVTLPAIRLGLFAAAVFAFLASWDEVVVSIFMSSPTLQT
FT                   LPVRIWATLRQDLTPVVAAASSLLVGLTTVLMLAGAVVRRARAH"
FT   CDS_pept        61822..62928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="BMULJ_05419"
FT                   /product="spermidine/putrescine transport system
FT                   ATP-binding protein"
FT                   /note="COG3842: ABC-type spermidine/putrescine transport
FT                   systems, ATPase components, Sinorhizobium meliloti"
FT                   /note="KEGG, K02052"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05419"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47254"
FT                   /db_xref="GOA:A0A0H3KPF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPF1"
FT                   /protein_id="BAG47254.1"
FT                   /translation="MTAFLQIQRLRKTYDDVVAIDHVSLDVRKGEFMTFLGPSGSGKST
FT                   TLYIVAGFQEPTDGRVLLDGKSLLSVAPNQRNIGMVFQRYTLFPHLSVGENVAFPLRVR
FT                   RRPDAEVRAKVEQMLKLVHLSECRDRMPAQLSGGQQQRVAIARALAYDPPVLLMDEPLS
FT                   ALDKKLREEIQLELRRIHQETGVTILYVTHDQEEALRLSDRIAVFNQGRIEQVGTGEEL
FT                   YANPASRFVASFIGNSNFLPVKVTKTRDGRMGGVFPNGVETASDAFHPSLAAGDDGTLM
FT                   IRPEQMRIRPVQYAGTATASAVGAGLPVTVRDITYLGDAMHYAVATPWQQEISIRTPAA
FT                   HRHGNGIVIGAQALVEWDARDARLFAQA"
FT   CDS_pept        62940..63647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05420"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG1802: Transcriptional regulators, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47255"
FT                   /db_xref="GOA:A0A0H3KUF1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUF1"
FT                   /protein_id="BAG47255.1"
FT                   /translation="MRPALPSLKVERPTATLRELALEKMRTAILDAHFQPGERLVERSL
FT                   CEILGVSRTVVREVLRHLETEGLVDSIPNQGPIVAVLDFDTAAEIYEIRALLEGEAAMA
FT                   CAEHADASLVADLSTCIDRIQHAFDTQDHHAVKALTSAFYERMFIAGKKHVAWEIVQTL
FT                   IARINRLRALTIASDDRGQQAVEEMREILAGIAAGDARAAREAAVAHVARVAEIARKLL
FT                   TQGRESAAWRQAG"
FT   CDS_pept        complement(63692..64078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05421"
FT                   /product="MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05421"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47256"
FT                   /db_xref="GOA:A0A0H3KQA5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQA5"
FT                   /protein_id="BAG47256.1"
FT                   /translation="MKNTPSRQLLAIGQLSQLTGASVRSIRHYDEHGLLTSVRASNGYR
FT                   MFPEKAVTQVKQIQRMIATGFTIDDIRGFPDCMLLIEGARSCDQITDVQRARLEAIERQ
FT                   IADLEKRRARLLKTLNEGVIPPVD"
FT   CDS_pept        64165..65109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05422"
FT                   /product="alpha/beta hydrolase"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05422"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47257"
FT                   /db_xref="GOA:A0A0H3KXV6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXV6"
FT                   /protein_id="BAG47257.1"
FT                   /translation="MSLRTFSHLLISALSAVTLLASAPHAFAAPNSYTVTSADGVRIAV
FT                   QENGNPNGQPIILVHGLLGSRLNWDAQVRSRELSRYRIITYDLRGHGLSDKPAGPEPYH
FT                   DGSRWGDDLAAVIRGSHARKPVVVGWSLGGVVISNYLAKYGDSGIAGAVYVDGVVELAP
FT                   GQIVAHPDVYRDMNSADLKTHLDGERTFVGLCFNRRPDADTFARLLANAAMASWDMQRE
FT                   VPAMTVFATEGLAKARVPLLFIYGGRDVLVDTQATLARAAALNPHIVSHVYADAGHAPF
FT                   IEEPERFNRDLDAFVRSASQQGRDVLPEGKEGT"
FT   CDS_pept        complement(65199..65996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR2"
FT                   /locus_tag="BMULJ_05423"
FT                   /product="DeoR family fructose operon transcriptional
FT                   repressor"
FT                   /note="COG1349: Transcriptional regulators of sugar
FT                   metabolism, Bacillus subtilis"
FT                   /note="KEGG, K03436"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05423"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47258"
FT                   /db_xref="GOA:A0A0H3KPU4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPU4"
FT                   /protein_id="BAG47258.1"
FT                   /translation="MKASERHRAILDLVLTGDASVEQLSAALGVSEATVRRDLTTLANQ
FT                   RRLVRTYGGATALIGAHEPEASLEERKATQREQKEAIARAAAAHVHDGDTLLLDGGTTC
FT                   AALARHLVSRVDLHVVTNNLLAVMTLANAPGVHLTLIGGDLRKSSMSTLGPLAELSLSR
FT                   LSVDKAFLGADGVVAEFGLCEASAQQAYLKDCIIRRAAQTFVLADADKLGRSRQQHWTP
FT                   LERDWCLITSSMADEALLAPFRALGRVVVETADIDTPSRPTIS"
FT   CDS_pept        complement(66073..67074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="BMULJ_05424"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="COG1995: Pyridoxal phosphate biosynthesis protein,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K00097"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05424"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47259"
FT                   /db_xref="GOA:A0A0H3KPF4"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPF4"
FT                   /protein_id="BAG47259.1"
FT                   /translation="MSNYLPVIGITMGDAAGVGPEIIVKSLAHDVVYRQCRPLVIGDAR
FT                   RLERANEIVGGTTKIRRIQEAADARYEPGTIDCIDLDLIPADLPFGRLSAVAGDAAYQF
FT                   IARAVKLAEAGQIDAICTAPLNKEALHAGGHKYPGHTEMLAHLTGVDEVSMMLVAPQLR
FT                   VIHVTTHIGIIDAIRKIEPGLVQRTIERGHATLVKAGIAKPRIGVCGINPHAGENGLFG
FT                   YGEEEEKIVPAVALLQERGLDVTGPLPADTLFFRAGRGDFDLVVAMYHDQGHGPVKVLG
FT                   LEAGVNVTVGLEVIRTSVDHGTAFDIAGTGVADERSLLEALRQGAELATRRG"
FT   CDS_pept        complement(67136..68434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05425"
FT                   /product="hypothetical protein"
FT                   /note="COG3395: Uncharacterized protein conserved in
FT                   bacteria, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05425"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47260"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUF6"
FT                   /protein_id="BAG47260.1"
FT                   /translation="MSMLIIADDLSGAADCAIGFASAGYRTVVTLDVPTQGLDATVADV
FT                   IAADTDTRRLTPAEAAQRTSAAWRALREPGRRLYKKIDSTLRGNWAAEVAALQPLAGLA
FT                   IVAPAFPATGRTVLGGRVFVRGEPLETTDTWKLENAGRTADLHAMLAQNGVSTAQLDVD
FT                   ALRESSQTLIARIAAVAASGTEALVVDAETNDDLIALARATAQMDDALFWVGSGGLARE
FT                   IASVESLFDARAARTGAAASQRQPRHAPVLALVGSLSAVSERQCAMLRERAGMMELTVP
FT                   PAVLRGGERHADVPQWQARIGDALRTGADLLLRIGSDDAFDPAEGALLSATLAALVKPH
FT                   FAVLGGLIATGGETARAMLSAVGVGSVELIEEIEAGVAVGKPIGASVCQPHLRIVTKAG
FT                   AFGTDHALFAAWRYLRETPAASVRAGARSHGSA"
FT   CDS_pept        complement(68431..69411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgT"
FT                   /locus_tag="BMULJ_05426"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="KEGG, K02526"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05426"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47261"
FT                   /db_xref="GOA:A0A0H3KQB0"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQB0"
FT                   /protein_id="BAG47261.1"
FT                   /translation="MAQIHIKRGIERVPGGMMIVPLLVGALVATFLPDMPKFFGSFTNA
FT                   LFTGALPILAVFYVCMGASIDVKATPYLLKKGGALFVTKVGAAIVVGVVMGHFLGEQPI
FT                   SSGLFAGLSTLAVVAAMNDTNGGLYMALMGQYGRSEDVGAYTIMSLESGPFLTMVTLGV
FT                   AGLSAFPWPTLVGSILPLAFGMLLGNLDREMRAFLGKAVPVMIPFFALALGASLDLHKV
FT                   WQAGVLGVGLGIAVVIVTGIPLYLADRLTGGTGVAGTAAANTAGNAAAVPALIAAANPV
FT                   YAEAAKSATLLVAACVVVTAVLSPILTAAVAKRVQVGREATEMAQ"
FT   CDS_pept        69920..70489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05427"
FT                   /product="FMN reductase"
FT                   /EC_number="1.5.1.-"
FT                   /note="COG0431: Predicted flavoprotein, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K00299"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05427"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47262"
FT                   /db_xref="GOA:A0A0H3KXW1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR019912"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXW1"
FT                   /protein_id="BAG47262.1"
FT                   /translation="MSKPVNVVAVSGSLQRPSRTLVLIDALLAALGNAARIETRRIELA
FT                   EIGSRLAGAATRAQVPPDLDSQLRAIETADVLIVASPVYRASYTGLLKHLFDLVDRDAL
FT                   VDVPVLLAATGGSERHALVIDHQLRPLLGFFQARTLPIGVYASESDFDRYAIANPALHA
FT                   RIARAARHAAPHLRARQFPVAADAAA"
FT   CDS_pept        70517..71620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuD"
FT                   /locus_tag="BMULJ_05428"
FT                   /product="alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="COG2141: Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases, Pseudomonas aeruginosa"
FT                   /note="KEGG, K04091"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05428"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47263"
FT                   /db_xref="GOA:A0A0H3KPU8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024014"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPU8"
FT                   /protein_id="BAG47263.1"
FT                   /translation="MSVTESHADGVKFAYWVPNVSGGLVVSTIEQRTDWSLEYNQQLAR
FT                   VAEAAGFDYALSQIRFTAGYGAEYQHESVSFSQALLHATTKLKVLAAILPGPWHPAVVA
FT                   KQLATIDHISNGRIAINVVSGWFKDEFTAIGEPWLEHDERYRRSKEFIQALKGIWTQDN
FT                   FTFKGDFYRFNNYTLSPKPLQKPHPEIFQGGSSRAARDNAASVSDWYFTNGNTPENLKT
FT                   QIDDIRAKAAANGHRVRIGVNAFVIARDTEDEARAVLDDIVRHAHVEAVHAFGDAVKQA
FT                   GKASPEGEGNWAKSTFEDLVQYNDGFRTNLIGTPEQIAQRILELKAIGVDLVLAGFLHF
FT                   IEEVEYFGKRVLPLVRELEAQRQPVAA"
FT   CDS_pept        complement(71674..72648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05429"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05429"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47264"
FT                   /db_xref="GOA:A0A0H3KPF6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPF6"
FT                   /protein_id="BAG47264.1"
FT                   /translation="MNEVRAITVFVRAATLGSLRAAAVDQGISPQAASHAVMQLEKALG
FT                   VRLFHRTTRKLSLTEEGERLFDSVKPALAMLASALGDARRSKSEVAGLLRVSAPRALGL
FT                   PVLWPCFEAFEHAYPDVQLDVRFDDQFTDLVTERADVGFRGGPPPSAGSIARPLVPIQL
FT                   IVCASPAYIARHGAPRTIDELAAHRCTGYRRANTGKLAQWTFRVGDEIVYRDVPAALTV
FT                   NDTDMETHAVLSGLGVGQLGSFSAAMHLRSGRLVPLLTEHVVEHGMIYLYYGHRTERSL
FT                   RVKTFIDFVVERLADNRDFFLDAAELRAMQPGTPRRRAAKARR"
FT   CDS_pept        72767..73624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05430"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K07124"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47265"
FT                   /db_xref="GOA:A0A0H3KUF9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUF9"
FT                   /protein_id="BAG47265.1"
FT                   /translation="MAATQHHGFKRVWFITGASRGIGALIAEAALADGNAVVAAGRNVS
FT                   AIVERLGESAALLPVALDVTDEAQARAAVQAAVERFGRIDVLVNNAGFGLLGAVEESSD
FT                   KDVRRMYDTNVFGLLNVTRATLPAMRANRSGHVINISSVGGYRAAAGFGVYSSTKFAVE
FT                   GITEALHAELQPLGIHATVVEPGYFRTDFLDASSLVVAPTVIDDYDATSGAVRRKAAQL
FT                   NHNQPGDPTKLAAAMIALVDAPNPPLRLPLGTDTLAAIAAKNAYVAQETEAWRALSAST
FT                   DFAA"
FT   CDS_pept        complement(73674..74096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05431"
FT                   /product="glyoxalase/bleomycin resistance protein"
FT                   /note="COG0346: Lactoylglutathione lyase and related
FT                   lyases, Mesorhizobium loti"
FT                   /note="KEGG, K07032"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05431"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47266"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQB5"
FT                   /protein_id="BAG47266.1"
FT                   /translation="MQPRISVLTLGVDDLEAALRFYRDGLGLKTDGIVGREFEHGAVAF
FT                   FDLQPGLKLALFGRADLAHDTGLPPTTRDGIASTIGHNVASAREVDDVMQQAAAAGARI
FT                   VKPAGETFWGGYSGYFQDPDGHVWEVVFNPAFVPAG"
FT   CDS_pept        complement(74303..74674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05432"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47267"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXW8"
FT                   /protein_id="BAG47267.1"
FT                   /translation="MLRIGNLFDIERTPGDGERFDTLVAGSNVTIERIVSAGHASPPGF
FT                   WYDDPRAEWVVLLSGAAVLEFEHDAARHALHAGDHLLIDAHCRHRVAWTDPSVPTVWLA
FT                   VYHEPERVASSASAPARPS"
FT   CDS_pept        complement(74722..75171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05433"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2128: Uncharacterized conserved protein,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05433"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47268"
FT                   /db_xref="GOA:A0A0H3KPV4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPV4"
FT                   /protein_id="BAG47268.1"
FT                   /translation="MTRRLDYAQIAPAGMKALGSVYGYVMQSGLSPILVDLVYLRVSQI
FT                   NNCAYCLDMHTRDLIERGASIEKLALVQAWAEAGSLFDERERAALAWAETVTRVAETGV
FT                   PDPAYEAARQVFDEREIVDLTIAISLMNAYNRMAISFRNTPQAAL"
FT   CDS_pept        complement(75173..76393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05434"
FT                   /product="major facilitator family transporter"
FT                   /note="COG2814: Arabinose efflux permease, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05434"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47269"
FT                   /db_xref="GOA:A0A0H3KPG1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPG1"
FT                   /protein_id="BAG47269.1"
FT                   /translation="MDRRLSILAVGMFAMGTDNFVVAGILPGVAASLHTSVALAGLMVT
FT                   CYAFTYAIAAPIMAALAGRWPRKLLLVSALGIFVAGNVLSALATDLGVVLFSRALAGFG
FT                   AALFSPTALGVASALATPERRGRALAAVTAGLTGATALGSPLGTFIGGFGGWRSTLWFV
FT                   AALGAVAMIGVWTMLPAVPRPAPVGLRERIAPMRDARIALTLLTSLFAFGGFLMVYTYA
FT                   GVVLQRVTHGDERMLAALFLLWGVAATAGNFIAGRLVDRFDSRRVIDAMLWIAIVNFCL
FT                   LPWTAAHVFGAIVALTIWGLCGWGLIVPQQHRLVHAAPQVAPLVLALNNTATYIGLAGS
FT                   GVLGGLVLRTIDARYLSVVAAALIVVAFVCAEAAYRRMRAPAAIDRTTPDTRIETRVLT
FT                   TPVEHGE"
FT   CDS_pept        76509..77537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05435"
FT                   /product="AraC subfamily transcriptional regulator"
FT                   /note="COG4977: Transcriptional regulator containing an
FT                   amidase domain and an AraC-type DNA-binding HTH domain,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05435"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47270"
FT                   /db_xref="GOA:A0A0H3KUG4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUG4"
FT                   /protein_id="BAG47270.1"
FT                   /translation="MHTIGFVVFPNFYLLGFAAITAFELANVVLGEPAYHVTVLSEEGG
FT                   LVLSSAGIRVETQPFSDTSFDTVMFGSGVEIDIASPALTAFVQRALATSRRIAAPCTGA
FT                   FILAEAGALDGRRATTHWRFAADLQRRYPEVAVEDDQIFIVDGPIWTSAGMTATIDMAL
FT                   AMIEKDHGHEVSRAVARKLVVYHRRAGGQSQFSTLLDLEPKSDRIQKAIDYASANLRKP
FT                   LTVEELADVAGLSPRQFSRAFSAETGQSPAKAVEHLRVEAARLLLEKGRLSLDVIADEV
FT                   GFADRERMRRAFLRTIGQPPQAVRRFSRSARAGNADGGERTLVPPAADVQAATAAGAVP
FT                   RS"
FT   CDS_pept        complement(77566..79077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05436"
FT                   /product="phospholipase C"
FT                   /note="COG3511: Phospholipase C, Mycobacterium tuberculosis
FT                   CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05436"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47271"
FT                   /db_xref="GOA:A0A0H3KQB9"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQB9"
FT                   /protein_id="BAG47271.1"
FT                   /translation="MDGTGAYRHYDRRRFLAGVAAVAGSVALSGCGGGGGDGGNGGGSG
FT                   GSGADGNAAAPSIGNTPSPNGGDRYSLPRPPLPDPSNAGIDHIVLVTMENRSFDHFLSW
FT                   VPGAEGMPANRQYTDAFGATHAPFALASNPAYGYQACAYHDPNHSYEGARTQLASGAMN
FT                   GWLLTPGTSQTQGDLLPIGYYTSADLPFFSAAATHYTIGDFYFTGILTSTFPNRLYLHS
FT                   GATDRLGDGIDTSTLRTIWDNLADANVGCHYYYHDVPFTALYGTRYVGISHPFSEFLSN
FT                   AAAGTLPAFCMVDPAFAGEREGTSSDDHPHADIRDGQAFLNQVYDALRTSPTWSRTLLI
FT                   IVYDEWGGFLEHVVPPTRPISNNELALGNDGKLGCRVPLALLGPRVRAGTVTRYPFDPS
FT                   SIHALLQWRFGLKPLGVRGSDPATVNLAYALDLASAPRTDAPAFTVPQGPFGGLCAGAT
FT                   APAPSDSISQIDPSQMAAKPAVNPTADRFADLRAKATALGFATGG"
FT   CDS_pept        complement(79761..80906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05437"
FT                   /product="hypothetical protein"
FT                   /note="COG2771: DNA-binding HTH domain-containing proteins,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05437"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47272"
FT                   /db_xref="GOA:A0A0H3KXX3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXX3"
FT                   /protein_id="BAG47272.1"
FT                   /translation="MTRIETIHQTIRHIYDAALMPDGWSRAGSALAHAAASPMAILLNA
FT                   RPATQRSARLATGFDAACATRMQHEFEAQPPPWIGAIPVATPVRQTACISDRDFARSRF
FT                   YHDAVRPADGFYAMIAPLAADRRVVLAIGRHRGAADFTDDDVRVAQWLVPHVATALQVQ
FT                   RRIAEANLRAQGAYDAISRLAFGVILVDAAMRPLFANPAAEALARGGNGLLLDRNAVSA
FT                   VQPADAARLRRTIAAAVALNAGSRRVADATVQPPASMRCHVSRRPPRPPLTIRVVPVGA
FT                   SDLPDGIDTAARAIVFVTEPDRPADIDPDCIATTFDLTPREAALAALLSGGLDLGEAAA
FT                   RLGIGIGTARGYLKQILAKTGTHRQAELVSLVVRAALPVMR"
FT   CDS_pept        complement(81399..82964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05438"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="COG0840: Methyl-accepting chemotaxis protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05438"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47273"
FT                   /db_xref="GOA:A0A0H3KPW0"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPW0"
FT                   /protein_id="BAG47273.1"
FT                   /translation="MRKRFTIRGGLVATIAGYTLLLVLVVAACIGGLYLGNDSLEAMYR
FT                   DDTASLLHLKTSSERMLVLRERMADVAQIISAGRPAKDEIAQLRTLLQQSNDELLAYSR
FT                   LHARDAHEQTLFDALQASRRTLLDRVFSKALAQLDQDDAFNFLDTQRTAPPELFTAYQK
FT                   AIDALEAFQVEREKARYEAAGERFHRIVWAMAAVAAIALVVGFVAQRLLAKAIIEPIAL
FT                   AVDHFDKISKGDLTGAVAIGGDNEMAYLLNALKRMQDGLVDTVSQVRASTETIVGDVRT
FT                   IASGNVDLSARTEQHAVSLQQAAASMEQLTATVRQNADNARDARSYVEGAAGIAARGGE
FT                   AMQRVVDTMSAISQSAAQIAGIVGVIESIAFQTNILALNAAVEAARAGEQGRGFAVVAT
FT                   EVRGLAQRCAAAAKEIRELIGDSTQRVEHGSGLVAHAGSAMTEIVAAVERVNAIMSDIS
FT                   TAFDEQSSGIEQVNATVTQMEQTMQRNTALVEETAAAALSLEKQGARLSNAVAQFRLRE
FT                   AASA"
FT   CDS_pept        complement(83149..83622)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05439"
FT                   /note="truncated metabolite transport protein"
FT   CDS_pept        84461..85060
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05440"
FT                   /note="truncated Vgr-related protein"
FT   CDS_pept        85148..87409
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05441"
FT                   /note="truncated Vgr-related protein"
FT   CDS_pept        87600..88280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05442"
FT                   /product="ankyrin repeat protein"
FT                   /note="contains ankyrin repeats"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05442"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47274"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPG4"
FT                   /protein_id="BAG47274.1"
FT                   /translation="MQQLAPKTDLNAPGAKNTTLLSYAVQEIVPVKNDASNTRYQIISA
FT                   LLKNGADPKAPVGASGGTVVDVALRADTPNLLRVLLDGGLDPNWRPSGDTPMIFEVAEN
FT                   KLLPQLKLLIEHKANVNGRDSLGKTALFEATMIQQWDTVDYLLAHGADPKISSELGVSY
FT                   GWVLQNELKNHTTPDSPARARIDAIRRKIVAAGAPWPPVDPKAQRADMRARGEKVVTPA
FT                   GQTE"
FT   CDS_pept        88324..88767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05443"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47275"
FT                   /db_xref="GOA:A0A0H3KUG8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUG8"
FT                   /protein_id="BAG47275.1"
FT                   /translation="MTRALESLPRVRRGTVLGVSVGLYVVSLLLPAMYFEKEAPLIGMS
FT                   VLAQGWWGLLMLNPSWLANPLYVIAAVQFGRARYGRASVFSGAAVVCALCSLFTTKWYF
FT                   NEADATPITGFGIAFYVWLISQVALLLGGLRLRQDAATAPPGN"
FT   CDS_pept        88823..89281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05444"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5435: Uncharacterized conserved protein,
FT                   Salmonella typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05444"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47276"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQC4"
FT                   /protein_id="BAG47276.1"
FT                   /translation="MTDSENRIRIHEGSIVLPDGFEDRTTNLLVPADLTTQPNLSVARD
FT                   WLKDGETLAPYIDRQVTLLKSRLQGLRLLGRQAERLGPEADGMPGERIDTAYRNGAKMV
FT                   FQRQAAFIVAPGRVLIFTASNAKSFNGTFDTFWRTWLDGYRPAEQASA"
FT   CDS_pept        89303..93535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05445"
FT                   /product="Rhs family protein"
FT                   /note="COG3209: Rhs family protein, Salmonella typhimurium
FT                   LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05445"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47277"
FT                   /db_xref="GOA:A0A0H3KXX7"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR032871"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXX7"
FT                   /protein_id="BAG47277.1"
FT                   /translation="MYEAARVTDPIEHTSALAGFLVGAVLGIALIAAVAFATFTCGFGV
FT                   ALLAGMAAGIGAQGLLSLGEAIGKMFSSQSGNIITGSTNVYVNGKPAAYATLSGVACSK
FT                   HNPVPLVAQGSTNIFINNRPAARKDDKITCGATIGGGSHDTFFHGGTQTYLPVDDEVPP
FT                   WLRTATDWAFALAGLVGGLGGLLKAAGGLSRAVLPCAAKFIGGYVLGEAVGRYVAGPAI
FT                   NKAIGGMFGNPVDVTTGRKILLAESEIDYVIPSPIPVAIKRFYSSSLNYVGTLGRGWVL
FT                   PWELRLQARDGRLWYTDAQGRESGFPLLRTGQAAFSEADQRYLTCTPDGRYILHDIGET
FT                   YYDFGRYEPDSGRIAWVRRIEDQAGQWYQFERDSRGRVTEIQTCGGLQAALDYEPEHGR
FT                   LGAVTLVHGDERRVAVTYGYDENGQLTSVTDANGAIVRRFRYADGLITSHSNALGFTSS
FT                   YVWSTIEGQRRVVETNTSEGEHWTFEYDVDGRQTRVRHADGRTAHWRFDAAFQIIEYTD
FT                   LDGGFYRIKYNDAGMPTMLMLPGERTVEFEYDDAGRIVAETDPLGRTTRTRYDGNSMRP
FT                   VEIIGADGGAWRAEYDPQGRLLSTQDPLGRENRYEYPTGLTALPTAHIDARGGRKMLAW
FT                   NRLGELVGYTDCSGKTTRAFFDAFGLPLARENALGQRISYDVRPTGEPRRITYPDGSSE
FT                   TFEYDAAGLVVKHVGLGGRIQQSLRNARGQLVEAIDPAGRRTRFRYDPEGRLRELQQGH
FT                   AHYAFTYSAGGRLATETRPDGVERRFGYGEAGELVALDIVGAPDSGTTSNRPIRTVRFE
FT                   RDRMGNLKVQHTPTEVTRYERDKGDRLLKVERTPTAMGVALGVAPDTVEFEYDKAGRLV
FT                   AEHGANGTVQYTLDALDNVMTLELPHEQKLQMLRYGSGHVHQIRCGDQIVSDFERDDLH
FT                   REVTRTQGRLIQRSAYDPLGRKVWQSAGFHLEALGRGRGHLWRNYGYDAAGELIETSDN
FT                   LRGSTQYDYDPAGQLTRRVNILARQLEEFAWDAAGNLLDDVQRRSRGYVEGNRLRMWQD
FT                   LRFEYDAFGNLVAKTRGANRTQRFTYDGQDRLIAVRTQDARGVVESRFAYDPLGRRIAK
FT                   SDTFFDIRGVKQRTETKRFVWEGLRLAQEVRETGVSSYVYSPDAPYSPAARVDRVIAEA
FT                   LAAAAIDTAKRAARIYHFHTDLVGAPLEVTDESGELAWTGQYTAWGKVESSSKDIARIE
FT                   QPLRYAGQYADEGTGLHYNTFRFYDPDVGRFINQDPIGLYGGGNLYAYGPNSQQWVDPW
FT                   GWCSVKLSNNMEKSGVTRPANSAAHHIVGDTAKEAAPARAILSKYGIDVDSELNGVFLP
FT                   NRNNTDNLAGILHNGKHPNTYFQKVNQLLQDADLGGKQAVLDQLQTIRETLQNASRDTP
FT                   WKSVLSEL"
FT   CDS_pept        complement(94985..95881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /locus_tag="BMULJ_05446"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="COG1893: Ketopantoate reductase, Mycobacterium
FT                   tuberculosis CDC1551"
FT                   /note="KEGG, K00077"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05446"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47278"
FT                   /db_xref="GOA:A0A0H3KPW3"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPW3"
FT                   /protein_id="BAG47278.1"
FT                   /translation="MNAEIGTEIAVVGPGAIGTTVAAALHEAGRTPLLCGRTRRDELTL
FT                   RDGDRLIVVPGPVRTDPAEIDRTVDLVFLSVKATQTAAAAEWLAALTGPETMVCVLQNG
FT                   IEQSDTVAPHCSQGRIVPAVVWFPAQAQPDGSVRLRGEVRLSLPDTADARTVADALRGT
FT                   RCAVDVTAAFSSLAWRKLLQNAVAGLMALAVRRSGMFGRPDIAELALAYLRECLAVARA
FT                   EGAELGDEVPQAILDKFRAAPADMGTSILTDREAGRPLEWDIRNGVISRRGRMHGIPTP
FT                   ISDVLVPLLAAASDGPG"
FT   CDS_pept        complement(95983..96870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05447"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05447"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47279"
FT                   /db_xref="GOA:A0A0H3KPG9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPG9"
FT                   /protein_id="BAG47279.1"
FT                   /translation="MNYRRLTPSMSLLLVFEAAARHESYTRAADELSLSQSAISRQIQT
FT                   LEDQLGVPLFRREGRSVKLTDVGRRYFAEVGGALGRIRGATLQAMSHQAGAGTLRLATL
FT                   PTFGSKWLLPHLHDFYAAHPGVTVHLHSRIGNIDFHVDDLDAAIAVGTGDWPGLHAHRL
FT                   YNEFLIAIASPDAPPDANGERAPAWAARQTLLGVTSNQHAWAEWFAHYRLDHRQMRIGP
FT                   SFELTSHLIQAVRAGMGIGLVPKVLVEDELSRNELVSIGDAITSRRSYYLVYPPENESL
FT                   PSLAAFRDWLMNAR"
FT   CDS_pept        97022..100093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05448"
FT                   /product="FAD/FMN-containing dehydrogenase"
FT                   /note="COG0277: FAD/FMN-containing dehydrogenases,
FT                   Salmonella typhimurium LT2"
FT                   /note="KEGG, K06911"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05448"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47280"
FT                   /db_xref="GOA:A0A0H3KUH4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUH4"
FT                   /protein_id="BAG47280.1"
FT                   /translation="MPIAPLPRPAAPTATAYRDFLDALRAAGFAGEIRADYANRTVQAT
FT                   DNSIYQRLPQAVVCPADVGDVERLARLLAQPAHRGVVVAPRGGGTGTNGQSLTDGLVVD
FT                   LSRNLNRILEIDVERRRVRVQAGVVKDQLNAALKPHGLFFAPELSTSNRATIGGMINTD
FT                   ASGQGSCTYGKTRDHVLALDFVLPGGERLHSTALSDDELVRRCARQDRIGEVYRTARRI
FT                   GDDHAALIDAKFPKLNRCLTGYDLAHLREADGRFNLNSVLCGAEGSLGFVVEATLNVLP
FT                   IPKYSVLVNVRYAGFMEALRDARALLELKPLSIETVDSTVLMLAMKDFVWSSVADYFPQ
FT                   DDRRPTLGINLIEFSGDDADEVDARVRAFVEHLRADTTVERLGHTIAAGDDAVKRVYAM
FT                   RKRAVGLLGNVQGEARPQPFVEDTAVPPEHLAAYIAEFRALLDGYGLRYGMFGHVDAGV
FT                   LHVRPALDMKDPKQAALVRPVSDAVAALTQRHGGLLWGEHGKGVRSEYAPAFFGELYPA
FT                   LQQLKAAFDPHNQFNPGKIATPPQPAMRLLKIDEVPTRGEHDRQIDERVWQSYGTAMHC
FT                   NGNGACYNFDPDDAMCPSWKATRERVHSPKGRASLMREWLRLQGEAGADVLAAARERQP
FT                   WLRGFVDRWRNTRAARRGAADFSHDVYDAMAGCLACKSCAGQCPVKVSVPEFRSRFLEL
FT                   YHQRYLRPLRDYLIGSLEFTVPWFARVPALYNGLMRAGWVRTLFERHVGMVDSPLLSRF
FT                   DLAAVIRQLDVRPADPHALAALTDAQRARSVVIVQDTFTRYFDTEQLATLIELAARLGF
FT                   HVWLAPLAPNGKALHVQGFLRAFERAAVRNATQLAALARAGVALVGVDPAITLTYRQEY
FT                   RKVPGLHDVPPVALPQEWLLDVLPDVKGDMQADTQAGDAARAYRLLPHCTEKTNAPDSG
FT                   KQWVQVFARRGLRLQVQPAGCCGMSGTYGHEARNVDTSRTIYAQSWAAHVDASEPAGEA
FT                   LATGYSCRSQVKRMSARQLRHPLQVLLDQVRAAQ"
FT   CDS_pept        complement(100373..100675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05449"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47281"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQC8"
FT                   /protein_id="BAG47281.1"
FT                   /translation="MCAMAYADFQQELKKAQLTAREFARLIRMNESSITNYSSKGTVPS
FT                   HLAVIATLIGALAAHEIDFRRVIRQTRIEPKRPRGVGAFPATTHPRTAKRGDEQS"
FT   CDS_pept        complement(100762..101916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="BMULJ_05450"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683: ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01999"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47282"
FT                   /db_xref="GOA:A0A0H3KXY1"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXY1"
FT                   /protein_id="BAG47282.1"
FT                   /translation="MERSIVGMRCKPLITAALAVAAFGAASGALADQVVKIGSVEPTTG
FT                   GIAHLGKDNENGARLAVEEINAKGLTIGGQKITLQFDPQDDAADPRQATQVAQKLVDDK
FT                   VVAVIGHLNSGTSIPASKIYSDAGIVQISPSATNPTYTQQGFKTTYRVVATDAQQGPAL
FT                   ASYAQSNGVKTVAVVDDSTAYGQGLANEFEKKAKALGLKVLSHDATNDKAVDFRAILTK
FT                   IKGENPDAIMYGGMDATGGPLAKQAKQLGLRAKILSGDGVCTDQLAQLAGPAADNVLCS
FT                   QAGAAIEKMPGGAAFVAKYQKRFNQGIKFDAPFAYDAVYIVVDAMKRANSTDPAKILAA
FT                   MPATKYEGVIGTTTFDSKGDLTHGIISIYGYKGGKKTFLDQVRM"
FT   CDS_pept        complement(102480..103652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05451"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05451"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47283"
FT                   /db_xref="GOA:A0A0H3KPW8"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPW8"
FT                   /protein_id="BAG47283.1"
FT                   /translation="MKRIRSLALLALPASLYAAGAHAQSSVTLYGIVDAGIAYVHNAQN
FT                   ANGSNASNLVKFSSGNLSGSRWGLRGTEDLGGGLAALFQLENGFNIGTGALGQGQREFG
FT                   RKAIVGLSSGTYGTVTLGRQYDPVVDLVQGLTEDNYFGGVFATPGDLDNYDNSLRVSNS
FT                   VKYTSPLIAGFQAEALYGFGGVAGATGSGRTYSFALGYANGPLSLGAGYFFANGGTTTA
FT                   NGIRSWTSSSDTLFNTVINQGFSSAKSIQIVRVAGQYVAGPATFGIAYSNTQYGADTLS
FT                   AFRQTAKFNNGSAFFNWQFSPALRAGVGYNYTSLTGPTSAHYNQVNVGADYALSKRTDL
FT                   YALFGYQKASGHTLDANGARVNATASVGSYGVNSGTDTQELAIVGIRHKF"
FT   CDS_pept        104639..105889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05452"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05452"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47284"
FT                   /db_xref="GOA:A0A0H3KPH4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPH4"
FT                   /protein_id="BAG47284.1"
FT                   /translation="MKANKWDTAYEWKAVTLLALGFGLVGLDRWLIAPLFPSIMKDLNL
FT                   TAQDVGNCIGVLGLSWGIFAALMGGISDKVGRRKVLIPAIVAFSLLSGFSGLASGLLGL
FT                   IAIRGLMGVAEGSFCPTSFAATADASHPRRRGLNLGLQQSGFALFGLALSPIIATQLLE
FT                   FVSWRWVFALVAVPGLVLGAVMFFVIREPERAKAVESEHAPASLGHVLKSRNILVAMAA
FT                   LCCAMTGVFVLGALLPLYLTDYLSLGTQKMGLVVSAIGFGGFFGQFGLPGLSDLVGRRV
FT                   ASIVGFAGTAVMLYLFRGLGPQPVMLFIVLFVASFFTLGLVSLLSGPVATEAAPVGLVS
FT                   TSIGVVVGCGEIFGGGIAPAMGGYVAAHFGIQNILWLPMGAVLLGIVVSTLMRETAPAV
FT                   LQRRVGVQPELTAGKQQ"
FT   CDS_pept        106011..106940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05453"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05453"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47285"
FT                   /db_xref="GOA:A0A0H3KUH8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUH8"
FT                   /protein_id="BAG47285.1"
FT                   /translation="MDRFLSIEAFVRVAEASSFAEAARQLGVTSSVVTNRIQQLEKFVN
FT                   APLFHRSTRHVRLSEVGETFYRECAEVVGRVNELTDQMRELRATPTGRLRIQMLPGFAL
FT                   DHFGVPLAEFNRRYPGIQLDVIVNDRVVDPVEEGFDIAFQIFPPISDSLIERRLFVVRR
FT                   LFCASPAYLEAHGAPQHPRELLQHTTALYSGYPSRNRWTLTRGDEVVEMELPGMIRSNS
FT                   VHLLREYALTGGGVVCLPTLVASDALVAGRLVPILTDFQIAPLSFAAVYPATQRQALKV
FT                   KALVEFLAEYIGDESPWDRPLLERGWVR"
FT   CDS_pept        107055..107549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05454"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47286"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQD2"
FT                   /protein_id="BAG47286.1"
FT                   /translation="MTDTARHTVFGSLDSYTRGEIEITSGSAKHYAFSNIFDIASKSAP
FT                   YEKVVAGKNLEYVIEVLRTEGESPWFACAHDEFAIQMDGEVRIEFIKLHSPPTTGRGTV
FT                   SAGIQPAGREMGYVVLRKGHQALLPAGCAYRFIASKPGVALVQTVLGELSVEKWAEICV
FT                   H"
FT   CDS_pept        107592..108611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05455"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47287"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR040908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXY6"
FT                   /protein_id="BAG47287.1"
FT                   /translation="MATLETLDLSAGFAADLVQATQADAVTGYRRFQLGEFAFQRDEYF
FT                   VKISWPAKGQTRTHAIPADAFLRAMMRDVAWGFFYGWVNFDHVFGTRNHYGKVDVYAGT
FT                   FNGILKEAGVDYTETFETPTIMATFKAMLHDWTNEGFDPFAAPEETGSAFGRKHGENDS
FT                   AIERTRIATRRMPGLEGDSPLREALPVNRAFLDVDQDEPEVHVEPGFEGELHAFNLFKY
FT                   LSRSDVTWNPSVTSVCGRSLFCPTTEEYILPVFHGNDRVEWFLQLSDEIVWDIGDKNTG
FT                   APRARITMRAGDICAMPADIRHQGYSTKRSMLLVWENATPDLPQRYESGELAPYPIEF"
FT   CDS_pept        108644..110110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05456"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Bacillus halodurans"
FT                   /note="KEGG, K00128"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05456"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47288"
FT                   /db_xref="GOA:A0A0H3KPX4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPX4"
FT                   /protein_id="BAG47288.1"
FT                   /translation="MQTQLFIDGRFVDAVDRGTIDVLNPHDGSLIAKIAAATAVDVDAA
FT                   VEAATRAFPTWSALAAADRGRLLLRLADAIEANAEELAQLESLDTGHPIRDSRALDVPR
FT                   TAACFRYFGGMADKLQGSVIPVEPGFLNYVQRAPIGVVGQIVPWNFPLMFTSWKMGPAL
FT                   AAGNTVVLKPSEMTPLSTLRIVELMAEVGFPAGVVNIVPGYGHTAGQRLAEHPGVGKIA
FT                   FTGSTATGRRIVEASQGNLKRVQLELGGKGANIVFDDANLDAAINGAAWAIFHNQGQAC
FT                   IAGSRLILHERIADEFLERFVSLASSIRIGNPLDPDTEMGPLTSKQHLDRVLSFVDVAR
FT                   EQGGRVLAGGSAPQDAALADGYYVRPTVIEAKSAADRIAQEEVFGPFVTVLRFGSDEEA
FT                   LSIANATEYGLGSGLWTNDLSRAHRMASKIDAGMCWINCYKRVNPGSPFGGIGKSGYGR
FT                   EMGFEAMHDYTEARSVWVNVDGNVPPHFKR"
FT   CDS_pept        110118..111185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linF"
FT                   /locus_tag="BMULJ_05457"
FT                   /product="maleylacetate reductase"
FT                   /EC_number="1.3.1.32"
FT                   /note="COG1454: Alcohol dehydrogenase, class IV,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K00217"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05457"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47289"
FT                   /db_xref="GOA:A0A0H3KPH9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR034786"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPH9"
FT                   /protein_id="BAG47289.1"
FT                   /translation="MERFVYQGTPSRVVFEWGALERLPDELNALGVRRALILSTPEQQP
FT                   LAERVSRVLGERAAGVCAQAVMHVPVEVARAACEMAVELGADCCVAIGGGSTIGLGKAI
FT                   ALESSLPIVAVPTTYAGSEMTPIFGLTEDRLKRTGRDARVLPRTVLYDPSLTLSLPPGI
FT                   SAASGVNAMAHAVEALYADDANPVISLMAEESIRALGEALPAIVRAPDDREMRSRALYG
FT                   AWLAGTCLGAVGMALHHKLCHTLGGTFNLPHAQTHAAMLPHTAHYNHAAAPDALRRVAR
FT                   ALGGSDAADAGPLLFELNRQLGLQAALGDLGMPEVGLDEAADLACRNPYANPRPIERAP
FT                   IRELLQHAWEGRAPR"
FT   CDS_pept        111214..112086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05458"
FT                   /product="hydroxyquinol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.37"
FT                   /note="COG3485: Protocatechuate 3,4-dioxygenase beta
FT                   subunit, Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K04098"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05458"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47290"
FT                   /db_xref="GOA:A0A0H3KUI2"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUI2"
FT                   /protein_id="BAG47290.1"
FT                   /translation="MTNDHDDGDTRLTEQVVASFDGAPNPRVRMLMQSLVRHLHAFVRE
FT                   TELTEAEWMAAIRFLTETGQMCDDVVRQEFILLSDTLGVSMLVDAINHRLATGATETTV
FT                   FGPFYIEGMPDRAYGENMALTSGTPALVHGRVLTTDGAPLPDAVLDVWQTADNGMYSGQ
FT                   DPAQPHGNLRGRYRTDAQGHYAITTILPVSYPIPTDGPVGKMLDATGRHPWRPAHLHFM
FT                   IDAPGYRRLVTHLFDEEDAYLQSDAVFGVKPSLMVAYRRREAGDELARRFGISGAYREA
FT                   TYDFVLDRS"
FT   CDS_pept        112092..112403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05459"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47291"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQD7"
FT                   /protein_id="BAG47291.1"
FT                   /translation="MARFFAVFATDQPGMRDVRDRVRPTHRSYLRSAAQHGVYVRLGGP
FT                   TLDPQGDAMNGTLLVIEADDIDAVMRFVGNDPYVKEGLFSRVDVRPWDWSLGNPERRV"
FT   CDS_pept        112406..112741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05460"
FT                   /product="putative 4-nitrocatechol monooxygenase ferridoxin
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47292"
FT                   /db_xref="GOA:A0A0H3KXZ2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXZ2"
FT                   /protein_id="BAG47292.1"
FT                   /translation="MGATQLCRFSDVPDGGARVVDEARSGRSVIVVRRGPQVWAYVNRC
FT                   PHFSVPLDFVPGNVSCYRSQVLMCAHHSALFRFDDGMCIDGPCAGAGLEAVPVEVDPAA
FT                   WVICRNA"
FT   CDS_pept        112967..114055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05461"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05461"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47293"
FT                   /db_xref="GOA:A0A0H3KPX8"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPX8"
FT                   /protein_id="BAG47293.1"
FT                   /translation="MKLRFGVVAMLAIAPGAYAQSSVTLFGLIDSGISYVSNEGGGKNV
FT                   KFDDGIFTPNLFGLRGTEDLGGGYHATFALVNQFSMANGSIVGTGLFARNAYVGIESER
FT                   FGSVRLGNQYDFMVDSLFAKGNAISMDITGLYGFRNGPFQRLALPNNPTGAFDWDRTAG
FT                   SKPVANSVKYSSPTIGGLSGGVMYAFGGVAGSVGANNTVSVGLNYEAGALGIGAAYTNE
FT                   KYGSTPGTPSTSVRNWGVGMHYDFGAVTAKALLTTVRNSFNEAGVWMAEAGAVWRIRPD
FT                   VFLGAKYMYMKGNEAVNDNHAHQVSGALQYLLSKRTMVYVSADYQRANSGANAQINGVL
FT                   DPNGASGSASQAVARIGVHTMF"
FT   CDS_pept        complement(114273..116126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05462"
FT                   /product="ATP-binding cassette"
FT                   /note="COG1132: ABC-type multidrug transport system, ATPase
FT                   and permease components, Pasteurella multocida"
FT                   /note="KEGG, K06147"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05462"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47294"
FT                   /db_xref="GOA:A0A0H3KPI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPI3"
FT                   /protein_id="BAG47294.1"
FT                   /translation="MYSWFERRLPTFPLEEPATPPNGFFSFVWACTQGARGWILLIALT
FT                   SAALAAYEAALFAMMGRVVDWLSSATPATFGELHFGTLAGFAAILAGSVVLIALHTMVK
FT                   HQVLAINFPMRLRWLFHRLMLEQSLSFYANEFAGRVTTKIMQTALAVRDALFMSVDVVI
FT                   GVAAYLLGILALAASFDWRLMIPLALWALGYGAACAYFVPRLGRVGSEQADARALMTGR
FT                   ITDAYSNITTVKLFSHTRREADHARRAMEAFKVTGDAQMRLVSAFEIVNHLLSTALLVG
FT                   STGLAVALWMHGEASAGVVAAVIAMALRLSSYSHWIMWEMTELFENVGTIQDGITTLTR
FT                   VRSVVDARDARPLVVSRGEIVFDNVRFAHDDNEKPVFDGLNLTIRPGERIGLIGRSGAG
FT                   KSTLVNLLLRFYDVDGGAIRIDGQDIAHVTQDSLRAAIGMVTQDTSLLHRTMRENILYG
FT                   RPDATEREMRAAAERAEASEFIERLRDRHGRSGYDVEVGERGVKLSGGQRQRVAIARVM
FT                   LKDAPILVLDEATSALDSEVEVAIQRSLDSLMMGKTVIAIAHRLSTIAAMDRLIVLDEG
FT                   RIVEEGTHQQLLQAGGIYAALWAHQSGGFLGETADEAAPAQ"
FT   CDS_pept        116405..116971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05463"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05463"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47295"
FT                   /db_xref="GOA:A0A0H3KUI9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUI9"
FT                   /protein_id="BAG47295.1"
FT                   /translation="METKPTVREQILDHAITLMMLRGYNGFSYRDLSDLVGVKTSSIHY
FT                   YFPSKDDLVLEAVAAYSDEVLAAMRAIDPSLPADVKLSLYTKLFGRALGDGDRICLCGM
FT                   LAADIESLPDNVRQAVQAFFQANERWLAELLAQGAKEGTLSFSGKPDAAARALYAAFQG
FT                   SVLASRLFHTRARLEDVEAVWKTRA"
FT   CDS_pept        117204..117629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05464"
FT                   /product="regulator of disulfide bond formation"
FT                   /note="COG1764: Predicted redox protein, regulator of
FT                   disulfide bond formation, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05464"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47296"
FT                   /db_xref="GOA:A0A0H3KQE1"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQE1"
FT                   /protein_id="BAG47296.1"
FT                   /translation="MSIEKVLYRAHAKATGGRDGRATVPESNLDLKLTTPRELGGAGGA
FT                   GANPEQLFAAGYSACFIGAMKFVAARDKIAMPADASIEGSVGIGAIPNGFGIEVELKIS
FT                   LPGLEREVAQTLIERAHIVCPYSNATRGNIDVTLTLV"
FT   CDS_pept        117689..118723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="BMULJ_05465"
FT                   /product="esterase / lipase"
FT                   /EC_number="3.1.1.-"
FT                   /note="COG0657: Esterase/lipase, Ralstonia solanacearum"
FT                   /note="KEGG, K01066"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05465"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47297"
FT                   /db_xref="GOA:A0A0H3KXZ7"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KXZ7"
FT                   /protein_id="BAG47297.1"
FT                   /translation="MKIVKPLLIAAAVAALSSAIPAALAAGPDTVRPDATTSAFLAALN
FT                   AQKGPGLETLSPAKARQVLVDAQNGVKVDLSGIDVSNRTIEQDGLSVPITIVRPQHATG
FT                   TPPVFMFFHGGGWVLGDFPTHERLVRDLVVQSGAVAVFVNYTPSPEARYPVAINQAYAA
FT                   TKWVAAHGAEIGVDGSRLAVVGNSVGGNMAAVVALMAKDKGGPAIRFQGLLWPVTDHDF
FT                   DTGSYRAYQQGHFLTRPMMKWFWDAYTKNEAQRNEIYASPLRASVAQLKGLPPALIQVA
FT                   QFDVLRDEGEAYGRKLDAAGVEATTTRYDGTIHDFGLLNALATDAPTQAALKAMANEIA
FT                   TRLK"
FT   CDS_pept        119177..120235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linF"
FT                   /locus_tag="BMULJ_05466"
FT                   /product="maleylacetate reductase"
FT                   /EC_number="1.3.1.32"
FT                   /note="COG1454: Alcohol dehydrogenase, class IV,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K00217"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05466"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47298"
FT                   /db_xref="GOA:A0A0H3KPY1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR034786"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPY1"
FT                   /protein_id="BAG47298.1"
FT                   /translation="MHSFVYNGLPSRVIFGAGSLAQLPQEIERLGATRAIVLSTPPQRA
FT                   QAEALAHRLGARAAGVFAEAVMHVPNETARAARAFAAQVDADCAIAIGGASTTGLGKAI
FT                   ALDSGLPIVAVPTTYAGSEMTPIYGLTEGGVKKTGRDLRVLPKAVIYDPDLTLSLPVAL
FT                   SVTSGINAIAHAAEGLYAPDANPVVSLMAEQGIRALAGGLPRIVHDAHDADARADCLYG
FT                   AWLCGAVLGSVGMALHHKLCHTLGGTLNLPHAETHTIVLPHALAYNRDAAPAAMRRIAA
FT                   ALGADDAARGVFDLARASGVPVALKDIGMDEADIERVLDLALRNPYWNPRPPERASLRA
FT                   LLEDAYAGRRPA"
FT   CDS_pept        120579..120950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgA"
FT                   /locus_tag="BMULJ_05467"
FT                   /product="holin-like protein"
FT                   /note="COG1380: Putative effector of murein hydrolase LrgA,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K05338"
FT                   /note="LrgA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05467"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47299"
FT                   /db_xref="GOA:A0A0H3KPI7"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPI7"
FT                   /protein_id="BAG47299.1"
FT                   /translation="MLQAFAVLLTFQCLGEGVSYLFGLPVPGPVIGMLLLFGFAMLRPQ
FT                   VADAIEPTALELLRHLSLLFVPAGVGIMVSAGRVRGDAVAVVVALVVSTTLAIAVTALV
FT                   TRALLRRQQRAAGTAEGTR"
FT   CDS_pept        120947..121681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgB"
FT                   /locus_tag="BMULJ_05468"
FT                   /product="holin-like protein"
FT                   /note="COG1346: Putative effector of murein hydrolase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K05339"
FT                   /note="LrgB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05468"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47300"
FT                   /db_xref="GOA:A0A0H3KUJ3"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUJ3"
FT                   /protein_id="BAG47300.1"
FT                   /translation="MTAFPKLGAIWVYLAASPLLGLTITLIAYLVAQAVYARARFNPLA
FT                   NPVLIAVALIVALLTLTRTPYPTYFEGAQFVHFLLGPATVALALPLYRQWAKLRRAAVP
FT                   LLIGLVAGSLTAIVSAVGIAALLGASHQTIASLAPKSATTPIAMAVAAEIGGIPSLTAV
FT                   LVISTGILGAVCARSILNALRIEEPAVRGFALGVASHGIGTARAFQVSEEAGAFAGLGM
FT                   GLNGVLTAFVVPILLPIVSRWL"
FT   CDS_pept        121899..122207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05469"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQE7"
FT                   /protein_id="BAG47301.1"
FT                   /translation="MKQSRVVSVVVAVTASFGLLLTGAPAAWAQDTTAASAPTQKQLDK
FT                   AKKKAARKAARERHAKDLKAIGTGSGYRLTNDQSNYPQNAVQKAPANAAPAAPASGQ"
FT   CDS_pept        complement(122306..122908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="BMULJ_05470"
FT                   /product="Trp repressor-binding protein"
FT                   /note="COG0655: Multimeric flavodoxin WrbA, Salmonella
FT                   typhimurium LT2"
FT                   /note="KEGG, K03809"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47302"
FT                   /db_xref="GOA:A9AT43"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AT43"
FT                   /protein_id="BAG47302.1"
FT                   /translation="MAKVLVLYYSSYGHVETMAQQVAEGAKSVPGVEVTLKRVPETIPA
FT                   DQAKAIGIKTDQAAPVATVDELADYDAILFGTPTRFGNMAGQMRTFLDQTGGLWMKGAL
FT                   VGKIGSVFASTGTQHGGQETTITSFHTTLLHHGMVIVGVPYACSGLVNMNEITGGTPYG
FT                   ATTLAGADGSRQPSANELDIARYQGKHVAELAVKLAS"
FT   CDS_pept        complement(122971..123696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05471"
FT                   /product="putative chromosome condensation protein"
FT                   /note="COG1741: Pirin-related protein, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06911"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05471"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47303"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY04"
FT                   /protein_id="BAG47303.1"
FT                   /translation="MIDIRAANQRGRAEHGWLSSRHTFSFANYFDPQQVGFSDLLVIND
FT                   DRVAPARGFGTHPHRDMEILSYVLEGALEHKDSMGTGSVIVPGDVQLMSAGTGVRHSEF
FT                   NHSPDAPVHFLQIWVGPAEKGAAPRYQQTHVAADDKRGKLALVVSPDGAAGSLKIRQDT
FT                   RIYAGLFDGDERATLELAPDRFAYVHVARGSVTVNGVTLGEGDGARIRGEQALTFADGH
FT                   DAEVLVFDLRPIEVTAEWA"
FT   CDS_pept        123824..124708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05472"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Sinorhizobium
FT                   meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05472"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47304"
FT                   /db_xref="GOA:A0A0H3KPY8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPY8"
FT                   /protein_id="BAG47304.1"
FT                   /translation="MELNDLRIFVATVDAGSFTAAADQLMLSKQFVSRRTMALEASLGV
FT                   RLLHRNTRNLAVTESGQEFYARAQRILAEVADAEQAMSVRSTELHGSLKISAPLSFGIT
FT                   HVSPLIAEFLSAHPAVRLNLDLTDRRVDVIGEGFDLVLRIGALEDSTLIARALGAWKMI
FT                   ACASPAYLKRHGTPATPAELANHTCLLYGRERRVGWEFRVDGAPRTFDVQGPLVANNGE
FT                   VVRDAAIAGLGIALLPSFIVGAALDGGALVPVLDAYAPAPITLNAVFPQHREGFVTLRT
FT                   FIGFLAERLGPRA"
FT   CDS_pept        124908..125102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05473"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47305"
FT                   /db_xref="GOA:A0A0H3KPJ0"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPJ0"
FT                   /protein_id="BAG47305.1"
FT                   /translation="MLRYLIGIGIPYLGVMGVLPWVASQDRYVFGVPFLFMWIFAWFVL
FT                   TSGCLFACWMLFDRHTPGA"
FT   CDS_pept        125181..126575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05474"
FT                   /product="Na+/solute symporter"
FT                   /note="COG0591: Na+/proline symporter, Thermoplasma
FT                   volcanium"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05474"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47306"
FT                   /db_xref="GOA:A0A0H3KUJ7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUJ7"
FT                   /protein_id="BAG47306.1"
FT                   /translation="MSTVVFAALIALSLYLAYRSRRGHGKQSVHDFFVASGQFGTALLF
FT                   FLTAGEIYSIGTMVGFPGGIYAKGPTYGVWFLGYILLAYPIGYFIGPKIWEAGRRHHAI
FT                   TLADLFKGHYGSRALELMVALASILFLIPWGQMQFTGLAAALKGLGWHVDPLYLILVCA
FT                   ALAFTYIAMSGVRASAYIAILKDILMLLAIVVTGTAVALKVGSVHPVFEAASRHVSNTM
FT                   TAPQLRFSMSTMLYQSLGFYIMPFAVQGFFTARGPNTIRRTQVAMPLYMLMYPFLVVAS
FT                   YYAISANLKLASPNDAFFAAVVHLLPGWLIGLVAAGAALSGLLVLAGICLAIGPIVTRN
FT                   LMPNLPETRQKRAAKYVIVGYLLLSIATTMLTPNLMLTLISTTFYGIAQFLPGVLILLA
FT                   GRRVRPVAVASGMLCGQALAMLFYLLHVDFGGINLGLVCLVINMLVVAAVHATLRGRPV
FT                   KHYAVS"
FT   CDS_pept        126612..128279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05475"
FT                   /product="amidohydrolase-like protein"
FT                   /note="COG1574: Predicted metal-dependent hydrolase with
FT                   the TIM-barrel fold, Mycobacterium tuberculosis CDC1551"
FT                   /note="KEGG, K07047"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05475"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47307"
FT                   /db_xref="GOA:A0A0H3KQF4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQF4"
FT                   /protein_id="BAG47307.1"
FT                   /translation="MQAFASSDARVTIFAARRILTMNPAQPAATHVAVRDGRILAVGDA
FT                   DDAAAWHTRFGACATDDTLRDRVLMPGFVEGHCHLMEGAMWDAVYVGYYDRRGPDGTLW
FT                   PGLRSLDAVLDRLAQAERAMTDDGPLLAWGFDPIFFGTSRLTVRELDRVSARRPIVILH
FT                   ASVHLMNVNGAMLAQAGIDEDTDIDGISRDADGRPTGELQEFAAMFPVYQAIGSKLAIS
FT                   AGEQPHAIRNFGRVAQLAGVTTATDLVNDLSPAGNRTLRDVTGDVDYPVRIVPAFAPQR
FT                   SPARSADSVLAEVARNTDKLRFGAVKFIVDGSIQGFTARVRWPGYAGGQPNGLWLIPPA
FT                   QLVDVFAPFHRAGLQLHIHTNGDEATEVVLDAMTTLLARDPRPDHRHTLQHCQMADAAQ
FT                   LARIRALGMCVNFFANHLYYWGDAHYAQTIGPDRANRMDAAGSAQRLGIPYALHSDAPI
FT                   TPLNPLFTAWCAVQRETASGRVLGEHERISVDDALRAITLGAAYTLKMDHLVGSIEVGK
FT                   FADFAVLDDDPSRVAPARLKDVRVWGTVLGGRVFRAPQ"
FT   CDS_pept        128276..129268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05476"
FT                   /product="cobalamin biosynthesis protein"
FT                   /note="COG0523: Putative GTPases (G3E family),
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05476"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47308"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY08"
FT                   /protein_id="BAG47308.1"
FT                   /translation="MNAAAAPIDLAVVGGYLGAGKTTVVNAILQAPHGRRIAVLVNDFG
FT                   AVNIDARLVRARGDDVIELDNGCICCTIGGALVDALTRVAARDARPELLLVEASGVADP
FT                   AKIAQIGMLNGAFRLTSVLVVADAIALYDTLADPHVGAIAQRQLDGASALVVTKLDLLA
FT                   PPQRDAALARVRARASTDIVVAASHGAIPLALLFDAAVPDRRATLRIARGHRPLGSDAM
FT                   PALASVTIVPPQVLDKARLRAWLKALPRTILRAKGIVRVADGDDVALRVCQVAARRVRF
FT                   TPHESQAEADRRCAMVFIGILDADTVAALHDGLAQCRASGVAASPSAVD"
FT   CDS_pept        129406..130335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="BMULJ_05477"
FT                   /product="taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="COG2175: Probable taurine catabolism dioxygenase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K03119"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05477"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47309"
FT                   /db_xref="GOA:A0A0H3KPZ4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPZ4"
FT                   /protein_id="BAG47309.1"
FT                   /translation="MTTTATRDAAPDAVVPPPVSPASAAPQRFEIVPFDAPLGAEVVGI
FT                   DLSQPLDADAFARIRRAHLDHHVLVFRDQRITPDEHVAFSRRFGPLQTHVLHQFALPGH
FT                   PEVLIVSNIVENGKPIGLGDAGYFWHSDLSYKRRPSLGSLLHAQELPAEGGDTLFANMH
FT                   LAWDTLPEALRRAVEGRRAEHTYLARYAELQARSPWRPNLSAEQIAQVEPVVHPVVRTH
FT                   PETGRRALFVSEHFTTRIVGLPDDESRALLDELFAHSVRAEHQYRHRWRDHDLVFWDNR
FT                   SLLHLAAGTPDHLRRKLYRTTIEGDEPF"
FT   CDS_pept        130388..131443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuA"
FT                   /locus_tag="BMULJ_05478"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   substrate-binding protein"
FT                   /note="COG0715: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems, periplasmic components, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K02051"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05478"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPK1"
FT                   /protein_id="BAG47310.1"
FT                   /translation="MSFSFLSALTGAASRPRRALAATLAAALAFAGVAAPQAAHAEGRI
FT                   RIAEQFGVVYLMLNVARDQQLIEKEGRKAGLDIKVDWVRLSGGAAVDDALLSGAVDIAG
FT                   AGVGPLLTVWDRTRGRQNVKGVASLGNFPYYLVSTNPNVRTIADLSAKDRIAVPAVGVS
FT                   VQSRVLQYAAAKQWGDRQFDRLDALTQAIPHPDATAAIVANSNVITGHFGNPPFQEQEL
FT                   AGNPNAHVVLNSYDVLGGPSSATVLYATEAFRRDNPKTYRAFVAALADAAQQIAADPER
FT                   AADVYIRANGSKIDRALLLKILRNPQVQFKIAPQNTLRLAQFMYRTGAIRHEPTSWRDY
FT                   FFDDPATAGGS"
FT   CDS_pept        131596..132522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="BMULJ_05479"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   ATP-binding protein"
FT                   /note="COG1116: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, ATPase component, Pseudomonas aeruginosa"
FT                   /note="KEGG, K02049"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05479"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47311"
FT                   /db_xref="GOA:A0A0H3KUK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUK2"
FT                   /protein_id="BAG47311.1"
FT                   /translation="MNAPSSRTWLPPFAARDRASSDTGTAASASASRDAHRAAPQAAPS
FT                   AAHSARLLAVDRVTLEYRTGTRIVRATQQVSFDVYGGDRFVLLGPSGCGKSTLLKAIAG
FT                   FVEPVAGTISLDGAPVHGPGPDRVVVFQEFDQLPPWKTVVENVAFPLRVAAKLTRAEAR
FT                   ERALHYLDKVGLSTFADAYPHTLSGGMKQRVAIARALAMQPRVLLMDEPFAALDALTRR
FT                   KMQEELLRLWDDARFTLLFVTHSIEEALVVGNRILLLSPHPGRVRAELNSHAYGLDSVG
FT                   SGDFRASVARIHRLLFDTDTPQTEEAA"
FT   CDS_pept        132522..133400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="BMULJ_05480"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   permease protein"
FT                   /note="COG0600: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, permease component, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K02050"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47312"
FT                   /db_xref="GOA:A0A0H3KQG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQG2"
FT                   /protein_id="BAG47312.1"
FT                   /translation="MRPFDPVLPPVRAEYERELEPPRDAERAAPLPLVRRVADAAWFRR
FT                   AAIAFVLIAAWELVARVVANDLLVPTFSATLAAFVDGIVSGELLVKTGISMSVLLRGYA
FT                   LGVLLAFVLTSVAVSTRFGRDLLTMLTSMFNPLPSIALLPIALLWFGLGTGSLLFVLVH
FT                   AVLWPLAVNMYTGFVGVPATLRMAGRNYGLTGLRQVLLILVPAALPSILSGLRVGWAFA
FT                   WRTLIAAELVFGASAGQGGLGWYIFQNRNELYTDRVFAGLAAVIVIGLLVEHLVFDTLE
FT                   RVTVRRWGVQH"
FT   CDS_pept        133840..134253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05481"
FT                   /product="DoxX family membrane protein"
FT                   /note="COG2259: Predicted membrane protein, Escherichia
FT                   coli O157:H7"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05481"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47313"
FT                   /db_xref="GOA:A0A0H3KY12"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY12"
FT                   /protein_id="BAG47313.1"
FT                   /translation="MRYLSLESKKDELLLAARVLLMILFVLFGWQKLTGFAGTVAYMAS
FT                   TGSPSPELSAAIAVGVELVGGVLIAIGFYTRPLALAFSVYTLATAFIGHRYWSLQGMDQ
FT                   YLAMINFYKNISIVGAFLLLALTGPGRYSVDRQ"
FT   CDS_pept        134383..135384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="BMULJ_05482"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="COG1091: dTDP-4-dehydrorhamnose reductase, Aeropyrum
FT                   pernix"
FT                   /note="KEGG, K00067"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05482"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47314"
FT                   /db_xref="GOA:A0A0H3KQ02"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ02"
FT                   /protein_id="BAG47314.1"
FT                   /translation="MTAASPSSRPATVLVIGASGLLGRAVVASLARDPAFATIATIRNR
FT                   DTRGARLLALPPDKIAILDVLDRPALERAFDLYRPAAVVVCAAERRPNVCERDPAGARA
FT                   INVDAPARIGALAARYGAWTLGISTDYVFDGRAAPYREDATPNPLNVYGRTKLEGEAAL
FT                   LAASPLSCVLRLPLLYGPIADWSESAVTSLVPAIVASARAGADAVGMDAWAIRYPTYTP
FT                   DVAAVIRDLLHRHLAGASVLGIRHWSGDEAMTKYEIAQRIADALGLRASLAPIDTPADA
FT                   TPRPYDCHLDAAQLHALGIHHATPFDTALREVLRDAPPLPSLPSPSTAPHKS"
FT   CDS_pept        135642..135971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05483"
FT                   /product="putative histone-like nucleoid-structuring
FT                   protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05483"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47315"
FT                   /db_xref="GOA:A0A0H3KPM8"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPM8"
FT                   /protein_id="BAG47315.1"
FT                   /translation="MTQALRDLEAQLRDLNIKLSEAKQKEKQAALAAFKQQVELYGITQ
FT                   QEVLSALGYIVQRKRKAPAKYYDPTTGRSWSGRGPKPKWLEGKDLDSLLVDREAKTWWP
FT                   GDDQG"
FT   CDS_pept        136174..137421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05484"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05484"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47316"
FT                   /db_xref="GOA:A0A0H3KUK7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUK7"
FT                   /protein_id="BAG47316.1"
FT                   /translation="MAADLPSSTLGDSSTPPVQQVGPYAWKALAGSAIGYAMDGFDLLI
FT                   LGFMLPAITAALQLTPGEGGALVTWTLIGAVAGGILFGALSDRYGRVRVLTWTIMLFAI
FT                   FTALCAFARGFWDLLVYRTVAGIGLGGEFGIGMALAAEAWPANRRARVSCYVALGWQVG
FT                   VLLAALLTPWLLVHIGWRGMFVVGVVPALLAWVLRNRLHEPEVFVQRAAQPASNAFRML
FT                   VADGRTARTSAGIVILCAVQNFGYYGIMIWLPTFLSKQLGFSLTKSGLWTAATVVGMML
FT                   GVWVFGQLADRIGRKPTFLIYQLGSVATVIAYAQLSNPTAMLWAGALMGMFVNGMVGGY
FT                   GTLMSEGYPTAARATAQNVLWNIGRAIGGLGPMTVGALAARYSFQTAIALLAGLYVLDM
FT                   VATVFLIPELKGVELE"
FT   CDS_pept        complement(137432..138691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05485"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Yersinia pestis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05485"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47317"
FT                   /db_xref="GOA:A0A0H3KQG7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQG7"
FT                   /protein_id="BAG47317.1"
FT                   /translation="MDSNDLPNLACLYAVQRVADTGSVSRAAAALFRAQSAVTRAVQEV
FT                   EAALGEPLFDRKPSGMLATPVGRAVLKRSERVFAELGELANWCALRQSRRRAPGEGGLP
FT                   AYLLNTRRLQLFSTLARHRHMPSAARALGVTQPAVSSAIRILESGAGFALFHRHPRGLL
FT                   LTADGETFLLHVRRALNELRHVADDVAALHGSIQGVVTVGALPLGRTLILPEAVARVVT
FT                   RFPKVRVITDESAYEALVAGVRAGDIDFILGALRANDAAGDLENERLMSENLVVLARRD
FT                   HPLARVRNLGLRSLAAAQWILPRSHAPARGLFDALFRRMKLKPPMPTVESADLAVIRGL
FT                   LLHSDMLAVLSAQQLHYECESGLLAVLDVPMHDTTRDIGLITRSGSPPSPAARALIDAI
FT                   RVVATDIARGPRIVAREAAH"
FT   CDS_pept        139242..140546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligB"
FT                   /locus_tag="BMULJ_05486"
FT                   /product="protocatechuate 4,5-dioxygenase beta chain"
FT                   /EC_number="1.13.11.8"
FT                   /note="KEGG, K04101"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05486"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47318"
FT                   /db_xref="GOA:A0A0H3KY16"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR034939"
FT                   /db_xref="InterPro:IPR034940"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY16"
FT                   /protein_id="BAG47318.1"
FT                   /translation="MARIIGGIAASHTPTIGFAFDKNKRDDPVWAPIFENFAPLAAWLD
FT                   AQRPDVLLFIYNDHVTSFFFDHYSAFALGVGPQWHPADEGGGARDLPPIAGDPAFAAHI
FT                   GQSLMADEFDMSFFQNKPLDHGCFSPLSVLCPHRPDWPVRLVPLQMGVLQLPVPSARRF
FT                   YRLGQALRRAIESYPEDLRVAIVATGGLSHQVHGERAGFNDPEWDRRFLDLFERDPERL
FT                   AGMTLAEYATLGGFEGAEVVMWLTMRGALPAGVVCRHRSYYLPSMTGIATAIYESADPD
FT                   VDTAAVERHRRRIAAELDGVERLPGTYPFTIARAVRAYRINDYLHRMIEPAHRAQFLAD
FT                   PEASFAAAGLSDEERDLIRRRDWAGLLRYGVIFFLLEKLGAVTGVSNLHIYAAMRGESL
FT                   EDFQRTRNAPGALYSVAGKSAGPLGWDAGTEGNES"
FT   CDS_pept        140671..142020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05487"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05487"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47319"
FT                   /db_xref="GOA:A0A0H3KQ07"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ07"
FT                   /protein_id="BAG47319.1"
FT                   /translation="MASGKTIDIKSFIDDRPVSRYQWLLVALCCLVVIADGMDVAIMGF
FT                   VAPSVIRDWAISRPEFGLVMSAAPIGLVIGALVAGPSADRFGRKRVLIASVLLFGLFTI
FT                   ATAYAGSPVQMAVLRLLTGIGLGAAMPNTTTLLSEYAPQRMRSLMITIMFTGFNLGSAL
FT                   IGFVAGWLIPLHGWRAVLLFGGALPLLLIPLQLWLLPESARLLAVRGAPSQRIGALLNR
FT                   VCGARFDGNETFVSNEPPLPTRKPIGVLFSQGYGVVTVSLWITYFMGLLVIYLLTGWLP
FT                   TLIKDAGLSVSTAANVTAMFQIGGTIGAIGVGWLMDKVRPAPVIGAAYLGGALCVAVLA
FT                   WAGALSSSLALLVFAAGFCMSGAQTGLNAYAPGRYPTVARATGVSWMLGMGRFGSIFGS
FT                   AIGGALLGLGWKFDAILSMLAVPATLAAIAIVTTQRAAAPEPKEMEKPAH"
FT   CDS_pept        142107..143132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05488"
FT                   /product="putative amidohydrolase 2,4-Oxalomesaconate
FT                   hydratase"
FT                   /note="KEGG, K07045"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05488"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47320"
FT                   /db_xref="GOA:A0A0H3KPQ2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPQ2"
FT                   /protein_id="BAG47320.1"
FT                   /translation="MIIDIHGHYTTAPKALETWRNRQIAAIHSPSERPKVAELNISDDE
FT                   LRESLEPNQLRLMRERGLDLTIFSPRASFMAHHIGDFDVSSTWAAVCNELCYRVHRLYP
FT                   DRFVPAAMLPQSPGVDVATCIPELVRCVEAYGNVAVNLNPDPSGGHWTSPPLSDRYWYP
FT                   LYEKMVEYDIPAMIHVSTSCNACFHTTGAHYLNADTTAFMQCLTSDLFKDFPTLRFVIP
FT                   HGGGAVPYHWGRFRGLAQELKKPLLTEHLLNNVFFDTCVYHQPGIDLLTGVIPVDNILF
FT                   ASEMIGAVRGIDPETGHYYDDTKRYIEASALDAQARYKIYEGNARRVYPRLDAQLKAKG
FT                   K"
FT   CDS_pept        143135..143818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05489"
FT                   /product="putative 4-hydroxy-4-methyl-2-oxoglutarate
FT                   aldolase"
FT                   /note="COG0684: Demethylmenaquinone methyltransferase,
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05489"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47321"
FT                   /db_xref="GOA:A0A0H3KUL0"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR014165"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUL0"
FT                   /protein_id="BAG47321.1"
FT                   /translation="MNELGVVYRTIDRADAQVAARLGELGAATVHEAMGRTGLMKPYMR
FT                   PIYPRAHASGTAVTVLLHPGDNWMMHVAAEQIRPGDVVVAAITADCTDGYFGDLLATSF
FT                   KARGAHALIIDAGVRDVAVLEAMQFPVWSKAISAKGTIKATLGSVNVPVVCAGALVHPG
FT                   DVIVADDDGVVAVPAAQAADVLDKALAREANEAKKRETLASGVLGLDMYDMREPLRQAG
FT                   LRYID"
FT   CDS_pept        143832..144539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="BMULJ_05490"
FT                   /product="molybdate transport system substrate-binding
FT                   protein"
FT                   /note="COG0725: ABC-type molybdate transport system,
FT                   periplasmic component, Yersinia pestis"
FT                   /note="KEGG, K02020"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQH2"
FT                   /protein_id="BAG47322.1"
FT                   /translation="MAHGPRTPAAIAGISSMATRSLLARLVECYAYDTGGRVDVTSIGG
FT                   VDAARRVQAGEPFDFVVLAADAIERLAVEGRVDMEGRVDVARSAIAVAVPAGTPRPDLG
FT                   TEAAVRDAVLRARRIGYSTGPSGVHLNRLFARWGIADALASRIVQAPPGVPVGSLIASG
FT                   DVELGFQQLSELANVDGIDVAGLLPDTIQSITVFAAAVCTAAREPASAAQFLAYLASPH
FT                   NDAAKRACGMEPA"
FT   CDS_pept        144774..146594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05491"
FT                   /product="putative feruloyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05491"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47323"
FT                   /db_xref="GOA:A0A0H3KY20"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY20"
FT                   /protein_id="BAG47323.1"
FT                   /translation="METNGNAVCARRTTGRETGSGTERLLRRLAIAIGWLCAVMLGWPL
FT                   VASAANAASSGGLANLPAVMPAMSCQAIASLDLSGVTDGPVTITSATVLPAGTVVGNNT
FT                   LPAPMCDVKGTIGPGASLFELQLPTQGWTQRYLQTGCGGLCGNLSVNAPMASTCVPVTN
FT                   GTIAMAATDMGHEGGNDGAWALDPRAKLDFAYRAEHATAQVAKAIIQRFYARPARYAYF
FT                   DGCSDGGREALMEAQRYPDDFDGIAAGAPANDLIVQNTFHHAWPAAVNTDPKTGNAILL
FT                   AGKLPMLHAAVLKACDALDGVVDGVIDNPRACRFDPATLVCATGQADATCLTPQEAAVV
FT                   RRLHDGATTADGLRLEPFVSREWGSELNWTLFVPATATAQSGTIGFVLPFLRYLDYYNA
FT                   SYPSATIGDLKFTLAGFLKTVVPASNYLAATDPDLSRFAGRNGKLLLWHGLEDQHISPR
FT                   SSIEYYEAMKRYMGDATVDRFARFYLFPGVAHCGGGQGPNVFDVLTPLMAWTETGATPG
FT                   RIVASIVDASGNTTRTRPVFPYPATARYTGSGSTDDAANFVADTPKADPFVDLHWAGEW
FT                   LYSPGYEATCRVSGSQLACTGGNGWRAYRP"
FT   CDS_pept        146668..147885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05492"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05492"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47324"
FT                   /db_xref="GOA:A0A0H3KQ13"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ13"
FT                   /protein_id="BAG47324.1"
FT                   /translation="MKKQAWRTALTSGVAFAVAAPAFAQSSVTLYGIVDNGIGYQSSAT
FT                   TVGSTSGGKSLVKMNQGVWAGSRFGLKGTEDLGGGTKAIFTLESGFNSGTGAAQYTDAM
FT                   FGRQAWVGLTNATYGTLTAGRQYASYYQTMAPFSPITWITGYYGAHPGDVDGLDTIYRA
FT                   NNTIEYTSPKWYGLTLSGSYSLGGVAGSTNAGSTWATGIQYAAGPLGVGVAFERINNSN
FT                   TAGGTWGANSTTSNGGSQIGVSAVTNGYQTAKAQQRFAVGLSYRFSDAWDATATYTNTQ
FT                   YIPGAASKFFNTAIFNTAGAVLHWKPSAVWDFGAGYAYTRATESNGITDSAQYHQFNLS
FT                   QYYSLSKRTGLYLLEAYQHAKGKTLGTNGAGNIVNATATLGDGLNTAPSSTGNQFAFGA
FT                   GIIHRF"
FT   CDS_pept        complement(147988..149076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05493"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05493"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47325"
FT                   /db_xref="GOA:A0A0H3KPT3"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPT3"
FT                   /protein_id="BAG47325.1"
FT                   /translation="MKILPRTLLIAGCGVSLVSLAHAQSSALTLWGQVDSGITYISNKR
FT                   GGASWGTASGIGSPTRWGLRGNEELGGGYRAVFALESGFNVNTGALIKTNTLFDRQAYV
FT                   GLDGPLGTLTLGRQSDLMDDVAIRYSNAFWNRSLYSFHAGNLDSLTNGYQIENAVKYRS
FT                   PDWYGVRVGALYGFAGSDASGHSAGAYATYDRGPLSAGVTYMTTKRRVLDLYNYFGWTR
FT                   FLGQTLSAQQTFQSNAVDNLGIGLTYRIVQPWTINLLYTRTDIKGARSATHMQNIDAGT
FT                   LYQFTAAEAVTLDYTYSRMEGMHWNTLEAGNLYSLSKRTQVQATLTWQLASGNGATAAT
FT                   YPNGPSSGRSQLLAHVGITHSF"
FT   CDS_pept        149257..150660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05494"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Escherichia coli K12"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05494"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47326"
FT                   /db_xref="GOA:A0A0H3KUL3"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUL3"
FT                   /protein_id="BAG47326.1"
FT                   /translation="MSIHGHSTTKPTPPTRDDRMPDTAARKPTRVRFLMLFLVFVGTVV
FT                   NYVDRANLSVAAPLLKHEFGLDPVAIGVLFSAYSWTYVLANLPGGWVVDRFGSRAMYAL
FT                   ALLIWSSFTFLQGFAGRFATLFGLRLGVGIAEAPTFPINNRVVSIWFAQRERGSATSVY
FT                   LVGQYIGMAALTPALFWIAGTFGWRAIFFATGLVGIVWAGIWYLLYRDPEQCRWVNQAE
FT                   LDHIRRGGAVVETGKPARGEPFPWRKLAIVFSNRQIVAICAGKFASLSSLYFFLTWFPS
FT                   YLISERHMTVLKAGGVASVPFVAASIGVLAGGALSDWLLRRGASVGTARKTPIITGLLL
FT                   VPTMTLTVLTDTNWIVIAIMSFAFFAQGVASASWSLIGDIAPRSMLGITGGAVNFVGNL
FT                   SGIVTPIAIGFIVRETGSFGWALGLISVFAVIGALCYTFLLGEVKRIDLDPPARGGRSP
FT                   EPLKSTVQD"
FT   CDS_pept        150675..151514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05495"
FT                   /product="IclR family transcriptional regulator"
FT                   /note="COG1414: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05495"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47327"
FT                   /db_xref="GOA:A0A0H3KQH7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQH7"
FT                   /protein_id="BAG47327.1"
FT                   /translation="MNPDTPDTTGTPSDDDTYLVPALERGLRVLELFNAREPVLTPNAI
FT                   AQRLGLPRTTALRLVQTLHTLGYLERANRDRDYRLGARVMKLGFDYLSSLALTDIGTPV
FT                   IERLRDETGFASHLVVRDGRDVVFVAKAWTHDSVMSAIKVNIGTRIPAHASVHGHVLLG
FT                   DLDRAELEALFPEPMLPTYTPHTPRTAAEVHARAQKYAAEGYALSESSFEPGISVISAP
FT                   VRDGSGLIVAAVTLTVARPFLEKSMLDQGLVGKVLKAAGELSERLNYRAPDPAATRD"
FT   CDS_pept        complement(151548..152876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BMULJ_05496"
FT                   /product="putative Glu-tRNAGln amidotransferase A subunit"
FT                   /note="COG0154: Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases, Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05496"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47328"
FT                   /db_xref="GOA:A0A0H3KY24"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR014087"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY24"
FT                   /protein_id="BAG47328.1"
FT                   /translation="MRDALGIARAVRAGRLSAVEVARQVLDDIGARHAQFNAISMCFDT
FT                   RALEAAARIDACVRAGRDAGPLAGVPFVVKSNFDVAGYATVAGSPTRLRAPAARCDAAM
FT                   VDRLVQAGAVPVAATHMDEFACGATGVNPHFGAVRLPADPSRMTGGSSSGSAAAVAAGH
FT                   VPLALGSDTNGSIRAPAALCGVWAIKPTHGRLSMDGCVPYASSLDVAGGFAANLDDLCA
FT                   LYDALSGTRRDDSPIGHAPLRVGVLTGEFERRADAQVRRAVERATACFAQHDHVQAEPI
FT                   DESVLEPIRGSARLVSNFEVARRHRALLDADASQVSAPLRERIRTGLAIDDAAYADALA
FT                   HRAEWQARLAALLERFDILIAPATPYVAPRFCDATVDVNGEALDSKTTLGMFTQPISFA
FT                   GLPVVSAPCHAKGELPAGVQLIGWPGDERRCLDAARRLVNLGW"
FT   CDS_pept        complement(152900..154231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05497"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05497"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47329"
FT                   /db_xref="GOA:A0A0H3KQ17"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ17"
FT                   /protein_id="BAG47329.1"
FT                   /translation="MASTNDTARMHDMPSERDAGTAADIDALYGKLTRRIIPLILVCYF
FT                   FGYLDRVNVGFAKLQMAADLHLSEAAYGVGAGLFFVGYLLLQVPAGWLVQRIGVKKCIA
FT                   GSMLAWGVVSIGTLATTGQTSFYVLRFLLGVTEASFFPAVIAYFSVWFPSRRLSRVMAL
FT                   LFLAMPLGVVIGGPLSGWIMDATHGGFGLRGWQWMFLLEGLPAVLLGLYLLASVTERID
FT                   DARWLTDAEKRMIHAEMAQETEGKRAHLGAALREPTLWLLFATSFLYNVGNYGLIFWMP
FT                   TMIKALGSLSNFAVGVVSAVPYLVASVAMVLNAQHSVRTGERRWHTAAPVIVGGVALLA
FT                   SVGMRAHPLLAVVCLTVGVAGIMSTLAMFWSLPSRILAGEAAAGGAGLVNIGAAVAGFV
FT                   GPSIMGYLKAMTGSTEIGVALLALTLFGAAALILSIPRRFIGRA"
FT   CDS_pept        complement(154234..155709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dan"
FT                   /locus_tag="BMULJ_05498"
FT                   /product="putative N-acyl-D-aspartate/D-glutamate
FT                   deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="COG3653: N-acyl-D-aspartate/D-glutamate deacylase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K06015"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05498"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47330"
FT                   /db_xref="GOA:A0A0H3KPV7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPV7"
FT                   /protein_id="BAG47330.1"
FT                   /translation="MHFDVILRHGELIDGTGAARFSADLGVRGAHIAAIGDLSHASADQ
FT                   VIDVSGHIVAPGFIDSHTHDDAFVLTDPDVEPKVAQGVTTVVAGNCGISLAPLLAEHEV
FT                   PQPLDLLGAWQRFRFPSFAAYLDALDATPAAVNTAALVGHSTLRVRHVADLQREANAAE
FT                   IAAMRADVREAMAAGAFGVSSGTFYPPAAAATQAELIDVCAPLRDTGGVFATHLRDETA
FT                   QILASLDEAFAIGRALGVRVVLSHHKVAGKENHGRSVETLARIDAQRALQPLCLDCHPY
FT                   TATSTMLRADRIRQSSRVMLAWSKPHPELAGRDFHELLPLFGDSVDAAIDALRPAGAIY
FT                   FVMDEGDVERIFRHDLTMVGSDGLPNDTRPHPRLWGTFPRVLGEFSRRRGLFPLETAVH
FT                   KMTGLTAAQFGLAGRGELKVGHCADLVVFDPERVLDRATFEHPTLRPEGIDHVFVNGRA
FT                   VLAHGQHTGARPGRALRRQAGTPIRHNDHLAGN"
FT   CDS_pept        complement(155849..156751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05499"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05499"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47331"
FT                   /db_xref="GOA:A0A0H3KUL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUL6"
FT                   /protein_id="BAG47331.1"
FT                   /translation="MKVENSELEAFVAVAELGTFHRAAEKLHLTQPGLSRRIQKLEQAL
FT                   GVELFQRTTRSVTLTGVGRQFLPMAREQIAQLGMMLSSIQEIAEKRYGKVRVSSIPTVV
FT                   AQLLPKVLLQYAEKYPLIGVQILDGNHDFVLSQVRAGIAEFGVSLHPGDDEDLLFEPLF
FT                   PDRYVLAVHRDDPLAQADGVTLAELRHARLVIGGRDSGNRLLLEMLMGQEAVRLRWFYE
FT                   VEHISCVAALVAAGVGCAILPRSAVDGVGMLASPDVRAVPITSPVISRTVGIVRHRAVS
FT                   MSSMASDLCALVKAAAARE"
FT   CDS_pept        156910..158079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05500"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47332"
FT                   /db_xref="GOA:A0A0H3KQI2"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQI2"
FT                   /protein_id="BAG47332.1"
FT                   /translation="MRPVHRFAFPITLSTLCCAAACAQSGVTLYGLLDGGVAYVSHAAA
FT                   ANGASGSAFRFGNAMSGNRWGLKGSEELGGGLSAVFQLESGYSLGTGMAAQGGREFGRT
FT                   AIVGLSSTRWGTVRMGRQYDPLVDLVSALTEDAYFGLTFGPPGDVDNYDGSMRVNNAIK
FT                   YTSPLVGGLRVAALYGFGGVAGATSAGQTWSVAGSYAYGPFSVAAGYFSANGGNTMNDA
FT                   GVRTWSASTDSPFNTAANVGFGSTHAVNIARIAGQYAAGAWTVGTGYSRTEYVPDGASV
FT                   FQVRTRFNDGSAFANYRIGAALNVGIGYHYTWLAGASAAHYHQLNAGVDYLLSKRTDVY
FT                   AIAAFQRASGTTLGADGTRVTAQAVIGDYGLNAGANTQTIVAIGMRQRF"
FT   CDS_pept        complement(158129..159106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05501"
FT                   /product="putative N-acetyltransferase"
FT                   /note="COG0454: Histone acetyltransferase HPA2 and related
FT                   acetyltransferases, Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05501"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47333"
FT                   /db_xref="GOA:A0A0H3KY29"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY29"
FT                   /protein_id="BAG47333.1"
FT                   /translation="MDLVDLPAQPRDATILELRDFSRKLVRELGFMRATLADSDWAPSA
FT                   VHAVLEIGMSPGINAKDLAQILRLDKSNTSRQLARLEAAGLVERRVSSGDARTAALFLT
FT                   AEGKKLRKRIDQFATDQVSNALRRLMPADQQALLRSLALYADALAQDNAARTTARKPDA
FT                   PPILEGYQPGCIGDIAGLHARFYAEHWGFGAFFEKRVATELAAFAATLPAEGRALWLCM
FT                   DDGRAVASLAIDGDAATGVAHLRWFIVSDALRGVGIGRQLMTRAMRFVDDYPFRETYLW
FT                   TFKGLDSARHLYESFGFTLDSEAEGAQWGTTVTEQRFVRQRPEQ"
FT   CDS_pept        159294..159695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05502"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ22"
FT                   /protein_id="BAG47334.1"
FT                   /translation="MNGLRSSAAMLGVGCSIVCGVAHGAGGQDTSPCRAANAAPPGMQL
FT                   MLPDRPGASTNAETTVRSFSTQGCAGAVLKGERGTATVDGDKVELKQGAVYVNGISYGA
FT                   VTSAQTVEYDVARGTRTLRVDGEVRTPAR"
FT   CDS_pept        160107..161186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuC"
FT                   /locus_tag="BMULJ_05503"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="COG0473: Isocitrate/isopropylmalate dehydrogenase,
FT                   Escherichia coli O157:H7"
FT                   /note="KEGG, K00056"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05503"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47335"
FT                   /db_xref="GOA:A0A0H3KPY3"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPY3"
FT                   /protein_id="BAG47335.1"
FT                   /translation="MTQTFKIAAIAGDGIGQEVMPEGVRVLQAACAKFGLNLEFTHFEW
FT                   ASCDYYLQHGKMMPDDWFETLRGYDAIYFGAVGWPDKVPDHISLWGSLLKFRREFDQYV
FT                   NLRPVRLLPGVPCPLANRKPGDIDFYVVRENTEGEYTSVGGKMFEGTEREFVLQESVFT
FT                   RHGVDRILKYAFELANTRPRKKLTAATKSNGIAVSMPYWDERVAAIAAGYPDIAWDKQH
FT                   IDILSARFVLQPDRFDVVVASNLFGDILSDLGPACTGTIGLAASANLNPERTFPSLFEP
FT                   VHGSAPDIFGKNIANPIAMIWSGAMMLDFLGDGDARFKDAHDAIMRAIETVLVSGPRTP
FT                   DMGGTADTTAVGKAVAAAL"
FT   CDS_pept        complement(161228..162298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05504"
FT                   /product="putative PAS protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05504"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47336"
FT                   /db_xref="GOA:A0A0H3KUM0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUM0"
FT                   /protein_id="BAG47336.1"
FT                   /translation="MSEDTFAFRLKVLLEHKKLSLQQVADAVGISRPAVHKWTRGGEID
FT                   YSNLRKLAAFLDVNWVWLRYGDDAVKDLGIGAQPELPMTDLRRRYTAEIVSSEARMKHA
FT                   QEAAGIVTWEWNLVSDELIYSDNCAKLYGREIHSNEEFWDILHPDERSWLNSRALQEAI
FT                   DARKPYVWEFRIVLPDGTVRWIESRTATLVDDAGRPTRMVGTTIDISARKSLEQQLRAQ
FT                   IALLADAERLAGRGAWQWRQAPDEVMVSDEWCRLFGVERDDAPHRHAQVQARVHPDDRA
FT                   ARDAALQEAMTKHGDYRALYRALLPDGTVRLMLEQGHARPDDEGDGVRVTAMCRAAEPA
FT                   DAIAFAAQPAAATTPH"
FT   CDS_pept        complement(162460..163425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05505"
FT                   /product="family 1 flavodoxin reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="COG1018: Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1, Escherichia coli K12"
FT                   /note="KEGG, K00540"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05505"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47337"
FT                   /db_xref="GOA:A0A0H3KQI5"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039003"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQI5"
FT                   /protein_id="BAG47337.1"
FT                   /translation="MNARESIFVDVVAVETLTPLIKRFTLALPDGAPLPPFSGGAHVLV
FT                   SMQNGEQWHHNAYSLLSSPHDTRQYQIAVRREEASRGGSAFMHEHVAAGTRLAIGSPAN
FT                   LFELARNARRHVFIAGGIGITPFLAQLAEHAPGGDVELELHYAYRSPEHGAFVDELKAG
FT                   PHAANVHTYVDSLGQRLDLMRLFKTLPADAHVYVCGPQGLNDAVYANAALLGWPKSQLH
FT                   SEQFAATDTAGRAFTVVLARSGIELEVPEDTTILQAIERAGVKIDSLCREGVCGTCEVA
FT                   ILEGEADHRDQYLDDDEKAAQKTILLCVSRARTPRLVIDL"
FT   CDS_pept        complement(163513..164973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BMULJ_05506"
FT                   /product="NADP-dependent succinate-semialdehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K00135"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05506"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47338"
FT                   /db_xref="GOA:A0A0H3KY33"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY33"
FT                   /protein_id="BAG47338.1"
FT                   /translation="MTSLQQPGLLREQAYIAGAWRGADDGAVLDVTNPSTGELIARVPN
FT                   MGAAEARAAIEAAHTAFATWRKTTAKERARLLRNWFELIMARQEDLAVLMTREQGKPLA
FT                   EARGEIAYAASFVEWFAEQAKRIDGDVIPSPNPDQRLVVTKEPVGVCAAITPWNFPAAM
FT                   ITRKAAPALAAGCTIVIKPANETPLSAFALAALAEEAGIPAGVVNVVTGKSREIGAEMT
FT                   SSPLVKKLTFTGSTEVGRLLMRQCSDTVKKMSLELGGNAPFIVFDDADLDRAVEGALLS
FT                   KYRNAGQTCVCANRFFVHDTVYDEFCRRFAERVAAFHVGDGFDAGVNIGPLINEAARDK
FT                   VDGLVRDAVAQGARVLVGGAPHARGGNFYAPTVLADAKPGMAVLSEEIFGPVAPIVRFT
FT                   SDDEVVRLANHSIYGLAAYFYSRDIGRVWRVAEQLEYGIVGINSGLISNEVAPFGGVKQ
FT                   SGIGREGSKYGIDDFLSIKYLCMGGVSA"
FT   CDS_pept        complement(164998..166146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05507"
FT                   /product="ring-hydroxylating dioxygenase large subunit"
FT                   /EC_number="-.-.-.-"
FT                   /note="COG4638: Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit,
FT                   Escherichia coli O157:H7"
FT                   /note="KEGG, K00470"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05507"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47339"
FT                   /db_xref="GOA:A0A0H3KQ26"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR039004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ26"
FT                   /protein_id="BAG47339.1"
FT                   /translation="MTYLPIEFHQKAKLPQLPADFCSNPELAWTIPKTYYTSQEVFKVE
FT                   EEKIFADTWICVAHRSELADANQYVTREVIGENVLIVRGKDKVLRAFYNVCPHRGHQLL
FT                   EGSGKAKNVITCPYHAWTFKLDGALAHANNCDHVMAFDKENARLVPVKVEEYAGFVFIN
FT                   LNPNAGTVEEQLPGMEARLRAACPVIDDLKLAARFVSETPANWKSIVDNYLECYHCGPA
FT                   HPGFSDSVKIDQYTHTLHGNWTLQFGHAESSERSFKLDPSIQDASFQGFWAWPCTMFNV
FT                   PPGADFMTVIHEFPVNAEVTLQHYDIYFLNEALTDYQKNLIEWYRNVFRPEDLRLVESV
FT                   QKGLKSRGYRGQGRIMVDQRRSGISEHGIAHFHHLLAQKYQD"
FT   CDS_pept        166517..167959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05508"
FT                   /product="putative cytosine/purines, uracil, thiamine,
FT                   allantoin transporter"
FT                   /note="COG1457: Purine-cytosine permease and related
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05508"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47340"
FT                   /db_xref="GOA:A0A0H3KPY6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPY6"
FT                   /protein_id="BAG47340.1"
FT                   /translation="MRQQAVADGLAMEGRGKSRIEARSIDYVPLAERRGKAWHLWPVWF
FT                   TGDANLATIACGAIGVSMGGNLLWSAIAVLIGNLLGTFFMAFHSSQGPQLGLPQMIQSR
FT                   PQFGYMGALLVWIVALVTYVGYNSFNQLMAGQTAHHLLGTEPHVSYIVFTAIAVGLAIF
FT                   GYDLIHKAQRWLAIALLIALSVFSVGICVKVPFPAGQLSFAGFKATPFLVQLFAAAAYQ
FT                   LSWSIYVSDYSRYLPPKTGVRATFWWTFTGALIGGAWMMLVGTAAAALNSKIEIADAVQ
FT                   RAGDAIHPGFGSVTLLLSLLGLLAITGLNFYGASLTLLSITDSFRPLKSNAGKRVASLL
FT                   IVAVVATSLAFAASDDFMGKFGDFLGILGYLFTPWTAINLVDFFFVRHTHYSVREIFNP
FT                   RGIYGRWNWRGLTAYAVGFVAMIPFFKTETYSGPVARALGGTDIAMLVGLPVAALVYLW
FT                   ACRSLDTEAERKLVEAADRGLN"
FT   CDS_pept        168204..169106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05509"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Escherichia coli
FT                   O157:H7"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05509"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47341"
FT                   /db_xref="GOA:A0A0H3KUM6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUM6"
FT                   /protein_id="BAG47341.1"
FT                   /translation="MNETSAMPELGDLRVFCMVARKASFSAAADALAMSSSYVSKRVGM
FT                   LETSLGIRLLHRSTRRVSVTDAGERVYAWAEKILDDVEHLVEDVSSTRRVPRGTLRVSS
FT                   SFGFGRNVVAPALAELSDRHPQLNVRLELFDRIVDVAAEGFDVDIRIGDEIAGHLIAKQ
FT                   LATNHRVLCASPDYLARHGAPKQVGDLASHACLAIKERDHPFGVWRLDARGETVSVQVT
FT                   GPLSSNHGEVAVQWALAGRGIVLRSVWDVQPLLDAGRLQRVLPGVTQPANVWAVYPARL
FT                   AQSAKVRACVEFLKDRLGA"
FT   CDS_pept        complement(169209..170303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05510"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47342"
FT                   /db_xref="GOA:A0A0H3KQJ0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQJ0"
FT                   /protein_id="BAG47342.1"
FT                   /translation="MDSPSHRHQCSAERSQRSSFDPARPAGRQEDIPATGHAIAVALDE
FT                   CRVRHIDSAALLEGTGLGADEVASPNLYVNRAQEQRCFRNLLRCSGVPSIGLWIGARLH
FT                   VSTLGLAGYAMLISGSVMQAFRCMSQFPLFMGLYFDVRVHAHADGMTVTIDRYNGEPDL
FT                   EVFQTDMCLSSLRLIVSDLVGKPVWPDQLLLARRTPRNASDYVRHFGCKAVFNAGENSL
FT                   VFTAVNGTETPRLANEVSFNALHGQCEALERQWAASIGTRFADRAKALMTRDLSRFKSM
FT                   TSLADALHMTERTLRRRLEKDGISFQALLDDVRRDEAARLLDDPALTVAAIAEHLGYSE
FT                   PRAFRHAYRRWTGRTPREGRGGDA"
FT   CDS_pept        170557..171948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05511"
FT                   /product="amino acid transporter"
FT                   /note="COG0531: Amino acid transporters, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05511"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47343"
FT                   /db_xref="GOA:A0A0H3KY37"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY37"
FT                   /protein_id="BAG47343.1"
FT                   /translation="MTDSTSARRAPHAAFDDSASDADARDAFASRHARPLGLFTLVIFG
FT                   LAYMLPMTVFTTYGLVTRETNGHLVAAYAVTLIAMLFTARSYGHMTRLMPSAGSAYTFA
FT                   SRNFGTSAGFMVGWALLMDYLFIPMISYLAIGIYMKQIVPAVPPAVWIVASIAFITALN
FT                   VIGIRLVNRVNLILIASQLVFIAVFLVAAARAAGGDALPTTIALPVTEDAHAIFSGAAI
FT                   LCLSFLGFDAVSTLSEETREPRRTVPRAILLCTLASGVLFMLIAYAGQAAFPDWHAFRD
FT                   LDSASLELMRHIGGGALSAFFVAVYVAGCFASAMAGQASVTRVLFAMGRDRVLPECVFG
FT                   RLHVRLRTPVRATLAVGAVSLSALFITLDLASTMISFVALVAFAVVNLCVMRSYLSRPE
FT                   HRTAAGWIRFGAMPAIGFALNVWLWSGLSRQTFYVGIAWLALGLAQLVWLTRGFTRPAP
FT                   TLTMN"
FT   CDS_pept        171992..173380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05512"
FT                   /product="putative
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotransferase"
FT                   /note="COG0161: Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase, Mycobacterium tuberculosis CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05512"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47344"
FT                   /db_xref="GOA:A0A0H3KQ32"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ32"
FT                   /protein_id="BAG47344.1"
FT                   /translation="MNVNPDTDLQALAKRHLLMHFTHADAYGDAALTVFDCGEGCWLVD
FT                   RDGKRYFDALAGLYCVQVGYSHGAEIGDAVREQMTRLPFATNWSYAHEPAIRLAERLAT
FT                   LAPEGLNRVFFTSSGSESNESAIKLVRQYHQARGEPQRRKFIARRVAYHGTSFGALALN
FT                   GMTAFRKHFEPLMSGVRHVGNTKRYGRPVDETEAQFTRHLLDEIESLIVQEGPDTVAAI
FT                   VVEPLQNAGGSLTPPAGYTAGLREICDRHGVLLVADEVICGFGRVGEYFGSTRYGLKPD
FT                   IITFAKGIASGYVPLGGVIASDAVVDAVLAGPQQMFLHGATYGGHPVACAAALANLAII
FT                   ERERVFDNVRDNAAYFRATLDALLELPCVGDVRGDGYHYSLELVTDKQARRWTGSIDAR
FT                   TFVSTVLAPAIFDAGLLCRAGVDHEGTPIVQFSPPLVMTRDEIAWFVAQIRDIVADAYA
FT                   RATR"
FT   CDS_pept        173418..174842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05513"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="COG1012: NAD-dependent aldehyde dehydrogenases,
FT                   Mesorhizobium loti"
FT                   /note="KEGG, K00128"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05513"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47345"
FT                   /db_xref="GOA:A0A0H3KPZ0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPZ0"
FT                   /protein_id="BAG47345.1"
FT                   /translation="MRTSRQTYIAGQWLDPADEQSIDVIDPATARPYARLGIGGMTEVD
FT                   RAVAAAKQAFDAYARWPVDARVALLSRVLDIYRRRYDEVAQTISQEMGAPIAFARAMQA
FT                   AVGTAHLEQTIRALQSFRFATQTDSLLVSHEPIGVCALITPWNWPINQIVCKVAPALAA
FT                   GCTMVLKPSEIAPFSAILFAEILDEAGVPPGVFNLVHGYGQVVGDALARHPDVDMVSFT
FT                   GSTRAGIEVAKAAADTVKRVHQELGSKSPNLILPDADIADAVARGVRSCFSNSGQSCNA
FT                   PTRMLVHVDQLAEAEAAARDEARRTIVGDPRSPETTIGPVVSRTQFERIQQFIGLGIDE
FT                   GATLIAGGPGRPEGLGDGFYVRPTVFSNVTPDMTIAREEIFGPVLSIMTYRTEDEAIAL
FT                   ANDSVYGLAAYVQSKDLERARRVAARLRVGNVHINYPPWNPAAPFGGYKRSGNGREYAE
FT                   FGLAEYLETKGTTGYA"
FT   CDS_pept        174984..175415
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05514"
FT                   /note="truncated uncharacterized conserved protein"
FT   CDS_pept        175343..176473
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05515"
FT                   /note="COG5476: Uncharacterized conserved protein,
FT                   Mesorhizobium loti"
FT                   /note="truncated uncharacterized conserved protein"
FT   CDS_pept        176606..177793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05516"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47346"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUN0"
FT                   /protein_id="BAG47346.1"
FT                   /translation="MPTHSFRLRRTRALVALALASATVAVHAADWIVSGNDGKYQRVEG
FT                   RDTYLPSPPADTLTLLDASSFPPKVAQTVDVENGIQGPPQAVAIAPDAKLALVGAPTRY
FT                   DTAAKQLVYDTFVQVVNLGASPPSIARIELGTHPQGIAIDRSGRLALVANVDGSVSILR
FT                   IDGTQVTLDGNLKIGKKRLAGISFTHDGKHALVSLRDEQGIAVLNVDDGKVTDSGARLS
FT                   TGVAPYTIDVSSDGRWAVVSNVGLAGLPGYTGTLAGDADTIALIDVSRVPFRTVQYLTV
FT                   PSLPEGVAISPDGKWIAVQAMDGSNLTADNPGRHKRGKVLLFEIRDGRAVQTSEVPGGE
FT                   ASQGIVFTADSRHVIVQFNVERQLALYAVEGGKLRDTGQRIALSGGPSSLRRLPR"
FT   CDS_pept        complement(177859..177993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05517"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQJ1"
FT                   /protein_id="BAG47347.1"
FT                   /translation="MARIGAFCITTWLAAAILYFGQHSVAMIALSGVVVFGGFDLLRP"
FT   CDS_pept        178349..178792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05518"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47348"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY41"
FT                   /protein_id="BAG47348.1"
FT                   /translation="MQIDLSATHASALPAAGGAADAAVPASSTAPADASSAAGASGDTT
FT                   SAGATPTGPTLGAAGSDADNPAVKQLKQLIERLQKQLAQLQQQIARAAQRAKTDPAAAV
FT                   EQQALSAEASAVSAALSAAIGQLAQALQQSGASAAGALVSTQA"
FT   CDS_pept        179035..180204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampC"
FT                   /locus_tag="BMULJ_05519"
FT                   /product="beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="COG1680: Beta-lactamase class C and other penicillin
FT                   binding proteins, Sinorhizobium meliloti"
FT                   /note="KEGG, K01467"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05519"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47349"
FT                   /db_xref="GOA:A0A0H3KQ39"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ39"
FT                   /protein_id="BAG47349.1"
FT                   /translation="MRITVTRVVATLLVATAAIATTGRAAELTQAHIRQIVTQQVAPAM
FT                   KQYAIPGVAIGVIVDGKRYVFDYGVMSKDTGKPVTADTLFEIGSVSKTLTATLAADAQE
FT                   GGELSLSDPVARYVPALNGKPAGALTLLELGTHTAGGLPQQVPDAIHDDATLIGYFDAW
FT                   RPASVPGTQRVYSNVGIGTLGWITAKAMKRDFAELMERRLFPALGMTHTYIDVPDARRA
FT                   DYAQGYTTDGTPIRMKPGGLWQPAYGVRTTATDLLRFVQANMGGIDIAPRLQRAIERTH
FT                   TGYFRAGPLTQDLIWEQYPYPVALPTLLEGNASKMLSDAVPAVALTPPLAPQRNVWINK
FT                   TGSTNGFSTYVAFVPAKRIGFVMLANRRVPNEVRVEIAYRILASLGGAR"
FT   CDS_pept        complement(180285..180641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05520"
FT                   /product="YjgF family putative translation initiation
FT                   inhibitor"
FT                   /note="COG0251: Putative translation initiation inhibitor,
FT                   yjgF family, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47350"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPZ3"
FT                   /protein_id="BAG47350.1"
FT                   /translation="MSEIVRIETNARMSRVVKAAGLVFIGGQTSADPSPDVKVQTAKVL
FT                   EKIDGFLEQAGIDKTRLVSAQVWLADIARDFAGMNEVWDAWVPAGHAPARATVEAKLAA
FT                   PHLLVEIAVVAAQR"
FT   CDS_pept        complement(180683..181843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05521"
FT                   /product="sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Mesorhizobium loti"
FT                   /note="KEGG, K00301"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05521"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47351"
FT                   /db_xref="GOA:A0A0H3KUN5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUN5"
FT                   /protein_id="BAG47351.1"
FT                   /translation="MTGTHEAIRDEADAIVIGGGLHGTSSAWHLARRGARVIVLEADYV
FT                   ARHASGVNAGGVRTLGRPLDEIPLALLSRELWHTLPDLIGDTGGFVPSGQLKIAETEAE
FT                   LDECGARVALLEAHGYTHETLIDRARVRELEPALAPHVTGGIWVEHDGYALPFRTTAAF
FT                   RIAAQRHGARFHERTPVTHLERRGTRWIAQSPRGAFAARKLLIAAGAWSGEFARAAGEP
FT                   VPLHAEGLMLMVTQRVAPFCRATLGATGRPLSFKQFDNGTVVIGGKLIGHADLQARHGE
FT                   VDFMRLARSARTVVDLFPHLRDLGINRAWAGVEAFTDDALPVISASRTADDLYYSFGYC
FT                   GSGFQLGPGCGQVVAELMLDGTPSVPLDAFAIDRFARARGAAPATH"
FT   CDS_pept        complement(181845..183236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05522"
FT                   /product="uncharacterized NAD(FAD)-dependent dehydrogenase"
FT                   /note="COG0446: Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05522"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47352"
FT                   /db_xref="GOA:A0A0H3KQJ5"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQJ5"
FT                   /protein_id="BAG47352.1"
FT                   /translation="MQETVDVVVVGAGPAGLGAATRAARAGLSVVLLDEQDAVGGQIYR
FT                   AIERADARRREILGPDYAAGAALADAFARSGARHLTRTTVWQVTRERQVHYLRDGKVGC
FT                   FDARRVILATGALERPFPIPGWTLPGVLSAGAAQILLKSAGEVPSTPPVLAGCGPLLYL
FT                   LGWQYLRAGVPIRALVDTTRPADRWRAKKHLFAALRAWPFLGKGLQMMRALRDANVPIH
FT                   EGADDLAIVSRAGDDGQPRAAALTFTAQGRAHRIDADVILLHQGVVPNTQFTHALRAAH
FT                   RWDDAQLCFTPQVDAWGELDVPGIFVAGDGAGIGGAQAAAQQGTLAALAVAAQLGALDE
FT                   AARDREAGAHRNALARALRIRPFLDSLYRPRDANRIPADDTIVCRCEEVTAGELRGFVA
FT                   LGCVGPNQAKSFGRCGMGPCQGRLCGLTVTEVIADARRVAPDTVGYYRIRPPIKPITLG
FT                   ELAGE"
FT   CDS_pept        complement(183241..183603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05523"
FT                   /product="uncharacterized NAD(FAD)-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05523"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47353"
FT                   /db_xref="GOA:A0A0H3KY45"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY45"
FT                   /protein_id="BAG47353.1"
FT                   /translation="MTAHPSSSLFKPLDAAAATVEIRFNDAPLRVPAGVSVAAALLAAG
FT                   VRRFRATPVSHAPRAPYCMMGACFECLVEIDGVPARQSCMVDVRDGMCVRTQEGARDLP
FT                   PESALAAASLENADDR"
FT   CDS_pept        complement(183620..184777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05524"
FT                   /product="putative opine dehydrogenase"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05524"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47354"
FT                   /db_xref="GOA:A0A0H3KQ46"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ46"
FT                   /protein_id="BAG47354.1"
FT                   /translation="MIRPAAASPDVLVIGGGLVGTAVAYGLAREGARVTVLDEDDGGFR
FT                   ASRGNFGLVWIQGKGHDRTPYASWSRSSAVRWPQLAASLLEDSGVDVALRQPGGFHLCF
FT                   SDDELAERRTRLATLQTALGDYPFELLDHRELRERLPGIGPAVVGASYTPMDGHVNPLK
FT                   LLRALHASMQHRGVRLVSGARVQQVRAEGAGFVADSAAGTFRTGRLVLAAGLGNRTLAP
FT                   QVGLHAPVAPNRGQVLVSERVAPFLRYPTINVRQTDEGTVQFGDSMEEVGFDDLTTTPV
FT                   LADIARRGVRAFPMLQHVRLVRMWAALRVYSPDGFPIYDESPQHPGAFVVTCHSGVTLA
FT                   AAHAMRIAPWIVGAPMPDELPALSARRFPDAPDTIAAAARPAPAY"
FT   CDS_pept        complement(184774..185571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="BMULJ_05525"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1177: ABC-type spermidine/putrescine transport
FT                   system, permease component II, Sinorhizobium meliloti"
FT                   /note="KEGG, K02053"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05525"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47355"
FT                   /db_xref="GOA:A0A0H3KPZ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPZ6"
FT                   /protein_id="BAG47355.1"
FT                   /translation="MQRNGFAALAFHALFVAFIVAPLAAVMLVAFTDKGYISMPFDGAS
FT                   LRWFRAIADNGDIVSAFWLSVRLALVAATLGVALAVPAALAIARYRFPGRGALTSFFLS
FT                   PMMIPAVVLGIAFLRFLSLLHLSGSFWALVAAHVVIVLPYALRLALSSAIGLDRDAERA
FT                   ALACGASRFTAFRRVVLPMIRTGVAGGWVLSFIQSFDELTMTIFVATPGTTTLPVAMYN
FT                   QIAQTIDPLVTSVSAVLIVGTVLLMLVLDRLVGLDRILIGEAR"
FT   CDS_pept        complement(185584..186456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="BMULJ_05526"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein"
FT                   /note="COG1176: ABC-type spermidine/putrescine transport
FT                   system, permease component I, Mesorhizobium loti"
FT                   /note="KEGG, K02054"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05526"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47356"
FT                   /db_xref="GOA:A0A0H3KUP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUP0"
FT                   /protein_id="BAG47356.1"
FT                   /translation="MATLDDTRGGAAPWLLSAPALLLFATLLLAPLLLTLVLSFHTFSD
FT                   IAGTQPGWTVANYLEVVRDPYYLTIFARTAGLATAVTLLSIVLGVPETIVLARMRKPWQ
FT                   SICLLVVLGPLLISVVVRTLGWQILLGNNGVLNDALQALHITDEPVRLVFTMTGTIVAL
FT                   THVLVPFMVMSVWATLQKLDPQVEWAGRSLGASPMRVFRRVILPQILPGVLSGSIIVFA
FT                   LSASAFATPALIGGRRLKVVATAAYDEFLGTLNWPLGASIAVLLLIANVAIVMGCSRLA
FT                   DRRFKHIFD"
FT   CDS_pept        complement(186443..187513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="BMULJ_05527"
FT                   /product="spermidine/putrescine transport system
FT                   ATP-binding protein"
FT                   /note="COG3842: ABC-type spermidine/putrescine transport
FT                   systems, ATPase components, Mesorhizobium loti"
FT                   /note="KEGG, K02052"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05527"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47357"
FT                   /db_xref="GOA:A0A0H3KQJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQJ8"
FT                   /protein_id="BAG47357.1"
FT                   /translation="MSFLTLQHVSKRYGDFTAIEQLDLSVERGEFLSLLGPSGCGKTTT
FT                   LQMIAGFVAPSAGRVTLDGRDITHERPEKRGIGVVFQSYALFPHMTVAGNVGFGLEMRK
FT                   MKRAQREERIAEALALVRLDGLDARYPKELSGGQRQRVAIARAIAMRPELLLLDEPMSN
FT                   LDAKLREEMHIELRAIQKRLGITTILVTHDQVEAMTMSDRIAVMHRGRIAQLSTPFDAY
FT                   ERPATPFASVFLGRTNTFEGEVLRRNPRCAEVAVASTTLHVPHEGRDVAGPVNVYIRPE
FT                   KMRLANGDARLHGRVATRVFVGNQWLLVIDTALGKLHVTQSNTGAPPPDEGSEVGLAWA
FT                   DDDLRMLTREGAHGHA"
FT   CDS_pept        complement(187550..188638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05528"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   system periplasmic component"
FT                   /note="COG0687: Spermidine/putrescine-binding periplasmic
FT                   protein, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05528"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47358"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY49"
FT                   /protein_id="BAG47358.1"
FT                   /translation="MNRSPHRRPSRFSPASRRVAAKPLVAAGAALALIASVAAHAETTL
FT                   NVANVGGSNEQLYRQKVIPAFEKAHNVKIVYVAGNSSDTLAKLQAQKGHQQINVAVMDD
FT                   GPMYQAMPLGLCATIDDAPIMKDLYPLARLGPAAVGVGVVATGIGYNADAFKKLGLPAP
FT                   DSWKSLEDPRLKGKLGMPPITVTYGLHTLVMLARLNGGGEKRIDPGFDAMAKRVAPNVL
FT                   SWAPTPGEMDGLMQAGDVIAAPYGSGRAVSLQNTGFPLKFVYPKEGAVALQVAACAVAE
FT                   NAQPQLSQQFIQYLLTPEVQALQAQAIGLGPVNRTVKLAPDVAARVPYGPDQVAKLTTV
FT                   DWTTINPRRTEWTQRWNRSVER"
FT   CDS_pept        188806..189720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05529"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Escherichia coli
FT                   K12"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05529"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47359"
FT                   /db_xref="GOA:A0A0H3KQ51"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ51"
FT                   /protein_id="BAG47359.1"
FT                   /translation="MNLKQIEAFRAVMVAGSMTAAAKALFTTQPNVSRMIASLERDTGL
FT                   TLFERVGARLVPTSEGTAFFREVERAYVGLRGLANAAEQIRNLGSGRLRIAAMPAVGYT
FT                   LVPRAIKRFQEQYPGVTVSLHVNTSATVNHWTASQFCDIGVAVYVSETSNCEVELLSKV
FT                   AAVCVMPGQHRLASKRTIKPADLAGESFISLCQGDGMRTLMDAVFERAGVERKLATEAQ
FT                   YTAICCEMVRLGMGVTLAHPVVAQAFAGPDVAIRPFSPAVTMPTYLLFPPQPSRDRLAT
FT                   AFATLLADEHDAATGRTSARGRR"
FT   CDS_pept        complement(189833..190621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05530"
FT                   /product="periplasmic substrate-binding protein"
FT                   /note="COG0834: ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47360"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KPZ8"
FT                   /protein_id="BAG47360.1"
FT                   /translation="MKKKTRITMLVAAAAMACATLASAKEWTTIRIGVDPTYPPFESTA
FT                   TDGSVQGFDIDLGNALCAKLNAKCVWVSSSFDGLIPGLQARKFDVILSSMAATEQRRQQ
FT                   IDFTDRLYRNQTRLIARTGSGLLPEAAKLAGKRIAVEQGTIQETYAREKWAAAKVEVVP
FT                   YPSYDQAYADLVNGRVDGVLMDAVQGQLGFLATPRGKGFSFAGGVVYDPKIMGNGDAAG
FT                   VRKADTDLRDALNRAIAQIRSDGTYNKIQSKYFDFDMYGN"
FT   CDS_pept        complement(190665..192101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05531"
FT                   /product="uncharacterized NAD(FAD)-dependent dehydrogenase"
FT                   /note="COG0446: Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05531"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47361"
FT                   /db_xref="GOA:A0A0H3KUP2"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUP2"
FT                   /protein_id="BAG47361.1"
FT                   /translation="MTRRACDLLIVGAGPAGMAAAMAARSAGLSVVVADEGPSPGGQIY
FT                   RNLADVPAKLAQWLGPDYAAGRPLIDGLLASGAHYLPRSVVWQIAFEPAPVAMLTLGGA
FT                   ARGTLEIDARAVLIATGAQERPWPVRGWTLPGVMGVGAAQTLLKSSGLAPSADTVLAGS
FT                   GPLLWLFAAQLLNAGRRVRALVDTTPPDAWRRALPHALPALRGADYLLKGWRMLRAVRD
FT                   AGIPVYRGATDVRVDGDGRAQYLRFRDADGIAHALDTSLVLLHQGVIPSTQLARSIGCA
FT                   HEWDERAACWRPQRNARGRSSVAHVWIAGDGAGIGGAQAAAIAGEVAALDIAASVGALA
FT                   PHEQAARERPLLKAWRRHLAVRPLLDALYTPPAALRRPDGDTIACRCEEVTAGEIRRLA
FT                   SLGCQGPNQMKAFTRCGMGPCQGRWCGTTVGELIAEVQQRDVADVGQYRVRAPIKPITV
FT                   DELADAVELSDDFRRGDFPS"
FT   CDS_pept        complement(192098..192397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05532"
FT                   /product="uncharacterized NAD(FAD)-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05532"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47362"
FT                   /db_xref="GOA:A0A0H3KQK5"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQK5"
FT                   /protein_id="BAG47362.1"
FT                   /translation="MFESIVPADAIRERVRIHVDGIAHDVPAHYSVAAALLAAGTLACR
FT                   STAVSASPRGPFCMMGVCFDCLVEVDGVPNVQGCMTPVRDGMQVRAMHGKARLA"
FT   CDS_pept        complement(192390..193514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05533"
FT                   /product="putative octopine dehydrogenase"
FT                   /note="COG0665: Glycine/D-amino acid oxidases
FT                   (deaminating), Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05533"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47363"
FT                   /db_xref="GOA:A0A0H3KY53"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY53"
FT                   /protein_id="BAG47363.1"
FT                   /translation="MNVRSFDVVVAGGGLVGMALAWGLARLGERVAVCDGDDIAFRAAR
FT                   GNFGLVWVQGKGGRCLPYARWSRESSERWGAFAAQLQRETGVDCGFERPGGIELFEHAA
FT                   DMNDAIALLESLRRQDAALAYEALDPAELRRRIPAASAALAGALWSPNDGHANPLYTLR
FT                   ALLQAFLQNGGVYLPRHDVVEIRPRAGRFEVDTRDVRLDAARVVLAAGLDNARLAPMVD
FT                   MAAPISPLRGQIMVTERLAPFLAYPTLVVRQTQEGSVLLGDSAEDVGFDDGQTRPAMAD
FT                   IARRARTAFPALAHARIVRAWGALRIMTPDGLPVYEASRTHPGAYLAICHSGVTLAASH
FT                   ADLVAPWIAGRAAPAELSAFTTARFAAPKEARHV"
FT   CDS_pept        193664..194578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05534"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Salmonella
FT                   typhimurium LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05534"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47364"
FT                   /db_xref="GOA:A0A0H3KQ56"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ56"
FT                   /protein_id="BAG47364.1"
FT                   /translation="MTTPSLRIRQIEAFRAVMQRHTVTRAARDLHISQPAVSRLIADLE
FT                   ARVGFVLFERQQGRFTPTAQARVLYEEVERAFIGLDRVAQAAEQIRAMRRGTLRVAGSP
FT                   AVALDLLPERITRFARAHPGVDITLLAHSASTVVDKIASGQCDVGLIAEPVPHPAVRSE
FT                   RLADAPMRCIVPRTHRLARKRVIRPDDLRDEAFVSFPPSFEARSAIDRVFVDAGVSRGL
FT                   SIEAQLSQTIVAFVANGAGVALIDPVTAAYAGHRVAVRPFEPVVPDHFYLVTSASQPLS
FT                   MIGEAFCTDLREAFGRMRALRDA"
FT   CDS_pept        complement(194655..196706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sqhC"
FT                   /locus_tag="BMULJ_05535"
FT                   /product="squalene cyclase"
FT                   /EC_number="5.4.99.17"
FT                   /note="COG1657: Squalene cyclase, Nostoc sp. PCC 7120"
FT                   /note="KEGG, K06045"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05535"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47365"
FT                   /db_xref="GOA:A0A0H3KQ00"
FT                   /db_xref="InterPro:IPR006400"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR018333"
FT                   /db_xref="InterPro:IPR032696"
FT                   /db_xref="InterPro:IPR032697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ00"
FT                   /protein_id="BAG47365.1"
FT                   /translation="MIRAMNKSALSPWSALDTAIARGRDALARLQQPDGSWCFELESDA
FT                   TITAEYILMMHFMDRIDDALQERMARYLRAIQRLDTHGAWDLYVDGAPDVSCSVKAYFA
FT                   LKAAGDSEHAPHMIRAREAILKLGGAARSNVFTRILLATFGQVPWRATPFMPIEFVLFP
FT                   KWVPISMYKVAYWARTTMVPLLVLCSLKARARNPRNVAIPELFVTPPDQERHYFPPTRG
FT                   MRRAFLILDRVVRHVEPLLPKRLRRRAIRHAEAWCAQRMNGEDGLGGIFPPIVYSYQMM
FT                   DVLGYPEDHPLRRDCENALAKLLVTRPDGSVYCQPCLSPVWDTAWSTMALEQARSVAVP
FT                   ESDESARALDELDARIARAYDWLATRQVNDLRGDWIENAPADTQPGGWAFQYANPYYPD
FT                   IDDSAVVTAMLDRRGRTHRNADGSHPYAARVARALDWMRALQSRNGGFAAFDADCDRLY
FT                   LNAIPFADHGALLDPPTEDVSGRVLLCFGVTRRAEDRASLARAIDYVKRTQQPDGSWWG
FT                   RWGTNYLYGTWSVLAGLTLAGEDPSQPYIARALEWLRAHQHADGGWGETNDSYLDPALA
FT                   GTNGGESTSNCTAWALLAQMAFGDCASDSVKRGIAYLQSVQQDDGFWWHRSHNAPGFPR
FT                   IFYLKYHGYTAYFPLWALARYRRLAGAAEARARASSGRAPHAADTALA"
FT   CDS_pept        196906..197493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05536"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator, Sinorhizobium
FT                   meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05536"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47366"
FT                   /db_xref="GOA:A0A0H3KUP6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUP6"
FT                   /protein_id="BAG47366.1"
FT                   /translation="MRAQLLDAASEIATHHGVAALTLDAVAERAGVTKGALQYHFANKQ
FT                   GLLDALFEQATERFAAQMAARRAADPHGEGAAARAYLHAVLDTAQPAASTDVLRVLVAS
FT                   MITDQETRARWSVPMREWTRPDPVPLEQAATLMICRLAADGLWISELLDSVEMSAELRT
FT                   EIVRQLDRMSGGGAPQAGTKPRAQARARGRRG"
FT   CDS_pept        complement(197506..198609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05537"
FT                   /product="putative LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05537"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47367"
FT                   /db_xref="GOA:A0A0H3KQK9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQK9"
FT                   /protein_id="BAG47367.1"
FT                   /translation="MTTIRSADESIAALYAAAIDPEQWHVALRALVALADARAANCFVH
FT                   DARTGRFLEYRFTGYGSGWADAYASHYHSLDLAREVLMREPAGRMYPMHRFLPDSVIDR
FT                   SEYYQDFYIREGLRYSCGGMRLEGDRRLILAVHRPVNHQPYDAHTVRELQRVLDHLPNV
FT                   FRVRETAAQTHDSAPMLAAALDALPRAVIVVDDTLRVRYMNAAASALLGASTELRVQAD
FT                   RVVASSPQVAPQLAQRVKDACTPPHVAAPQPLYALDRERRPTLEIQVVPLKPQLTASLD
FT                   RDTRPLAMLLPRRPFRGAARPHAEGAPFALTPAEMAVASGIAGGLTPAEYAQRNGVRIS
FT                   TVRSQIKSIFAKTGVRRIADLVALFGD"
FT   CDS_pept        199002..199262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05538"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY59"
FT                   /protein_id="BAG47368.1"
FT                   /translation="MLTRDYVERELSHIQRMVAMLESDSGTKAYLPGAARVSCPSYWRG
FT                   RIEALLSTPDMPRHARKISETLLVKIDGMEARFAARASARR"
FT   CDS_pept        complement(199406..200347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BMULJ_05539"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="COG0329: Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase, Brucella melitensis"
FT                   /note="KEGG, K01714"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05539"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47369"
FT                   /db_xref="GOA:A0A0H3KQ62"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ62"
FT                   /protein_id="BAG47369.1"
FT                   /translation="MSDNIFTGTIPALMTPCTADRQPDFDALVKKGKELVEIGMRAVVY
FT                   CGSMGDWPLLTEAQRQEGVARLVAAGVPTIVGTGAVNSKEAVSHAAHAAAVGAHGLMVI
FT                   PRVLSRGASPAAQKAHFSAILKAAPNLPAVIYNSPYYGFATRADLFFELRRQHPNLIGF
FT                   KEFGGAADMRYAAENITSQDDSVTLMAGVDTQVFHGFVNCGAAGAITGIGNALPREVLH
FT                   LVELCKKAAQGDAVARARAKELESALAVLSSFDEGCDLVLFYKYLMVLNGDKEYTLHFN
FT                   ETDVLSDAQRNYAETQYTLFRNWYANWSKTLG"
FT   CDS_pept        200752..202128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05540"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47370"
FT                   /db_xref="GOA:A0A0H3KQ05"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ05"
FT                   /protein_id="BAG47370.1"
FT                   /translation="MTGQVGDAVSPGNAAAQRAASNSALKRVVAASMVGSIAEWYEFFL
FT                   YGTASALVFGTHFFRKTGNPVDGLLAAFALYAVGFAARPIGGLVFGYYGDKFGRKHLLQ
FT                   VSLIVVGVTTFLMGCLPTFDAIGYWAPALLVTLRLIQGFAFGGEWGGAVLLVSEHSPDD
FT                   RRGYWASWPQAGVPAGNLVATIILLVLSSSLPESEFLSWGWRAAFWFSAVVVLIGFWIR
FT                   RKVDDAPIFKDAQARRERNQEKQLGVMHVLRHHWREVLIGIGARFAENILYYMVVTFSL
FT                   TYLKLVVGADTTRILKLMFAANAIHFFFIPLMGLMSDLVGRKPVYLTGAVLTACWGFVA
FT                   FPMMDTGNDWIIMAAIVLGLFIESMTYSPYSALMTEMFPTNVRYTALSLCYQVAPLMAG
FT                   SLAPLIGLSLLERYHSSMPIAIYLVVAAAISIVCVGVAKETRGKSLRDVDADAQRRTAR
FT                   "
FT   CDS_pept        complement(202251..203609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05541"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUQ2"
FT                   /protein_id="BAG47371.1"
FT                   /translation="MTRSTRIARLSIPVALVALGVAACGGDASSPAASASAGSRNPLAT
FT                   DDQIAAEKRALELVQAPAVIEAKAVLKSKWLAVAQTLGGVPAEAMASLDTAVDETVFSN
FT                   ALSIANRDPERPKIVSLLAAPHAWFGLNVPGSRTTFDNPDTIYRTFVVDPAASYVVAGH
FT                   VDRHAPVDVNISLWNSANATLSNLAGQQLAIDADGNFTITADANAQGSGNHVQLTPTAA
FT                   SFFIRDTVNDWGVQQFNRLSVKRVPATTTASTVTQDAQAAALASTLGKVGDVFAYYNAL
FT                   AYAQPVNTLPAITRGGANGRLSSQAATYSAFRLADDEALVLSVNLGGAKYFIAPAYSRW
FT                   TITTDYIGHTQTLNNTQAVADPDGTYTFVVSPSDPGVYNWVDTVGIHEGLLNLRWQGLP
FT                   DTAGAAPPSASARLVKLRDLPSVLPPTTKYVTAGERHAQQVARAASYASRYTP"
FT   CDS_pept        203935..204615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05542"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG1802: Transcriptional regulators, Sinorhizobium
FT                   meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05542"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47372"
FT                   /db_xref="GOA:A0A0H3KQL2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQL2"
FT                   /protein_id="BAG47372.1"
FT                   /translation="MNEKRPALVYATRAEAAANELRRRILSGEYVDGYQLRQDALATEL
FT                   GISRIPLREALVQLESEGLVKILPHKGAVVSELSPEDITELFELRALLEPVLLKKSIPK
FT                   LTAEDFARLDAILAEYSKVLHASQSGRWGELNTELHHVLLSRAEQPKTAAIVASLLQQT
FT                   DRYTRVQLSLSQAARDVAESEHAELVALCRKGDARAAASLLKRHIEHAGGELNAFLRER
FT                   RLGR"
FT   CDS_pept        complement(204644..204838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05543"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47373"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY65"
FT                   /protein_id="BAG47373.1"
FT                   /translation="MQTTKRSAGPNPDEPLNPGDEGPPDAPGVGEDLCGACHGTGMVEG
FT                   RPCTVCGGTGKVLQGIGGG"
FT   CDS_pept        complement(205059..207143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05544"
FT                   /product="endopolygalacturonase"
FT                   /note="COG5434: Endopolygalacturonase, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05544"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47374"
FT                   /db_xref="GOA:A0A0H3KQ67"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ67"
FT                   /protein_id="BAG47374.1"
FT                   /translation="MSAATLAACGGDEPGASAALAAAPSANSVFQVGTTTVDPNLPAEP
FT                   ALPTDAQVCSTLEASNTLVSRPDGSLPPEADPSPSGVGKAVSAATANPDQARIQAALDA
FT                   CGAAVDAEVGAAIAAADAAATASQKAAAVPNVNLAGASGETLAQPKYRASKFAVRLVVN
FT                   HAGAGNGFISGPLTLPSGVTLWIDKGVTLYASRDVKAYAPNVAGPYCGNTAVSATKAGS
FT                   SSNCLALITGTNLVNAAVVGDGRIDGRGYAELVTSDAKYPLMKVDLTCSNTYAAYRNGT
FT                   VAPDGTACDDGGTVVDSKSTVRNMTWWDLAYLGNMVQNGTTGFGSQSNFRLMVFNYAKN
FT                   LTLYRITLNNSPNFHVVPSGIDGLTVWNVKVQTPTLAAFANPAGNGNPLYNGQTFNADN
FT                   VKNTDAFDPGSASKPISAALSTGSTTTSASPVSFDGYLKNVVFAYNYVSTGDDDIALKG
FT                   GNNPSPAGSQLPGIDGNRDVRADRKWGIAIAHNHIYWGHGISIGSETNGGVTNVQVYDN
FT                   SFQDSEEGLRIKSDYARGGEVSQIHYANICIRDAKNALLFTPYYSTKAVPAGGPLYPNF
FT                   HDISLANVAIFGEAGVKLQGFEANTGGYGEPAFPLAMTLTDVVADTPDSISVIASDANL
FT                   TLHNVNLPIFASTANRVVVDGMATHNARPANVVDCSKAFVDFPGIDQSNPFGTTWAPSL
FT                   "
FT   CDS_pept        207737..208723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05545"
FT                   /product="PTRAP-type C4-dicarboxylate transport system
FT                   periplasmic component"
FT                   /note="COG1638: TRAP-type C4-dicarboxylate transport
FT                   system, periplasmic component, Agrobacterium tumefaciens
FT                   strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05545"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47375"
FT                   /db_xref="GOA:A0A0H3KQ09"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ09"
FT                   /protein_id="BAG47375.1"
FT                   /translation="MKHRFTRSRTALAVALLAGFAASAHARVFRSADVHGDNFPTNMAV
FT                   KYMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAIDMARVNGASFNEIVPESLI
FT                   PSFPFLFRDIDHFRKAMYGPAGQKILDAFAAKGMIALTFYESGARSIYAKRPVRSPADM
FT                   KGLKVRVQPSDLMVDEIKAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEV
FT                   APDYSETQHAMTPEVLVFSKKVWDKLTPEEQTAIRKAAADSVPYYQKLWTAREASAQQI
FT                   VTKGGAKIVPASQVDRAAFVKAMQPLWAKYEKTPQMKQIVDEIEAIK"
FT   CDS_pept        208720..209289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05546"
FT                   /product="putative tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05546"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47376"
FT                   /db_xref="GOA:A0A0H3KUQ7"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUQ7"
FT                   /protein_id="BAG47376.1"
FT                   /translation="MTRHTSLDGAAAGAPASAAADGGAAARPHPVPVLRRVNDVLFRVL
FT                   AVIASLCLAALTVLVFYAVVMRYVFENAPDFVEPIALLLVIVIAMFGAAMKVRDGGHIG
FT                   LDSFVRRLNPRARDAVVAFQHLSLIGFAIAILVGCGSMAVETMGDRIPIIGLPEGVRYL
FT                   ITIPAAVAIILFSLEHLLALRRASRP"
FT   CDS_pept        209296..210648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctM"
FT                   /locus_tag="BMULJ_05547"
FT                   /product="TRAP-type C4-dicarboxylate transport system large
FT                   permease component"
FT                   /note="COG1593: TRAP-type C4-dicarboxylate transport
FT                   system, large permease component, Caulobacter vibrioides"
FT                   /note="DctM protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05547"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47377"
FT                   /db_xref="GOA:A0A0H3KQL5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQL5"
FT                   /protein_id="BAG47377.1"
FT                   /translation="MELAILSVSFLIFLVLGVPVSFALGIACVLTYMVEGLPIATAMQS
FT                   MISGMNAFSFLAVPFFIFSGELMLHGGIADRILRFAQATVGHFRGGLGMANVVACTLFG
FT                   GVSGSPTADTSAMGGVVIPLMKREGYSAAYAVNVTTHASLAGALMPTSTNMIIYAFAAQ
FT                   GITGMLHGQPVSGVSIGDLLFSGLLPVLWVMGFVLAAAYWQAVRHGYPRRADGSSALPA
FT                   FPAWYAVARSFVGAVPGLLVIAIILVCVAKGIATATEAAAIAVVYSLVLTAIVYRTLTL
FT                   DKLRRALSHASRTTGVVLLLIAVSNMLRFQMSYLEIPDAIEGLLKQSTAAPWLMLLYIN
FT                   IIQVFLGTFVDMAAHILITTPLFLPIAMACGVGPVQFGIMLLLNCSLGLVHPPIGSVQF
FT                   VGCAIGNVSIGETTKMAWPYYIAIFSAINIVTYLPFFSTWLPSLISGHPVY"
FT   CDS_pept        complement(210803..212272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP"
FT                   /locus_tag="BMULJ_05548"
FT                   /product="proline/betaine transporter"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Salmonella typhimurium LT2"
FT                   /note="KEGG, K03762"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05548"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47378"
FT                   /db_xref="GOA:A0A0H3KY71"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY71"
FT                   /protein_id="BAG47378.1"
FT                   /translation="MSTSQARPAKARSSRKSVKLDDITIVDRAVLKRAVGAMAFGNAME
FT                   WFDFGVYSYIAVTLGKVFFPSSSPSAQLLATFGTFAAAFIVRPLGGMVFGPLGDRIGRQ
FT                   RVLAMTMIMMAVGTFAIGLIPSYASIGIMAPVLLLIARLVQGFSTGGEYGGAATFIAEF
FT                   STDRRRGFMGSFLEFGTLIGYTLGAATVALLTATLSHEALLSWGWRVPFFIAGPLGLVG
FT                   LYVRLKLEETPAFKKEAEAREADERARPKQTLGALLVEQWKPLLQCVGLVLIFNVTDYM
FT                   ALSYLPSFMSSTLHFDESHSLVLVLIVMVLMMPMTLYAGHLSDRIGRKPVMMFGCVGLL
FT                   VLSVPALMLIRSGAMLPVFAGMLIYGTLLSTFTGVMPSALPALFPTRVRYGALAIGFNV
FT                   SVSLFGGTTPLVAAWLVDRTGDLMMPAYYLMGASFIGIVSVLALRESARRPLPGSAPCV
FT                   GSRAEALALMRGETGDARVRERKFAPAGERA"
FT   CDS_pept        complement(212646..213716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05549"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05549"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47379"
FT                   /db_xref="GOA:A0A0H3KQ71"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ71"
FT                   /protein_id="BAG47379.1"
FT                   /translation="MKHTFWIGCAAAAGAMACSGAFAQSSVTLYGNLDAALLYTNKTLD
FT                   ATTGRNAGHQFAMTDTGMTPTTFGMMGTEDLGGGLKAKFQLESGFAVTNGAFNHSNGNF
FT                   FGRQAWVGLDGAFGTVKAGLQYSPFLLAIFDSDPRSFSHFGSGLIPYVDNVLVTGLFNA
FT                   NAVSYTSPTIAGLTGSAMFAFGGAAGNFQAGRQYSASLKYEHGGFMINAAFYDGNDGGT
FT                   AATPVPSTVAFVGRTIGAAYRFGPVTAKASFASYKVGGSFSNNVYGGGLDYQATPAVDL
FT                   NGGVWYTSDRNDTANHSLLAALGASYSLSKATSLYAQVAMVDNHGAMNTGLGINNALYG
FT                   ATGTTVGANVGIRHAF"
FT   CDS_pept        complement(213965..215947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="BMULJ_05550"
FT                   /product="acetyl-CoA synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="COG0365: Acyl-coenzyme A synthetases/AMP-(fatty)
FT                   acid ligases, Ralstonia solanacearum"
FT                   /note="KEGG, K01895"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47380"
FT                   /db_xref="GOA:A0A0H3KQ14"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ14"
FT                   /protein_id="BAG47380.1"
FT                   /translation="MTALVSILHERRIFEPTADTRDRATLSGMEAYRALAAEAERDYEG
FT                   FWARLAREGLAWHKPFTKVLDESDAPFYKWFDDGELNASYNCLDRHVEAGNGERVAVIF
FT                   EADDGTVTRVTYADLLARVSRFANALKKRGIGKGDRVVIYMPMSIEGIVAMQACARIGA
FT                   THSVVFGGFSAKSLNERLVDVGAVALITADEQVRGGKTLPLKNIADEAIAMGGCDAVKS
FT                   VIVYRRTGGKIDWHADRDLWMHELADGESDTCAPEWVGAEHPLFILYTSGSTGKPKGVQ
FT                   HSTGGYLLWAAQTVKWTFDWKPTDVFWCTADIGWVTGHTYITYGPLACGGTQVVFEGVP
FT                   TYPDAGRFWKMIGDHKVSVFYTAPTAIRSLIKAAEADEKVHPKSYDLSSLRIIGTVGEP
FT                   INPEAWMWYHKHVGQERCPIVDTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAV
FT                   VDETGQDVPNGQGGILVVKRPWPSMIRTIWGDPERFKKSYYPEELGGRLYLAGDGTVRD
FT                   KDTGYFTIMGRIDDVLNVSGHRLGTMEIESALVAHELVAEAAVVGRPDDTTGEAVVAFV
FT                   VLKRARPEGEEAAALAKALRDWVGKQIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLA
FT                   KGEAITQDTSTLENPAILRQLARAL"
FT   CDS_pept        complement(216196..218034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05551"
FT                   /product="RNA polymerase sigma 28 subunit"
FT                   /note="COG0568: DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32), Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05551"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47381"
FT                   /db_xref="GOA:A0A0H3KUR2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUR2"
FT                   /protein_id="BAG47381.1"
FT                   /translation="MPDARQPAPAGGHDDTLASASTRFAGLIALGLSRGFVTRGDLIDA
FT                   LPDDDAHDAGIDAATAVLAELGIAVSDDAHAETGWSLDRYFRPAPLSRAAAERNGAFAA
FT                   FDLLVPRTTDPVRLYLREMGTVPLLTHDEEIAYAQRIERGRAASVAVLCGDPDALDALA
FT                   SIRREIAEGRAAASAYLMFVDAGGHADAAAALDLHGDAQHDDMRPGEPHVCDAALARLS
FT                   SLDVLARDMRAALTSGGTASRAYRAAARDAAALLRPLRLSARAVERIGAPLRGRARRHR
FT                   EQLARMTRVLRHAGIPSQTTWRYHDAHDDDHARWLAAGIAAHPECEPALKRSAPALFEA
FT                   RDALASEARASVLPPRTVALLDARLDAIERATRAAKTALFDANLRLVVSIAKRYPDRGL
FT                   PFADLIQEGNIGLLKAIDRYDHRRGFRFSTYATWWIRQSITHALADLGRTIRVPTHTVD
FT                   AINKLARLAREHRQRAGATATPAELAAQMGEPVDKVRDLMAIVKEPVSADLPIAPDGDM
FT                   TFVDVVPDASTPSPEDAADAAQRRAAIAAAIDRLPPREALIVRLRYGLHAGEGCSLRDI
FT                   GRRLNLSAERVRQIEASALARLRASGTLAVLRPFVG"
FT   CDS_pept        complement(218057..218374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05552"
FT                   /product="high potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05552"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47382"
FT                   /db_xref="GOA:A0A0H3KQM0"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQM0"
FT                   /protein_id="BAG47382.1"
FT                   /translation="MTYSTTRRTFIVQTLGLCAALAAARTATAAPPLVDENDATAKSLG
FT                   YRAHAAAVDAAQFPKYQPGQRCANCRFYKGEAADAAGTCPMFGGKAVAADGWCNVYAKR
FT                   A"
FT   CDS_pept        complement(218449..219687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05553"
FT                   /product="putative ABC-type amino acid transport/signal
FT                   transduction system periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05553"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47383"
FT                   /db_xref="GOA:A0A0H3KY77"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY77"
FT                   /protein_id="BAG47383.1"
FT                   /translation="MNLRLPHLAAACALASGAALTALPAAAAPVRVCSLPGTPTAALDK
FT                   AVAREAFRTAGVVATFAAPGVDGSDDDGVSAHELVRLLERDCDVLAGFPRSAIADASDT
FT                   TLLFSQGYLRSGYVSVTRRDAAASTSGREIVAATYASPAQLIAVQQQNAHFDLENTSEQ
FT                   TVAAVASGRAHRAIVWYPAVVAYQAAHPKQTFRIAPTSSPYTAWQLAFAFAPRSASLQQ
FT                   RIDTALTQMKRDGRLAALTRKWTLPANALEARNADAMPPVAGSIMRAGFVRARGLPAGG
FT                   GFIRIAASTAEHAPTFDAAQVEHGRTLYGNACAKCHGADLEGNTAPALSGPSFAPLSHS
FT                   HLTIGGVFGYMATNMPADQPGKLKDEEYADLMAFLLASNGYVAGKSKLTADTARASTAP
FT                   LVVGPAGHQAAGQ"
FT   CDS_pept        complement(219758..221485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05554"
FT                   /product="putative glucose dehydrogenase"
FT                   /note="COG4993: Glucose dehydrogenase, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05554"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47384"
FT                   /db_xref="GOA:A0A0H3KQ76"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR034119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ76"
FT                   /protein_id="BAG47384.1"
FT                   /translation="MKKLSASTSRLATIGIAAAAAIALNPGLVDAAADYPAVTYQRLTN
FT                   AQHDPGWLTYYRTYNGQAHSPLKQIDASNVGRLTQAWSYKFPAELKQGFEATPIVNGRY
FT                   LFVTTPKDNVYAFDAATGAQLWKYEPKLGAESFKTACCDVVNRGVALYGKNVYVAMLSG
FT                   EVAALDAQTGTLVWKKQMFEPGLGYAFSLAPLALDGAIVVGSSGGEYGARGFIAALNAN
FT                   DGSLLWKRFTIPGQGEKHGDTWPDGMQTHGGAPAWLTGTYDAATRTLYWGVGNPGPWLA
FT                   DLRPGDNLYSDSLLALDPKNGDLKWHYQYTKHDTWDYDGVNTPILATIRYKGQARDAII
FT                   HADRNGFFHAIDRDTGKLIYAEPFVKATSVTGYTEDGTPIQDPAKYPKVGTTIDTCPSF
FT                   LGGKNWWSVSYDPERHLAIVPSLHACMSLSGKSVNYMEGLPYLGEGFEIKPEPGSEGYG
FT                   ELQAIDVNTGKKVWSHWSKLPWNGGVATTASGLAFSGSLDGHLYAFDVSTGKVLWESPK
FT                   LASGIIAQPSVFEVDGKEYVAVLAGYGGANPIWGGPMAKAADDVPRGGTLYVFALDRT"
FT   CDS_pept        222084..224384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05555"
FT                   /product="putative Fe transport"
FT                   /note="COG1629: Outer membrane receptor proteins, mostly Fe
FT                   transport, Escherichia coli K12"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05555"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47385"
FT                   /db_xref="GOA:A0A0H3KQ19"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ19"
FT                   /protein_id="BAG47385.1"
FT                   /translation="MKETAPSKRRVAACRARIALCCGGAFGGLLIAWPAHAAPDDSRDA
FT                   TTLAPIVVVGTTPLLGLGTPLSRVPSNVQTVRSAEQERQHRSTLTDYLDKNATSVDIAE
FT                   AQGNPYQPDVNYRGFTASPVVGTPQGLSVFVDGVRINESFGDVVNWDILPPSAIDTLQL
FT                   IPGSNPTYGLNTLGGALAITTKNGSTSPGGAVEVGAGSWGRKTVQFEQGGRVGDRVDYY
FT                   LNANVANDNGWADHNASRVRQIFGKLRYTDADTTLSLSAGGADNTLQGTQTIPRSFLDN
FT                   PRQAYTYPDLNRNRAGYLTLSGDHAFGDRVQLSGNVYYRRYRNTNVSSNVNEDVGRADD
FT                   DDAADGAQATNDRSTIATERYGASLQLTLLGKPAGFDNQLVLGASADLANARFEQASQP
FT                   AAFTDSRATIGIGEFQQTTRAKTRNANYGFYFDDTLQLAPQWSLTLAGRYDWARAAIED
FT                   VSGLQPLLTARHTFSRFNPAIGVTWNPAPGLTAYATYNEGMRSPTAIELACADPAAPCS
FT                   LPNDFLADPPLKPVIAKTVEFGARGRVGAATTWSAALYRTTLDDDIQFVSSNGGAGTLG
FT                   YFQNVGKTRRQGIELAAHTRVGPVGIGVSYSYVDASYRSTWTEHSASNSSADARGNIVV
FT                   RSGDRIPGIPASTAKLRLDYAATPTWSLGTNLTYRSGVFARGDENNRDAGGKLPGYLLI
FT                   DVDTTWQATKHLQLFASITNLLDKRYASFGMLGRNFFNGPNHMFDGAAAVDETFVGPGA
FT                   PRGAWIGMRYAWD"
FT   CDS_pept        complement(224403..225425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="BMULJ_05556"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="COG0596: Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily) , Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K01259"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05556"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47386"
FT                   /db_xref="GOA:A0A0H3KUR7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUR7"
FT                   /protein_id="BAG47386.1"
FT                   /translation="MRMRCHAVRALARRRRPRSSIIARMNRRPERRPSAPSLRRLSRDG
FT                   CAIAWREAGHPRGHPVVVLHGGPGSGSRPAMLRLFDLQRMRVVLVDQRGAGASTPRGGL
FT                   RHNNTMRLIDDLEALRMRLGIARWGVVGGSWGAALALAYAGRHPAQVTGVVLRGLFLTS
FT                   ARELRAFFVGSRARAPRAWRQLAAAAGTARADRLLAACARGLRPGVDAGRRRAIARAWS
FT                   AYEDALLAGAPVRRMRTTPRALDRLADKYRIQAHYLQRRCWLGERRLLSLARRAAHAGV
FT                   PLHAVHGTRDAVCPVDNVARLARAVPAAIVERVPAGHLASDAALARRLARAIRTLFGDA
FT                   "
FT   CDS_pept        225666..227657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05557"
FT                   /product="sigma54-dependent DNA-binding transcriptional
FT                   regulator"
FT                   /note="COG3284: Transcriptional activator of
FT                   acetoin/glycerol metabolism, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05557"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47387"
FT                   /db_xref="GOA:A0A0H3KQM4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQM4"
FT                   /protein_id="BAG47387.1"
FT                   /translation="MRDDVHPAADTRAAQAPGWPTPTIRKSHQRSETFGLQASARPDYD
FT                   VLSASELALKREQNRVLCVHAMPVMETLHEQIVNTQSMIVLTDAEGLILHSIGDDDFLR
FT                   RAERVALRPGANWAEDRQGTNAIGTALAELCPMVVHGDQHFLAANHFLTCSSVPILDPY
FT                   GDVIGVLDVTGDHRSYHQHTMALAKMSVQMIENHLFTTTFQETLQVSFHGRPEFLGTLM
FT                   EGIVAFTADGRFLSANRSAQFQLGMPLSALRAHTLASLFDVTSAQLIDRMRASTEPYVM
FT                   LNLGNGAVVCARVQFRRALRAEGSRPADVHDGGAVPAARPAAAHGAASLSRLSYLDTGD
FT                   PQVAAVIAKVRKVIGKDIPVLITGETGTGKELLAQAIHNDSPRRDGPFVAVNCASIPET
FT                   LIESELFGYEEGAFTGARRKGATGKLLQANGGTLFLDEIGDMPYPLQVRLLRVLQERIV
FT                   NPLGSTKAIGVDIAIICATHRDLREMIAQNRFREDLYYRLNGLVVRLPPLRDRTDLAVV
FT                   VQKMLQRETLSGPGRRPLSVAPDVMALFERCAWPGNFRQLANLLRTAAAMVDDDGEIRC
FT                   EHLPEDFFDDLRCDDAQSAQDGVAAPPVAADPFAAGDARLQDVAACAIAAALARHGGNV
FT                   SAAARARRVAQHDLPEDAVGRHGAAAHG"
FT   CDS_pept        228092..229015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqB"
FT                   /locus_tag="BMULJ_05558"
FT                   /product="pyrroloquinoline quinone biosynthesis protein B"
FT                   /note="COG1235: Metal-dependent hydrolases of the
FT                   beta-lactamase superfamily I, Pseudomonas aeruginosa"
FT                   /note="KEGG, K06136"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05558"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47388"
FT                   /db_xref="GOA:A0A0H3KY83"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY83"
FT                   /protein_id="BAG47388.1"
FT                   /translation="MKIRILGSGAGGGLPQWNCNCANCRRARAGTDGIVPRTQSSIAVS
FT                   SDGVDWVLVNASPDILAQLRAAPELQPARAVRDSGIVAVVLCDAQIDHVTGLLMLRERT
FT                   SPLPLYASAPVLDDLSTALPIVPLLGHYCGVDAHAIALHEPFAIPGAGGIRFTAVPVDS
FT                   KAPPYSPRRAAAAPGDNVALLIEDVASGRRAFYAPGLADVDDRVQAAMQDADLVLVDGT
FT                   FWTGTEMIELGLSAKHAADMGHLAQRGDGMRPGMIDRLRALPAQTRKVLTHINNTNPIL
FT                   DPASAERAHLHGHGIEVAHDGMHFEV"
FT   CDS_pept        229018..229737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqC"
FT                   /locus_tag="BMULJ_05559"
FT                   /product="pyrroloquinoline quinone biosynthesis protein C"
FT                   /note="COG5424: Pyrroloquinoline quinone (Coenzyme PQQ)
FT                   biosynthesis protein C, Pseudomonas aeruginosa"
FT                   /note="KEGG, K06137"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05559"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47389"
FT                   /db_xref="GOA:A0A0H3KQ79"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ79"
FT                   /protein_id="BAG47389.1"
FT                   /translation="MNAPISAAALHASPWSADEFEARLRALESRYHIHHPFNRRLNAGA
FT                   CTPAQIRGWVANRFYYQISIPLKDAAILSNCPDRDTRRLWVQRILDHDGHGDDAGGIEA
FT                   WVRLGEAVGLDRAALWSLEHVLPGVRFAVDAYVNFARRATWQEAVCSSLTEMFAPQIHL
FT                   DRLAGWPSHYSWIDADGLQYFRSRLPLAQRDVEHGLAVTLAHFTTADAQRRALEILTFK
FT                   LDVLWSILDAIEKAYCA"
FT   CDS_pept        229734..230012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqD"
FT                   /locus_tag="BMULJ_05560"
FT                   /product="pyrroloquinoline quinone biosynthesis protein D"
FT                   /note="KEGG, K06138"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47390"
FT                   /db_xref="GOA:A0A0H3KQ24"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ24"
FT                   /protein_id="BAG47390.1"
FT                   /translation="MNSVDVSGVPLRPTLRGMYRLQWEAAQDAYVLLYPEGMVKLNPSA
FT                   GEILARCDGTRELDEIIGELERLFSTSDLASDVYRFLDHARLRGWLD"
FT   CDS_pept        230014..231147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqE"
FT                   /locus_tag="BMULJ_05561"
FT                   /product="pyrroloquinoline quinone biosynthesis protein E"
FT                   /note="COG0535: Predicted Fe-S oxidoreductases, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K06139"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05561"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47391"
FT                   /db_xref="GOA:A0A0H3KUS4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUS4"
FT                   /protein_id="BAG47391.1"
FT                   /translation="MTRDPNPPSPSPPLWLLAELTYRCPLHCAFCYNPVDFATHGAELD
FT                   TDTWRTVIADARALGAAQLGFSGGEPLQRDDLETLVEHARSLGFYTNLITSGIGLTAAR
FT                   IERLKAAGLDHIQLSLQDSTRELNDFLTSTRTFELKRSVARLIKSHGYPMVLNCVLHRY
FT                   NLPHVDRIIEMALDLGADFLELANTQYYGWAMLNREQLMPTAEQLRDAEETVNRYRKLV
FT                   GERCRILFVVPDYFEQRPKACMNGWGSVFLGVAPDGTALPCHAARALPALALPNVRERS
FT                   LKEIWYDSDAFNAFRGDGWMREPCRSCDERHVDHGGCRCQAYLLAGDPAEADPVCAKSA
FT                   HHGRVEHAVRLARRATPRDEQPLVFRSVANSIARAGG"
FT   CDS_pept        complement(231144..232235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05562"
FT                   /product="putative topoisomerase IB"
FT                   /note="COG3569: Topoisomerase IB, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05562"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47392"
FT                   /db_xref="GOA:A0A0H3KQM8"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQM8"
FT                   /protein_id="BAG47392.1"
FT                   /translation="MRRRMKPRAPRSAAGNGMRMSDARAAATLRHVDDRQPGYTRRRVR
FT                   NGFAYYTQDGERIRDPDEIARINALAIPPAYTDVWICADPRGHLQATGRDARGRKQYRY
FT                   HPQWRATRDANKYARMAAFALALPRIRARVARDLARPGMPREKVVATIVRLLDTTLARI
FT                   GNAEYARENESYGLTTLRKRHLKIESGQVRLRFVGKSGVEHDVTVDDPRVARIVRRCAE
FT                   LPGHELFQYVDDDGERHSIGSADVNDYLREVAGAEFTAKDYRTWAGSVQALALLRRAPH
FT                   GGVTEARKQIVETVRAVADMLHNTPAVCRRCYIHPDVLEMYESGRLDTLVIRRAPRGLR
FT                   ADEAAFAALVAGAARRAAKTARA"
FT   CDS_pept        232579..233541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05563"
FT                   /product="simple sugar transport system substrate-binding
FT                   protein"
FT                   /note="COG1879: ABC-type sugar transport system,
FT                   periplasmic component, Escherichia coli O157:H7"
FT                   /note="KEGG, K02058"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05563"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47393"
FT                   /db_xref="GOA:A0A0H3KY88"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY88"
FT                   /protein_id="BAG47393.1"
FT                   /translation="MTNIRKLAAGALVAATAMLASGAYAQQKPITLGFSQVGAESAWRT
FT                   ANTVSVKSAAKEAGINLKFSDAQQKQENQIRAIRSFIAQKVDVIAFSPVVESGWEPVLT
FT                   EAKAAHIPVILTDRAVDVKDPSLYVTMIGSDFLEEGRRAGHWLEERYKNDAGPINIVEL
FT                   QGTVGSAPANDRRAGLLEVIKNNPKFKVIASQSGDFTLAGGKQVMEAFAKTYGKQINVV
FT                   YAHNDDMALGAIQAMEEAGIKPGKDVSVVSFDATKGGFQAMIAGKINVDVECSPLLGPQ
FT                   LMTAVKDVVAGKQLPKRIVTNETVFPMNVAAQVLPTRKY"
FT   CDS_pept        233603..235114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05564"
FT                   /product="simple sugar transport system ATP-binding
FT                   protein"
FT                   /note="COG1129: ABC-type sugar transport system, ATPase
FT                   component, Sinorhizobium meliloti"
FT                   /note="KEGG, K02056"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05564"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47394"
FT                   /db_xref="GOA:A0A0H3KQ85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ85"
FT                   /protein_id="BAG47394.1"
FT                   /translation="MTNPPVVEMIDIDKTFPGVNALQRVSFRLFPGEIHALMGQNGAGK
FT                   STLINVLTGVHAHDAGEIRVGGTPVRFAAPREAEAAGIQTLYQEVNLCANLSVAENIFA
FT                   GRQPMRRGAIDWKTIHARARDALAELDLSLDVTRSLDAYPIAVQQMVAIARAVSVDARV
FT                   LILDEPTSSLDDGEVARLFDVLRRLKASGIAILFVTHFLEQTYAISDRITVMRNGEREG
FT                   EYLARDLPVDALVAKMTGRERLSDTLQARAAEAARGGASAPFLSMQQVGRRGMISALDL
FT                   DVRPGEIVGLAGLLGSGRTETAQLAFAAERADTGAIEIDGARARLASPHDAVRHGIAYC
FT                   PEDRKKEGIVAALSIRENIVLALQARRGWWRLIGRARQRELADAYIERLGIKARDAEQP
FT                   IGLLSGGNQQKVLLARWLATDPKLLILDEPTRGIDVAAKFDIMERVLGLCAKGLAILFI
FT                   SSEISEVVRVSHRIAVLRDRRKVAEVSGADASEEQIYRLIAGGQS"
FT   CDS_pept        235111..236151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05565"
FT                   /product="simple sugar transport system permease protein"
FT                   /note="COG1172: Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems, permease components,
FT                   Escherichia coli K12"
FT                   /note="KEGG, K02057"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05565"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47395"
FT                   /db_xref="GOA:A0A0H3KQ29"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ29"
FT                   /protein_id="BAG47395.1"
FT                   /translation="MTRLRTLLRHPLVWPVLTLVLLFALDVAHRPSFLSIALLDGHLFG
FT                   APIDILNRAAPLVIVSLGMTLVIATRGIDISVGAIVAIAGAAAAIVLDGDPSRVGTALA
FT                   AALGVGVLAGAWNGVLVAFVGMQPIIATLILMVAGRGVAQLLTGGQIIPIGAPGYLALG
FT                   GGYLATVPCSVWFAVATIVAIALLVNRTALGLFIRAIGVNPVATRLVGLRAGAVVFGVY
FT                   LCSGVMSALAGILASSNVRSADGNNAGLLLELDAILAVTLGGTSLLGGRFSLAGSVLGA
FT                   LIIQTLTYTTYSIGVPPEATLVVKAVVVIVVTLIQSEAARALAIRHLSKLMPVARSRAT
FT                   TGATPR"
FT   CDS_pept        236148..237236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05566"
FT                   /product="simple sugar transport system permease protein"
FT                   /note="COG1172: Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems, permease components,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K02057"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05566"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47396"
FT                   /db_xref="GOA:A0A0H3KUS9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUS9"
FT                   /protein_id="BAG47396.1"
FT                   /translation="MNRFLGRLADPRTLPIVVTIVLFAALFGFGSVMYTGFFSMQVLTG
FT                   LLVDNAFLLIVAIGMTFVIVSGGIDLSVGSVVALTTIFCAVGAERLHWPVWVIVPLVLA
FT                   FGALYGAAMGALIHYFRLQPFIVTLAGMFLARGACFLITTQSITINEPTFHAIAAISVP
FT                   LGDGTLSAGALVALATLAAAIYVAHFTRFGRNVYAIGGNERSALLMGLPVARTKIGVYA
FT                   LSGFCSALGGVVFTLYVLSGYGLQAQGMELDAIAATVIGGTLLTGGVGYVIGSVFGVGI
FT                   LGTIQVLITFDGTLSSWWTRIVIGALLCVFCLLQRIIERHAARRRTGGTGLGAHGNKTA
FT                   DAAPTPAAPKPGEDAALVSSLR"
FT   CDS_pept        complement(237501..238316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05567"
FT                   /product="IclR family transcriptional regulator"
FT                   /note="COG1414: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05567"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47397"
FT                   /db_xref="GOA:A0A0H3KQN2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQN2"
FT                   /protein_id="BAG47397.1"
FT                   /translation="MEKIARTKKTAPAERDRRQRVQSASIGLLVLKELAACGGRATLTA
FT                   LAARLDENPAKVHRYLASLMEESFVAQDRGTQQYVLGPQCISIGLAAMRMADPIRLAEP
FT                   SLVRLRERLEVTCFVAIMGNRGPTIMRFEEPGLPVTVNVRAGSVMSLLWSATGRLFLAR
FT                   LDEPRVRQLAEDELASAPAELRAQLDRRDPVGTLQREIRAAGVATVRDTNLKGISAVSA
FT                   PVFDANGHMCAAITALGATGGFDASIDGPVATALRHEAELISAELGYTG"
FT   CDS_pept        238430..240778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhf"
FT                   /locus_tag="BMULJ_05568"
FT                   /product="cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /note="COG2124: Cytochrome P450, Corynebacterium
FT                   glutamicum"
FT                   /note="KEGG, K00517"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05568"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47398"
FT                   /db_xref="GOA:A0A0H3KY95"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KY95"
FT                   /protein_id="BAG47398.1"
FT                   /translation="MSVTQRDASSSQCPFHPAPAAAAAPNGCPVSAAAAAFDPFEDGYQ
FT                   QDPPEYVRWAREQEPVFYSPKLGYWVVTRYDDIKAIFRDNLTFSPSIALEKITPTGPEA
FT                   NAVLASYGFALNRTLVNEDEPAHMPRRRALLDPFTPDALKHHEPMVRRLAREYVDRFID
FT                   DGHADLVDQMLWEVPLTVALHFLGVPEEDMDTLREYSIAHTINTWGRPKPEEQVAVAHA
FT                   VGKFWQFAGKVLDKMREDPSGPGWMQYGIRKQKELPDVITDSYLHSMMMAGIVAAHETT
FT                   ANATANAMKLLLQHPDAWRDICEDPSLIPNAVEECLRHNGSLAAWRRLATKDVTIGGVD
FT                   IPAGAKLLIVTSSANHDEARFADADLFDIRRENASDQLTFGYGSHQCMGKNLARMEMQI
FT                   FLDEFTRRLPHMKLAEQRFTYVPNTSFRGPEHLYVEWDPALNPERRDRSVLRPRAAVRI
FT                   GEPSSHAVSRAVKVERVSICADRVAHVRLVSADGRPLPRWTAGSHIDVICGDTGITRQY
FT                   SLCGDPDERDAYEIAVLHEAQSRGGSAWVHANLRAGDVLKIRGPRNHFRFVTDAGKAIF
FT                   VAGGIGITPISAMAREAKARGIDYEIHYSGARRASMAMLDTLAALHGERLHVYVSEEGT
FT                   RNDFHALFAQPADDAHIYACGPARMLDALDASCAHWPRDALRVEHFVSTKAALDPSKEQ
FT                   QFEVELKDSGITLTVAANQTVLDALQHANIDVQSDCREGLCGSCEVRVLAGRVDHRDSV
FT                   LTRAERDAHDRMMTCCSRACGGERLVLEL"
FT   CDS_pept        240838..242157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05569"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05569"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47399"
FT                   /db_xref="GOA:A0A0H3KQ91"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ91"
FT                   /protein_id="BAG47399.1"
FT                   /translation="MKKRANLMFACTVGTTLEWYDFFAFAACAVLVFDKQFFVVGNPLA
FT                   ATLLALAMFAVGFVARPLGGIVFGMIGDRIGRRKTLVVSLLMMGISTFCVGLLPTYASI
FT                   GIAAPLLLVLLRIVQGIAVGGEATGAILMIAESMPGTQRGFWTSFTMFAGPLANVLTAF
FT                   VIGMVQRVYGDTAFVDWAWRIPFFISALLVIVGFWTRRRVEESAAFAELAAAHKTVERA
FT                   SLREACAGNWRQMARAFFVKAAENTFLYLFSTFALGLATGYLHFSRPQALSALMWASAI
FT                   EVVVILIAAHVSDRIGRRPVLIAGLIGAAVAGCSLFTLSPGSDYAHLQLALIACLTCHG
FT                   IILGPMAAYMAELFPTRVRFTALSTSYQLASVLGGSIAPIVGTLLVSYTGSAIFVAGYA
FT                   ILMALPAFVAVIASRESRGQDFAFQPASGGNARVKDHAAA"
FT   CDS_pept        242418..242699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47400"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ34"
FT                   /protein_id="BAG47400.1"
FT                   /translation="MNRKLIAAVALAAVVGTPVAAFAQSSPSGITRADVIADLVQAERD
FT                   GTVPTSEWDYPPSAQTVARNRELYAIAHGEQRTATAAVATPGSGANVQ"
FT   CDS_pept        complement(242915..244168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sotB"
FT                   /locus_tag="BMULJ_05571"
FT                   /product="L-arabinose/isopropyl-beta-D-thiogalactopyranoside
FT                   export protein"
FT                   /note="COG2814: Arabinose efflux permease, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K08159"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05571"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47401"
FT                   /db_xref="GOA:A0A0H3KUT4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUT4"
FT                   /protein_id="BAG47401.1"
FT                   /translation="MQTPSTPSESPAATPSWTGVWALALSAFIFNTTEFVPVALLGAIG
FT                   GSLEIAPTDVGLMLTIYAWTVALTSLPLTLLTRKVERRRLLVWVFALFIASHVVTGVAW
FT                   NFPVLVIGRLGIAAAHAVFWSISIALAVRLAPPDKKSRALGLIATGTAIAMVAGIPLGR
FT                   VIGETLGWRMTFLAIAATALVPLLMLRYTLPELPSQRTGSLASVPVLLRNPALILLYAI
FT                   TILIVSAHFTSYTYIEPFVRDVNHASENRITYILVLFGAAGIPAAVCFNRLFPARPAHF
FT                   LLASIVATSTCLLILFPSALTIVTLSVHTVAWGGAIICFGLAMQAWVLKLAPDATDLAM
FT                   SIYSALYNVGIGGGALLGNHIANDFGLPWIGTFGGLLGGLGAALCWLALRLHARHAAVA
FT                   AATSAAPAASHPATPAAD"
FT   CDS_pept        complement(244242..245366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05572"
FT                   /product="poly(3-hydroxybutyrate) depolymerase"
FT                   /note="COG3509: Poly(3-hydroxybutyrate) depolymerase,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05572"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47402"
FT                   /db_xref="GOA:A0A0H3KQN7"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQN7"
FT                   /protein_id="BAG47402.1"
FT                   /translation="MPRKKSGLRLWPFDLRGVTTAAPAKKKRAKPATSPARPATARPAK
FT                   RATAAAAGRTSVRDAPGTWLRSFHSARPAAGQFINHLAYELYLPVAAAAGKAMPLVVML
FT                   HGCKQTAESFAAGTRICRLAERAGFAVLFPEQAKTAHSQRCWNWHGDTSQSEAPAIASL
FT                   IDAVARERAIDRTRIYLAGMSAGAGLAARLAIRYPDLFAAVGLHSGPAIAPPLSTMAAV
FT                   GLMRRGLRDDAIGVADACVDVAAYPGMPALIVHGGLDAVVTDRNATQLGLAFARLNRLV
FT                   DEHGAPRVGEQHTYVDADADYTDYLRGRSVIVRVCVVRRLAHAWSGGDPREPFHSATGP
FT                   DATAMFWNFFRRRRRAVAGADVAPARRTMRARSR"
FT   CDS_pept        246812..247897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05573"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4804: Uncharacterized conserved protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05573"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47403"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYA0"
FT                   /protein_id="BAG47403.1"
FT                   /translation="MVTAGARRPADSSIPNKMTELVPASLLTDLRRMIDSARARAAAAV
FT                   NAELTLLYWQVGRRIRDDVLGGERAGYGQQILPALARQLRAEYGRGWSEQQLRHCIRAA
FT                   EVFPDEPILSALRRELSWTHLKMLMYVDDPLKRDFYIELCRLERWSSRQLQERMQSMLF
FT                   ERSALSRQPDEVIRREVAHLRDAQQMTPDLVLKDPYILDFLGLNDHYLERDLEDAILRE
FT                   MEQFLLELGAGFTFVARQKRLPIDDDDFYLDLLFYNRKLKRLVAIELKLGSFKAEYKSQ
FT                   MELYLRWLAKHEQEPDEAPPIGIILCAGKKQEQIELLELGKSGIHVAEYLTVLPPRETL
FT                   QAKLHQSIAAARARLDGKGKS"
FT   CDS_pept        248142..249338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05574"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47404"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ96"
FT                   /protein_id="BAG47404.1"
FT                   /translation="MISIGDIYDKDLNFLFGSGASIGLLPTLQLQMRTGVGEARYSLEE
FT                   LATKFEQDDDDRRRLVTLFMHYYSACIRPAERLTLDAAVGTEAGAMTIKNYRTFLTTVL
FT                   EMVSRRKALDRRCNLFTTNYDGCFPLVADELIKEGRTDFVLNDGARGFSKRILHARNFG
FT                   SYLCQTGVFGRFQSSTPQINLIHLHGSVYWSKAGSAIQVSYETKDREDLLDVGTAELLR
FT                   PFSAALSNPDAELAQLPDTGIDNEVLEQFWAKYERMPIVNPTKWKFHETVYEEHYYQML
FT                   RLLSYELEKHNAVLITFGFSFADEHILNLVMRSLSNPGLQVFICCYSPSGRAAMEEKFK
FT                   GHRNVRCLALEGENMDFTAFNEKVLVWPEAVAATPVVALPPPADSAVPGVHRAGEDLV"
FT   CDS_pept        249338..250588
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05575"
FT                   /note="inactivated hypothetical protein"
FT   CDS_pept        250589..251125
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05576"
FT                   /note="KEGG, K06915"
FT                   /note="inactivated hypothetical protein"
FT   CDS_pept        complement(251753..252727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05577"
FT                   /product="putative ring-hydroxylating dioxygenase large
FT                   terminal subunit"
FT                   /note="COG4638: Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit,
FT                   Mycobacterium tuberculosis H37Rv"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05577"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47405"
FT                   /db_xref="GOA:A0A0H3KQ37"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ37"
FT                   /protein_id="BAG47405.1"
FT                   /translation="MDAGTSPEPVIGCPRPLPYPNGWFALCYSDELKPGDVRIAPFMGH
FT                   ELVVYRTARGEAHAVEPYCPHLGAHLGHGGKVNGDDLVCPFHGLAFGPDGTCIRAPGDR
FT                   PPPRAALARWLTCERHGAVLVWRDSDRAQPDWEIDEVEPAHGFSPSRKSCDLFDGYVHD
FT                   VGENSADVMHFAHLHGFTSTSMTYEIGRSSITFDMTGRFRGVLINMHFVNYGVGCVIGT
FT                   STAPSLGATVVTKVFTTPTAPLKWTLRVSNAVHVSRVAALPRWLRTPLNTMLIAFAHRW
FT                   AIGVARDDFPIWNHRNFVDHPKLMAGETSIAVYRRWMKRFYPE"
FT   CDS_pept        complement(252778..254151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05578"
FT                   /product="cytochrome P450"
FT                   /note="COG2124: Cytochrome P450, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05578"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47406"
FT                   /db_xref="GOA:A0A0H3KUT7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUT7"
FT                   /protein_id="BAG47406.1"
FT                   /translation="MLLNPLSRRVRMQQGMPVLPGAFPVVGHLPAVARALPDLLAYGER
FT                   RWGTHFWLDMGAMGRMLVCTRPEAFELFNNKDVLADLLGDVAPAMRDTMATQDGELHRR
FT                   TRAWANPSFQPQGLSAAKVGELFADIMMAWIRAWPARGTINLVDETSALTLTMIFRMLG
FT                   IAEDDIATWETHYRHYALVSLLPVDLPGTPLRRSRRAQVWIDARLSALVNELGRSPGDS
FT                   GLLATLIRSPAAPDASSPESNLLGNLRALIHAAHKTTAVTMAHLAIRLAEQPDHWDALV
FT                   AEARAAGTVPRNPSELARFPFAEALFLETLRSEPAFPLVFRRTRERIELGGRELAAGTR
FT                   LIIPLILLSRAPSLYPQPDTFLPQRWLEHRGAHKPIQTLQFGSGPHRCLGFHTACMQLV
FT                   QFAVTLALVLDERKMRPQLVPQRTCGRRRFPINYPPRDTQVAFRSVSSNHDNRSEIPS"
FT   CDS_pept        complement(254142..255704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05579"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47407"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQP1"
FT                   /protein_id="BAG47407.1"
FT                   /translation="MMDDRPESAGQDSLADALVSELRRLVTGLPDDGRTAASVYETALV
FT                   LCYQPAIGDRRRVQDWLHDAQHADGGWCDPDYPKFRIASSLAALLALHRAGDPRYRAAI
FT                   DAGCAFLDRQDPYWRSATLDDIPVGLEIIWPRLQADAQRAGLRFSLSPPATLNAIGQAR
FT                   LAKLSRATALPAGHPALHCWEAWGSVPVAASLGPEGSLAISPSATAAWLRAAHEHELDS
FT                   ALIERASTYLREASRASEAAVPGVFPYVWPLDVFECAYVLYSLGLGGLAAHPALTEPIA
FT                   RTATFLGARITERGASFAAGFNPDGDTTSVAIAALSMAGAATSCHSLAHFASDGVYATC
FT                   PGERNPSLSTTVHAMHALRLQREPRTVASAHVLAKRDADGLWRGDKWHVSPFFLTCHAV
FT                   AALDHDEVDRHGAQTLEGLLACQRADGGWAGTGTPNFEETAYAVLTIDRLCARGPMPPA
FT                   ARTSLLKAFRLMRDCYRSPRAQASMLWINKELSRPTRVVRAVELAGLWVAHRRAEALEA
FT                   ACC"
FT   CDS_pept        complement(255767..256711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05580"
FT                   /product="putative ring-hydroxylating dioxygenase large
FT                   terminal subunit"
FT                   /note="COG4638: Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit,
FT                   Mycobacterium tuberculosis H37Rv"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47408"
FT                   /db_xref="GOA:A0A0H3KYA7"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYA7"
FT                   /protein_id="BAG47408.1"
FT                   /translation="MIRPRRPMPYPNGWFALCHSDELKRGDVRVAPFMGHELVVYRTAQ
FT                   GEAHAVEPYCPHLGAHLGHGGKVDGDALVCPFHGLAFGPDGACVHAPNGRPPHAALTKW
FT                   ITRERNRLVLVWRDSAGQPPSWEIPEVLAGNGFGSPSQIVDMLEGYAHDPIENSTDVVH
FT                   FAYLHGFTEVSMTHELDESSITIDFSARYRGVPVSIHFVNYSPNCLTATATAPSLGVSI
FT                   FSTIFTTPTAPLKYARRISNSVRVSRFSSLPGWLLKPIYSLLTPLADRWIMENARQDHP
FT                   IWMNRNYLTHPKLIEGEAAMAAFRRWMKHFYPE"
FT   CDS_pept        complement(256976..259009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05581"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47409"
FT                   /db_xref="GOA:A0A0H3KQ98"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR034686"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ98"
FT                   /protein_id="BAG47409.1"
FT                   /translation="MSATQNVLNVGALRFGDTLHFPPFGFRARHRRQPDADALLSRVDA
FT                   DDWPYVVAFYRSEQAADANRRHLLPLFGSLICPSAPAERSYWIMRQVELIAVMDDHFTL
FT                   PDVIDDPLQLSVLGDVYGRAVDGFRPSDAYPLAQLLHDTVQPVLAMFAPDASLPHRLTR
FT                   AIHDVIDYLSHPIVHRMETLSFDEYLRIRRCETTAEWCALLVEFGIDVDMADALDENAD
FT                   LRAVQRAAADLIVIVNDLGSFRREFSNDDALNGIWLLVRQQHLSVQQALDRFAVFARET
FT                   EDALLAARDRVLASPLGQRDDVRRYMDELVFFYAGCAEFHTFSERFFGRDCAQAFYSGE
FT                   VKIERLLMPQDIAGLSSHARTHAKSRCEMSLLHDDAARIYVIDGRQIDHYQDSIERVYA
FT                   DSPDEWRKIIGDEFWFQYGVFDDKTSRDGTPMDASGRRHMDRQFELAKHNGADLSVGSV
FT                   RRAIDIGCGWGPVLKYIADWFPECACIDAVNVSPVQMDYVRRSVERDGLTDRVNLYLCN
FT                   AKDIGALPDPDVPYDLAILRGSICQFTPEVMEDAMTALAARMRPGGTVIISETLYKTDL
FT                   ATYQPFIPDEVDRGAAGHRKTPAGVREALERHGFAVLDERILPTNDEVVRWYTILRENI
FT                   ETHYPLERCEVFQQLHDMSISLSDALAKDKVSSVSFIAQRGP"
FT   CDS_pept        complement(259062..260024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05582"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47410"
FT                   /db_xref="InterPro:IPR020803"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ41"
FT                   /protein_id="BAG47410.1"
FT                   /translation="MNRISEQTISDTHALRGLRQLPIRQLRGESVSDYQRKIESTYEGD
FT                   PADWRKAIGEYLLFQFGVYDDPRSTPPISLDESGIRYFERQLRLAGFDEPDHPSVERIL
FT                   DIGCGWGYILKYLADRFPHCMRLDGVNVSREQLEYCAQLHAKHGLEDRINLYQCNAQDV
FT                   GLLPDTATPYDLVIIRGVISHFPNALYEKTIKALYPRVRPGGSVVISDNLYNVALDDYR
FT                   SDTPDDVDRIACKHRKTPDYFAEVLTDAGFALHDMRVLPSNIDVARWLMDSKANIEKHF
FT                   PQGATGTLEELRVLAENWSVALIKNKVSTYSVIVTRPTA"
FT   CDS_pept        260592..262619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="BMULJ_05583"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="COG1154: Deoxyxylulose-5-phosphate synthase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01662"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05583"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47411"
FT                   /db_xref="GOA:A0A0H3KUU0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUU0"
FT                   /protein_id="BAG47411.1"
FT                   /translation="MATTLQDIRFPADLRRLPVHALRPLADELRAFVLDSVAKTGGHLA
FT                   SNLGSVEVAIALHYVFDTPYDRIVWDVGHQSYPHKILTGRRDAMAGIRQSGGISGFPCR
FT                   TESEYDAFGTAHSSTSISAALGMVHAARLRGETRHCVAVIGDGALSAGMAFEALNNAGV
FT                   AGDLPLIVLLNDNDMSISPPVGALRHALGRLTASRTYTQAKRHMQDVLDLAPSIRQLAN
FT                   RMETQVKGWLAPATLFEEFGLNYAGPIDGHDVHALIDALLNLKRVPGPHLLHVVTQKGH
FT                   GYAHAERDPVGYHGPGKFDPAVGLVPGKAGRPTYARVFSDWLCDEAARDERVVAITPAM
FT                   RDGSGLVDFERRFPERYFDVAIAEQHAVTFAAGLAAEGMRPVVAIYSTFLQRGYDQLIH
FT                   DVALQRLSVTFAIDRAGIVGADGATHMGAFDLAYLRCVPNLVVMAPSDENECRQMLHTA
FT                   LHHPGPCAVRYSRGTGPGATIEAELTALPIGVSVVRRASAAAAGRRIAFLAFGTMVAPS
FT                   LAAAEKLDATVVDMRFVKPIDIKRLSEIARSHDALITVEEGCLHGGAGAACIEALADLR
FT                   LSRPVLRLGLPDAFIEHGEPEQLLSLIGLDSSGIETAVRRFLARLGWAATSIVTSESNA
FT                   NLLLPQSGGTQGPECRPTELLQAVARQSPNDEGRQRWKNA"
FT   CDS_pept        262604..263134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idi"
FT                   /locus_tag="BMULJ_05584"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="COG1443: Isopentenyldiphosphate isomerase,
FT                   Schizosaccharomyces pombe"
FT                   /note="KEGG, K01823"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05584"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47412"
FT                   /db_xref="GOA:A9AST0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9AST0"
FT                   /protein_id="BAG47412.1"
FT                   /translation="MEERLILVDTDDRPIGICEKMRAHHEGLLHRAFSIFVFDSAGRLL
FT                   LQQRALNKYHSGGLWSNTCCGHPRPREALPDAVRRRLGEEMGFACELRPVDALVYRARF
FT                   ENDLIEHEFVHIHVGRFDGTVAPDFAEVAAWRWIDVPTLLEWMADEPSAFTVWFHCMIE
FT                   RAGLPVLHRWAHR"
FT   CDS_pept        263685..266096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /locus_tag="BMULJ_05585"
FT                   /product="pyruvate, water dikinase"
FT                   /EC_number="2.7.9.2"
FT                   /note="COG0574: Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase, Nostoc sp. PCC 7120"
FT                   /note="KEGG, K01007"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05585"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47413"
FT                   /db_xref="GOA:A0A0H3KQP6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQP6"
FT                   /protein_id="BAG47413.1"
FT                   /translation="MDHGKAHVVWFDDLRRGDVARVGGKNASLGELIGNLSAQGVSVPP
FT                   GFASTGDAYWRFIDANGLRQTIGSTLEALGARKIALAEAGGSIRQAILHGDWPDDVADA
FT                   IRDAYRQLCQQAGADDVDVAVRSSATAEDLPDASFAGQQETYLNVRGEHALLAACRRCY
FT                   ASLFTDRAIAYREEKGFDHLRVALSIGVQRMVRSDLGAAGVMFSLDTETGFDKVVLISA
FT                   AWGLGENVVQGSVDPDEYEVFKPLLGDPARTPVIGKTLGGKAHKLIYARDENVPTRNVP
FT                   TSKAERATFVLADRDILTLANWACAIEAHYGQPMDIEWAKDGVSGALFVVQARPETVQS
FT                   RREASAIKTYRLGETGRKLLTGVSVGEAIAAGSVFVIDSPHDMGRFVDGAVLVTHTTDP
FT                   DWLPVMRRAAAIVTDHGGRTSHAAIVSRELGLPAVVGTGNATRMLYDQQEVTVSCAEGE
FT                   VGFVYEGIAQYHVEAIDLTDLPATRTKVMLNLANPAAAFRWWRLPADGIGLARMEFVIS
FT                   NHIKVHPMALAHYDALTDAHAKREIAALTSGYDDPSDYFVDRLAHGLARIAAVCHPAPV
FT                   IVRMSDFKTNEYAHLVGGTQFEPREENPMLGFRGASRYYSPRYRDGFALECRAIARLRS
FT                   DMGFRNVVVMIPFCRTLDEADRVLDVLAANGLKRGEDGLQIYVMCEIPSNVILASQFAQ
FT                   RFDGFSIGSNDLTQLTLGVDRDSAELAGLFDEQNEAVKWMIARVIESARDAGAKVGLCG
FT                   QAPSDHPAFADFLVACGIDSISVSPDGFIAVKRRVAAAENAAPGERASPE"
FT   CDS_pept        complement(266145..267359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="BMULJ_05586"
FT                   /product="esterase / lipase"
FT                   /EC_number="3.1.1.-"
FT                   /note="COG4553: Poly-beta-hydroxyalkanoate depolymerase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01066"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05586"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47414"
FT                   /db_xref="GOA:A0A0H3KYB2"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYB2"
FT                   /protein_id="BAG47414.1"
FT                   /translation="MWYDLIERQRQWLRTWSAAARFTRGLWSDAAASCYADLVEPLLDV
FT                   QADAPRFAIDSVDVDGRRADVDESIVARTPFCTLRRFARAGARRVILLCVPLAGHAAVI
FT                   MRETVETLLVDGDVCITDWIDARDVPCDAGRFGLDEYVSMLDRFIDTLLADARPMHVVA
FT                   VCQATFPSLGAIALRAQRDVTLPASLTLIGGPLDARINPSALGTAARSHSLAWCRATLI
FT                   DTVPHGFAGYGRQVFPAYLQRAEIAITYPQRYMALVDRYRRAVSSGDTDALATARRALR
FT                   EYLTLLDMPAEYFLDTVDIVFQRTCLANGTWHVHGQRVQPAALRSIVLLTVEGKCDAVT
FT                   GAGQTHAALAMCGGLAADARQRADIDDCDHYGLFTGEHWRTDVHPVLQAAFARAERDPP
FT                   RSCAA"
FT   CDS_pept        267511..268044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05587"
FT                   /product="putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05587"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47415"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQA2"
FT                   /protein_id="BAG47415.1"
FT                   /translation="MDASRRMLVVFYSRSETTAVVAHQLAAELGAGCERLREADDRRRA
FT                   GAIGFLRSLVDVIRDRAVDLRPTICSPSAYDAVVIGTPVWAGRASTPVSTWLARHGSEL
FT                   RATAFFCTMGRRGDLTAFGQMQALARQAPLATCAISGRDIGRGLAARKLARFARSIARR
FT                   FAAGERHTSAEQAT"
FT   CDS_pept        268041..270374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05588"
FT                   /product="putative fusion protein of pyridine
FT                   nucleotide-disulphide oxidoreductase and patatin-like
FT                   phospholipase"
FT                   /note="COG0446: Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases, Mycobacterium tuberculosis CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05588"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47416"
FT                   /db_xref="GOA:A0A0H3KQ45"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ45"
FT                   /protein_id="BAG47416.1"
FT                   /translation="MTARSGGERDYDHVLVGGGIAGVSAAHALRREDPFARIAILCGEH
FT                   VLPYQRQPLTKEFLAGNVAPAAIAIHPAGFYEMRRIDLHLGARVASVDCGAHVVRLEDG
FT                   APIRYGKLLIASGAAPRRLTVPGATLAGIGHLHDLDDALALRDNAARHRRLLVLGGGFT
FT                   GIEAVATLRERGLEVTLVERCERLLPQLNSARLSDHFAGLCATHGVDVRTGTTVERFIG
FT                   TQSVEAAVLADGCVIECDLVVVAVGVEPNCGFLAGSGIATADGVLVDECLQASDPDVHA
FT                   AGDVARFRDPVFGVQRRIEHWDNAVRQGRLAARHMRGARLPYRDVSIFYGNVFDVPYNF
FT                   LGNAADATEVVEQGRFPHAPYSLLYLRHHVLRAVFSIGVRADEMTAAEETIRHRVNLGA
FT                   QVEAATHGGLRLRELPAQTVLILQGGGALGAFESGAIAALEARGVRPDVVAAVSIGAFN
FT                   GAIAASHPGHAAEALDAFWRELSIRSPVGVPSCAYAGHALVAWHVALFGVPNFLRPHWW
FT                   PDGIPPPGLAPWWTSCYDTQPMLALLRRHVDFDALAGSATRLLLGAVDVESGERRIFDS
FT                   YVDRITPEHLLASGSLPPAMPWTQIDGRAYWDGGIISNSPLDLVIERCGRIAGRVFVVD
FT                   LFSGSRPLPSNLLEVMLRRDEIVYADRVRNDLRFEENANDFRDLVERITSRLDPETAAR
FT                   MRQLPEYIRLMGNRAPVRVFRIALDRFAGGRDTFARDFDFSDTSIATLFELGRSAALAV
FT                   LASDATEPLGGAAGHPSRARPPAP"
FT   CDS_pept        complement(270346..270645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05589"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47417"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUU4"
FT                   /protein_id="BAG47417.1"
FT                   /translation="MPTFVMLTRLSPDAVRTPEKLAELEHHAVHRLQKTCGQIEWLHNF
FT                   ALMGPHDYLDIFTAPDLDTAFRVSASMRTLGHASVEVFPAVEWKAFKALVASLD"
FT   CDS_pept        complement(270696..271115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQQ3"
FT                   /protein_id="BAG47418.1"
FT                   /translation="MPNETEARRALLVHLGSILRTLSCVLEYEPDDRTLDSLLAAQPML
FT                   ADILLLNQVFAHMTVREFTRAVLHAYCLWPQLLLDEPLDRDALAKPVCAWLFTDNPGGW
FT                   TRYVASLGAEIPWFGQGMGPSCSSGRRPARTSSVA"
FT   CDS_pept        complement(271593..271808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05591"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYB8"
FT                   /protein_id="BAG47419.1"
FT                   /translation="MNWYCDVERELSHIEGSIRLLERTRSCFHTQTSVTDPAYWRARLN
FT                   TVRQTAERNSTLLRRTDEILARLERL"
FT   CDS_pept        272208..272621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05592"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05592"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47420"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQA7"
FT                   /protein_id="BAG47420.1"
FT                   /translation="MPVSFTNTSNRPIISHCEASTLSVSAATHHHHHPVDADGDRLLSP
FT                   HEIAILMVLASEPRRQQGDPADLRCLVDRGLVRLGAASLDEAPACLSAYGRQMVLRLAR
FT                   RDRVWQRKNVDVTIAWRAIASETLAGMAHHAAR"
FT   CDS_pept        272694..273344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05593"
FT                   /product="predicted periplasmic or secreted lipoprotein"
FT                   /note="COG2823: Predicted periplasmic or secreted
FT                   lipoprotein, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05593"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47421"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ50"
FT                   /protein_id="BAG47421.1"
FT                   /translation="MKSDSELKKDVEQELEWDPSINAVRIGVEVHERIVTLTGHVGSYL
FT                   EKVAVRKAVERIEGVRGIVLELGVQTDDGKRRSDEDIAIAARSLLMWDAGLGEQAVQVT
FT                   VENGCVTLSGEVMWSYQMQEAERAVERLRGVTRIINEIHVRPHPTHSDIAGKIQAALIR
FT                   HATEEAAHVGITVQDGCVTLTGQVGSLSERRLAFDAAWSAPGVRDVVDQLTVA"
FT   CDS_pept        273406..273855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05594"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05594"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47422"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUU8"
FT                   /protein_id="BAG47422.1"
FT                   /translation="MNAAMLCTRDVAMCSARATVVEAAEMMRDAHAGDLIVVREQEGRC
FT                   VPVGMVTDRDIVLTVVSPDAEAGSLFVGDIMSTPVAIANADDDIWLLAKRMRQHGVRRL
FT                   PVVGGDGELIGIVSLEDLLRAAAALLDELRLVAARQPYFEEKQRG"
FT   CDS_pept        273946..274392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05595"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05595"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47423"
FT                   /db_xref="GOA:A0A0H3KQQ9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQQ9"
FT                   /protein_id="BAG47423.1"
FT                   /translation="MTRGRHTGPRTWMRRWLGAIGFCLLLSSATTWLGAIHDHPVSPGV
FT                   VAGMTAPECGRVGARPAGSILTTPIPEQDVCLSLFVYRASYPDAASDVPSYRTWILQQR
FT                   VGEFWQLFGYVLLLWTAVLGLVAGPIWIFMRRAGYRHRGSRRER"
FT   CDS_pept        274436..274675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05596"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYC3"
FT                   /protein_id="BAG47424.1"
FT                   /translation="MTISGELNEADWTVAIETVGVATGGYRCRVHVTVRSPDCRCEHVF
FT                   PHHRVFATEREAALEGLRSGMTWVEMKKSDTFTY"
FT   CDS_pept        274862..275317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05597"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQB3"
FT                   /protein_id="BAG47425.1"
FT                   /translation="MNRLSRACRVLVLCAAACCVPTQQAHAQHARHVARQDVHSRDFHG
FT                   RDFRHFAPTERARWRGGRWVQDWHGGRYAWWWIVDGYWYIYPEPMYPYPTYIPPAIVVQ
FT                   RPPPTPARLPPARAWYYCNDPRGYYPYVASCNGVWTAVPSSPDPASQ"
FT   CDS_pept        275397..276773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="BMULJ_05598"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="COG1488: Nicotinic acid phosphoribosyltransferase,
FT                   Mycobacterium tuberculosis CDC1551"
FT                   /note="KEGG, K00763"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05598"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47426"
FT                   /db_xref="GOA:A0A0H3KQ55"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ55"
FT                   /protein_id="BAG47426.1"
FT                   /translation="MNGSWPEADVDDVLLTDWYELTMMQAAFDAGMNDMASFEFFVRAL
FT                   PEHRAFLMAAGLAPVLDYLSGLRFTAATLERLAATGRLRADFLASLADFRFTGAVDAMP
FT                   EGTVFFADEPILRITAPLREAQFVESRVMNLLHYATLVASKAARAALVAHGRLLVDFGM
FT                   RRAHGAEAAMLSARASYLAGFAGTATLLAGLRYDIPVYGTMAHSYVQAHDDEALAFEHF
FT                   ARSQPDNALLLIDTYDTERAAHKVVELARRLASDNVRIKGVRIDSGDLAAHARNVRAIL
FT                   DHGGLTEATLFASGNLDEIRLRELVHQHAPIDGFGIGTQMSTSADAPCLDCAYKLVEYA
FT                   GRARCKRSEGKATLPGRKQVFRQYDRDGRIAADSLGLDGERSDGMPLLRPVMIGGSRLA
FT                   APTLGESRIHAMRELSTLPDSMQALTPVMPMQAAISPALATLVAQENARLDAYARQQAA
FT                   "
FT   CDS_pept        276770..277846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05599"
FT                   /product="hypothetical protein"
FT                   /note="COG2187: Uncharacterized protein conserved in
FT                   bacteria, Aquifex aeolicus"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05599"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47427"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUV1"
FT                   /protein_id="BAG47427.1"
FT                   /translation="MNDARIPAGRPITLSDKVVALRAPTAWPDGTRSVEAVETHMSWVF
FT                   LTDRYAWKLKKPVRAPQLDFRTLAARYRFCCEEVRLNRRLAADVYLDVVPLVVDAHGCL
FT                   RADGPGEIVDWLVRMRRLPAARMLDRALSRGMATADDAYRIAARLSAFYHALAPARIDG
FT                   AAYREALRGTIDTNERALCKPLAGQCVDTVRTLCARQRSLLVCEAARFDLRVRQGHVVE
FT                   GHGDLRPEHVCIDDPVAVIDCLEFCRRLRIQDAADEVGFLALECERLGAAGFADTLVNA
FT                   YHSASGDDVDDGCVHFYQSCRAMTRARLAVWHLREPEFRATPVWRDRANTYIALARRHA
FT                   DGCERTWVASHVSAATGR"
FT   CDS_pept        complement(277824..278831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="BMULJ_05600"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COG0462: Phosphoribosylpyrophosphate synthetase,
FT                   Fusobacterium nucleatum"
FT                   /note="KEGG, K00948"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47428"
FT                   /db_xref="GOA:A0A0H3KQR4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQR4"
FT                   /protein_id="BAG47428.1"
FT                   /translation="MNRGSHATERLPFSLFAFASCRGVGERIAARLGVTLAAHEERPFE
FT                   DGEHKTRALASVRGHDVYVVQSLHGEPGISVNDKLCRLLLFIGALKDASAARVCAVTPY
FT                   LCYSRKDRRSHPRDPVSTRYVGTLLEAVGVDRVVAIDIHNIAAFQNAFRCPTEHLEANG
FT                   MLVEWLASQAGERPVVVVSPDAGGARRAEDFRARLEARIGRPVDAAFAGELRSGGIVTP
FT                   KPIVGEVAGRCAVIVDDLIGTGTTLARTAENCRTLGAQSVYAVATHGMFFDDAPVLLGG
FT                   DALAGIAVTDTVPPWRVPAGPLKDKLAVLDSAPLFAEAIARIHRGGSLTDLLRR"
FT   CDS_pept        278855..279814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05601"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47429"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYC9"
FT                   /protein_id="BAG47429.1"
FT                   /translation="MTRFDVFNGDADGICSLHQLRLEMPAESVLVTGPKRDIALLARVS
FT                   AARGDFVTVLDVSLDVNRTALDALLARGVDVDYFDHHMPGAVPAHPRLHAHVDTAPETC
FT                   TSVIVDRYLAGRQRIWAVVGAYGDNLVGVAGRLAAACGLTDADAYRLQVLGESVNYNGY
FT                   GDCRDDLFMAPLAVYTAVRPYADPLEFAKSPLARRLDANRRRDIARAERQRANIALPGA
FT                   DVYILPDTRWARRVRGVFANRLARGDATRAHAVLTVSASGGYIVSVRAPVAAPYGADRL
FT                   CRAFPGGGGREGAAGINGLAPERLDAFVAALANAYPAA"
FT   CDS_pept        280014..281747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="BMULJ_05602"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   permease protein"
FT                   /note="COG4986: ABC-type anion transport system, duplicated
FT                   permease component, Xylella fastidiosa 9a5c"
FT                   /note="KEGG, K02050"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05602"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47430"
FT                   /db_xref="GOA:A0A0H3KQC1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQC1"
FT                   /protein_id="BAG47430.1"
FT                   /translation="MEHHAEVLRGGRWTLPVPGWRDLAAMLIVVGFLLLAGISARQMAG
FT                   PLAVAHPPAISLSPAALPGYTLRTVARMFAALLASIVFTFVYATAAARSRRAERVLIPL
FT                   LDVLQSVPILGYLSFTVLFFLSLFPGRILGAECAAIFAIFTSQAWNMTFSFYQALRTVP
FT                   PDLDEASRSFRLSAWQRFWRLDVPFAMPGLVWNAMMSMSGGWFFVVASEAIAVGNLHVD
FT                   LPGVGAYVAQAIANRDLAAVGWAIVAMSVAIVLYDQLLFRPLVAWSERFRYGDAAPTVA
FT                   SRSWMLDLFHRSRWMGRASGPVRALLRRAARARPRGFMSAWRDRIVLPPRTGDVLWFAL
FT                   CGAGCAYAAYELFRLGRATLTWTDLRVVASEGGLTFVRVTVLVTLASMIWVPIGIAIGL
FT                   RPGVAARIQPVTQFLAAFPTNLLFPVAVFAIVRLRLEPDIWLCPLMILGAQWYVLFNVI
FT                   AGASAFPADLREAAACFRVRPATWWRHVMLPGVLPYFVTGAIAASGGAWNASIVAEAVS
FT                   WGSTRLDAGGLGAYIARMTDAGDYPRIALGVAVMSLLVIATNRLVWRPMYAFAERRTRL
FT                   D"
FT   CDS_pept        281783..283126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="BMULJ_05603"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   ATP-binding protein"
FT                   /note="COG1116: ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, ATPase component, Xylella fastidiosa
FT                   9a5c"
FT                   /note="KEGG, K02049"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05603"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47431"
FT                   /db_xref="GOA:A0A0H3KQ58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ58"
FT                   /protein_id="BAG47431.1"
FT                   /translation="MPNLSECTEGNVASAAAPTSAEAAVVLEMRAVCKSFTKPSGEPLH
FT                   VLADIDLALHEGEILGLLGRSGSGKSTLLRIAGGLVKPSSGAVTYRGAPLAGPTDGIAV
FT                   VFQTFALYPWLTVIENVELGLDAQGLASEDARARAAAAIELIGLDGFESAFPRELSGGM
FT                   RQRVGFARALVSEPVLMLMDEPFSALDVLTAETLRTDFLDLWNAHQLSIRSVLMVTHNI
FT                   EEAVLMCDRILVLGAGPARIEATLNVPLPRPRSRHDPAVQAIVGKIYATLTARITDATA
FT                   GRAATGSALAMKLPDVSSHHLAGFVDALAAAPYDGHAELGTIASALALRTDALYSTAAA
FT                   LHLLAFAEWHDRTIRLSAAGHVFAQSDDNARRRLFSEHLVRFVPLAAHIDEVLGEREGH
FT                   RAPRERFELELEDHLDPRSADQALRVVTDWGRYARLFDYDDHTRTFGR"
FT   CDS_pept        283280..283744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05604"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUV4"
FT                   /protein_id="BAG47432.1"
FT                   /translation="MNWLSEYFAQRTSPLSLSLWAHPPLALGPDGPICREPYRLPYPGV
FT                   ELVFTPAEAVERGGRTYTLPARYDSRGLLAARSTAHDEAASFFREVTIFAPSQFNRDFV
FT                   VTVNGEFSFVPTFWQDGSPGFSGVCVPAGSGRTTGERAGPPWLFQGYLSI"
FT   CDS_pept        complement(283779..284372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05605"
FT                   /product="uncharacterized membrane protein"
FT                   /note="COG0705: Uncharacterized membrane protein (homolog
FT                   of Drosophila rhomboid), Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05605"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47433"
FT                   /db_xref="GOA:A0A0H3KQS0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQS0"
FT                   /protein_id="BAG47433.1"
FT                   /translation="MTYALILVNVAVFIAEASGWPMLIDQFALWPPARPGAPATPGFHV
FT                   WQLLTYSVLHASLAHIAFNMFGLYMFGRDVERVLGRARFLALYLASVLAGAITQLAVIR
FT                   ALPPSDAPTVGASAGVFGALIAYAVLFPKRRVVLLFPPVPMPAWLFATGYALTELLSGL
FT                   SGDTSGVAHFAHLGGMLGALVCLAFWRKRADERA"
FT   CDS_pept        284618..285130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05606"
FT                   /product="putative signal transduction protein"
FT                   /note="COG0517: FOG: CBS domain, Methanopyrus kandleri
FT                   AV19"
FT                   /note="contains CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05606"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47434"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYD5"
FT                   /protein_id="BAG47434.1"
FT                   /translation="MRRRGAVRMRIVHAKDNGSVIMHIGRISTQPVESCTAECSAFELA
FT                   DRMRHAHVGDIVVIEYRNGEAIPIGLVTDRDLVIEVMARGDNPGDVTAGQIMSRGLVVV
FT                   SDTDEIGVALEEMRRSGIRRLPVVDDAGRLAGIVTLDDIVEHLAGLLGGVAEVGKLQQI
FT                   EEQRFRA"
FT   CDS_pept        complement(285191..286801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05607"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG2187: Uncharacterized protein conserved in
FT                   bacteria, Pseudomonas aeruginosa"
FT                   /note="KEGG, K07028"
FT                   /note="conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05607"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47435"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQC7"
FT                   /protein_id="BAG47435.1"
FT                   /translation="MSRAPHVPFALSRGNARRKSTQFDRAMRRPATYPHPAGRIERIET
FT                   HLSVVYLAGRYAYKRIKPVHFAFVDFMRPARRRRCALAECALNRPFAGPLYLGVWPLVA
FT                   HGRRCAFAAPVPTGGRRRRRRQQTVPGEYVVRMRRFDAQAMLSVRSASRDDGLADADAL
FT                   ADTLARHHLHAPRRAPRGHPGSAASVAAQCRPLLDTLDVTVPDEAALRAWYEAELACIA
FT                   PLLADRHALGFVRACHGDLHLENIVRWRNRILMFDCIEFNDALRWIDVASDLAFALMDF
FT                   SAHGRDDCAHRLLSGWLARTGDHAALGVLPCYFVYRALVRALTARLRGDEAARAGYLRI
FT                   ASAMADARRDAQPALLLCHGVSGSGKSLASRALAAQLGAIRLSSDVERKRLAGTSDNTR
FT                   LSPRAYSDTAIDEIYERLLSAAHVVLDSGYTAVVDATFLRQHNRAAFIALAARLGVRVA
FT                   MLDFTASRATLAARVAGRAAGGRDASDADTAVLARQIEHADPLTEAEAAIAIRFDTDCD
FT                   AAAYESRAFWAPLIAALRT"
FT   CDS_pept        287118..287555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05608"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ63"
FT                   /protein_id="BAG47436.1"
FT                   /translation="MERRALALGVLLAQGACAGAERTEAFRTMETRLLAMRQAASLQCS
FT                   TPSECSRAWSRTRRYVQDHSSTRITRFSTDRIETAQPYLAGAVYLWASRAESGGGSVIW
FT                   LKAMCKGMYDSNGGPGWQYDVCARKILEIEQGFRSDENPPS"
FT   CDS_pept        287759..288232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05609"
FT                   /product="putative universal stress protein"
FT                   /note="COG0589: Universal stress protein UspA and related
FT                   nucleotide-binding proteins, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05609"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47437"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUV7"
FT                   /protein_id="BAG47437.1"
FT                   /translation="MYTNIMVATDGSPSANQALDEGLRMARLCGARLFAVFVVDKSTLF
FT                   VYGGRMEPEALLDEIRRHGAAILRDADRTISRAAVNGETEIIETDFGEDVAERLQRYVV
FT                   DHSIDLAVVGTHGRRGVRRLVLGSVAERFLRASSCPVLLVRGEDTSPATVAVA"
FT   CDS_pept        288276..288551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47438"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQS5"
FT                   /protein_id="BAG47438.1"
FT                   /translation="MQISFPSEHPTYCDLDSALSFPALVEGRRVRCAITSAALEDHFRA
FT                   ASPREQDLVDAFARHRPAIERAARRLLEEIGGRPILLHSGHFRFCT"
FT   CDS_pept        288729..289163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05611"
FT                   /product="putative molecular chaperone"
FT                   /note="COG0071: Molecular chaperone (small heat shock
FT                   protein), Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05611"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47439"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYE1"
FT                   /protein_id="BAG47439.1"
FT                   /translation="MSNLTRYDPFSIEPVSDLFQGLFRPLRGMTLADEPDLASMKIDVT
FT                   ENDKAYTVNAELPGVAKDDIDVQVTGNTVSINAKIERNNEQKDGARVIRRERYSGAISR
FT                   SFSLSGDIDDANATATYQDGVLSLTLPKKAPVGQKKLTIS"
FT   CDS_pept        complement(289268..289933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05612"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05612"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47440"
FT                   /db_xref="GOA:A0A0H3KQD4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQD4"
FT                   /protein_id="BAG47440.1"
FT                   /translation="MTEQQMLAYSPAPVMQPASPEGESPAIVDLPRPMLDNDVPLMTAL
FT                   ATRMSSREFAATSLPPATLGTMLWAADGINRPASGGRTAPSAHAFNEIDIYVALPYGVY
FT                   RYDAPAHRLVLKHAVDARNLTGYQDFVGRAPLDLVYVVRTAAILDMPPQQRDVFSAIAA
FT                   GAIAQNVSLYCAAAGLGTVVRGWINHRTLADALRLNEDELPILAQTVGYRTGSTASHA"
FT   CDS_pept        290165..290815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05613"
FT                   /product="predicted periplasmic or secreted lipoprotein"
FT                   /note="COG2823: Predicted periplasmic or secreted
FT                   lipoprotein, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05613"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47441"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ68"
FT                   /protein_id="BAG47441.1"
FT                   /translation="MKTDKQLKQDVQDELESDPSIDSTRIGVEVADRIVTLSGHPPSYA
FT                   EKLAIERAANRVAGVKALVVDMTVHLPDDDVRTDEDIAKAVRSVLHWTVGLHDDAVKVQ
FT                   VERGWITLSGKVDWAYQSHLAVRAISQMRSVTGVTDHITVQGTVGSDDIGGNIKRAIMR
FT                   HAEREAKHIAIEVHDGTVRLSGKVGSFSERKAVRGAAWSARGVRAVVDDLVVE"
FT   CDS_pept        290864..291103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05614"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUW0"
FT                   /protein_id="BAG47442.1"
FT                   /translation="MTLSGELHEADWSVAIETVVAESGGFRCRIHVTLKSPDGGCERTF
FT                   AHSGIHATEREAAIEGLRAGMTWAEMKKSNTFTI"
FT   CDS_pept        complement(291197..292954)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05615"
FT                   /note="COG0659: Sulfate permease and related transporters
FT                   (MFS superfamily), Mycobacterium tuberculosis CDC1551"
FT                   /note="inactivated MFS superfamily transporter"
FT   CDS_pept        complement(293087..293338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05616"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05616"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47443"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQT1"
FT                   /protein_id="BAG47443.1"
FT                   /translation="MSHADYRSDSGMRAATSATSATSETSGTAALDMPALVALARDAGM
FT                   LVILDGQIGRERYESVTGSIATLARFAQALQLSALKVL"
FT   CDS_pept        complement(293479..294507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05617"
FT                   /product="predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /note="COG1611: Predicted Rossmann fold nucleotide-binding
FT                   protein, Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K06966"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05617"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47444"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYE6"
FT                   /protein_id="BAG47444.1"
FT                   /translation="MSPPVKRAPAGKAKGHARGRPVPVATIAKARGKRPRARPDAAVRK
FT                   DAIQPVSRRARRVPQSPNRTPADEDATLLQGSGMRGIRLLLDYWKAEERLQNERIGHAV
FT                   VIYGSTRIVAPSVANARLDEANRRLAQRPHDASRRRAVAIASRLVEQSAYYRVAREFGR
FT                   IVAHADRCTRTARLAIVTGGGPGIMEAANRGAYERGAPSIGFNIELPRQQAPNPYITPD
FT                   LCLRFHYFAIRKLHLLERAKAAVFFPGGYGTFDELFEVLTLLQTRKIAPLPVILVGEAY
FT                   WRRAVDLAFLADEGMIDRRDLELFTYCESAAAIWHAIGSWYARRRERAPARCEASSKPR
FT                   AV"
FT   CDS_pept        complement(294530..294865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05618"
FT                   /product="putative cytochrome c551/c552"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05618"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47445"
FT                   /db_xref="GOA:A0A0H3KQE0"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQE0"
FT                   /protein_id="BAG47445.1"
FT                   /translation="MRIIRAAALCAIAVTAEMAAAQTSVPEPTELVNAQHCMFCHTTDM
FT                   TFLGPSFHEIAERYRGDPHAAAALERKLRVGGRAHWGDTPMPSAIDRGGPLSADDAHLL
FT                   VQWVLSQ"
FT   CDS_pept        complement(294885..295892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05619"
FT                   /product="putative nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05619"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47446"
FT                   /db_xref="GOA:A0A0H3KQ73"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ73"
FT                   /protein_id="BAG47446.1"
FT                   /translation="MISVPPLAASTRPDHDPRTLVGYAVLAPSSHNSQPWHFLVNGNTI
FT                   SLCADRVRALPVVDPFDRELIISCGAALLNLRVALDHAGLAHTISTFPSEVDPDLLAQV
FT                   RICDDGYSDAALGTLFHAIPERVTTRAPFESSPVPEAIQQALVEAGIAEGADVACVDSI
FT                   AHRARVAELVAEADRQQFADARFRRELASWIDPRRHVDGMPAFAAGVPTLLDFAAPVVT
FT                   MAVRTFDLGSGLAALHHQLVGASPLIVCIATARDDREAWLAAGQALERVLLVATRAGYT
FT                   ASYLNQPIETAGLRAHLCHMLALRGEPQLLLRVGRGPHTPHSPRRPLDEVVSFS"
FT   CDS_pept        296069..297058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="BMULJ_05620"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="COG1064: Zn-dependent alcohol dehydrogenases,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00001"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47447"
FT                   /db_xref="GOA:A0A0H3KUW5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUW5"
FT                   /protein_id="BAG47447.1"
FT                   /translation="MLAMMFDGTTPHLRETRVPDPSPTAGQLLIDVNACGVCRTDLHVV
FT                   DGELAHAKLPLIPGHEIVGTVRGLGEGVTGFAVGDRVGVPWLGSTCGHCAYCTSGRENL
FT                   CDSPGFTGYTIDGGYAECAVADHRYCVHLPRRYSDLEAAPLLCAGLIGYRTLRMAGNAR
FT                   RIGIYGFGAAAHLVAQVAQGEGRKVFALTKPGDTAAQRLALSLGAAWAGGSDEVPPEPL
FT                   DAALIFAPSGALVPAALRVLDKGGIVVCGGIHMSDIPGFPYAWLWGERRIASVANLTRA
FT                   DAVAFMRIAAATPLRVAAVRYALTEANRALDDLRGGRVSGAAVLDMHD"
FT   CDS_pept        complement(297084..297857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnr"
FT                   /locus_tag="BMULJ_05621"
FT                   /product="CRP/FNR family anaerobic regulatory protein"
FT                   /note="COG0664: cAMP-binding proteins - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases, Ralstonia solanacearum"
FT                   /note="KEGG, K01420"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05621"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47448"
FT                   /db_xref="GOA:A0A0H3KQT5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQT5"
FT                   /protein_id="BAG47448.1"
FT                   /translation="MQSSAEISTTMPLRPFIPMRPVEPADQPKRAASRCSTCALRTVCM
FT                   PPDLSPDDFARVDAMICTTRHVRRGETLFRSGDAFNSIYAVRTGSFKTIVMHRDGDEQI
FT                   TGFQIVGESLGLDGVHTGHHNGDAIALEDSTVCIIPFGQLEQMCREVRPMQHHVYQMMS
FT                   GEIVRESSQMLLLGTMSAEQRVAAFLLNLSARFKARGYSAAEFVLRMTRDEIGEYLGMK
FT                   LETVSRMLSKFQHKGLVVAQGKQIRIVDSDGLRQI"
FT   CDS_pept        complement(298178..298825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrY"
FT                   /locus_tag="BMULJ_05622"
FT                   /product="two-component system invasion response regulator"
FT                   /note="COG2197: Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K07689"
FT                   /note="UvrY protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05622"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47449"
FT                   /db_xref="GOA:A0A0H3KYF1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYF1"
FT                   /protein_id="BAG47449.1"
FT                   /translation="MISVLIADDHALVRDGLRHILQNATGFEVVGEAQDSASTIALVRG
FT                   TDANVLVLDLSMPGRNGVELIKQIKDEKPGLHILVLTMHAEQQYAVRAFRAGASGYMTK
FT                   ESASAELVAALTKIAAGGVYVSLTMAEQFAQSLNEPTDLLPHQRLSDREFDVFRRVTTG
FT                   ESISEIAQALCVSVKTVSTYKTRILEKMQMPNDTALVRYAMRHKLFEYPDEL"
FT   CDS_pept        complement(298822..300837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05623"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COG4585: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05623"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47450"
FT                   /db_xref="GOA:A0A0H3KQE5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQE5"
FT                   /protein_id="BAG47450.1"
FT                   /translation="MTVNAPSFKAGPAPHRIRPGLPAVAAALLTLALGLAAAFAASRAL
FT                   QDDARQAARAKFEQTATLATADVKRSLLGAAAVLRGARGFASTLPARQSGAAWRRYLAG
FT                   LDLDGLQSPVRYIGRIEPSAAIDDPSTRHALQRAAQTGKVALAANAVQDSVDAAVARTE
FT                   LTLYLPIDANADESPLSAPGRTRATGYVYASLNPDRLVDSSLLARLHVEIVADDPAAPV
FT                   YSGGFGGGDADAEAGDTFARTDSLTFGGTPLALHYSAPRAGTAAAATAMLPAGAALALM
FT                   LAALVRYAIAKRSLPGTHAGDAPPTEARMMAIIRSSMEAIITVDENQTIVIFNPAAERV
FT                   FGVSAMDAIGAPLERFIPERFRAAHAKHVEQFGVTGVSERQMGRQRVLFGLRGDGAEFP
FT                   IEASISQIVDGTGKLYTVMLRDVTERVRAENALKQSREELRELSANLQNVREEEKARIA
FT                   RELHDDLGQQLTALKMDVSAVELGLAGVVAPNTGVREQLRGMHRLIDSTVASVRRIAAD
FT                   LRPVMLDDLGLVPAIEWLVNDFTRRYRITVERDIAPVDTAFTGAGATTLFRIVQEALTN
FT                   VARHADATHVKLALKIEDGYCTLRIADNGHGAPDSGRDGGAGSDARDRPSFGLIGIRER
FT                   AHMLDGTVTIDNRPGAGFTMTVTLPLHAIQQGDVLS"
FT   CDS_pept        301085..301552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05624"
FT                   /product="putative universal stress protein"
FT                   /note="COG0589: Universal stress protein UspA and related
FT                   nucleotide-binding proteins, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05624"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47451"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ77"
FT                   /protein_id="BAG47451.1"
FT                   /translation="MYERIFAALDGSRSARLALDEAITLARDSGSLIIALCVVSDTPRI
FT                   ADVDSGYIDQRDPAGLAADEAAIAASDAETAFQLAGVRGIAQTIDACGENVSDVLARAA
FT                   AEYDADLIVIGTHGRRGVRRLLLGSVAESLVRIADRPVLVVREGARACAGM"
FT   CDS_pept        complement(301618..302454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05625"
FT                   /product="putative universal stress protein"
FT                   /note="COG0589: Universal stress protein UspA and related
FT                   nucleotide-binding proteins, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05625"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47452"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUW9"
FT                   /protein_id="BAG47452.1"
FT                   /translation="MSYKTLLVHLDDSARCATRVKLALELAGRWNAHLIGLYVVCQDLL
FT                   EPLRRPHEPLKLAVYERLCDQRRNEAEQRFLAAAELAGRSNVEWQAPAGDATDAGILHA
FT                   RHADLLVLGQEDPDDRMTYVARHFVEDVVMGSGRPAIVVPYAGDVRTIGENVVIGWDGG
FT                   REAARALADALPLLARARFVNVETVSHGHPDPDKTPAGVDVAAYLERHGIRASFSTTPR
FT                   DRSVGVGATLLNRVTDLHADLLVMGLYSHARMHERVLGGATRTILEAMTVPVLLSH"
FT   CDS_pept        complement(302451..302954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05626"
FT                   /product="putative universal stress protein"
FT                   /note="COG0589: Universal stress protein UspA and related
FT                   nucleotide-binding proteins, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05626"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47453"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQU1"
FT                   /protein_id="BAG47453.1"
FT                   /translation="MYSNILVALDGSDTSSRALDAALDLAAQTGARLTPVYVVDFLVPA
FT                   YDTFGYDPSILIDAFREEGLRVTEDAAHRMTARGVTGTPQISNVAPAGEDIAHRIVTVA
FT                   DDIGADLIVMGTHGRRGFRRLVLGSVAERVLRQATCPVLMIPASCASKASADTAAASIE
FT                   KEPS"
FT   CDS_pept        complement(303024..304238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="BMULJ_05627"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="COG0282: Acetate kinase, Mesorhizobium loti"
FT                   /note="KEGG, K00925"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05627"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47454"
FT                   /db_xref="GOA:A0A0H3KYF8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYF8"
FT                   /protein_id="BAG47454.1"
FT                   /translation="MRTLALLVVNAGSSSVKFAVFAYAPHGDPARQPLHEGEAVETGNG
FT                   VSIRFDAEPGGALPWVAGDPYRAVLARIATWIRERLPHIALGAIAHRVVHGGARYVEPV
FT                   IVDERVLDALRTLTPLAPLHQPHSLDAIGALRDAFPDVPQIAVFDTAFHRTLPRVEQLL
FT                   PLPHAWFDAGVRRYGFHGLSYEYLSVALDESFGARAHGRVIAAHLGSGASLCALRDGRS
FT                   IATTMGFSALDGLMMSTRCGSLDPGAVLHLLEVGKLSRDALAHLLYHESGLEGVSGTSG
FT                   DPRVLLALEAAGDAHARDALALYVHRIVREAGALIALLGGLDMLVFTAGIGEHSAVLRE
FT                   RICAQLGWLGIALDAHANAVDAHVVSSASSAIAVVVEPTNEAWIAARAALRVLRVLRGD
FT                   RDSDR"
FT   CDS_pept        complement(304248..305087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05628"
FT                   /product="putative universal stress protein"
FT                   /note="COG0589: Universal stress protein UspA and related
FT                   nucleotide-binding proteins, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05628"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47455"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQF3"
FT                   /protein_id="BAG47455.1"
FT                   /translation="MSYKSMVVHLDTSARAHSRLELALRLARRFGAHLTGLFAVYTPEP
FT                   HSFYVMAGSADYFRAHREQRDERMAALERLFHAETTRAKVPATWVRADERANLAVPRAA
FT                   RLADLVIAGQSDPNDPETYIDNQFSENLVLSAGRPVLFWPYTGEFPSVGERLFVAWDGS
FT                   REAARAAHDALPFLEHAKRTTVVAVVDGDSESATTRIPAADAALMLARHARDVNVLDIA
FT                   IGSGASVGDTLLSRAYETGSDLLVMGAYGHPRWRELLMGGATRTVLASMTMPVLMTH"
FT   CDS_pept        305344..305814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05629"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47456"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ81"
FT                   /protein_id="BAG47456.1"
FT                   /translation="MIAQNRDWQHEWHALAGRCIERDRTAVRRLQQALGESEAWTAFAE
FT                   AGRQVMSDCAIASIAIWQDAAELCMRAQFESASAWRTWLREYGAGALSRYQTDWLPDLG
FT                   RLAAVNEASMPWAGWMAALERGIEDAGGATNGALPAGRVNDIAGAREHDHVR"
FT   CDS_pept        305804..306550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="BMULJ_05630"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases), Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00023"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47457"
FT                   /db_xref="GOA:A0A0H3KUX5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUX5"
FT                   /protein_id="BAG47457.1"
FT                   /translation="MSAKRVAFVTGGMGGLGAAISRRLHDVGMTVAVSHTEGNDHVATW
FT                   LTHEREAGRTFHAFEVDVADYDSCRQCASRVLAEFGRVDVLVNNAGITHDATFVKMTKS
FT                   MWDAVLRTNLDGMFNMTKPFVPGMIEGGFGRIVNIGSVNGSRGAYGQTNYAAAKAGIHG
FT                   FTKALALELARHGVTVNTVAPGYLATAMLETVPKEVLDTKILPQIPVGRLGNPDEIAAL
FT                   VAFLCSDAAAFATGAEFDVNGGMHMK"
FT   CDS_pept        306547..308367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbC"
FT                   /locus_tag="BMULJ_05631"
FT                   /product="putative polyhydroxyalkanoate synthase"
FT                   /note="COG3243: Poly(3-hydroxyalkanoate) synthetase,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05631"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47458"
FT                   /db_xref="GOA:A0A0H3KQU5"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQU5"
FT                   /protein_id="BAG47458.1"
FT                   /translation="MKAAVMRAPFGPELPCPPDAVEIATSAAGCAPVRAAPADEWNRAA
FT                   HANVAAMTFGLSPVSLALAMLDWGAHLAVAPGKCFVLATQAWLAALAPAASPGEGGADD
FT                   ADASGLAVHAGQSDPRFAAPAWSGWPFRAYRDGFLSVQRWWRDATRGVPGVERHHEELV
FT                   GFVARQWLDACSPGNFLATNPVVLDATMRSGGANLAAGLHHWLDDANALLDRTSGTRAR
FT                   DTRGFLPGRDVAITPGRVVWRNALCELLQYDPTTPAVAREPILIVPSWIMKYYILDLQP
FT                   HDSLIRFLVDAGYTVFAVSWRNPGAEARELGLDDYLRDGCMAALGAARSICGEAVHAVG
FT                   YCLGGTLLAIGAAALARDGRQHEALRSVTLLAAQTDFSEPGELGLFIDASELSALDALM
FT                   WRQGYLDGAQMSAAFQLLNARDLIWSRMMSEYLLGTRTKPNDLMSWNEDTTRMPYRMHT
FT                   EYLTRLFLDNDLAAGRYSVDGRPVALSDIDVPTFVVGTERDHVSPWRSVYKLHLLTHHA
FT                   LTFVLTSGGHNAGIVSEPGHPGRHYRCATREPGAPYRSRHDFVRETPAVDGSWWTCWRD
FT                   WLRAHSSGDVSARVPAAGFGAAPGTYVLET"
FT   CDS_pept        308364..309395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptb"
FT                   /locus_tag="BMULJ_05632"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="COG0280: Phosphotransacetylase, Rickettsia
FT                   prowazekii"
FT                   /note="KEGG, K00634"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05632"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47459"
FT                   /db_xref="GOA:A0A0H3KYG3"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYG3"
FT                   /protein_id="BAG47459.1"
FT                   /translation="MNMNLHPDVSAGACLPGLLPRADGALPELIARARHAPPLTVAVVH
FT                   PCDPASLVALAAIDASPLGAVIEPLIVAPRAKVSRVADEAGVDLAKWTIEDVPHSHAAA
FT                   ARAVTLAASGRAGALMKGSLHTDELMGAVVAAESGLRTDKRMCHCFLIEAPAYPRPFLL
FT                   TDAAVNIAPDLARKASITQNAIDVAHALGVACPRVAVLCAVETVNPAMRSTLDAAALAK
FT                   MAGRGQITGAIVDGPLAFDNAISQRAAREKGIDSPVAGRADILVVPDIEAGNMLAKQLE
FT                   YLGGAANAGVVVGARVPIVLTSRADGVAVRVASCALAVLLAQARRGAAPIPEQAPLSME
FT                   EQR"
FT   CDS_pept        309392..310432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="BMULJ_05633"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="COG1063: Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases, Ralstonia solanacearum"
FT                   /note="KEGG, K00001"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05633"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47460"
FT                   /db_xref="GOA:A0A0H3KQF8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQF8"
FT                   /protein_id="BAG47460.1"
FT                   /translation="MKALVYHGPGRKALEERPKPALQSPTDAIVRVTRTTICGTDLHIL
FT                   KGDVPTCEPGRILGHEGVGIVEQVGAAVDSLKPGDHVLISCISSCGRCEYCRRGLYSHC
FT                   TTGGWILGNRIDGTQAEFVRIPHAPTSLYRIPAGADEDALVMLSDILPTGFECGVLNGK
FT                   VQPGCSVAIVGAGPIGLAALLTAQFYSPARIVMIDPDSNRLDIARRFGATDCFDGRDGD
FT                   PVADVMKLTDGVGVDCAIEAVGIPATFEMCTSLVAPGGVVANVGVHGIKADLHLEKLWD
FT                   RNIAITTRLVDTVSTPMLLKTVGAGRLDPARLITHRFSLDDVERAYDTFGRAAQTHALK
FT                   VIIGVG"
FT   CDS_pept        complement(310529..311932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05634"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="COG1236: Predicted exonuclease of the beta-lactamase
FT                   fold involved in RNA processing, Ralstonia solanacearum"
FT                   /note="KEGG, K07576"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05634"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47461"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ83"
FT                   /protein_id="BAG47461.1"
FT                   /translation="MKLTFLGATETVTGSKYLVEHGGRRVLVDCGLFQGTKNLRLRNWR
FT                   TLPLAPDTLDAVVLTHAHIDHTGYLPVLVREGYRGPVYCTAATAELCDIMLRDSARLQE
FT                   EEADFANRHGYSKHHPAQPLYTLDDAQRALRLLTPVAFDECTALGGAVSFRLLPAGHIL
FT                   GAASVVMHWDQKVLAFSGDLGRYHDPIMQPPRPPAHADYLVIESTYGDRLHPASDPENE
FT                   LAEMFDKTFARGGVVVMPCFTVGRAQEILHYIARLKASGRMARVPVFVDSPMATDVTEI
FT                   YRHHILEHRLTVSEANALGHAATMIRSVDQSKAIAEHHGPMVIIAGSGMATGGRVLHHL
FT                   ARYAPDARNTIALVGYQAAGTRGAALAAHEPTLKIHGEYVRVRAQVESITTLSAHADYE
FT                   EILKWLGTMPCAPVRTFVTHGEPAAADAMRRRIEERLHWRCEVPTYEQCVDLDAVESGN
FT                   TQEPAALPT"
FT   CDS_pept        312163..312612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05635"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUX8"
FT                   /protein_id="BAG47462.1"
FT                   /translation="MTLIVNLDGAGQHYRLCFVRSPWAWFTCLPLDEQCGERWADVPYQ
FT                   NAAKPPYSDSRAQLLRVAFDAPNLLPPEAGRHGHAWSVQQINHGAAPWLRSEDFVDALT
FT                   PTVPAGATLATFVERIEAAGGTVYGPLGWAELPPWQRPDVVPQTG"
FT   CDS_pept        complement(312633..314045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05636"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05636"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47463"
FT                   /db_xref="GOA:A0A0H3KQU9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQU9"
FT                   /protein_id="BAG47463.1"
FT                   /translation="MLLAGCTVGPNFVPPPAPRVARFVPPDDPGAASGSWSGDGRTQAL
FT                   STDAALTRDWWTRFGSRAIDSTVAEALTGSPTLDLAEATLRRSEHALRAGQGIFFPQVD
FT                   AQASASRQRAWPLRTGQALPASIFNLFTLSATVSYTLDLWGGEQRQVEALAADVDAQRQ
FT                   ALAGAYLMLTANVVNTMVARAAYRDEAAATREMIGLLDEQIRLTGAQVTAGAAAYVAVL
FT                   TLESQRASLEAALPALDQKRAQADDLLALLAGRYPVDWRTPDLSLDGIELPASLPDTAP
FT                   SSLVRRRPDILQAEAQLHVASAQVGVATAALYPNLTLSASGGFDSVVASKLFAPAGRAW
FT                   SVGAGLTAPIFHGGTLLNRRRAAQDAYDEADAAYRQVVLSAFSQVADTLRALANDAMAL
FT                   DAQARAMAAARDALKLTQAGYDAGIAGYVQLLVADLQYHQARIAWLQTVAQRLQDTVAF
FT                   YVALGGGWGDAG"
FT   CDS_pept        complement(314101..315186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05637"
FT                   /product="HlyD family secretion protein"
FT                   /note="KEGG, K02005"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05637"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47464"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYH0"
FT                   /protein_id="BAG47464.1"
FT                   /translation="MKHRLVFVAAVLGFLASVVAAWVYSRQEPPQPPVFKPAANPYARG
FT                   VYANGIVESEQPAGANVNVYPDVSGAVTRILVHDGDPVKAGDALLTIDDSVQRATAAQL
FT                   AAQADAADALLDELKAQPRREVLDVASAQTAAAQASLKLAQDQYDKQRHAYDIDPKAVS
FT                   RDALDTAANTVRVAAANLDVVTRQYRLTKAGAWRYDVRNQEAQAIALRRAADAAAALLA
FT                   RYTLRAPADGTVLAMNAAVGSYLTSQGLYDTYTQGNAPAAVLGTPVDRLQVRCYVDEIL
FT                   IHQLPDLHALKAHMFVRGTSVEADLQFVRVQPYVTPKIELSDQRTERVDVRVLPVIFRI
FT                   VPNRNVRLFPGQIVDVYVAGK"
FT   CDS_pept        complement(315183..315881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05638"
FT                   /product="ABC-type antimicrobial peptide transport system
FT                   ATPase component"
FT                   /note="COG1136: ABC-type antimicrobial peptide transport
FT                   system, ATPase component, Caulobacter vibrioides"
FT                   /note="KEGG, K02003"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05638"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47465"
FT                   /db_xref="GOA:A0A0H3KQG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQG6"
FT                   /protein_id="BAG47465.1"
FT                   /translation="MAGIAIDARGVSKWFGEGDARTQALRDVSMQANFGEMLLIVGPSG
FT                   SGKTTLLSVISGILRPDGGSVSIDGVDLWSQPNDAIADFRLNRIGFVFQDYHLFPRLTT
FT                   AENVAIPLILKRRSWNDAIKEAHAYLDVVGLANRAQLPPVKLSGGEQQRVAIARAIVSQ
FT                   PDLLILDEPTASLDGDTGRMIIDFVKHKVLNDTRCIVIVTHDARIFEYADRVLRMEDGK
FT                   LNGIERGGAQ"
FT   CDS_pept        complement(315884..317020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05639"
FT                   /product="putative ABC-type antimicrobial peptide transport
FT                   system permease component"
FT                   /note="KEGG, K02004"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05639"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47466"
FT                   /db_xref="GOA:A0A0H3KQ87"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ87"
FT                   /protein_id="BAG47466.1"
FT                   /translation="MNGIFRLAFKLLVNDSAKFTALTVGITFSVLLMIEMTSLFAGILN
FT                   KSSASVINIGAKVWVMDPAVKTIANSIGMPDYVLDSVRSIDGVKYAVPLYSGGALVKLR
FT                   SGTYQAVTVVGLDDASLLGRPTMLQGRIEDIYAENGFIAIQDPEFPKLENPSVGTDFEL
FT                   NDHRGVIVGIAKVAASGLFGTPTLYTTYARAIRYIPSPRFTTSYILVEPKSDADVAHIK
FT                   AVVQSLGYRAYTRDEFIAQIARFYKYETGLGTNIMLMTIISFIIGLSISGQTFYAFILE
FT                   NLDKFGALKAIGAKSRELVAMILFQATFTALTGYGIGVGLCVLMISLAKLRIPDYAALV
FT                   TYGNLSLAFGMVVVIATISSYLGVRRVLRIEPFDIFRG"
FT   CDS_pept        complement(317017..317238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47467"
FT                   /db_xref="GOA:A0A0H3KUY2"
FT                   /db_xref="InterPro:IPR021347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KUY2"
FT                   /protein_id="BAG47467.1"
FT                   /translation="MMGLPYRSALATFCVFIALASLLGVVHAMLIDERVVPYAIIALVS
FT                   GIVAFVAQPDPASSGRQRHGPDALDSPS"
FT   CDS_pept        complement(317395..318519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05641"
FT                   /product="ABC-2 type transport system permease protein"
FT                   /note="COG0842: ABC-type multidrug transport system,
FT                   permease component, Brucella melitensis"
FT                   /note="KEGG, K01992"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05641"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47468"
FT                   /db_xref="GOA:A0A0H3KQV6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQV6"
FT                   /protein_id="BAG47468.1"
FT                   /translation="MSRLLVIFRLGVKELWSLARDPILLALIVYTFSASIYVAATARPE
FT                   TLHKVPIAIVDEDASPLSARIAAAFFPPQFAPPPIVDARAADRGLDDGDYTFSLDIPPD
FT                   FQRDVLAGRHATVQLNVDATRMTQAFTGGGYIQQIVSGEIDAFVRRHRGTALPPVDLAM
FT                   RMRFNPNLDEVRFGALMELINNVTMLSMILTGAALIREREHGTIEHLLVMPVTAAEIML
FT                   AKVWSMGLVVAAAAVASLMFVVGGALHVPIPGSVSLFVAGMALHLFATTSMGIFLATLV
FT                   RSMPQFGMLLVLVLLPLQLLSGGLTPRESMPSVVQDVMLVAPTTHFVELAQRILYRGAG
FT                   LDAVWAQFAALFAIGCVLFLLSLTRFRKTIGQMT"
FT   CDS_pept        complement(318522..321350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05642"
FT                   /product="ABC-2 type transport system ATP-binding protein"
FT                   /note="COG1131: ABC-type multidrug transport system, ATPase
FT                   component, Pseudomonas aeruginosa"
FT                   /note="KEGG, K01990"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05642"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47469"
FT                   /db_xref="GOA:A0A0H3KYJ7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYJ7"
FT                   /protein_id="BAG47469.1"
FT                   /translation="MNAPTPAGTDAGAIDRSPVSADPRMVARLSAVSLRYGDKYALDDV
FT                   TLDIPAGRMIGLIGPDGVGKSSLLALVSGARAIQQGRVWTLDGDLASRRHRARACRRIA
FT                   YMPQGLGRNLYATLSVEENLQFFARLFGHDAAERRRRIDALTQSTGLQRFLDRPAGKLS
FT                   GGMKQKLGLCCALIHDPDLLILDEPTTGVDPLSRAQFWELIGRIRAARPAMSVLVATAY
FT                   MDEARRFDRLIAMDAGRVLATGSPDELLERTGCDTLEAAFIALLPEARRRGHQSVVIEP
FT                   FQPDQAAGYAIEADALTMRFGDFVAVDHVSLQIRQGEIFGFLGSNGCGKSTTMKMLTGL
FT                   LPASEGTATLFDRPVATNDIDTRRRVGYMSQGFSLYGELTVRQNLVLHARLFGVPEPDV
FT                   PARVTEMVERFGLADALDALPERLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVAR
FT                   DDFWRLMIALARNDRVTIFISTHFMNEAARCDRISLMHAGRVLASAAPAELVRLRGAAT
FT                   LEDAFIGYLSDAQHADADGAEGAGGAAADAPPDAGWLAAPLAAAGAAHAAAWFSPARAG
FT                   SYLWREVLELRRDPLRATLALFGSLVLMCVISIGISLDVDNLTFAVLDRDQSILSQDYA
FT                   QNLAGSRYFVPRAPLADDRDIERRMRHGQLSLALEIPPGFARDVARGHRVEIGAWVDGA
FT                   MPMRAETIRGYVAGMHENWMRDQARRRLGVSLVPAVDIAIRYRYNPDVKSLPAMIPAIM
FT                   PMLLLMLPAMLTALAVVRERELGSIVNLYVTPVTRAEFLLGKQAPYVMLAMLNFLLMVV
FT                   LADVVFGVRIKGSFATLAAAVLIFNVVATGIGLFASTFTRSQIAAIFMTIVGTLIPVVQ
FT                   FSGLLTPLSSLEGSGKWIGTVYPATYMLAISRGVYNKTLGLADLSSQFWPMLASVPVIL
FT                   VMTGVLLRKQER"
FT   CDS_pept        complement(321347..322420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05643"
FT                   /product="HlyD family secretion protein"
FT                   /note="COG0845: Membrane-fusion protein, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K01993"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05643"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47470"
FT                   /db_xref="GOA:A0A0H3KQJ6"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQJ6"
FT                   /protein_id="BAG47470.1"
FT                   /translation="MKTIPRPLLIGVGAAVLAIGLAYYGWTRWRDGQTDAGLVSGNGRI
FT                   EATEIDVATKLPGRVTAMLVDEGDFVTAGQPLARMDVVVLQAQLDEARAREQQAVNTAA
FT                   SIDAQVAQRRSDKAAAAAVVVQRESELDAATRRLARSETLSRDGASSLQELDDDRARAG
FT                   SLRATVNAARAQVEAAQAAVDATRAQLVAARSAVTAAQATVARVRADIADSELTSPRDG
FT                   RVQYRIAESGEVLPAGGKVLNVVDLSDVYMTFFLPEAVVGRVPLGADVRIVLDAAPEYV
FT                   IPARVSYVSSTAQFTPKTVETATERQKLMFRVKARIDRDLLQRHLKLVKTGLPGVAWLK
FT                   TDPRAGWPDRLAIRVPQ"
FT   CDS_pept        complement(322417..323910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05644"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05644"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47471"
FT                   /db_xref="GOA:A0A0H3KQA8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQA8"
FT                   /protein_id="BAG47471.1"
FT                   /translation="MRAAAPAVRFHPAVVRRMRAIALAAGMGLLSGCLSLAPPDERAAA
FT                   PIPASFPDPSADATPATPVPEWQAYFVDARLRALIGQALAENRDLRAAVARVEQARAVY
FT                   GIRSADQWPTIGAGAAYARFRTPGGFLTPAPVIGQLYEVQLAETQWELDFWGRVRNLKD
FT                   AALQRYLASDAAKRAVTLSVVTGVANADLNLCEIDERIALTRATIDTRRESLRIFRLRH
FT                   AAGAISRLDLTQSEILLQQAESLGVQLQQARATAADALALLVGAPPALADTPLALDDGA
FT                   VLPSLAPGLPSSLLTRRPDVIAAEHELQATRANIGAARAAFFPRIALTSAIGSGSSALH
FT                   DLLSSGAGVWSVIPNVTLPLVDGGRNRSNLALSHAQRDEALAQYEKTLQRAFRDVSDAL
FT                   AARHWLADQVAIERATLASQAERARLAKLRYDSGATRFLEVLDAQRDLMNAEQQLVMTR
FT                   RALLSSRVALYGALGGGEIDTGKTTAATAPISTDSDNTP"
FT   CDS_pept        complement(324131..324319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05645"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47472"
FT                   /db_xref="GOA:A0A0H3KV09"
FT                   /db_xref="InterPro:IPR021347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV09"
FT                   /protein_id="BAG47472.1"
FT                   /translation="MIHKQYRIVLATLSVFIAIASLVGIVHGMLFDEEVFRYSIVTLIS
FT                   SILAFVVLLNPGPGDRP"
FT   CDS_pept        324610..325257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05646"
FT                   /product="predicted periplasmic or secreted lipoprotein"
FT                   /note="COG2823: Predicted periplasmic or secreted
FT                   lipoprotein, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05646"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47473"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQY7"
FT                   /protein_id="BAG47473.1"
FT                   /translation="MKSDAVLKQDVEQALFWNPAVDARRIDVEVRDRIVTLRGTVDSWA
FT                   QKLEAQKTALHIADARALVLELNVAPPENACADQELAIAITFALGWQEALRDHKISVEV
FT                   DHGCVTLDGEVDHAYQSRAAEAMVSRMIGVVGVANRIRVRTDHTVPDVGARIAEALARR
FT                   AHRESAGISIDAADGVVTLTGAVASLAEKRAACGAAASVRGVREVVDRLTVA"
FT   CDS_pept        325297..325806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05647"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYK6"
FT                   /protein_id="BAG47474.1"
FT                   /translation="MKRSHTGPSRNYLRRDKRMQPHTKDSYRDPKRPTGDHVCEGCGAV
FT                   CDAGRWTWSATALDGRQLECPACKRMRENVPAGELVLHGEYLRAHRSTILKLLEHQADL
FT                   ETSEHALERIMDIEKSAESLIVRTTGVHMVRRLGEALLRAHHGDLAINYRDGEDVLRAH
FT                   WTRDEA"
FT   CDS_pept        325840..327747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BMULJ_05648"
FT                   /product="cell division protease"
FT                   /note="COG0465: ATP-dependent Zn proteases, Nostoc sp. PCC
FT                   7120"
FT                   /note="FtsH protein"
FT                   /note="KEGG, K03798"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05648"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47475"
FT                   /db_xref="GOA:A0A0H3KQK1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQK1"
FT                   /protein_id="BAG47475.1"
FT                   /translation="MNKSFDYSGLLIPIAFAVLVAFQLLARQPAATSISYSDFHRLVEA
FT                   RLVADLEIGQSSISGTLRMPAAGAALPASDAAEVKELGPPWRFTTNRVSDEGLVAALTN
FT                   AGIRYRGATDTGWIETLAAWIFPLIGFVVIWNFLMRRPGGMRDLSGMGKSRARVYMQKE
FT                   TGITFDDIAGIDEAKAELQQIVAFLRNPERYQRLGGKIPKGVLIVGAPGTGKTLLARAV
FT                   AGEAAVPFFTISGSAFVEMFVGVGAARVRDLFEQAQRSAPCIVFIDELDALGKARGVGL
FT                   MSGNDEREQTLNQLLVEMDGFQANSGVIIMAATNRPEILDPALLRPGRFDRHIAIDRPD
FT                   LTGRKQILAVHTKRVKLAPEVDLAELAQRTPGFVGADLANVVNEAALHAAELGKPAIGM
FT                   ADFDEAIDRAMTGMERKSRVMNEQEKRTIAYHESGHALVAQSRAHCDPVKKVSIIPRGI
FT                   AALGYTQQVPTEDRYVLRRSELLDRLDVLLGGRVAEEIAFGDVSTGAQNDLERATALAR
FT                   HMVMQYGMSEKVGLVTLDDGAPQGGAPGVWTPGDGHCSEHTAQLIDEEVRALLEDAHAR
FT                   VTATLGEHRDALERIALSLLQHESIDHDGLVTLIAPPDDADVTPRPAQADAETTTGVSA
FT                   "
FT   CDS_pept        complement(327800..329596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="BMULJ_05649"
FT                   /product="ribonucleoside-diphosphate reductase alpha chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG0209: Ribonucleotide reductase, alpha subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00525"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05649"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47476"
FT                   /db_xref="GOA:A0A0H3KQB1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQB1"
FT                   /protein_id="BAG47476.1"
FT                   /translation="MDEQPLCTTVFAERYAQPGETSRADVFHRVAHALSLAEPAERRAQ
FT                   AERAFFLNLQRGAIGAGRILANAGADNGRTMVNCFVHPLAIPPDTPVQTVDTALAQALD
FT                   DARVTLLMGGGIGYDFSPVPPADAYERRQSSVRGACEAIDRFDGMCRALPFTGPRRGAQ
FT                   MGVLRCDHPDLVAFVAAKRGRSRWPTFNLSVGVTDAFMEAVRHDLPWALVHHAPPRRAS
FT                   GAPPRRPDGRYLYATVPARTLWHEIVKAARDSAEPGLLFLDTIRDANPLREHERIDATN
FT                   PCGEQPLPPYGSCVLGPIDLSRFVLHPFGVDENPRFDFATLADAVRIQVRMLDNVLDLT
FT                   AWPLAAHEHEARRTRRVGVGVTGLADALTMLRVRYDSAEARTLARTIVLTMREHAFAAS
FT                   AALAAERGAFPAYDPAAYLTGPAYRTLLPLKVHHTIARHGLRNSHLLSFAPAGSVSLAF
FT                   CDNCSNGIEPAVGWTQRRMVRTADGQIRPFRAENHAYRLFHELHGENVELPGYFVTAAD
FT                   IAPADHVAMLAALQPCVDAGISKTVTMPGQCSLAEVDALFFQAWRDGLKGITVFRPDPR
FT                   LASVVADDTARARRDGPVCIGC"
FT   CDS_pept        329798..330733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="BMULJ_05650"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="COG1105: Fructose-1-phosphate kinase and related
FT                   fructose-6-phosphate kinase (PfkB), Mycobacterium
FT                   tuberculosis CDC1551"
FT                   /note="KEGG, K00882"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47477"
FT                   /db_xref="GOA:A0A0H3KV11"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV11"
FT                   /protein_id="BAG47477.1"
FT                   /translation="MTDIVTVTLNPAVDVATSVEHIVDTHKLRCARPRRDPGGGGINVA
FT                   RTIHRLGGDCVALYLAGGPTGDVLTLLLEAERLPAVRIRIAGETRENVCVTETATGREY
FT                   RFLMPGPLVTEAEWRDCAARIDTLHPAPRYLVLSGSLPPGAPDDLYATLARTARARGSR
FT                   VVVDAAGRALQAALEAGVHLVKPSLGELSALAGEPLDETSACRKASELVARGQADIVAL
FT                   TLGARGAWVVTRDGALRLPGRPATVCSTVGAGDSFVGGMVWALARGVPFDEACRYALAA
FT                   SAASVEHPGTALCTRDDVERIHAELVAQAS"
FT   CDS_pept        330852..331643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05651"
FT                   /product="predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05651"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47478"
FT                   /db_xref="GOA:A0A0H3KQZ2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQZ2"
FT                   /protein_id="BAG47478.1"
FT                   /translation="MAFRLIAFLLLLSCMPPVSSAEVATVDSPSTRVLILVYHRFATAR
FT                   LDSMTVRTETLRNQLRAIEANGYRIVPLADVVRWHGGQADAVPARAVAITVDDGHRSVY
FT                   EVLRPLLATHPMPVTLFIYPSAISNASYAMTWDQLRMLGQSGGFDIESHTYWHPNFRTE
FT                   RARLTPDDYLRFVSFQLSRSRERLESETGQPVRMLAWPFGVHDAQTDQLAAREGYVAAF
FT                   TLDARPVRITDPAMALPRYLMTDACDTRCMNGLLRTAGGKP"
FT   CDS_pept        331640..332896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05652"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1306: Uncharacterized conserved protein,
FT                   Fusobacterium nucleatum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05652"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47479"
FT                   /db_xref="GOA:A0A0H3KYK9"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYK9"
FT                   /protein_id="BAG47479.1"
FT                   /translation="MIERLIVCLLVSLAGFAARAAPVTITVVDATNGRPLAGAIGHAPG
FT                   ANRTADRDGAFSLEIDAAGTRLSVRAPGYARTEVTLAPAEGAQTIRMTPVRPKAVYLSA
FT                   YGVADRTLREAALSLQDKTAINALVIDVKGDSGVTPYRSLAREISGASNNVAGAIVRPP
FT                   DLPDLLWTFHARGLYLIARIVVFKDDALARAHPEWAVRDAAGEIWQDREHQRWIDPTSH
FT                   AAWQHNYDVAEEAARMGFDEIQFDYLRFPDANGLRFAEPNTEANRVAAITGFLTGARER
FT                   LRPYNLYVSADIFGYVCWNADDTAIGQRLDALGPVVDYVSPMLYPSGFTWGLPGCRKPT
FT                   EHPGEIVSRSLAEAKRRTGLDGVRFRPWLQAFRDYALDHRRFDADEIRAQVDAADAAGT
FT                   DGWMLWNPRNRYDPAALPR"
FT   CDS_pept        complement(333207..333668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05653"
FT                   /product="putative cell wall-associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05653"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47480"
FT                   /db_xref="GOA:A0A0H3KQK6"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQK6"
FT                   /protein_id="BAG47480.1"
FT                   /translation="MIDQTAAHADDAMLDGEPPVGAHLVTPRPGYLHHGIYIGDGNVIH
FT                   YAGWSRHASGGPVEVVTLDGFRAGFGLAVIRHARTPYDGTEAARRAASRLGECQYRLLT
FT                   NNCEHFCLWCLFGVGRSEQVASCLRNPVHGIAVAVMLMACVLAARCIRR"
FT   CDS_pept        334090..334563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05654"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05654"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47481"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQB4"
FT                   /protein_id="BAG47481.1"
FT                   /translation="MWTGTMKMLLAACLLTVGANALAETSTEPIQRNGVAYITGGIGED
FT                   EVTAFRDVAPRYNLRIMFASKAGHYLSDVDVTLSSGKSTLLDVHTSGPFLFARVPPGRY
FT                   TVSAHDRAVQEVRHVVVPARGGVEVRFYWRDPERQGAMHLCTRCPQSQRQPAR"
FT   CDS_pept        334703..337060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05655"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3876: Uncharacterized protein conserved in
FT                   bacteria, Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05655"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47482"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV15"
FT                   /protein_id="BAG47482.1"
FT                   /translation="MEHARSLRCLWAAALVFALASAGARADADAAMAPQQAAAIDGAIA
FT                   AEIADGHLAGAVVVTGDADGVRVRVARGQRVTGEHVEAMTVDTVFDLASLTKPVATAVA
FT                   IMQLAERGMLSLDAPAARYWPAFGAHGKAGITIRQLLAHVSGLPAGVSSSRALRSRAAV
FT                   LADIVAMTPGALAGTQVRYSDVNYVVLGKIVERVSHRPLDAWCAAHVFAPLGMASTAFR
FT                   PPASLFARVAPTTARDGHLLRGSVHDPVAAAMGGVAGNAGLFASADDLARFARMLLNGG
FT                   ALGPVRVLARRSVAALETPATLDAEGDLHTPGWAVGPPLVANRYRLPPVGALQHLGYTG
FT                   TALWIDPVTRRFAIVLTSRLYPDETGTAMPLRSLVLGIVSSEAAPVTSSRIATRVPEMA
FT                   TAVAQVARLPVSRGPVLAGIAVLAARGFAAVAGKRIALVTNRSGFDRFGRRTIDLLAQA
FT                   PGARLVALFAPEHGLGTDVDETFGDTVDAATGVVIHSLYGDRRRIAPALLADVDVLVLD
FT                   LQDAGVRFFTYLATLGYALEAGAAAHRPVLVLDRPDPLGGDVFGGPVADAGPATFTGYY
FT                   QLPLQPGMTLGELARLFNDRLHIGAALTVVPMANYVRTMRFGDTGLGWVPPSPNLRDAA
FT                   ALSLYPETGLIEGAAVSVGRGTETPFGVVGAPWIDGRILADDLRAMRLAATFSPVRFVP
FT                   AEGPYHGMVCEGVRIELPAGKARPGEIGLALALALHRRYPARFRIDAIRASVGSREVAD
FT                   MLEAGRSIGEIERVVDAQNAAFARERAAFLLY"
FT   CDS_pept        337380..337742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05656"
FT                   /product="cytochrome c553"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05656"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47483"
FT                   /db_xref="GOA:A0A0H3KQZ8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015170"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQZ8"
FT                   /protein_id="BAG47483.1"
FT                   /translation="MLFAGVACARAETPAGLLEGYTTQAGTSAAPARGQRFFTSRHGRE
FT                   WSCASCHGSTPTGPGRHVVTGKTIEPLAPAFNPARFTDAARTEKWFRRNCKDVVGRECS
FT                   AAEKADVLSWLMSLKP"
FT   CDS_pept        337755..338276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05657"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05657"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47484"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYL2"
FT                   /protein_id="BAG47484.1"
FT                   /translation="MNNADSTPFLRRIAPPRHVRASVISMLLLSLLPRAAMAEDETRGI
FT                   SIPLLPKYKQECATCHVAYPPGALPAESWRRILNGLDRHFGTDATLDPTTIGQLETWLT
FT                   AHAATGAAARRPPEDRITRSAWFAATHDEVPASVWRSPAVKRPSNCAACHTQADKGNFD
FT                   ERFVRIPSSR"
FT   CDS_pept        338242..338979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05658"
FT                   /product="putative cytochrome b"
FT                   /note="COG3658: Cytochrome b, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05658"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47485"
FT                   /db_xref="GOA:A0A0H3KQL0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQL0"
FT                   /protein_id="BAG47485.1"
FT                   /translation="MNDSSASRAPGEPACSRPARILVWDAPIRAFHWLTVVAFAGAWLT
FT                   AESERWRLMHTAFGYTMLALVAFRVVWGVAGTRHARFSSFVRSPAAVFRYVLSLAKGRP
FT                   EHHVGHNPAGAVAIVAMLAMTVVTGITGWAAYNGNGESFGDLHEGAANVMLALVAVHVA
FT                   AVLVSSVVHRENLARAMVTGYKRGAPIDGIRRARWRIAVVMTAAAIGWWWTQWHAAPQP
FT                   ALADRPVATDTGRAANGAGRDDD"
FT   CDS_pept        339004..339669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseB"
FT                   /locus_tag="BMULJ_05659"
FT                   /product="OmpR family two-component system response
FT                   regulator"
FT                   /note="COG0745: Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain, Pseudomonas aeruginosa"
FT                   /note="KEGG, K07666"
FT                   /note="QseB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05659"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47486"
FT                   /db_xref="GOA:A0A0H3KQB7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQB7"
FT                   /protein_id="BAG47486.1"
FT                   /translation="MRILLVEDDILLGDGIRAGLRQQGFQVDWVRDGDAAQRELRAHAH
FT                   AAAILDLGLPLVDGMDVLQRIRRDGMALPILILTARDAVPDRIRALDVGADDYVIKPVD
FT                   LYELGARLRALVRRAHGRPTERLQAQDVELEPASRTARRAGVAVALSTREFDLLHILML
FT                   NAGRVLSREQIELYLYSWGQEVESNAVEVHVHRLRAKLGSELIRTVRGVGYVLMRDAA"
FT   CDS_pept        339675..341054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05660"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K07645"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47487"
FT                   /db_xref="GOA:A0A0H3KV19"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV19"
FT                   /protein_id="BAG47487.1"
FT                   /translation="MLPARSLHGRLLTLVPAVVLGVWLSTLMLTWLDARREIDRLLDGH
FT                   LAQAAALLVAQQARGPDDDDNAIDAPILHPYGPRVAFQVFHEGRLGLHSENAPSRPMVA
FT                   PELTGRDRASGFWTVVIDGNAWRVFVVHGMRDDVQVFVGERIDSRKSILGGVMRSAFWP
FT                   MAAALPLLVLAIGWAVRRGTAPLRDFGRALAKRNPQALDTIRLERTPLEMRPMLDALNG
FT                   LFARIRAVMDAERRFTADAAHELRTPIAAVKAQAQVALAERDDERRLHALRGVLEGCDR
FT                   AARLVDQLLLLSRLDSGALADRAPVDVSAVAKGGVAEAAPRSIGRQQKLELDAPSPCIV
FT                   GGNEALLAAMVRNLVDNAIRYSPPLARIAVSVGQRDGRTVLRVEDSGPGIGDDDLHRLG
FT                   ERFFRPAGTRPSGSGLGWSIVRRIAAAHVADIQVDRSPAFGGLRVTISWPAANEAGAAA
FT                   R"
FT   CDS_pept        341670..342170
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05661"
FT                   /note="truncated Co/Zn/Cd cation transporter"
FT   CDS_pept        342170..342436
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05662"
FT                   /note="truncated Co/Zn/Cd cation transporter"
FT   CDS_pept        complement(342487..343104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05663"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05663"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47488"
FT                   /db_xref="GOA:A0A0H3KR02"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR02"
FT                   /protein_id="BAG47488.1"
FT                   /translation="MLTLAVLFLLILLLNLMPAFAPPTWMAMSWVGFNLPDGNPLIFAI
FT                   VAASAATTGRVILAIFARSLVRSGWMRDSDRENIDVASRWLRKRRTLTAGAFFFYALSP
FT                   LPSNYLFIAYGLSDLPFRIIAAAFFVGRATTYAIWAHLGRFASNRLDLESGLEGSYLGG
FT                   FFIVTQLVLLGLVFMLMKLDWLAFFNERRLTFRRGHRPRGPE"
FT   CDS_pept        343329..345620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atp7"
FT                   /locus_tag="BMULJ_05664"
FT                   /product="Cu2+-exporting ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="COG2217: Cation transport ATPase, Sinorhizobium
FT                   meliloti"
FT                   /note="KEGG, K01533"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05664"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47489"
FT                   /db_xref="GOA:A0A0H3KYL7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYL7"
FT                   /protein_id="BAG47489.1"
FT                   /translation="MSRIPWSIDLALLVLTAVTLAGGGMCVAFGLPSLARVIWLLGTLP
FT                   VLLVLTVSLATAIARGQAGIDVLAWLAIGFAIALDETLAATVIALMLASGRTLERYAQD
FT                   RAQREMTALLERAPRQATRFEDGEWRSVAVETIVPGDRLLVRSGAFVPVDGTLTDDAEL
FT                   DESMLTGESSTQRRCAGESACSGVVNAGSPFEMVARTTAGESTFAGIVRMVERAQRERS
FT                   PSVRLADRYAVFFVFASLLVAGIAWLLAGDVARALAVLVVATPCPLILAVPVAIVSGMS
FT                   RCSKRGILVKGGGALERLAQATILFFDKTGTLTGGRPRIVSIDGAPAVATDEVLHFAAS
FT                   LAQASGHVISDALTVGARERHVALSPPSAIVEAAGEGVTGRVDGRLVTIGKCDYVCSHA
FT                   ARADWSDAFARRVAASGGAAVFVSVDGAMIGGIHLADRLRIEAPRALRLLKRAGIGRLV
FT                   MLTGDRRDIAESIGELLGVADVRAEQTPADKLAAIRAARREGVAIMIGDGVNDAPALAA
FT                   ADVGVAMGVRGAAASSEAADVVLLVDRLDRLVETISIARRSRRIAGESVAVGMSLSFAA
FT                   MLVAAFGFLPPIAGAVVQEAIDIVVIVNALRVSLMHPMPAQVRDSATDFEQLKSEHSAL
FT                   SPLIDRIGELADQIAKLSGAAAIDELARLVGELNERLVTHEKYDDVEVYPRLALLLGGD
FT                   DPLAAMSNAHREIIRMARLLTQTVADLPVDGPDAAQTQAIQRLLYGLEAIVRLHCAQEE
FT                   ELFDAIGAAA"
FT   CDS_pept        complement(345632..346585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05665"
FT                   /product="putative universal stress protein UspA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05665"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47490"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQL4"
FT                   /protein_id="BAG47490.1"
FT                   /translation="MSASASATEAHYAHRRVLIAIDVSAASERALAYAERMLHANAFVH
FT                   LVSIAENPRTLVPLGSHAMSFLHAARNELLKDAADCLSRAQRTMTRRTDIVVSTEVVDL
FT                   SAHGGDIVDALTDRAQTWQADLAIVGTRQHHGVRRWIEGAVSGPLAARIGCPLLIVPEG
FT                   FVPNADALPRRILFAVDGSGPALDALRVGLQFATPGAELRALYVVDRAVSLGDFVPIDT
FT                   VERALNAEGDTALREATAMLVAITAHAHAHLTQTDQAAPDVPHAIVREAVEWHADLTVM
FT                   GTHGRRGIAGWALGSVAERVARITKTPLLLVNANPA"
FT   CDS_pept        complement(346919..347662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05666"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47491"
FT                   /db_xref="GOA:A0A0H3KQC0"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQC0"
FT                   /protein_id="BAG47491.1"
FT                   /translation="MPINYLRAFTTLHRSDAANRRLGRSLAFVAGAANAGGFFAVGQYT
FT                   SHMSGIVSSMADNLALGDIGVVAAGLSSLLSFLAGAATSAILINWGRRRQLSSQYAMPL
FT                   ILEATLLLLFGLLGSGLETHHVLFVPATVCLLCYVMGLQNAMITKISKAEIRTTHVTGL
FT                   VTDIGIELGKLIYWNVGASQRDLVRADRQKLLLLGSLLLSFLIGGLAGAVGFRHVGFLS
FT                   SVPLAIVLVTLAVVPVFDDMLARRR"
FT   CDS_pept        complement(348079..348729)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05667"
FT                   /note="truncated transcriptional regulator"
FT   CDS_pept        complement(348108..348374)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05668"
FT                   /note="truncated transcriptional regulator"
FT   CDS_pept        complement(349488..350318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05669"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV22"
FT                   /protein_id="BAG47492.1"
FT                   /translation="MPLRNRDIKPRRFLACPNSMMARVSAATARSPSHHTVVFPVRSIA
FT                   LRLRSTVRQHARHYPRRSPEETNRCASADRNAERPERRSNAIAAHARPTLLVTGRLAAS
FT                   DEIVERVGLHVSERAESVARALRQPNLSVDALIAHVALLRVDLAVQFVSLAQARGVRAA
FT                   AVVYEYGSAQALSIVSLAGFLLFRSVRGHIDQPFVLTKLQQSIATMYAATPAAPLEILR
FT                   MGQKVKGCAVAGSSRMIGAGSPAVPASRPAPTRGHKRHPLEASPNWRRRRSRGF"
FT   CDS_pept        complement(350823..351314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR07"
FT                   /protein_id="BAG47493.1"
FT                   /translation="MLRSLAVPAASLLADASCLNDLASTRRTNSGRLRILTTLPARGTA
FT                   VWTGHACAFDTPVAPSLAFSLDVRYMRLVSTAMNDIERLSANACRRWCVTCGVTTSTKR
FT                   STTYRLATCFAACTLPAAARVYGKARPTAVAAKPASSHALAPRTRAKPSRGRWLGDDAR
FT                   "
FT   CDS_pept        complement(351363..351767)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05671"
FT                   /note="truncated cyclopropane fatty acid synthase"
FT   CDS_pept        complement(351870..352799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05672"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05672"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47494"
FT                   /db_xref="GOA:A0A0H3KYM2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYM2"
FT                   /protein_id="BAG47494.1"
FT                   /translation="MRIEHLNFHHLFYFWRVARTGHLTQAAGELHISQSALSAQIRQLE
FT                   DRLGEALFEREKRRLILTDTGRMVLTYAENIFGLGQEMLGRLHGRSEGMLRLRVGSVAT
FT                   VSRNYQENWIRPLLSDPGVTLTLESGMLDGLIERLLQHQLDIVLANEPLPSDPDRPLHC
FT                   SFLGSQAISLVGPASVWHGRRLRVPDDLGGLDVALPGVRHALRARFDALCASASAKPRI
FT                   RAEVDDMAMLRLIARDSGWLTVLPEVVVQDELRQGMLVSVGQTPELQEHFYAITTPHRH
FT                   RIERLEQLLAGATLSELDPLGGGPAGAS"
FT   CDS_pept        352897..354495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="BMULJ_05673"
FT                   /product="NADH dehydrogenase I subunit 5"
FT                   /note="COG1009: NADH:ubiquinone oxidoreductase subunit 5
FT                   (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit,
FT                   Vibrio cholerae"
FT                   /note="KEGG, K05577"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05673"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47495"
FT                   /db_xref="GOA:A0A0H3KQL7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQL7"
FT                   /protein_id="BAG47495.1"
FT                   /translation="MPVTHVVSFVCALAPAVLMSTAAALLGFRPDDSRAVWKPFHWLAA
FT                   IALLVALIQPVVLATAAPPAANIHDGAWTAWIEVTPLAAWMAALVQLLGTVIGVFSGRY
FT                   LHGEPGQSRYAAAFAGVLASVHVLLLSGHWLLLIAAWAGVGVWLRDLLCFYRDRPFARL
FT                   AAYKKQIVDRLADVLLLAAAGLAWAEAGGGTFAALRDHIAAYGASTPLQASAVCLVLAI
FT                   VLRTALFPVHGWLIQVMEAPTPVSALLHAGVVNLAGYLLMRFAPLLAVAPAARWLLVGF
FT                   GLGTTFLAGFVMLTRISIKVRLAWSTVAQMGFMVLECGLGLYQLAALHLIGHSLYKAHT
FT                   FLSASSAVQNTRLQIMRGRRDAATPSLVLAPAASLVVVMLVQMLAPTGSWPWWWSGVLA
FT                   LAWAPLLWIPVTEGDEPARAWTHAGFGATLIAGYTAVAALAHKLPLGVADTPFNVAGPV
FT                   ALAGMALLYVGLAALQRCPRRFATWRRWSYAGFYVDEFYTRLALRIWPARWAPHDAAHA
FT                   PRPAATSSAPGLTER"
FT   CDS_pept        354517..357126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05674"
FT                   /product="hypothetical protein"
FT                   /note="COG3002: Uncharacterized protein conserved in
FT                   bacteria, Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05674"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47496"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ASJ1"
FT                   /protein_id="BAG47496.1"
FT                   /translation="MSTATLEQRAKRGEAPRANDAGHCAHPADGARRGYPRERIDAACD
FT                   AACRSIAPAWPLDRAIAVNPHWERIGRPVREIAARMAVLADIKVFPPREQIRSAWESAR
FT                   IAPADLRYALQALPAAQAAGMTERNCIDALARPLNLPRLPLLIDVLDDDPLRHERLSWR
FT                   QAITHQVSQTCAAYFDEHQADWRPHHDQSLYAFWRDTISHDHGIGVLMGLPRLGQSLRA
FT                   LPATRQEAEAWVLERLGLPEAVWPDYLEAVLLTVNGWASWCAYLGWQARLAGESDEHLR
FT                   DLLAIRLAWGVLLLDCKDDAAARRAFAAVQGHWRDSAALLADAQARLLVDEVWQLAFEA
FT                   GYQRELAGKLGAVGQPQTIPEAATPAEEIEVQAAFCIDVRSEPLRRAVESIWPAVQTIG
FT                   FAGFFGLPVAYTPLATSARRPQLPGLLAPSLEVTDAVSGPAGEGGGTMRAAASTARRTR
FT                   FALSNQASAATRLPGTSFSFVEAAGLGYLGKLRQWLKPSRNPRVRDDLAGLPPRYKAVC
FT                   RPALVGIDDQAKADLAARILHGMGIARSLAPLVVLVGHASQSANNAHAAALDCGACCGQ
FT                   SGEVNVRVLAQLLNDRATRAGLAQRGIDVPDDTTFVAALHNTTTDEIEGFDVDLLNPIA
FT                   AARWAKLLSVFGHASDQVRRERAVRVGLDPRMEGGRLLASLRERANDGAQTRPEWGLAG
FT                   NAAFVIGPRTRSHGAVLDGRCFLHDYDFTQDTDGSLLELLMTAPMLVAHWINWQYHAST
FT                   CDPAHMGCGNKVLHNVVGGHIGVFEGNSGDLRIGLSKQSLHDGQRWMHEPLRLTVIIDA
FT                   PGASIERVIDRHPTVRHLIDHGWLHLWRFGETGLLRFSDRQWHPLAMGADPATRQSP"
FT   CDS_pept        complement(357256..358773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="BMULJ_05675"
FT                   /product="deoxyribodipyrimidine photo lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="COG0415: Deoxyribodipyrimidine photolyase,
FT                   Caulobacter vibrioides"
FT                   /note="KEGG, K01669"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05675"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47497"
FT                   /db_xref="GOA:A0A0H3KQC3"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQC3"
FT                   /protein_id="BAG47497.1"
FT                   /translation="MTSSELPYESRPVVVWFRDDQRLGDNPALCHAVASGHPVVCVYVH
FT                   DPAPSIRRPMGGAQRWWLHESLGKLDDALSALGGSLIVLRGDEHEAIRDFAVGIGAAKV
FT                   VWNRRYSKAHTGTDASIKQDLVGRGIAVSTFNGHLLHEPWTVLTREGLPYQVFSAYWRA
FT                   ACRDDLSPPPPLPAPSRIAFFPVPHNVTPHVCTLRALGLQPTAPDWASGLRLTWRCGEE
FT                   AARQRLDAFLEHSLRDYADMRDLPAAHATSRLSPYLRFGNISVRQVWYAASSAASAMQR
FT                   TRKADLGDPQSGPLNKFLSEIGWREFSYHLLYHFPPLHQVNFRRQFDSMPWRDDPNALR
FT                   KWQTGHTGYPLVDAGMRELWHTGWMHNRVRMVVASFLSKHLLIDWREGEAWFWDTLVDA
FT                   DEASNPASWQWVSGSGADAAPYFRIFNPVLQGQKFDPQGEYTRHWVPELSKMSAEKIHA
FT                   PWTASAEQLHDACVSLGRTYPFPIVDHQAARTRALESVKRVDSQKNA"
FT   CDS_pept        complement(358865..359479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05676"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47498"
FT                   /db_xref="GOA:A0A0H3KV25"
FT                   /db_xref="InterPro:IPR021306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV25"
FT                   /protein_id="BAG47498.1"
FT                   /translation="MTSVRNRATPRTLAPSARTYVYLATTQIGWLLCVMTAASHRAAWG
FT                   VAYALTATAGHLLFARRPSSEARLVVTVTVTGWLWDSAVAHSGLLDYPNGVLLNGTAPY
FT                   WLAALWALFAIQLNTLLRWLRGRPIIAALVGACAGPASFRAGAALGAVHFDAPAVALLV
FT                   IATGWACILPASVALGSHWDGITPRSATIGGNEGMQDGRAR"
FT   CDS_pept        359995..360954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05677"
FT                   /product="putative esterase/lipase"
FT                   /note="COG0657: Esterase/lipase, Caulobacter vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05677"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47499"
FT                   /db_xref="GOA:A0A0H3KR14"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR14"
FT                   /protein_id="BAG47499.1"
FT                   /translation="MNVKVGLAVLTILLAVGLLAACRPTRLLNALSPRYTFSLFADIPY
FT                   GSGERHVLDVYVPTRVMDDWPADSDAGVPVVVFFYGGSWQSGERKDYLFVGEALASRGF
FT                   VAVLPDYRTYPATTFPGFVDDAAQAVAWARAHASAFGGDPRRLILMGHSAGAQIAALLA
FT                   TDGRYLAARQMHKRDIAGVIGLAGAYDFLPLHDAMLERVFPPEVRAASQPIRFIEGAEP
FT                   PMWLAVAENDMVVEPGNTYRFARALQNAGDAVAVMRYANLGHATIVGVLGAPLRGRAPV
FT                   LDDLSAFVRRVAQASHAGAASGLVSASGAAARSAVSLR"
FT   CDS_pept        complement(361134..362105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05678"
FT                   /product="MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05678"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47500"
FT                   /db_xref="GOA:A0A0H3KYM7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYM7"
FT                   /protein_id="BAG47500.1"
FT                   /translation="MPPRKDRDTPHRYRSGEAARLARMPAATLRIWERRYGVVAPPKTP
FT                   SGQRLYSDDDVQRIRLLKALVNQGHAIGTIATLSREELEAMSLTSTHGPALPEKGVSLA
FT                   VVGALPISESAIERMGLRIDMQLDSIDDASEHAGETADALIATTTSLHEDVVSQLATAA
FT                   QKLNAQAVAVVYAFGTAEAIELARLSGFELFRSTEGQTNPASIISKLAQAVVKARQSND
FT                   ADRGLWLRSRRRFDETTLASLSGLSTTVKCECPRHLSELIMQLSAFERYSDECVSRSPA
FT                   DALLHRHLGDAANRAAELLETALAVILREEGLGGTTPDLKAQ"
FT   CDS_pept        362444..363973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05679"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3046: Uncharacterized protein related to
FT                   deoxyribodipyrimidine photolyase, Vibrio cholerae"
FT                   /note="KEGG, K06876"
FT                   /note="related to deoxyribodipyrimidine photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05679"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47501"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQM2"
FT                   /protein_id="BAG47501.1"
FT                   /translation="MKTLRLVLGDQLDWTHPWFADVRADTLYVLMEVRQETDYTLHHAQ
FT                   KLIAIFAAMRRFATLLRDAGHRVHYIEIDDQFNRQAIPANLDSVAALHGAARIEYLLSD
FT                   EWRVDRQLSEYAAVASVPVRAVDTGHFYTTRDEVGRVLGTGRAWVMDRFYRSMRVRHRV
FT                   LLDGEGRPAGGQWNYDAENRDAWSGTPAEPSDWRPHHDHRPLWDRIVAAGVRSFGEPSA
FT                   GDFRWPVDRVEALACLDAFIEHALPSFGQFQDAMHTSARRLFHSMLSFALNVKMLNPRE
FT                   VVARAEHAYRTGAAPLAAVEGFIRQILGWREFVRGVYWARMPGYETSNAFGHRRPLPQW
FT                   FWNGRTRMGCMAHALRQSLEDAHAHHIQRLMVIGNFALLAGLDAHAVHEWYLGVYIDAF
FT                   EWVEMPNTLGMSQYADGGAMASKPYVSSAAYIHRMSNYCKGCAYDRNARTGARACPFNA
FT                   LYWDFFARNRDALQHNHRLAMVYRQLARFDADALDAIRMQADGIVRNIESL"
FT   CDS_pept        complement(364272..365285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05680"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3380: Predicted NAD/FAD-dependent oxidoreductase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K06955"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47502"
FT                   /db_xref="GOA:A0A0H3KQC6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQC6"
FT                   /protein_id="BAG47502.1"
FT                   /translation="MNSFSDSSANIAVIGAGIAGLACARVLADAGYHVTVYEKSRGVGG
FT                   RTSTRRTDGWQADHGAQYFTARHPAFVAEVARWVAGGAAAPWAARVASIGSLGPRELLA
FT                   PAQRYVGVPGMTAPARYLSAGIDTMLETTIIELTRDAQRWRLISAEHGALRMHHDAVIV
FT                   AVPPPQAVALLRRAEPGLAVIAQRTEMRPAWAVMAQYGRLPDPGFDAAFVNVGPLGWIA
FT                   HDTSKPGRSGFSTWVLHATPEWSQAHLEAPPEQITRTLLDVFRDIVGATANSATAHRWR
FT                   YAELAPTSMTAPGRLAWRAGPRIGLCGDWLGGGKIEGAWLSGAGLGRAVADTLITH"
FT   CDS_pept        365558..366310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05681"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05681"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47503"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV29"
FT                   /protein_id="BAG47503.1"
FT                   /translation="MAFVWICGATGAVGSALARRLNAKGVSTLLTARNPERLGVLAETL
FT                   SRERVVVAPADATDAAALDRALATGVERFGAPDGLAHCVGSIVVKPMHSTSDAELHDAF
FT                   AANYFSAWNALRAFMRTVLAAQAGGSAVLFGSVASRAGFPNHEAIASAKAAVAALAQSA
FT                   AATYAARGIRVNCVHPGLIASAMSARLTSAPQVAKRLADASPLGRIGAGDDPAAFAEFL
FT                   LSDDASWVTGQQFGVDGGQGALIVPARP"
FT   CDS_pept        366307..366765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05682"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47504"
FT                   /db_xref="GOA:A0A0H3KR18"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR18"
FT                   /protein_id="BAG47504.1"
FT                   /translation="MSMRAMLRRYRVPAALALAGLVPFIALSWLSVHASSRHDVYVHAL
FT                   LNYAACIVSFVGAVHWGIALRAPESPPRQRMLYGWSVIPALMAWAVLMLPDIGARLAGM
FT                   AIGLVGCAAVDGVLWRKALIPGWYFALRCLLTSVAGLSLLAAAASTNG"
FT   CDS_pept        366779..367195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="BMULJ_05683"
FT                   /product="succinate dehydrogenase cytochrome b-556 subunit"
FT                   /note="COG2009: Succinate dehydrogenase/fumarate reductase,
FT                   cytochrome b subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00241"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05683"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47505"
FT                   /db_xref="GOA:A0A0H3KYN2"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYN2"
FT                   /protein_id="BAG47505.1"
FT                   /translation="MTTSRTPRPREYRNIGIGDITLKYRMPLAAILSILHRVSGALLFL
FT                   FLPFLLFLFDQSLTSELSFEVFKQFLSNIVVKLIVLALSWAFFHHFCAGIRHLLMDVNH
FT                   DAVSKEGGKRTAVVVFVVSIALTIAMALKLFGAF"
FT   CDS_pept        367200..367568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="BMULJ_05684"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein"
FT                   /note="COG2142: Succinate dehydrogenase, hydrophobic anchor
FT                   subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00242"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05684"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47506"
FT                   /db_xref="GOA:A0A0H3KQM5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQM5"
FT                   /protein_id="BAG47506.1"
FT                   /translation="MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFF
FT                   GAHDFSYEGWASIFSAQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLT
FT                   IVWLLACAGYAAQILWRV"
FT   CDS_pept        367572..369347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="BMULJ_05685"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /note="COG1053: Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00239"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05685"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47507"
FT                   /db_xref="GOA:A0A0H3KQ35"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQ35"
FT                   /protein_id="BAG47507.1"
FT                   /translation="MAAIKTSLPRRKFDVVIVGAGGSGLRAALQLSRAGLSVGVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHFHFYDTIKGSDWLGDQDAIEFMCREAPNVVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVEAKT
FT                   QFFVEWMALDLIRDADGDVLGVTALEMETGDVYIMEGKTTLFATGGAGRIFAASTNAFI
FT                   NTGDGLGMAARAGVALQDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALK
FT                   FANVDCIKEPIPVVPTIHYQMGGIPTNIHGQVVGTSRDHKEPINGFYAVGECSCVSVHG
FT                   ANRLGTNSLLDLVVFGRAAGNHIVEQVKKQKEHKPLPADAGEFSLARLNKLDKSSSGEY
FT                   TQDVANDIRATMQKHAGVFRTSALLKEGVELMDGLKQRVEHIHLKDKSKVFNTARVEAL
FT                   ELENLIEVARATMVSAEARKESRGAHAHSDYEHRDDENWLRHTLWYSEGDRLDYKPVQM
FT                   QPLTVESVPPKARTF"
FT   CDS_pept        369369..370070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="BMULJ_05686"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /note="COG0479: Succinate dehydrogenase/fumarate reductase,
FT                   Fe-S protein subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00240"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05686"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47508"
FT                   /db_xref="GOA:A0A0H3KV32"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV32"
FT                   /protein_id="BAG47508.1"
FT                   /translation="MAKRIFEVYRYDPDKDAAPRMQTYELEIKHERMLLDALVKLKALD
FT                   ETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLIVDMT
FT                   HFFNQYHSIKPYLINDAPPPEKERLQSPEERDELDGVYECILCASCSTSCPSFWWNPDK
FT                   FVGPAGLLQAYRFIADSRDTATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIG
FT                   KIKELMVRRAV"
FT   CDS_pept        complement(370333..371037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05687"
FT                   /product="ECF subfamily RNA polymerase sigma-70 factor"
FT                   /note="COG1595: DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog, Mesorhizobium loti"
FT                   /note="KEGG, K03088"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05687"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47509"
FT                   /db_xref="GOA:A0A0H3KR22"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR22"
FT                   /protein_id="BAG47509.1"
FT                   /translation="MNRSHESLLRSSGPGRTTPLPAGRQPQRRASRARSRPGGRTDISA
FT                   DAAVLPDEACDAHAELDRLLARVATGDEHAFAQLYRWTAPRLFGAILRMIRDRHEAEDL
FT                   LQDVFTTAWRRAGSFDATRGAAMTWLMTLARNRTIDRIRQHRELPLDDELALSIPDASP
FT                   TPDLGAQANQERLRLERGLAHLGERQAYVLREAFHGGASYAELAERMQVPLGTMKSWIR
FT                   RSLMRLKIYLEQ"
FT   CDS_pept        complement(371154..371885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BMULJ_05688"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="COG0302: GTP cyclohydrolase I, Mycobacterium leprae"
FT                   /note="KEGG, K01495"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05688"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47510"
FT                   /db_xref="GOA:A0A0H3KYN7"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYN7"
FT                   /protein_id="BAG47510.1"
FT                   /translation="MGNLIDAPARTLTAIDEGIPLSLIIRRRLEHAGARFHANDNIAAH
FT                   LRDGELDALQNEVAQQMEAVLRSLVIDVDNDHNTRETAQRVAKMFIREVFAGRYEAAPL
FT                   VTEFPNVERLDELLIVGPLRVRSACSHHLCPIMGRIWIGVLPSATSNLIGLSKYGRLVN
FT                   WVMTRPQIQEEAVKQIADLLESRIAPDGLAVVLEADHFCMHWRGTKDDQAKMTNSVMRG
FT                   KFLADASLRREFLALLPGKNA"
FT   CDS_pept        complement(372012..372797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05689"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47511"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQM9"
FT                   /protein_id="BAG47511.1"
FT                   /translation="MPTRNHAINPRRLLACPASLIGRGSVASARGPSRHAGAASGPPVA
FT                   SRRLEAAQCRGERRRHRSPQQTTPCASAGPNDTSVEPRSNSVAARAHPTLLVTGSLTAS
FT                   DEAAEGAGLHVCERVESLARALRQPCLAVDALIAEVTSLHIDLANQFVSLARARHVRAA
FT                   ALVYEHGSAQALSAVRRAGFHLFRSVGGRVDQTFVLTKLQQSVAVTLAATMAANDPVWR
FT                   LYRDVEGWARAPSACPSCAYRAGAPATRPHRHACPRARR"
FT   CDS_pept        complement(373379..373549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47512"
FT                   /db_xref="InterPro:IPR017136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQD3"
FT                   /protein_id="BAG47512.1"
FT                   /translation="MANKTHLPEKICETCGLPFSWRKKWKAVWDEVRHCSKRCRRNRRS
FT                   PAGMKTNAERR"
FT   CDS_pept        complement(373651..374178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05691"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47513"
FT                   /db_xref="GOA:A0A0H3KV36"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV36"
FT                   /protein_id="BAG47513.1"
FT                   /translation="MKRPLAMLAASVALAAPLVAGASCVDEIASARLIGSGRFCILGIC
FT                   LYDAQLWAPRAPGALDTPFALSLAYRRDVKGERLVSTGMDEIERLAPAPLPAATLDAWR
FT                   RDMERAFTDVSRGDVLCGVYVPERGARFYTNGRLTADVTDPAFARAFFAIWLDPRTRAK
FT                   ALRRQLLGDDAH"
FT   CDS_pept        complement(374180..375397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="BMULJ_05692"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="COG2230: Cyclopropane fatty acid synthase and
FT                   related methyltransferases, Caulobacter vibrioides"
FT                   /note="KEGG, K00574"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05692"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47514"
FT                   /db_xref="GOA:A0A0H3KR27"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR27"
FT                   /protein_id="BAG47514.1"
FT                   /translation="MTLLRLLSSASQPAMPLSARLFIALLRRIRDGHLTLVTPEGAQHV
FT                   FGDPHCQPAATLQIRDWRACRAILRAGDIGFAEAYRADRIDTPDLVALLRLAIRNQPVI
FT                   AKPVTGGRVARVWYALRHRLRMNTRAGSRRNIHAHYDLGNDFYRLWLDDTWTYSSACFD
FT                   GDPQRSLADAQTAKYQRIVDALGLRAGMRVLEIGCGWGGFAVHAARQGIHVHGVTISHA
FT                   QYALAQERVARDGLSDRVTFDLRDYRDVEGQYDAIVSIEMFEAVGESFWPVYFNTLRQR
FT                   LKPGARALIQSITIVESQFDAYRASSDFIREFIFPGGMLPSPARFVDAARRARLVAKPV
FT                   FAFGDDYARTLRTWRSSFDAHVDSVRAQRFDETFIRTWRLYLAYCEAGFAERRTDVMHF
FT                   IVSAHD"
FT   CDS_pept        complement(375394..376248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05693"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3496: Uncharacterized conserved protein,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05693"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47515"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYP2"
FT                   /protein_id="BAG47515.1"
FT                   /translation="MNAPFARDGAAARLLVGTVMHERLRPVRHAFRYPLFQVCCDVERL
FT                   DEIAGSWFGIDRRAPLALACRDYGPRDGRALGPWMRDVLAQAGIRADGPIWLQTIPRIF
FT                   GYAFNPVSFWYCYDRAGALRALYADVRNTFGAHHGYLLSAMHHAPIEADTVLVCRKTFH
FT                   VSPFCDVIGEYAFRVRQRGDHLSVAIDYRDDDGVLLRTAIGMRAAPLTAARAWRALARQ
FT                   PLNAINVVIRIHWQALRLWLARVPFHGKTPAGRSAATDSPLSPVPGASPRGRSAMSDHE
FT                   ARP"
FT   CDS_pept        complement(376245..377549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05694"
FT                   /product="predicted NAD/FAD-binding protein"
FT                   /note="COG2907: Predicted NAD/FAD-binding protein,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K06954"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05694"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47516"
FT                   /db_xref="GOA:A0A0H3KQN3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQN3"
FT                   /protein_id="BAG47516.1"
FT                   /translation="MHPKPSVPPPGRRIAVVGAGIAGLASAYLLARQHRVTLFESADYL
FT                   GGHTHTVDVELDGARHPVDTGFLVFNDRTYPNLIALFDELGVAAHATDMSFSVSVDGGR
FT                   LEWAGSNLNTVFAQRRNLFSPTFLGMLRDILRFNASAQAHLESASRERLSVGELLTAGG
FT                   YGASFQHHYLLPMAAAIWSSAASDILRFPAATFLRFCLNHALLQVNNRPTWRTVAGGAR
FT                   RYVERIAATLDDVRVNTPVRAITRDDAGVTVATDTAGPERFDAVVLACHAPTSLRLLAD
FT                   ASNAERAVLAAVRYQPNVAVLHTDTALLPRRRRVWSAWNYLSGRTGRRAGPAPVCVSYL
FT                   LNQLQPLPFRSPVVVTLNPVDEPAPGTELGRYDYEHPLLDFAAVDAQHRLPMLQGRRNT
FT                   WFAGAWTGYGFHEDGLKSALRVAYDFGIAPAWARP"
FT   CDS_pept        complement(377642..378253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05695"
FT                   /product="outer membrane lipocalin-like lipoprotein
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05695"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47517"
FT                   /db_xref="GOA:A0A0H3KQD5"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQD5"
FT                   /protein_id="BAG47517.1"
FT                   /translation="MIVRRILRRATITAVTALALGGAGCTGSPPNPNPRAAVPLSTVPV
FT                   DLPRYMGRWYVIANIPYFAERDFVGSRAEWRLRDDGRIDDEFVGRKGSFDGPEKRYRFV
FT                   DTVKPGSGGGEWRVRLFWPVYVTQLTLYVDPDYRYTILGYPGKTLGWIFSREPTMDDAT
FT                   YRSLLARLDAMGYDTSRFRRVPQLPAQIGMPGFASPGDRE"
FT   CDS_pept        complement(378259..379359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="BMULJ_05696"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="COG2230: Cyclopropane fatty acid synthase and
FT                   related methyltransferases, Caulobacter vibrioides"
FT                   /note="KEGG, K00574"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05696"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47518"
FT                   /db_xref="GOA:A0A0H3KV38"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV38"
FT                   /protein_id="BAG47518.1"
FT                   /translation="MTATTSQSSPAAIAAPQDAWLIRCCERGWLPDALIRAGMRRLMRQ
FT                   RLRDAHAHDGEPRAAAVDALVHELRASPIAIETHAANTQHYELPGSFFEAHLGPRRKYS
FT                   CGYYPNGNETLSQGEEAMLALYAQRADLADGQRILDLGCGWGSLSLWLAERYPAAQIVG
FT                   LSNSYGQREFIERCAALRRLTNLRIVTGNVVDFDFDPAEAGFDRVLSIEMFEHMKNYGQ
FT                   LLAKIARWMDDDGKLFVHIFAHKLAAYHFAVHDDTDWMSRHFFTGGTMPSADLLLRFQD
FT                   DVRIARQWWLDGTHYARTANQWLASLDAARPRIMPIFDTVYGADARIWFQRWRMFYMAV
FT                   AELFGYADGQEWGVAHYLFDKRGGRA"
FT   CDS_pept        complement(379356..380189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05697"
FT                   /product="predicted membrane protein"
FT                   /note="COG3752: Predicted membrane protein, Mesorhizobium
FT                   loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05697"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47519"
FT                   /db_xref="GOA:A0A0H3KR32"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR32"
FT                   /protein_id="BAG47519.1"
FT                   /translation="MPAVAVALLAFVALIASFTAVWIAQLHSRNAGMIDPVWAATLGGV
FT                   AVFVAVLGTGPELNRVLVAAGGGIWGLRLARHLWARNRGQPEDPRYRQFRQQWGDAAPR
FT                   NMFWLFQLQALISMLLSASFFVPAYSPEPAAPAAIAAAAAIWIAAVAGETVADRQLKRF
FT                   LANPDHRGQVCRAGWWRYSRHPNYFFECVHWLAYTALAIGMPWGWLTLMPPVVMAWLLV
FT                   KVSGMPLLEARMVETRPDYREYMRTTSALIPWPPRAATGTSRTRPDHPQDRSTRS"
FT   CDS_pept        380390..380959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blc"
FT                   /locus_tag="BMULJ_05698"
FT                   /product="outer membrane lipoprotein"
FT                   /note="Blc protein"
FT                   /note="COG3040: Bacterial lipocalin, Caulobacter
FT                   vibrioides"
FT                   /note="KEGG, K03098"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05698"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47520"
FT                   /db_xref="GOA:A0A0H3KYP7"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYP7"
FT                   /protein_id="BAG47520.1"
FT                   /translation="MKRLIVGRPLLTASVFVAGAALLLAGCAGVAGGPSGNAHVPQPAR
FT                   TVDLDRYVGRWYEFARYENRFERGCEGVTADYAKREDGLVSVRNTCREGSPEGRARSSD
FT                   GRARIVPGSGDAKLEVSFFGPFFFGDYWILDHADDYSWSIVGEPSGRFLWILTRDAKPS
FT                   AERAAALVERVRSLGYDTAMLRRTAH"
FT   CDS_pept        381663..382868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05699"
FT                   /product="uncharacterized paraquat-inducible protein A"
FT                   /note="COG2995: Uncharacterized paraquat-inducible protein
FT                   A, Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05699"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47521"
FT                   /db_xref="GOA:A0A0H3KQN5"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQN5"
FT                   /protein_id="BAG47521.1"
FT                   /translation="MTIGCPACGTLGDIPPLGARALVRCRRCRAPLERRSGRSVQAALA
FT                   CTTATFILLFPANLAPLMTVTMLGTAHSSVLASGILTMWDRGWVILAALLAMFGIVLPF
FT                   ARFGGLMLVLGAIRFRRPFTGIGVVFRWTLWLDAWAMPDVYLVGCIVGYARVTQNLTGT
FT                   IDAGGYCLLAAGLMSMITRASLDRCTVWRAIAAERYPQPGELTVACSACDLVLPVSREG
FT                   TPCPRCGLGLRLRKAAPLSRASALSLAALVLTVPANLLPMTRSMQFGHVVSHRIIDGVS
FT                   QLFHVGLWPFGILTFITSIAIPVGKIAGMAWFVASVLRRSRRHLRAKGRLYRWIDELGR
FT                   WSNVDVFTIAAFIPLIRFDGIASADPAAGATAFALVVFFTMLASRAFDPRLMWDSRDRS
FT                   SR"
FT   CDS_pept        382865..384160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05700"
FT                   /product="paraquat-inducible protein B"
FT                   /note="COG3008: Paraquat-inducible protein B, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47522"
FT                   /db_xref="GOA:A0A0H3KQD9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQD9"
FT                   /protein_id="BAG47522.1"
FT                   /translation="MNRPRTPRTRADVRRSAWPGWVWIVPVATLGVVGWLAIRALAERG
FT                   ETVTVVFSDAHGMKVDDTEVTLRGVKVGKLSGIALSPDGQHVEATLAIARAEEQYLRSG
FT                   TRFFLRGAQPEMSDPSSLRALVVGPEIVMEPGPGRPARHFDGTERRPALAPRHGPVVSY
FT                   VVRFAGAAGELKDGAPVKLRGFQVGTVTRVRLSYDVASEQLGTPVQIALEPSALGITGV
FT                   QPPADGNWRPIVDRMLGRLVARGLRARLVQDPPLVGARMISLDFVRDAPAATLAAAEGP
FT                   AEIPSVESADFDAIAARANDIAGKIDALPIRETGDDVRNIAARINALAASPQLRDSLAH
FT                   IDRSVAQIDRTLQQVSPQIGPLVAQLRDTANAADQAVASARRTLDDDGTAESSLPAALR
FT                   ELTDTARSVRALADYLDRHPEAIVRGRREEKP"
FT   CDS_pept        384157..384795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05701"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47523"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV42"
FT                   /protein_id="BAG47523.1"
FT                   /translation="MIVVACKQIGTSVRDAVKSAPAALAVTIALGGTFVVAGCGHSPPT
FT                   CYVALSPVASAAPRATEPVAPVQLTAVHVPAALDRLEVVVQRSANRLVIDDGARWGAPL
FT                   DLMMRETLTQDLLARLPEGAVVLPGAPRQADTRTLVVTVLDAHADESGTLTFLAAWTLL
FT                   SGRPERVTSSRETTLTAQLTSRDAAAQADALSRVLGQLADRIASALVGR"
FT   CDS_pept        complement(384900..386879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05702"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05702"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47524"
FT                   /db_xref="GOA:A0A0H3KR37"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR37"
FT                   /protein_id="BAG47524.1"
FT                   /translation="MSAIKRIRDWAARAVRDGRHHLPLPTALKAGLVCAAPALLAATLH
FT                   APLLCWAAIAAFWTCLADEPSESMRQRALAGAMFGLIGSLASAAATAVADLAWLAVGLT
FT                   GIAVYIGGLTRVGGPTIGARGLLLATACAVSAAFPAHPWPAPAEYAASFAAGSLWAVAC
FT                   LVGPQPESAATRARRAAFAYLYAAGSFVRALVPVAHDARHASGPNRTALRTRLDALIRT
FT                   ARSRPDAAGATVTAWQLDGERSIALLAGLDTLLRNRPPGSSAATALLVPSLHQLVALID
FT                   AHADTVLARPHARAAVTRLRNRLAADLRGATLRAEGAALTEPARTWLQSCLALMMAFTD
FT                   IGGSEVGDRRMAPPPQTERHEPLRAKATAPGAALMEIRTNGRIARYALRLSAAAMLSAV
FT                   LARVLGVQQGYWMVLTTLFVMQPTVPHTLKTSALRVLGTILGAILASAVALACHNPVLL
FT                   ALAIVPLATGTFSARPLDYVSYILFLTPHFILVAYLGAPIASPWLLAGMRVANSIAGAL
FT                   VALGVSVLAWPDWERRRLDAVSSDATAAVTEYVELVRAFVTTHGVDADALVAARRRACT
FT                   ATDELDTLLAAMRLETVARRRRHIDDARELVRRLRDAVGAAAPLECLTPDMSDGPSAGR
FT                   GPRARPLFDVPAPPLACAVKSAAS"
FT   CDS_pept        complement(386894..387493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="BMULJ_05703"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG, K00782"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05703"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47525"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYQ2"
FT                   /protein_id="BAG47525.1"
FT                   /translation="MSSRDLILSRLRDVRPTPRPLPDVPLFDTALPPAVDTFRASLARL
FT                   GGTWCAMPENASLDAFVRSRFPGASVFCSATPEFDGNRDLAAIDDPRALNDVDVGIVRP
FT                   AFAVAETGSIWLSEAQYDVNALGYLSQHLVALLDPADIVGNLHHAYHRSEFFAANYAVL
FT                   MSGPSATADIEGVLVRGAQGIRSLTVIPLRRPVGER"
FT   CDS_pept        complement(387490..388863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05704"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1139: Uncharacterized conserved protein
FT                   containing a ferredoxin-like domain, Bacillus halodurans"
FT                   /note="contains a ferredoxin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05704"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47526"
FT                   /db_xref="GOA:A0A0H3KQP0"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQP0"
FT                   /protein_id="BAG47526.1"
FT                   /translation="MKRVDHVGASAKFIADEKHIQFHDKRLWELRTSRDAEVHAIPEWE
FT                   ELRTLASAIKEHTLTHLPEYLEEFERNATANGVIVHWAKDAEEHNRIVYEILERRHAKL
FT                   LVKSKSMLTEECEMRPYLEERGITVVETDLGEQIQQLDDELPSHIVVPAVHKLATDVAK
FT                   IFSEKIGTDPNESNIPKLAEAQRNATRPLILNADAGMTGCNFAVAETGGITVCTNEGNA
FT                   DLSANVPPLHIASIGIEKLIPKLEHLGVFIRMLSRNAIGSPITQYTSHFRGPKKGGEMH
FT                   FVLVDNGRSERLGMDDFWYSLKCIRCGACMNTCPVYRRSSGLSYGGVYSGPIGAIINPT
FT                   FNLRKYSSLPFASTMNGSCTSVCPVKINIHEQIYKWRQIVAEQHELPFVKQEAMKVAGQ
FT                   VLSRPALYRAAVKTAGTAVSVLPRAVLYNPLNVWGKHREVPDAPQQTFRDWYLKRNKK"
FT   CDS_pept        complement(388860..389603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05705"
FT                   /product="putative Fe-S oxidoreductase"
FT                   /note="COG0247: Fe-S oxidoreductase, Bacillus halodurans"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05705"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47527"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQE4"
FT                   /protein_id="BAG47527.1"
FT                   /translation="MKVALFIPCFIDAFYPDVGIATLQLLERLGCDVDYPLDQTCCGQP
FT                   MGNSGCEKQATATENLFVKNFTGYDYIVAPSGSCVHHVRDHLTAADQTRDAVAVRKNTY
FT                   ELVEFLHDVLRVREFPWAEFPHKVGLHNSCGTLRALRTAKMSEIEEPFFSKPLTLLKGV
FT                   KGIEFIQPDRPDECCGFGGTFCVSEEPVSARMGADKVRDHKRNGAEYIVSADSSCLMHQ
FT                   KGCSDRLELGLKFIHIAQILNGARA"
FT   CDS_pept        complement(389643..390620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="BMULJ_05706"
FT                   /product="cytochrome bd-I oxidase subunit II"
FT                   /note="COG1294: Cytochrome bd-type quinol oxidase, subunit
FT                   2, Pseudomonas aeruginosa"
FT                   /note="KEGG, K00426"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05706"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47528"
FT                   /db_xref="GOA:A0A0H3KV45"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV45"
FT                   /protein_id="BAG47528.1"
FT                   /translation="MTWFWFAELAFALVAYLMLDGFDLGVGMLTAFAGDARDEMIASIA
FT                   PVWDGNGTWLVIAGTILFGAFPSVYSIVLPALYAPLCLMLAGLIMRGVAIEFRHKAARS
FT                   RRIWDVLLFVGSLLASVMQGVCVGTYAHGLPVDQLRYAGNGFEWCSPFSFWCGVSLALG
FT                   YALLGSGWLVLKGQRASQRIGRDAIARLAPITALFVLSILASTLLTETTVETRWLLHPL
FT                   LFALPVAACATFLCAPAAARRDGASAYLFAAGGCIAMVLMLAASYLPFIVPFDLTLDAA
FT                   AAPRASQTFMFWGAGLFVMPFIVFYTCVAYSVFRGRVSNDHAYH"
FT   CDS_pept        complement(390620..392050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="BMULJ_05707"
FT                   /product="cytochrome bd-I oxidase subunit I"
FT                   /note="COG1271: Cytochrome bd-type quinol oxidase, subunit
FT                   1, Ralstonia solanacearum"
FT                   /note="KEGG, K00425"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05707"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47529"
FT                   /db_xref="GOA:A0A0H3KR41"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR41"
FT                   /protein_id="BAG47529.1"
FT                   /translation="MEATALLLSRIQLAATVSFHIIFPSFTIGLAAWLAVLEAMSIATG
FT                   NRVYRRVFEFWLKIFGVAFGMGVVSGIVMAFQFGTNWSELSRASGPIQGPLLTYESFTA
FT                   FALEATFFGVMLLGRARVRPWFYLTSCILVAAGTTMSAFWILVNNSWMQHPVGYVVQNG
FT                   IFVPTDWAAIIFNHVVWVRFPHMLLGAYLTTAFCVAAVGAAYLLKDRYRVEATLMVRMS
FT                   VTLAAALVPLQILFGHLTGDYLHDDQPAKFAAVEGRWTDEQPAAEVIFAIPDAAHERNR
FT                   FEWKVPVLGSLIASGTADSREVGLTDFAAADRPPVLIPFFAFRVMAGCGLIMLALAWAG
FT                   TVAARRGRLERRRWLLWPLACSFPLGFIAILAGWFTAEVGRQPWTVWGVLRTADALTPG
FT                   LTAHFAAATLALFVAIYAFIFCFGVYYIVRIVRRGLVIGNVLTVWNGHVIQQTHAPAAL
FT                   PVHARRRDVLKIRSGEVQ"
FT   CDS_pept        complement(392202..393896)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05708"
FT                   /note="truncated hybrid histidine kinase"
FT   CDS_pept        complement(394088..394849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="BMULJ_05709"
FT                   /product="two-component system aerobic respiration control
FT                   protein"
FT                   /note="ArcA protein"
FT                   /note="COG0745: Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain, Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K07773"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05709"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47530"
FT                   /db_xref="GOA:A0A0H3KYQ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYQ6"
FT                   /protein_id="BAG47530.1"
FT                   /translation="MTDANLPHVLVVDDDPAIRELLSGYLSDNDIRVTVAACGQDMAQA
FT                   LESFAIDLVILDLRMPGEDGVQIARELRTRSNLPIFIVSGKRDEADRVMALELGADDYL
FT                   TKPFSNRELLARVRALLRRAGATAPATGRAKDARAYRFSGWELNVGTRRLTDPAGTPVE
FT                   LTNGEFCLLNAFLAAPGRVLSRDQLLESSRLYDDVYDRSIDVQILRLRRKIEPDPSHPV
FT                   FIRTVRGAGYVLDVPVTRLSAAGGWTNGTPV"
FT   CDS_pept        complement(394882..395448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05710"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47531"
FT                   /db_xref="GOA:A0A0H3KQP4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQP4"
FT                   /protein_id="BAG47531.1"
FT                   /translation="MEPARLTRAQRRLGTRERLVAAARHCFVAQGFADTTVEHIVERAG
FT                   YTRGAFYANFKHKRELLVEILRRDRPQLLAWMRPCAMDDWRFRAADAAQIAAEWECFPL
FT                   WVEVHLHALRDAATREMVDTLHAEPAPPAAASGAADFAERTPSPATWAALLGVALLRAG
FT                   AQHALRGEPVQDAAPEVPSGDARRL"
FT   CDS_pept        complement(395531..396277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompW"
FT                   /locus_tag="BMULJ_05711"
FT                   /product="outer membrane protein"
FT                   /note="COG3047: Outer membrane protein W, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K07275"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05711"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47532"
FT                   /db_xref="GOA:A0A0H3KQE8"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQE8"
FT                   /protein_id="BAG47532.1"
FT                   /translation="MWNGKRTTRALGMATAVGIGIASFAGDARAQAAGSVSLGAGWLHI
FT                   MPQSGSGDLFVQSVAGAPVNRALPDTGGHVATSNAFSLMAEYQFTDHVGIAFLAGTPFT
FT                   SDLVGDRSFAGYGVLGQAKPLAPVLALRYHFLAADARFRPFVGLGVNYTWYVDTHITNK
FT                   QFLDGSCGPGCTTRSSLSASWNPTFEAGFNVALGKHLGLNVSAMYIPMSTTLTTDATNA
FT                   AGTHDVTTLHVHTNPLITHVDLVYSF"
FT   CDS_pept        complement(396470..397192)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05712"
FT                   /note="EC 6.2.1.3"
FT                   /note="KEGG, K01897"
FT                   /note="truncated long-chain-fatty-acid-CoA ligase"
FT   mobile_element  397208..398395
FT                   /mobile_element_type="insertion sequence: ISBmu9b"
FT                   /note="IS110 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        397408..398373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05713"
FT                   /product="ISBmu9 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05713"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47533"
FT                   /db_xref="GOA:A0A0H3KV49"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV49"
FT                   /protein_id="BAG47533.1"
FT                   /translation="MSAPSLVTVGIDVAKDHVDVSVLGAHLDTQRFDNDAEGHSALAVA
FT                   LQPLDVALVVMEATGGYEAEMACALQSAGLPVAVVNPRQARDFARSMGRLAKTDRIDAR
FT                   MLAELASVLVRREDLSRLLRPVPDERQQWLAALLTRRRQLLTMLLSERQRLQITPVGLH
FT                   PSLLAIIAAVQAQLDDIDAQMVGHVREHFSELDRLLQSTHGIGPVSSACLIAELPELGK
FT                   LSRRQIAALVGVAPIACDSGSRNGRRRVQGGRFEIRRVLYMATLTATRHNPAIKTFYQR
FT                   LKAAGKLPKVALVACMRKLLTILNAMVRSNTPWDDSLHKA"
FT   CDS_pept        complement(398244..399602)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05714"
FT                   /note="EC 6.2.1.-"
FT                   /note="KEGG, K01913"
FT                   /note="truncated long-chain-fatty-acid-CoA ligase"
FT   CDS_pept        complement(399599..400555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05715"
FT                   /product="putative fumarylacetoacetate hydrolase"
FT                   /note="COG0179: 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway), Methanothermobacter thermautotrophicus"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05715"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47534"
FT                   /db_xref="GOA:A0A0H3KR47"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR47"
FT                   /protein_id="BAG47534.1"
FT                   /translation="MPLHVLHFRHRGRAQWGVVANGAVTPIPGEFATTASFLAANPVER
FT                   LAMIDGPTIPEADVQWLPPVTANQQFVCQGANYRRHMIESGMDPDAKQFNMIFTKAPSC
FT                   IVAADSRVVKPRHVRFLDYEIELGLVLKRDITRHQPVTDANLHEYVAGIAIVNDYSARD
FT                   VQIPQMQFYKGKSFRTFGPVGPYLCLLERHDFPKLKTLELTLSVNGTVRQQDSTANLVY
FT                   GPAETLTELSGVHDLGAGDLLATGTPAGCALSIPSPAKQRVVALFPESVKWKMFMKVQA
FT                   QRTQYLKAGDIVEARIASPDGTIDLGVQRNEIMDEAA"
FT   CDS_pept        complement(400588..401658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bphC"
FT                   /locus_tag="BMULJ_05716"
FT                   /product="putative 2,3-dihydroxybiphenyl-1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05716"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47535"
FT                   /db_xref="GOA:A0A0H3KYR1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYR1"
FT                   /protein_id="BAG47535.1"
FT                   /translation="MKLTTAQPARHPRPTTKAATLAYLMFERPNLDDAEHFLNDFGLRT
FT                   ALREPELLLLRATDTSPFCYVVRRARKAAFVGFGLEVESRSDLHALTGVPGASGIEPSE
FT                   WPGGGDRVRLVDPAGFRVDAVTGRTRVPPLPHRAPLAFNSVDMHLRINETQRPPAAPPE
FT                   IVRLGHVVLEVADFQATCAWYTRHFGFIPSDVQVLPDGSPAVAFMRLDRGDTPADHHTL
FT                   ALAQGFVSTYSHSAFEVVDADALGMGQRMLRDNGWTHAWGIGRHILGSQIFDYWQDPWG
FT                   AKHEHYCDGDLFTADEPTGIHPVSREAMAQWGPVMPRSFTKPRFTPSSVAALLRNLRRS
FT                   PDLTLSKVVTLAKLFA"
FT   CDS_pept        complement(401672..403357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05717"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /note="COG0654: 2-polyprenyl-6-methoxyphenol hydroxylase
FT                   and related FAD-dependent oxidoreductases, Escherichia coli
FT                   K12"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05717"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47536"
FT                   /db_xref="GOA:A0A0H3KQP8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQP8"
FT                   /protein_id="BAG47536.1"
FT                   /translation="METFETTGAHAAGDMPPSDARGLPSATDILIVGFGPVGAALANLL
FT                   AGHGVNVVAIDKASDIFMAPRAIALDNDALRILQMAGVDEHDFDTVAIPYVRMRSPSLG
FT                   EFGRIDTLGTLDGHPKLVTFYQPDLERCLRARLRGRDNVHVALGTALEGFVEEQDGVVA
FT                   ALRDERGNTHSIRARYVVGADGASSLVRQLIGQQFNGKTYAEDWLIVDARHVPRPIDHV
FT                   EFICDHRRPTPHMVAPGARERWEFMLRPGERRDEMESDARIRELLAPWGDIDDIAIERK
FT                   AVYRFHARTVDAFGKGRVFLAGDAAHITPPFVGQGLVAGLRDAANLGWKLAWVVLGRAD
FT                   PRILDTYDAERRPHAKSMIRLAKFMGRLVMPRNAAVALATHGLMRAMRCVPALRAQFDE
FT                   LRIKPKNAFRSGLFVGGRSGARLTRGALLAQGWLRGAAGAARLSDDVLGSGYTLIGFGC
FT                   DPRVGLAPDAAAALARAGGTIVRIAHRGQRLHPAGDDCWEDIDGTFLPGVAPVGWVAVV
FT                   RPDKTVVHDGPAAHVSRIVCDSLSLLGTAPRAVPSAAVSAIRPT"
FT   CDS_pept        403495..404259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05718"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309: Transcriptional regulator, Corynebacterium
FT                   glutamicum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05718"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47537"
FT                   /db_xref="GOA:A0A0H3KQF0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQF0"
FT                   /protein_id="BAG47537.1"
FT                   /translation="MSNPPKRRTPKRAAAEPSVTADVAAPVAEEREPRGARRKRETRGR
FT                   LLDAALKLMAERGMEGVAINEITEAADVGFGSFYNHFESKEAIYETLVETVFGEFADSL
FT                   DRLANGLSDPAEVVAVAVRHTLIRARREPMWGHFLIREGFSARVLTLGLGQRLLRDIER
FT                   GIAAQRFVVADPFIGFLSVGGTVLTAIAAELNFVAPGAPAADVLAQLGFSGEHFPERTA
FT                   ATLLQTLGLKRAEAEKIASRPLPVVEPADAPQ"
FT   CDS_pept        complement(404323..405033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05719"
FT                   /product="putative lipoprotein"
FT                   /note="COG3009: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05719"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47538"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV52"
FT                   /protein_id="BAG47538.1"
FT                   /translation="MNARLFRRLRMTARIATCAALAVLSACASPPVHFHTLSAPAGAGG
FT                   DRAAHPAWLIDVQTLHVAAPADGNRLVVQRGPGLADILEQERWAAPLGDEMRDGLSTRI
FT                   ASGLGAIDVHRVAYPDGTPVYRVAVDVQRIESWPASHVLLDAAWSVSAAAAAPPAQRAL
FT                   TCRSIVRVDASAGYDALVDAHRRALDALAHAIAAGIRAVATHAAAPADCRAGGPDPTVA
FT                   RRAAGRGTPDTSDD"
FT   CDS_pept        complement(405030..406697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="BMULJ_05720"
FT                   /product="paraquat-inducible protein B"
FT                   /note="COG3008: Paraquat-inducible protein B, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06192"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47539"
FT                   /db_xref="GOA:A0A0H3KR51"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR51"
FT                   /protein_id="BAG47539.1"
FT                   /translation="MARRPRVEPRERASARRFLSNSKTMHPFDLPQPEIRPRSRWIPSL
FT                   VWIVPLVCALIGLSLVIRTVAATGPTITVTFANAEGLEAGKTKVRFKDVDIGSVQSITL
FT                   TPDFKRVVVAIQLTRDAARFANRGTRFWVVRPRIGATGISGLGTLLSGAYIGADLGRSP
FT                   QKETAFTGLETPPAVTADQQGRRYRLHGDSLGSIDIGSPVFYRHLQVGQVVGFSLDEKG
FT                   TGVDVQVFVNAPYDKYVDNNTRWWHASGVDLRLDSNGLKLNTQSLATVVVGGLAFQSPP
FT                   GQPDAPQAADNASFRLAPDEADAMRDPDGTPLMVVMRFDQSLRGLSVGAPVDLRGIALG
FT                   QVTNIGIEYNERTRNFSMKVTMALYPSRLSRHSDTALPAPDTAGGHELLEHLVVQGLRG
FT                   QLRTGSLLTGQLYVALDMFPKAPRASVDVHRTPVELPTVPNTLDELQVQIADIARKLDQ
FT                   VPFDRIGNNLNGALAHANELFGHLDQQVVPQAHDTLAAAQRTFDAAESTLRQNSPMQSD
FT                   VHEAMQSLTHTLQSLNALADYLERHPEALLFGKKGDRQ"
FT   CDS_pept        complement(406666..408003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiA"
FT                   /locus_tag="BMULJ_05721"
FT                   /product="paraquat-inducible protein A"
FT                   /note="COG2995: Uncharacterized paraquat-inducible protein
FT                   A, Vibrio cholerae"
FT                   /note="KEGG, K03808"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05721"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47540"
FT                   /db_xref="GOA:A0A0H3KYR7"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYR7"
FT                   /protein_id="BAG47540.1"
FT                   /translation="MKPDNVIACHECDLLLQRPPRLRALVPHCPRCGARVSGAAPGPKT
FT                   LDRMCALALAALLMYCVAQIFPIVALDAAGVVSHATLADAVRALWSNGQPVVAVLVFGT
FT                   TMLFPLLELAAWLYLLAPLRAARVPRRFAPVLHAVQRLRPWSMVEVLMLGVLVTMVKMT
FT                   SVAHVIAGPALFAFAGLAGMLAFLSSIEPAGLWNARDELVALRPSDADDPVPSAGGITV
FT                   PDALPATGGGSGSSGLTAHAAGLIACHHCARVQPAHAHGQRCTRCGSPLHARRPRSVAR
FT                   TAALAAAAALLYIPANLLPVMRATSLGRAEDDTILGGVAYFWTSGDWALAVVVFVASVL
FT                   VPMLKLAILALQATAAHRGARWRPRERARLHRLVECVGRWSMLDVFVVALTIALVHFGT
FT                   FADITPGPGALAFGAVVVLTMCASMQFDPRLIWDGACGPTAARRTS"
FT   CDS_pept        complement(408138..409610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05722"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05722"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47541"
FT                   /db_xref="GOA:A0A0H3KQQ1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQQ1"
FT                   /protein_id="BAG47541.1"
FT                   /translation="MLMKLSRITTALAATAALGLSGCALAPSSTPPAMPSPAHYGAEPQ
FT                   VRQTVAAQGVAQQFDVGAAPVPQWWRLYRSSALDALVDEGLRANPTLAATEKTLAAAQQ
FT                   ELRAQIGASTLPSLDANAQVARTRTPDISGAGAQSLRYNVFVGQLQAHYTFDLFGATRY
FT                   ASAASAARVDVRGCELEAARRALAANIVGTAIGAAALDRQILLTERLVAVAQASAAEDQ
FT                   QRYALGAMSHAQALASTQGAASLAATLPALRQQRASTVHALAILLGRTPDAPPPIPAFT
FT                   ELSLPEHVPVAVPSDLLKARPDIRAAEAAVRAAAADVGEATAQMFPSLSLTASMGRGGF
FT                   SWPALLSGAGGLWAVGAGLSQPLFHGGALLAHRRASRDLYDAAVLQYKAAVLSAFGDVA
FT                   DSLAALDNDAQALEANELAARAAGAAFDETAQRRALGAVPMSAQQASEQRYLSAELDAV
FT                   RAASRRMTDTAALLQAMGELPPDAHATIAARQ"
FT   CDS_pept        complement(409604..410041)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05723"
FT                   /note="truncated AcrB/AcrD/AcrF family protein"
FT   CDS_pept        complement(410195..412960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05724"
FT                   /product="ISBmu13 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05724"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47542"
FT                   /db_xref="GOA:A0A0H3KQF5"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQF5"
FT                   /protein_id="BAG47542.1"
FT                   /translation="MTGRPLGSYKQIPTVLWRHLGRQLNVKPPDLGTLRSLYDGNLKTL
FT                   SDHQRFARDAINFRAVAEHQRRYVIRWLKEQLTGRPERGQLTNYLKRWFYDHRIVIPPE
FT                   RMLRQFVVQAVRDIEGQLHGALEQAVGMEKLESWARVLAQPHGEHSSLQRWLWAVPLRN
FT                   STHQMSEILDKVNLLTMYEVATRWPIECNDAVVRHYARRCASRPPSISKRIEPQSRRIE
FT                   AACFMRYSLCIATDQVLEMLRRWILKVVNDTSREVDAMRMKAADQLREFALAVKALAND
FT                   ESLSREQLGEKLCLLADDVLQPHPTSRRSQIRQCLVRKRYYARNLLNRIVQLPFESEAA
FT                   HPVVDALSLLRGLYRRRAFLLPDGVNIRLGRAWREAIDGYDRLRAMVAFEWATLFALRV
FT                   ALRNGSVFINHSFSFRSQSHMLISTEQWLAKRNHHYGHLGLPQDPNEFLEPILEQLEQR
FT                   LALLDDAVVNGSIRVDTAVHLDPMAAQDPDAQADQLRRQIFEAHPPGQFPEIILEIDSA
FT                   TRFSWTLLGREPRSRTELLIVYSAILAHGTSLTAADISRMVPEVSTEAIRQMMKRLADE
FT                   RMLRTAADAVLEFMHEHPIAAHWGRADLASSDMMSLETTRTIWRARADPRRRTASIGMY
FT                   THVLDRWGIFYDQPIILNERQAGAAIEGVVRQSATKDIAQLAVDTHGYTDFAMGISRAL
FT                   GFDLCPRLSHLRDRRLHVPRGQAIPARLAGITDRDVRLGLIVDVWDEFVRVAASIRSGQ
FT                   CTAVEAIARFGSAARGQAVYDGGVQIGRLFRSIFLIDYFTNAAFRSELQHALNRGEAVH
FT                   TVHRAIHIGRIPVELARRQESLAAVSSALTLLSNILMAWNTTHMQRALENIEAGRHQPI
FT                   EADQLRRIAPTHMEGINLRGTFNFPVALYAKRILPSTAADNAIASSSQRA"
FT   mobile_element  complement(410195..412960)
FT                   /mobile_element_type="insertion sequence: ISBmu13"
FT                   /note="Tn3 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        413446..414333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05725"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05725"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47543"
FT                   /db_xref="GOA:A0A0H3KV57"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV57"
FT                   /protein_id="BAG47543.1"
FT                   /translation="MATSRIPSIQGLLAFETLARLRSVTLAGEELSVTPSAVSHRIRQL
FT                   ESQLGIKLFARGDFSLSTEGAAYLNRVREALAVLQQIPSRGSAAGTTRLRVAVTPTFSR
FT                   QMLLPKLALFRHAYPEIDLVLQVTIPMLNVTAEEADIELRFGPGPGPYADRESLHLSSD
FT                   EVTPVCSPEYLNEVGPLDEFATLDAVSRARLIRCPLEPWRTWFAASGITLDEPSGGSQF
FT                   NDIGLVLDAAVAGFGVALMRLRLGTAWLDSGRLIRLSPRSVPSPHHYFLCWKPGTLDRW
FT                   ECAAFVEWLKHALG"
FT   CDS_pept        414456..416117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05726"
FT                   /product="LctP family lactate transporter"
FT                   /note="COG1620: L-lactate permease, Ralstonia solanacearum"
FT                   /note="KEGG, K03303"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05726"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47544"
FT                   /db_xref="GOA:A0A0H3KR56"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR56"
FT                   /protein_id="BAG47544.1"
FT                   /translation="MMWQQVYDPFGNMFISTALAAIPIVVMLACLGLFHIKAHIAAGLG
FT                   LVAAALVAVFGYGMPASMAGRAALYGGLTGLLPIGWIVLNIIFLQQLAERNGSFKILQD
FT                   SLSGITEDRRLQLLLISFCFGAFFEGAAGFGTPVAVTAGILIGLGFSPLAASGLSLIAN
FT                   TAPVAFGALGAPVITLARVHGYDLMEVTAMIGRQLPLFSLMVPFWLIWAFAGRKAMMEI
FT                   WPAILVTGLSFAIPQYLVSNFIGPELVDIIAALVSMISLVLFLRVWQPRKIWISPSLKG
FT                   HDVSADEAKPAGPIVRHSRAQLVRAWTPWLILTVFVFVWGLPSVKTWLDHLYAPKFQMT
FT                   GLHNLVEKMPPVVRAPVKESAVYMLGLLSATGTGILLSAIVGALVMKYNPVEIVRIFFR
FT                   TLWLVRYSLLTIVLMLALGTLTRYSGTDTTLGLAFANTGVLYPFFGTLMGWLGVAMTGS
FT                   DTASNVLFGGMQKAAAGQLGLGVNLMGAANSSGGVMGKMIDAQSIVVASTATRWVNHEG
FT                   DILRYVFFHSIALACLVGLFVTMQAYVWPFTLMVVH"
FT   CDS_pept        416158..417309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD"
FT                   /locus_tag="BMULJ_05727"
FT                   /product="cytochrome L-lactate dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /note="COG1304: L-lactate dehydrogenase (FMN-dependent) and
FT                   related alpha-hydroxy acid dehydrogenases, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K00101"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05727"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47545"
FT                   /db_xref="GOA:A0A0H3KYS2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYS2"
FT                   /protein_id="BAG47545.1"
FT                   /translation="MSIITTVEDLRVLAERRVPRMFYDYADSGSWTESTYRANESDFQK
FT                   IKLRQRVAVNMEGRTTRTAMIEQDVAMPVAIAPTGFTGMQHADGEILAARAAEKFGIPF
FT                   SLSTMSICSIEDVAAHTQAPFWFQLYVMRDKDFVERLIERAKAAECSALILTLDLQVLG
FT                   QRHKDLKNGLSAPPKPTIANLINLATKPRWCLGMLGTKRRTFGNIVGHAKGVGDLSSLS
FT                   SWTAEQFDPALSWADVEWIKKLWGGKLILKGIMDAEDARLAAASGADALIVSNHGGRQL
FT                   DGAPSTIEALPPIVEAVGTQIEVWLDSGIRSGQDVLKAIALGARGTMIGRAFLYGLGAM
FT                   GEAGVTKTLEIIHKELDITMAFCGHRDIRTVDRSILLPGTIPS"
FT   CDS_pept        complement(417932..418582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05728"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="COG1802: Transcriptional regulators, Brucella
FT                   melitensis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05728"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47546"
FT                   /db_xref="GOA:A0A0H3KQQ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQQ6"
FT                   /protein_id="BAG47546.1"
FT                   /translation="MMNQGKAGQAYQEIEKLIVSEELAPGTLVSEAVLMEKTGLGRTPI
FT                   REALQQLARNRMVEIHPSRGVLIPPASVEAQLRMLEVRRVLEVLAVRLACHDASGVDRG
FT                   RMDAIVRRLSGDPMPLAEYAETLKDTHQIIATAGHNEYLADAMAPLQGLSRRFWLANVR
FT                   DEQDEIKNGTTHHLAILRAILASDPQAAEQASLTLNDYLIEFAYKTIRRPSGS"
FT   CDS_pept        418714..420102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05729"
FT                   /product="putative cytosine/purines, uracil, thiamine,
FT                   allantoin transporter"
FT                   /note="COG1457: Purine-cytosine permease and related
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05729"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47547"
FT                   /db_xref="GOA:A0A0H3KQF7"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQF7"
FT                   /protein_id="BAG47547.1"
FT                   /translation="MTKTTAIERRSIDFIPPEERHGSPRSLFFVWFAANTSITAVVTGA
FT                   LFVILGNSALWSIPAIVLGNAVGGFFTSLHSAQGPKLGVPQMIQSRAQFGYYGAILPLV
FT                   LALMIYVGFYATGLVLGGQAMSALFHIPPQAGAVVFALMSTALAIVGYRYIHRFSRVAA
FT                   VLSGVAFAILLVRIIADGNMPIPIATHGFAAAPFALGISISASWQLTFGPYIADYSRYL
FT                   PAETSTRATIGWTFLGSVLGGSVAMILGALAAALGGAAFSNDQVGYLAALGGAIWPLVL
FT                   LAVICGKLTGNTLSSYGGCMSLTTIVTSLTGQDRVSPRQRAAFVCIISAIALGIALAAS
FT                   RNFLSNFTNFLLFLLYFMTPWSAINLVDYYWVRRERYKVAQFFAKDGEYGLVRIGAFVA
FT                   YFFGVLIQIPFMNSSLYVGPIAHLLGGAEIAWVIGLAVAGGLYYASTGSIRRVMAATSA
FT                   NQGI"
FT   CDS_pept        420139..420795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05730"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1853: Conserved protein/domain typically
FT                   associated with flavoprotein oxygenases, DIM6/NTAB family,
FT                   Staphylococcus aureus N315"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47548"
FT                   /db_xref="GOA:A0A0H3KV60"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV60"
FT                   /protein_id="BAG47548.1"
FT                   /translation="MKYDPSHEKSPLPFSPFKSCTVPRPIGWLSSSSPDGIDNLAPYSQ
FT                   WQNLTFDPPMVMFAANQYPDGRRKDTVLNAEQTGWFVWNMATYDLREAVNISAMALPRG
FT                   ESEFDRVGVTRRRADLSNVQMVAESPVHFECRYLSTHRFTGNSNVGTIDVVFAQVERIH
FT                   INEDFVTREGKLDIPRIRPLARLGYYDYTSVTEVFEMRIPNASEEEANGLEGAAG"
FT   CDS_pept        complement(421086..421796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05731"
FT                   /product="putative SecA translocase subunit"
FT                   /note="COG3318: Predicted metal-binding protein related to
FT                   the C-terminal domain of SecA, Neisseria meningitidis
FT                   Z2491"
FT                   /note="KEGG, K07039"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05731"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47549"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR62"
FT                   /protein_id="BAG47549.1"
FT                   /translation="MNQTTDQPLTDGEFARLSRFLDAIGPSAMNIEMLDGYFAALICGP
FT                   DMVPPSEYLPDIWGENFAFESDEQAAQIMGLLMRHRNTIATELRHTLGEPDVYLPVLLE
FT                   GDDGIAPGNDWAHGFMRGVQTRPASWGELIDDEDHGGPMLRIMMLHYENDPDPQMRPPP
FT                   IPSEKREELLQTMIGSLTHIYRYFEPHRRALASMPAHLPMRREGPKVGRNEPCPCGSGR
FT                   KYKHCCLANEPTLH"
FT   CDS_pept        complement(421906..424953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05732"
FT                   /product="ISBmu14 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05732"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47550"
FT                   /db_xref="GOA:A0A0H3KYS6"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYS6"
FT                   /protein_id="BAG47550.1"
FT                   /translation="MPRRSILSASERDSLLAMPEELDDLIRHYTFSEPDLSLIRQRRGD
FT                   ANRLGYAVQLCLLRYPGQGWSTATEVPLAMLQWIGQQLGIDPACWPQYAKREETRREHL
FT                   LELRAQLGLSPFNLSHYRTAVHALVGLAMQTDKGIVLAQALVEHLRRQTILLPREAVIE
FT                   RICAEAITRSTRQIYRILTEPLSEEHGQRLDRLLQRRADGRMTWLAWLRQPPGKASSRQ
FT                   MLQHIDRLKLLQAVNLPAGLDRLIHRNRLLKIAREGGQMTPHDLGKFEPRRRHATLAAI
FT                   VMEATATVTDEIVELHDRIVGKLFNTAKKKHRERFHRSGKAINDKVRLFGKLGRALLKA
FT                   KEDGGDAFQAIESVMSWDAFTRSVTEAEQLAQPEAFDFLHEIGDHYATLRRYVPAFLEV
FT                   LKLRAAPAAADVLEAIDTIRAMDSDGARKVPADAPTKFIKPRWKPLVFTDAGLDRRYYE
FT                   LCALSELKNALRSGDIWVQGSRQYKDFDDYLLPAEKFEAIRQENLLPLPITTDCERYLA
FT                   ERRRLLEQRLEAVNRLAAANDLPDAIITDSGMKITPLDAVVPDAAEALIAQTALMLPRV
FT                   KITELLMEVDAWTGFTRHFTHLKTGETTQDKTLLLTTILADAINLGLTKMAEACPGTSY
FT                   AKLAWLQAWHIRDETYSQALAELVNAQHVHPFATYWGDGTTSSSDGQRFRAGGRAQSTG
FT                   HVNPKYGAEPGRMFYTHISDQYAPFYPNLVNVGVRDATYVLDGLLYHESDLRIQEHYTD
FT                   TNGFTDHVFALMHLLGFRFAPRIRDLDDMKLYVPGSVKDYPALAAMIGDTYNEKHIQRS
FT                   WEEVLRLATSIRQGTVTASLMLRKLGSYPRQNGLALALREIGRIERTLFILDWLQNVEL
FT                   RRRVHVGLNKGEARNALARAVFFCRLGEIRDRSFEAQRYRASGLNLVTAAIVQWNTVYL
FT                   ERAVQAMHARGLPVDVALLPYLSPLGWEHVNLTGDYVWRQSQKLPAGTFRPLRPVPETQ
FT                   LSTPRATQSTSGDIEPEAIPGEADGI"
FT   mobile_element  complement(421906..424953)
FT                   /mobile_element_type="insertion sequence: ISBmu14"
FT                   /note="Tn3 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        complement(424983..426125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05733"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05733"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47551"
FT                   /db_xref="GOA:A0A0H3KQR0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQR0"
FT                   /protein_id="BAG47551.1"
FT                   /translation="MRIPADLSGAAGVNRARSAVRHVGAADDLAAVAAWLARYTDTPGT
FT                   LAAYRKEAERLLLWTVIQHGKPLSSLTHEDLLVYQRFVADPQPSWRWIMTARKKPGRAS
FT                   PDWRPFAGPLSSTSVRHAMTILNAMFAWLVEAGYLAGNPLSLTRRRGVARKPAVTRYLT
FT                   HEWWGVVKTTIETLPVGTERERLHAARCRWLFTVLYLAGLRATEIASTPMGAVCCRRDA
FT                   TGAERWWIEVLGKGNKPRLVPATDELIAELARYRRAHGLAPSPYQGERRPLLLPLIGHE
FT                   KPLSRGSIHQIVKEVFALAAARLRARGPEWQAQADQLASASAHWVRHTAGSHMTDRQVD
FT                   LRFVRDNLGHASLATTSVYLHAEDDARHDATQTRHRLGWN"
FT   CDS_pept        426326..426988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05734"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47552"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQF9"
FT                   /protein_id="BAG47552.1"
FT                   /translation="MTPDPTATLDEQALLADIAALRGRCADTRELYREVCALLFFRYGV
FT                   TPTANKLYSLVRKGSMSTPADVLNRFWQDLRERTRVKIDHPDLPDAVKQVAAEAVLTIW
FT                   HSASEASAAELAALRAETRHQAHEAEVARDRAAAEAEAARQAASSTQVQLEAVRAQLAE
FT                   SGDALAAERQAHAATDARLQEALRRAERAEAEVDVTRRLVDGLKKTPPARGAARAKG"
FT   CDS_pept        427073..428182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05735"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05735"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47553"
FT                   /db_xref="GOA:A0A0H3KV64"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV64"
FT                   /protein_id="BAG47553.1"
FT                   /translation="MQTARTAAGLVGGRHIAMIEGGSAGLQGSRWGLKGSEDLGGGLKA
FT                   LFVLESGFYSNNGVLNQGGAMFGRQAYVGLSHSIGTVTLGRQYDPVVDFYGPFLAAPQW
FT                   GGYMTSHPGDLDNALNSRRINNSIKFRSASYRGLTVEAMMSLGGTAGSFPTNWIWGAGT
FT                   SYAAGPFSFGAGYLNVRNPNTSFFGANPNAGPATSNNLGSAGSATSPESNPVFAGYASA
FT                   NRLEIAGVGAGVTLAALSVNLAYSNTRFEGLGSASGPNALRYAGTAAFNNVEINARYQF
FT                   TPSLLAGVAYDYTRNGGAGGKGGANYNLVSAGVDYFLSKRTDVYTVAVFEKASGTDSLG
FT                   QPAVAQITGLTPSATDRQVSLRIGLRHKF"
FT   mobile_element  complement(428534..432656)
FT                   /mobile_element_type="insertion sequence: ISBmu15"
FT                   /note="Interrupted by IS402 insertion. No target site
FT                   duplication has been identified."
FT   repeat_region   complement(428534..428583)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu15, terminal inverted repeat"
FT   CDS_pept        complement(428678..430978)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05736"
FT                   /note="inactivated ISBmu15 transposase"
FT                   /note="inactivated by IS402 insertion, C-terminal portion"
FT   misc_feature    complement(428678..430874)
FT                   /note="ISBmu15 transposase, interrupted by IS402 insertion,
FT                   C-terminal part."
FT   repeat_region   430872..430874
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  430875..431788
FT                   /mobile_element_type="insertion sequence: IS402"
FT                   /note="IS5 family"
FT   repeat_region   430875..430891
FT                   /rpt_type=INVERTED
FT                   /note="IS402, terminal inverted repeat"
FT   CDS_pept        join(430962..431315,431315..431779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="BMULJ_05737"
FT                   /product="IS402 transposase"
FT                   /note="IS402 transposase is a fusion between two ORFs,
FT                   (88-441) and (441-905), as suggested by comparison with
FT                   other IS5 family members. At position 441, the sequence
FT                   5'-CAAAAACTGGGCC-3' is a potential site for a -1
FT                   frameshifting."
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05737"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47554"
FT                   /db_xref="GOA:A0A0H3KR69"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR69"
FT                   /protein_id="BAG47554.1"
FT                   /translation="MAKPIIDDELWTLIEPLLPPPKPRREKNPGRLPVSNRAALTGILF
FT                   VLKTGLRWRDLPAEMGCGSGVTCWRRLRDWQAAGVWDRLHELLLAKLRAADQIDFSRAA
FT                   VDSSSIRAVGAGQKTGPNPTDRARPGSKHHIVTDANGTPLAAILTGANVNDVTQLLPLI
FT                   DAIPPIRGLRGHPLQRPRVVYADRGYDSERHRRALRDRGIEPVIAKRRTEHGSGLGKYR
FT                   WVVERTHAWLHHFRRLRIRFERRADIHGAFLKLGCCLICWNTLRRADQSL"
FT   CDS_pept        complement(431767..432510)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05738"
FT                   /note="inactivated ISBmu15 transposase"
FT                   /note="inactivated by IS402 insertion, N-terminal portion"
FT   repeat_region   431772..431788
FT                   /rpt_type=INVERTED
FT                   /note="IS402, terminal inverted repeat"
FT   misc_feature    complement(431789..432510)
FT                   /note="ISBmu15 transposase, interrupted by IS402 insertion,
FT                   N-terminal part."
FT   repeat_region   431789..431791
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   repeat_region   complement(432607..432656)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu15, terminal inverted repeat"
FT   mobile_element  432655..433676
FT                   /mobile_element_type="insertion sequence: IS408b"
FT                   /note="IS21 family, truncated IS408"
FT   misc_feature    432655..432812
FT                   /note="IS408 transposase, OrfA, C-terminal part"
FT   CDS_pept        432829..433578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05739"
FT                   /product="IS408b transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05739"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47555"
FT                   /db_xref="GOA:P55923"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55923"
FT                   /protein_id="BAG47555.1"
FT                   /translation="MLMQHTLTQLKALKLDGMARAFEEQSTLTASTSLSFEERVGMLVD
FT                   RELAWRDTRRLERLLRAAKLKNPQACVEDIEYRQTRGLDQRIVATLAGCDWVRNAQNLI
FT                   LTGPTGAGKTWLACAFGQQACRQGFSVFYVRVARLFEELKIAHGDGSFTRRLAQLAKID
FT                   VLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHAWLQDPTLADAILD
FT                   RLVHQAHKLPVKGDSMRKKTKSESADA"
FT   repeat_region   433631..433676
FT                   /note="IS408, terminal inverted repeat"
FT   CDS_pept        434121..437057
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05740"
FT                   /note="truncated Helicase"
FT   CDS_pept        complement(437359..438414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05741"
FT                   /product="ISBmu16 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05741"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47556"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYT0"
FT                   /protein_id="BAG47556.1"
FT                   /translation="MTDLFRSTLVAIDGSKFKASNTRDRNFTTGKIDKRQQQIEESIQR
FT                   YLSALETADRTQPPEVEAKTTRLREKIAQLQGQMRHLEQVKEELKTLPDGQISLTDPDA
FT                   RSMATSGRGSGIVGYNVQVAVDSKHHLIVAHEVTNAGSDRAQLSPMAQAARDAMGKTRL
FT                   KAIADRGYYSGPQIKACEDAGIAAILPRTTTSSAKAHGRFDRADFIYIARDDEYQCPAG
FT                   QRAIYRFTGLEHGMYLRRYWSSACIGCALKPQCTPSDYRRITRWEHESVLEAAQRRLDR
FT                   MPDAMTVRRRTVEHVFGTFKHWMGYTHFLTRRLANVSTEMSLHVLAYNLKRVIAILGFA
FT                   KTMKAMRLVGA"
FT   mobile_element  complement(437359..438414)
FT                   /mobile_element_type="insertion sequence: ISBmu16"
FT                   /note="Unclassified IS family, No terminal inverted repeat
FT                   or target site duplication have been identified."
FT   CDS_pept        438567..439199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05742"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQR5"
FT                   /protein_id="BAG47557.1"
FT                   /translation="MDDSRHAMRPVATPRPRGAPRLDAFSLKLDRRLTLFQRGAPELWL
FT                   LIETDPAVQSFCERPGYVQLNGQRYLADFWIRYADREEVVILSDSLADMRLHAARPKYE
FT                   LDGVPVRSVTSTDLAAARAWIDNWRYMLPCVVAARGLVASSLLRAVETFVTMPHTLLEI
FT                   ERELSVGDPALVRAAVFALVYAGHVDAVDLRTEPLSLLTRFVATEAA"
FT   CDS_pept        439199..441184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05743"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47558"
FT                   /db_xref="GOA:A0A0H3KQG3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQG3"
FT                   /protein_id="BAG47558.1"
FT                   /translation="MARRKPEFQTLDPSSWPTIAWTEFDAAERESIQARMAAIEQYARG
FT                   AAIKEIEQSTGVNRRQLYRLLERALAAHPDGRLYGFRALVLHARVADYVRLSPVKPNDE
FT                   RGIRGAAGALSQLFERFPVLAAWLRLQIKQRRVALIEIRTGGELRTRLRGLQGLHASFL
FT                   LQCRQSGLTPADYPFNTASHAIRSLSARVKSELLSEFGIAARAAGAAHLKGLPRSDEFA
FT                   APAATRPYQVVEFDGHRLDIRLKIVMLDPLGFTHEFEIERVWLLVIIDVCTRAVLGHHL
FT                   VLAREYSRYDVIKAIESALEPHRARSFTIRELDYGPMDGYPSQRMPELAYVTWERIKLD
FT                   NAKANLATETLAALCEFIGCQVAAGPKHSPDERPYIERFFGTIATRLSSRLPGYTGGHP
FT                   RDLRRALSDPKGNLRLFVSFDELEELVEYAIASYNGTPHTGLNNVSPLEAMESFVRGRH
FT                   TLVNWLPEPRRRTLCLMQSAKRCRVHAYLNQGTRPHINLYGVRYSSPVLACSTELIGKQ
FT                   LLVYLNADDLRSVRAFLLDGTELGLLDAQGAWHVVPHNLTLRQEIRKAQGRKRLRTSLD
FT                   AHGIEKYIRAKLEQAGKTRRAASDLAQAARILAAAPLVRTPPGPVSTSMSTSTAVAYPA
FT                   TSVVRPEVPEVRAHPRKLKIGTGQVG"
FT   CDS_pept        441211..442188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05744"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47559"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV68"
FT                   /protein_id="BAG47559.1"
FT                   /translation="MSVEVPRPIDPALHPLATGNYRIATPAIEAFYDLVTKCLRYRIMG
FT                   ALIYGPPRIGKTRAIEYLRLLLARDLPKITSYHALCEHKPRHAEGPFFVNLLEAVGDHN
FT                   PNAGVGSAKRMRLTLRIREAAARAGSGTVLLFCDEAQRYNENEYEWLRDVHDALDRQQI
FT                   KLFTFLVGQQELLSQKTAMQIAGKTQIVARLMVEELSFYGIRNVDDVATCLNGYDQTAY
FT                   PETSDWSFTRFYLPQAFDAGYRLLDDAGELWRAFEAAHHKASLPGRLEIPMESFARAVE
FT                   IVLKDSELMDAPGYCPEPTLWTHAARQCGYIQSRHATGHVLATA"
FT   repeat_region   442973..442975
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  442976..443889
FT                   /mobile_element_type="insertion sequence: IS402"
FT                   /note="IS5 family"
FT   repeat_region   442976..442992
FT                   /rpt_type=INVERTED
FT                   /note="IS402, terminal inverted repeat"
FT   CDS_pept        join(443063..443416,443416..443880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="BMULJ_05745"
FT                   /product="IS402 transposase"
FT                   /note="IS402 transposase is a fusion between two ORFs,
FT                   (88-441) and (441-905), as suggested by comparison with
FT                   other IS5 family members. At position 441, the sequence
FT                   5'-CAAAAACTGGGCC-3' is a potential site for a -1
FT                   frameshifting."
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05745"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47560"
FT                   /db_xref="GOA:A0A0H3KR69"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR69"
FT                   /protein_id="BAG47560.1"
FT                   /translation="MAKPIIDDELWTLIEPLLPPPKPRREKNPGRLPVSNRAALTGILF
FT                   VLKTGLRWRDLPAEMGCGSGVTCWRRLRDWQAAGVWDRLHELLLAKLRAADQIDFSRAA
FT                   VDSSSIRAVGAGQKTGPNPTDRARPGSKHHIVTDANGTPLAAILTGANVNDVTQLLPLI
FT                   DAIPPIRGLRGHPLQRPRVVYADRGYDSERHRRALRDRGIEPVIAKRRTEHGSGLGKYR
FT                   WVVERTHAWLHHFRRLRIRFERRADIHGAFLKLGCCLICWNTLRRADQSL"
FT   repeat_region   443873..443889
FT                   /rpt_type=INVERTED
FT                   /note="IS402, terminal inverted repeat"
FT   repeat_region   443890..443892
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  443934..444377
FT                   /mobile_element_type="insertion sequence: ISBmu32"
FT                   /note="Inactivated IS3 family, no terminal inverted repeat
FT                   or target site duplication have been identified."
FT   CDS_pept        444003..444377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05746"
FT                   /product="ISBmu32 truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05746"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47561"
FT                   /db_xref="GOA:A0A0H3KYT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYT5"
FT                   /protein_id="BAG47561.1"
FT                   /translation="MRDVMLAAVENRFGNELHTPSEMEWLSDNGSGYTADDTRRVAVAI
FT                   GLKPLTTPVCSPQSNGMAESFVKTMKRDYVAFMPKPDAATAARNLAIALEHYNEKHPHS
FT                   ALKYRSPREFRRSMDSATLV"
FT   CDS_pept        444915..445622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="BMULJ_05747"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /note="COG0479: Succinate dehydrogenase/fumarate reductase,
FT                   Fe-S protein subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00240"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05747"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47562"
FT                   /db_xref="GOA:A0A0H3KQR9"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQR9"
FT                   /protein_id="BAG47562.1"
FT                   /translation="MSDTRTFEIFRYDPERDSRPYMQKYEIVVADDDRMLLDVLVRLKA
FT                   RDETLSFRRSCREGVCGSDAMNINRKNGLACITNLNDLPRHTVLRPLPGLPVVRDLIVD
FT                   MTAFFKQYHSIKPYLVNDTPPPERERRQSHEERDQLDGLYECILCACCSSACPSYWWNP
FT                   DKYVGPAGLLQAYRFLVDSRDEGTGERLDNLDDPYRLFRCRTILNCTDVCPKGLNPARA
FT                   IAEIRTMLARRMM"
FT   CDS_pept        445652..445987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05748"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05748"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47563"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQG5"
FT                   /protein_id="BAG47563.1"
FT                   /translation="MAVPRVTQGELIDVRPLGETLQNSKSVTLMRSDHLEVVRLVLLAG
FT                   KRIPEHRAPGEITVQCLEGAVKFGTDMEARLMRSGDMLFLLAEEPHWLEAVENSSLLVT
FT                   LYLPNGD"
FT   CDS_pept        complement(446542..446769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05749"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV71"
FT                   /protein_id="BAG47564.1"
FT                   /translation="MNQYHRIETELAHVRNATQVLDEGRGQFPPRLEVCEPRYWITRLH
FT                   AIRDLTIHHNYGHLTVQANELLAKLEKLRR"
FT   CDS_pept        447097..448170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05750"
FT                   /product="uncharacterized membrane protein"
FT                   /note="COG1814: Uncharacterized membrane protein,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47565"
FT                   /db_xref="GOA:A0A0H3KR79"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR79"
FT                   /protein_id="BAG47565.1"
FT                   /translation="MDGAALYEALAAAEPDPSRRDVFMQLAEAEHEHAEIWRAKLQQRG
FT                   VDVATMRPTFKTRALRTLIRGFGPRFVLPALAAAEFADRDKYAQQTDAGALSADESTHA
FT                   AVVAAVARSNPSGGVKGSDIARAESWHRGASGNDLRAAVLGANDGLVSNFCLIMGIAGA
FT                   GASNKTILLTGLAGLIAGASSMALGEWLSVTNAYELAQTQIARENEELQRTPKAELREL
FT                   ALIYQAKGLDRDDARRVAEEMMRNRDKALDTLTREELGLDPEELGGNPWRAAGTSFGLF
FT                   ALGAIFPAVPFFWARGVVGIGISVSLSVLCLAVIGVVTSLFNGRSSWFSVTRQIVIGCV
FT                   AAGFTYGVGALLGVSMS"
FT   CDS_pept        448263..448685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05751"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47566"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYU0"
FT                   /protein_id="BAG47566.1"
FT                   /translation="MGYVCQKSDAWAKIVATLDRPNDVDRFTPIGQIVGKNLGATEQFN
FT                   TKGSVTYDVMRVVKIVDRPSQGTLLVSWSDAQKCVYLEQTWKLRVANKRGRCVLSGREI
FT                   QIGSSVFVPFCRPRPLNAGAMIIEEVAPIFFHASKA"
FT   CDS_pept        complement(449132..449626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05752"
FT                   /product="response regulator receiver protein"
FT                   /note="contains response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05752"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47567"
FT                   /db_xref="GOA:A0A0H3KQS2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQS2"
FT                   /protein_id="BAG47567.1"
FT                   /translation="MTASSGGEERGARFTVRLPLMHETSVDQEFTAPASSGSALLDGLS
FT                   FLLVDDDVAAQEVLAHLLRNLGAQVHTATGAADALNCLEAGSFDILITDLAMPGADGHT
FT                   LLRRIRQQEGNRRRIYALALTGLASIQDRDAANAAGFDDHLPKPMNLQLLLAKLSLGRG
FT                   R"
FT   CDS_pept        449728..450027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05753"
FT                   /product="putative histone-like nucleoid-structuring
FT                   protein H-NS"
FT                   /note="COG2916: DNA-binding protein H-NS, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05753"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47568"
FT                   /db_xref="GOA:A0A0H3KQG8"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQG8"
FT                   /protein_id="BAG47568.1"
FT                   /translation="MPTYKELKAQMDALAEKAEAARVAEFQAVVDDIRCKIAEYGITEK
FT                   DIFGTRRGRPAKQATVQPEAKYRDPKTGATWSGRGRAPAWIRDAKNRNRFLIQQ"
FT   CDS_pept        complement(450106..450510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05754"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05754"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV73"
FT                   /protein_id="BAG47569.1"
FT                   /translation="MDQILDESRGRFRSGLVVFEPKYYPIGPHAIPGFARRNHYGDLWV
FT                   EANEMLRLMKELRRQGPHLLHEKRPGVRYAVVSPHHRRRPFFPVFPFPAARSADSIKAG
FT                   GTAPLRPTPCSHPSDDGQSTQKWRRNIVGT"
FT   CDS_pept        complement(450687..451325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05755"
FT                   /product="signal transduction response regulator"
FT                   /note="COG2197: Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05755"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47570"
FT                   /db_xref="GOA:A0A0H3KR84"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR84"
FT                   /protein_id="BAG47570.1"
FT                   /translation="MKKVLLAERHAITRDGIRYILQETGEYQVARELPDGNALIATVRD
FT                   ETFDIAIVDLISIGARSTELISQVVSCTPMMRVLALCSTAEPTYAKSVFSAGASGFVTK
FT                   GSPAAELVRAVHSVLAGHRYMSAQVAERMVQTIDISPDAQLHARLTAREKAVLEGLACG
FT                   NGISEIASRLGINAKTVSTYKARLLKKLEVRTEAALIRYALEHQIVDPD"
FT   CDS_pept        452213..452920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05756"
FT                   /product="class I cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05756"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47571"
FT                   /db_xref="GOA:A0A0H3KYU3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYU3"
FT                   /protein_id="BAG47571.1"
FT                   /translation="MLRRLAGAILLCAVPSCFVFGQDRPTERAPDTMQARVLACAACHG
FT                   KAGEGTNNDYFPRLAGKPSGYLFNQLKAFRDGQRQYPPMNYLLAYLPDAYLRKIADFFA
FT                   AQHPPYPPATAPAVSAELLRRGKQLVNDGDRTRNIPACAACHGASLTGMEPAIPGLLGL
FT                   HAQYISAQLGAWRYGTRVSTAPDCMHDIASRLGNDDITAVAAWLSSLPGAANSAPATAG
FT                   SVKLPIACGSVPQ"
FT   CDS_pept        452989..454260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cccA"
FT                   /locus_tag="BMULJ_05757"
FT                   /product="cytochrome c family protein"
FT                   /EC_number="1.1.-.-"
FT                   /note="COG2010: Cytochrome c, mono- and diheme variants,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K00120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05757"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47572"
FT                   /db_xref="GOA:A0A0H3KQS7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQS7"
FT                   /protein_id="BAG47572.1"
FT                   /translation="MSKALRVCLTTIAASAALIIAPPRLAVAQDGSAKVDVIKRGEYLA
FT                   RAGDCIACHTQPSDKLFAGGRAMPTPFGTLYSPNITPDAETGIGRWSSDEFYAMMHTGR
FT                   SRDGSILYPAMPYAAYTKVTREDSDAIYAYLMSVPPVRRPNRPHDMRFPYNNRELLLGW
FT                   RTLYFREGVYKPDHEKSVEWNRGAYLVQGLGHCSMCHTAINALGGSSESKAFEGGLIPM
FT                   QDWYAPSLTSSREAGLGAWSIADITDLLQKGVSRRGAVYGPMAEVVYDSLQYLSDDDVR
FT                   AMAVYLKSLPQHGGEGAAEPTSSMSRDERNRLFRVGSKIYDSQCATCHGKNGEGKLPDF
FT                   PPLANNQSIQMVSAVNPIRMVLNGGYAPGTAKNPMPYGMPPFAQSMSDDEVAAVVTFIR
FT                   TAWGNRGMPVSAKDANALRSAPLY"
FT   CDS_pept        454270..454470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05758"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05758"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47573"
FT                   /db_xref="GOA:A0A0H3KQH1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQH1"
FT                   /protein_id="BAG47573.1"
FT                   /translation="MSDSTEDGIPQAPIARRLSDDEQHVDDIVRMGPKGALALAGIATF
FT                   IVIAMWFAFYFLVFLPRGVIQ"
FT   CDS_pept        454481..455068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="BMULJ_05759"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="COG1622: Heme/copper-type cytochrome/quinol
FT                   oxidases, subunit 2, Bacillus halodurans"
FT                   /note="KEGG, K02275"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05759"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47574"
FT                   /db_xref="GOA:A0A0H3KV76"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV76"
FT                   /protein_id="BAG47574.1"
FT                   /translation="MSNTQNTPPTAPANHADSHAIAVRTERRWAMFSVAFVLLLVAIVV
FT                   FTGLHWAMMPPSRVETIDPTTLHVSGEFIEGNLGTAREADGSVTVRVVAQQYSFTPQCI
FT                   LVPARTPVTFRITSADVVHGFLIANTNINSMVEPGYISTFRSTFNEPGDHLMPCHEYCG
FT                   TGHEGMWANVKVIEAAEFDKLAAGARRLSCVK"
FT   CDS_pept        455058..456683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="BMULJ_05760"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="COG0843: Heme/copper-type cytochrome/quinol
FT                   oxidases, subunit 1, Bacillus halodurans"
FT                   /note="KEGG, K02274"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47575"
FT                   /db_xref="GOA:A0A0H3KR90"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR90"
FT                   /protein_id="BAG47575.1"
FT                   /translation="MLNNRRLVLAHFWFAFATFGVALLLGAWQMYVRSPLHAWLSAPEL
FT                   YYRSVTAHGSVMAYVFPTLIAMGFGYAITELSLAQRLVGKRWAWAGWWLVAVGSIVAMV
FT                   PVSMGRASVLYTFYPPMIGNPFYYIGVVLVVVGSWIWVALMSVNLHVWKKANPGTPVPL
FT                   PMFANVAGSYLWAWTAVGAAIEILFQILPVALGLRSTIDSGLARVFFSWTLHAIVYFWL
FT                   MPAYIAYYTLVPRAVGGRLYSDEMARISFILFLVVAMPIGIHHLFADPQVGSGFKFLQS
FT                   VFTALVAVPTLLTVFTICASVEIAGRLRGGKGAFGWIRALPWHEPMMLAVAFSFVMLGF
FT                   GGAGGLINMSYQLDSTIHNTQWITGHFHLIFGGAIVIMYFAIAYELWPQLTGRSLRSVR
FT                   LIRWQLWTWFVGMIVTTFPWHYAGILGMPRRMAFFDYSDPAIAPEAITVVLSFVGALIL
FT                   VASAVLFFIVLARGHRGAIEPARRFEFSVAVHPPRTLPVALNSFGLWIALMIGLTVVNY
FT                   GYPIAQLLALPQTSVPAVWIGGQR"
FT   CDS_pept        456680..457480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05761"
FT                   /product="cytochrome c553"
FT                   /note="COG2863: Cytochrome c553, Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05761"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47576"
FT                   /db_xref="GOA:A0A0H3KYU6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYU6"
FT                   /protein_id="BAG47576.1"
FT                   /translation="MRTPPSPEARLFSLRNRWFTVSVGLTVAVAGVSALIGFVWLPSAQ
FT                   TDPQFKGLWNAICSAAGVPQQWLVSQPVVSSTKTSTAVLTPQTFAGTDGLSIGRGATLS
FT                   LRCTMCHGPQGLSFANSPNLAGQYESVVYKQLKDFQSGARTNAVMTPMATNLSDQDMKD
FT                   LAAYYASLPRVRVGASAVPAPAIVATGSPMRNIAPCASCHGAAENKLGAPWLEGEPLVY
FT                   IRQQLLAFAGGERHNDTSEQMRNVARNMTRDEIEAAAKFYSGQP"
FT   CDS_pept        complement(457735..458052)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05762"
FT                   /note="inactivated ISBmu34 transposase"
FT                   /note="truncated"
FT   mobile_element  complement(457735..458052)
FT                   /mobile_element_type="insertion sequence: ISBmu34"
FT                   /note="Inactivated IS30 family transposase, OrfB"
FT   mobile_element  457985..459589
FT                   /mobile_element_type="insertion sequence: ISBmu11"
FT                   /note="IS3 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        458316..459530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05763"
FT                   /product="ISBmu11 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05763"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47577"
FT                   /db_xref="GOA:A0A0H3KQT0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQT0"
FT                   /protein_id="BAG47577.1"
FT                   /translation="MVGKAGRPAVSLATRQLAVYELCTREGSAQAVAQKLDVDRVSLYN
FT                   WKNQLLGRGAPASMKRDKGSPSETDRDELERQVEELRRDIRNLKLEHDLLKKANELVKK
FT                   DLGVDLSLLSNREKTTLVDALREEYGLTELLERLDLARSSYFYHRSPIRVADKYADVRR
FT                   TVAEIFEDNHRSYGYRRVQAALSRQRVFLSEKVVRRLMKQGGLHAARPKRRRYRSYIGE
FT                   ISPAPDNIINRDFHANAPNEKWVTDISEFQIPAGKVYLSPMIDCFDGMVVSWSIGTSPD
FT                   AELVNSMLDAAIETVTEDDETPIVHSDRGGHYRWPGWLSRVAKAKLIRSMSRKACSPDN
FT                   AACEGFFGRLKTEMFYPGDWRSTTIAEFVEVLDAYVRWYNEKRIKGSLGYLSPIEYRES
FT                   LGLAT"
FT   CDS_pept        459868..460266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05764"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05764"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47578"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQH4"
FT                   /protein_id="BAG47578.1"
FT                   /translation="MRIARLLQESGRQWFEAVERATADSIAESAAEIETLRGKTDWPSV
FT                   AALPAESLGRLFQRRADDAQAVAREAVKSQAAFTAGLQQALGDWQKAVGEVAGGVNAAS
FT                   SAQDFIKQWSGAWQGATAVANAKVRKEA"
FT   CDS_pept        460268..461017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /locus_tag="BMULJ_05765"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases), Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00023"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05765"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47579"
FT                   /db_xref="GOA:A0A0H3KV80"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV80"
FT                   /protein_id="BAG47579.1"
FT                   /translation="MTTTQDRTALVTGGMGGLGEAIARALYDAGCRVLVTHARDAASAA
FT                   EWLAGEADKGYRFHSYDANVADFESCKRMADRIRADGLHVDILVNNAGITRDATFRKLE
FT                   KDGWDAVLRTNLDSVFNVTKPFIDGMVERGWGRVINISSINGSKGQFGQTNYSAAKAGI
FT                   HGFTKALAQEVARKGVTVNTVSPGYLATKMVTAVPEDTLKQIVAGIPVGRLGQPDEIAA
FT                   LVAFIASDAAGFMTGSNVAMNGGQHMY"
FT   CDS_pept        461259..461747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05766"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05766"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47580"
FT                   /db_xref="InterPro:IPR033846"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR95"
FT                   /protein_id="BAG47580.1"
FT                   /translation="MRRSGIEQKTFNGHAMNKPFFATLISVVMLGAGLSPASAFAHDLD
FT                   EQFTCKSSAHAFISRLISDQSIEPSPMLVEANSVNAFKPRHDAGLTAFGLRVRAVFGYQ
FT                   PGDPMFKPGNGKTPSGPIYGAVVFGSTDSVEALVRQAGSHAAIHQVIPLMLSAIVCES"
FT   CDS_pept        461804..463249
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05767"
FT                   /note="EC 2.7.2.1"
FT                   /note="KEGG, K00925"
FT                   /note="truncated acetate kinase"
FT   CDS_pept        462417..462983
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05768"
FT                   /note="EC 2.7.2.1"
FT                   /note="KEGG, K00925"
FT                   /note="truncated acetate kinase"
FT   CDS_pept        463404..464267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05769"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05769"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47581"
FT                   /db_xref="GOA:A0A0H3KYV1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYV1"
FT                   /protein_id="BAG47581.1"
FT                   /translation="MGDPVASLSISEDFATYVSPRFGSRDSTSRPSMVIVIGASDEIRL
FT                   VTERGAYTGRCLLVSPNVSRSIEVNNATGLYSIQLDPASRLSQYLRRHVPGEKPVVDLS
FT                   KKAEGFALETSGAALGKPPGDPDIAAASQRVLDALFGDAVAFPATECRVQTVAGCLKAR
FT                   VPVRTDPRSLARLCGISESRLVHLFASVTGVSIREYLLWVKARKAVSMFASGKTLTEVA
FT                   HATSFSDQAHLSRTFKRYFGLTPSFLSNPRLVRISNSATGCRAEPDCGRHCGHSSFRIA
FT                   DPAKLC"
FT   CDS_pept        complement(464311..465342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05770"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207: AraC-type DNA-binding domain-containing
FT                   proteins, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47582"
FT                   /db_xref="GOA:A0A0H3KQT3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQT3"
FT                   /protein_id="BAG47582.1"
FT                   /translation="MSFGEFTRGPASARLLIGFGQEHGVPAARLLAGTRLAAGQLDDPN
FT                   LELAAAQELCIARNLLRLLKHPPGLGLQVGCRYTFSVHGMLGYGLISSETVGDALTLAL
FT                   RFLPLSYAFTSITYHEHEHVGVLRFGELDHLADDIRQFLVERDMAAAAVLLRDVLGGDI
FT                   ASLRFAFRGDEPRPAYRPSRAWPTALGTEHEFSARFNSLSFERSLLSRALPHANPVTAS
FT                   MCEQMCAQLMESRRARTGTAAAVRHHLSAAGAALPDLGRMARLMNVSERTLKRRLSDEG
FT                   VTFRELLAEARRSAAESLLGADDLTLTEIAGRLGYSDLSSFSQAFKRRHGITPSAFRKR
FT                   VRN"
FT   CDS_pept        466140..467138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05771"
FT                   /product="HlyD family secretion protein"
FT                   /note="COG0845: Membrane-fusion protein, Pasteurella
FT                   multocida"
FT                   /note="KEGG, K01993"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05771"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47583"
FT                   /db_xref="GOA:A0A0H3KQH5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQH5"
FT                   /protein_id="BAG47583.1"
FT                   /translation="MVDRVQMNKRRSWAIAAVVAVGLAGAGAWWVHDRRGAWPDDIAFA
FT                   NGRLEMARIDVAVKYGGRVVELPVHEGDVLAAGAVVAREDDSELLAQLDAASASRTRAA
FT                   GAATRARAEVDASAANERLAGLEWTETSKLFGDGQVSGVERQRRRFALDGAEAGQQAAR
FT                   SGLDEAHAAIAEADAQIARLKTVLADTTIRAPIAGRVEYRIVEVGAVLPAGGRVATMLN
FT                   PDDIYFTIFLPAPQAGKLAIGADARIVLDAFPNEPIPARIGFVSSDAQFTPKYVETAGE
FT                   RAKLMYRVKLQLPVDVARRLAPRLKAGLTGNGFVRLDGAHPWPAALAVRGS"
FT   CDS_pept        467142..469970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05772"
FT                   /product="ABC-2 type transport system ATP-binding protein"
FT                   /note="COG1131: ABC-type multidrug transport system, ATPase
FT                   component, Pasteurella multocida"
FT                   /note="KEGG, K01990"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05772"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47584"
FT                   /db_xref="GOA:A0A0H3KV84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV84"
FT                   /protein_id="BAG47584.1"
FT                   /translation="MAATLGTSGAGHAAGAIHVANLSHRYGSALALDDVSLSLPAHTTI
FT                   GLIGPDGVGKSTLLGVIAGVKRIQQGDVSVLGADLRVRDRREAILPRVAFMPQGLGRNL
FT                   YPTLSVYENIDFFARLFGLDAHARAARIQRLLDATGLAPFPDRPAGKLSGGMKQKLGLC
FT                   CALVHNPDLLILDEPTTGVDPLSRRQFWTLVDDLRAEHRGMSVIVATAYMEEAQRFEHL
FT                   VAMDGGRVLVNDSTQAVLERAGTDDLERAYVSLLPGAGGAGAAALVIPPRPQDGAPAIV
FT                   ADGLTRRFGSFVAVDHVSFRIERNEIFGFLGSNGCGKTTTMKMLTGLLDATSGTATLLG
FT                   KPIDATDMNTRMKVGYMSQSFSLYEELTVRQNLDLHAKLYRMEGERASEAVERSLASFE
FT                   LQPCADERPAALSLGIRQRLQLAAACLHKPEVPILDEPTSGVDPGARDMFWRHLIQLSR
FT                   EERVTIFISTHFMNEAARCDRISLMHRGRVLAVGSPEELREQRHASTLEEAFVACLEEA
FT                   EAAGATAPASRQPDAARPDAQADATAEATAEATGKATAEGAPEATPTTAPTAGSLARIW
FT                   AFARRESLELARDRLRLAFALLGPVVLLLAAAWSVSFDVENVRFAVLDRDHSLESRTLV
FT                   EQFSGSRYFVPTGHVYTDGEAHRLLQADDAQLVVEIPPDFGRDLLAGRRPELSFHVDGS
FT                   SPFPGATIGTYVNAVLLDYVGKEIRHASVAMPALPVSVESRFIYNEEFRSIYAITPGVI
FT                   MLALILIPTMLTALGVVREKEMGSITNLYASPAGVGEYLLGKQAPYVGLAMVSYLVLVA
FT                   LTVTVLGVPLKGSFVALSIGALLFVFAATGLGLLVSTFVRSQVAAIFGTAILCLIPSVN
FT                   FSGLLYPVSTLTGSSYWAGLGFPSSWFQLVSLGSFTKGLGAAHFGTMYAALSGFALLYL
FT                   IGAYCLLPKQEA"
FT   CDS_pept        469973..471100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05773"
FT                   /product="ABC-2 type transport system permease protein"
FT                   /note="COG0842: ABC-type multidrug transport system,
FT                   permease component, Pasteurella multocida"
FT                   /note="KEGG, K01992"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05773"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47585"
FT                   /db_xref="GOA:A0A0H3KR99"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR99"
FT                   /protein_id="BAG47585.1"
FT                   /translation="MTQWFKNVARLSRKEIFSLFSDATLMALIVFAFTLAVYSVAKGIK
FT                   AEVSNASVAIIDGDHSELSRQLRAAIQPPYFKPPVDVGRQDIDAELDRGRYIFAVEIPP
FT                   RFEADVLAGRSPSVQVLVDATAMTQAGLGTAYLQQIFTTETFAFLRARNLDARLPVNAV
FT                   VRVQFNPNTESYWFTSTMQIVIDITVLSIILVGAAVIREREHGTIEHLLVMPVRASEIA
FT                   VAKIIANGSVIFVVSLLSLCFVVNLWLKVPLQGSIALFALGTALYLFSVTALGMWLATL
FT                   APAMPQFGLLAVPTYAIAYLLSGAATPVQSMPVAMQPFVKLLPTTQFVALTQSILFRGA
FT                   GIDIVWPRLLGIAAAGGLFLALALVRFRSMLAQQG"
FT   CDS_pept        471225..472634
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05774"
FT                   /note="COG1538: Outer membrane protein, Pasteurella
FT                   multocida"
FT                   /note="truncated outer membrane protein?"
FT   CDS_pept        472759..474987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05775"
FT                   /product="putative poly(3-hydroxyalkanoate) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05775"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47586"
FT                   /db_xref="InterPro:IPR024501"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYV4"
FT                   /protein_id="BAG47586.1"
FT                   /translation="METIDQAAEAVESTCFPFLRDSLFPWGAMSSYLADAWQRGILYAD
FT                   VMRERGNRYNAHLAEKVPNVLHFPCELILSGLDLPKPVNYGLVRILPHADAPTDETKRP
FT                   FVVVDPRAGHGPGIGGFKPDSEVGAALRAGHPCYFVGFLPDPVPGQTVEDVMRAEAAFL
FT                   EKVIERHPDSQGKPAVIGNCQAGWQILMTAAMRPELFGPIIVAGSPVSYWAGWKGRNPM
FT                   RYAGGLLGGSWLTALTSDLGAGRFDGAWLVQNFENLNPANTLWTKQYNLYSKVDTEAGR
FT                   FLDFEEYWGGHVFLNDVEMQYIVDNLFVGNRLATAELITSDGIRLDLRNIRSPIVVFCS
FT                   YGDNITPPPQALGWITDLYRDDMDVLTHDQTIVYATHESIGHLGIFVSGGVGRKEHRKF
FT                   AANIDLIDLLPSGIYEATIGANPEQNVQPAPVEGEFLLDVKPRKLDDIREIVQPDPQSD
FT                   RRFDTAARCSDINLGLYRTFVQPWVRACVTPESARRLETLHPLRVGYEWWSDSNPLAAW
FT                   VSAVAGDVRANRTQVLADNPAWQAQERVSDAIEAVLDQWRDLRDAAYEQTFEAVYGSPW
FT                   LQALVGQRAADDRPPRPYPSVSPEHRQFVDQKLAELRSAIDEGGLIEAALRAIFYVLRH
FT                   RPEIDERRFNLALRLHESGAVKRSSRRKANLIEAFRIIVRQQTNLMRLDLDAAMAAIPQ
FT                   LLARSEPNEIRRLGDALEQVFTAGDPLGEEEQVDLRHALAIFDAAARR"
FT   CDS_pept        475035..475229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05776"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05776"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQT6"
FT                   /protein_id="BAG47587.1"
FT                   /translation="MPAEPVAQLQRATRAQLQTVDACLAAARGEIPADQQERLARVARV
FT                   LGVDAGEKPNKRGKSTEAA"
FT   CDS_pept        475238..476179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptb"
FT                   /locus_tag="BMULJ_05777"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="COG0280: Phosphotransacetylase, Rickettsia
FT                   prowazekii"
FT                   /note="KEGG, K00634"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05777"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47588"
FT                   /db_xref="GOA:A0A0H3KQH9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQH9"
FT                   /protein_id="BAG47588.1"
FT                   /translation="MENKREKYARLIAFAKTLPPTPTAIAHPCDESSLRGAVEAAQLGL
FT                   IQPILVGPSDRIVAVAGESGLDIADLQLVDAPHSHAAADTAVRLVREGRAQALMKGSLH
FT                   TDELMSAVVAHDTGLRTARRISHCFVMDVPGHDDPLIITDAAVNIAPTLEDKVHIVQNA
FT                   IDLAHALRFPAARVAILSAMETVNPKVPSTLDAAALCKMADRRQIEGGILDGPLALDNA
FT                   INVDAARLKHIDSPVAGHANVLVVPDLEAGNMLAKSLSFLAGADAAGIVLGARVPVILT
FT                   SRADSVVARLASCAVAALVALWRRDPLRAVVN"
FT   CDS_pept        476191..477369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="BMULJ_05778"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="COG0282: Acetate kinase, Sinorhizobium meliloti"
FT                   /note="KEGG, K00925"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05778"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47589"
FT                   /db_xref="GOA:A0A0H3KV87"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV87"
FT                   /protein_id="BAG47589.1"
FT                   /translation="MDVILVVNAGSSSLKFSVFAVSGSALDPVCHGNFEEIDTHPQVHV
FT                   TDAQGAPLDEKRWPEGFRLGHSGAIAFLFDWLHGHAAGYTAIGVGHRIVHGGSHYASPV
FT                   RIDDEVIADLEALVPLAPLHQPHNLAALRIIAARRADLPQVACFDTAFHHGQPAVATQF
FT                   ALPREITEQGVRRYGFHGLSYEYIASVLARYDERAARGKTVVMHLGNGASMAALANGRS
FT                   MASTMGFTAVDGLPMGTRSGTVDPGVLVWLMDHQHMDARAIETLLYKRSGLLGVSGISS
FT                   DMRTLLASDDPAAANAVELFCYRVSRELGSLAAALGGLDSIVFTAGVGEHSAAVRERIC
FT                   RAAAWLGVSLDPAANARHGPRISTAGSVVSAWVIPTDEERMIASHTLDLLEI"
FT   CDS_pept        477370..478149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="BMULJ_05779"
FT                   /product="NADH-dependent enoyl-[acyl-carrier protein]
FT                   reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="COG0623: Enoyl-[acyl-carrier-protein] reductase
FT                   (NADH), Aquifex aeolicus"
FT                   /note="KEGG, K00208"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05779"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47590"
FT                   /db_xref="GOA:A0A0H3KRA4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRA4"
FT                   /protein_id="BAG47590.1"
FT                   /translation="MEDTPNLPLAGRKVLILGIANEHSIAYGCARAFRELGAELAITYA
FT                   SEKSKTYVEPLARELGATLLMPLDVSKPGEMESLFDAIRDTWGRLDVALHSIAFAPKAD
FT                   LQGGLINSSAEGFATAMDVSCHSFIRLARLAAPLMDQGGTLFAMSYLGASRVVPNYDLM
FT                   GPVKAALEAACRYLAYELGPRGIRVHPVSPGPLKTRAASGLKDFDLLLNEARQRAPLGE
FT                   LVDIMDVGFACAYLATPYARRITGNTIFIDGGVSIVG"
FT   mobile_element  478236..480546
FT                   /mobile_element_type="insertion sequence: ISBmu17"
FT                   /note="IS5 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        478236..479150
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05780"
FT                   /note="ISBmu17 transposase, inactivated by ISBmu12b
FT                   insertion"
FT                   /note="inactivated ISBmu17 transposase"
FT   misc_feature    478236..479080
FT                   /note="ISBmu17 transposase, interrupted by ISBmu12b
FT                   insertion, N-terminal part."
FT   repeat_region   complement(479073..479080)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(479081..480435)
FT                   /mobile_element_type="insertion sequence: ISBmu12b"
FT                   /note="IS256 family"
FT   repeat_region   complement(479081..479108)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12b, terminal inverted repeat"
FT   CDS_pept        complement(479120..480379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05781"
FT                   /product="ISBmu12b transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05781"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47591"
FT                   /db_xref="GOA:A0A0H3KTS5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KTS5"
FT                   /protein_id="BAG47591.1"
FT                   /translation="MPRKRKEEVTIEPGKGLNLDPELIKQLVPGTLDRASINEQFAALK
FT                   KAIFERALGGELTHHLGYEKGEAKPVGRTNHRNGTSRKRIATDNDLLDVEIPRDREGTF
FT                   DPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLDMYGIEVSPDFISTVTDAVIDE
FT                   VREWQQRPLEPMYPVVFFDALRVKIRDEGVVRNKAIYLALGVRRDGTRDVLGLWIEQTE
FT                   GAKFWLRVVNDLKLRGVQDILIAVVDGLKGFPEAINTVFPETTVQTCIVHLIRNSLDFA
FT                   SWKDRKSVAAALKEVYRAPSAEAAAVALDAFDTSPWGTKYPPIAALWRRAWDQVIPFYA
FT                   FAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHD
FT                   WKSAMTQFALLYPERFNIGI"
FT   repeat_region   complement(480408..480435)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu12b, terminal inverted repeat"
FT   misc_feature    480436..480546
FT                   /note="ISBmu17 transposase, interrupted by ISBmu12b
FT                   insertion, C-terminal part."
FT   repeat_region   complement(480436..480443)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(480586..480936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05782"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47592"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQU0"
FT                   /protein_id="BAG47592.1"
FT                   /translation="MTVEEAWEANGLGSLPALTNAVWIMFPPLDETTMHKLAVLARIDV
FT                   VTLDRIQTPEGWMTPRRRLPYCYRCLVINPVDVSTPYWRRAWLDPAIRNCGEHGTPLET
FT                   VPPFVFHRGSVA"
FT   CDS_pept        481076..481552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05783"
FT                   /product="ISBmu22 truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05783"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47593"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQI0"
FT                   /protein_id="BAG47593.1"
FT                   /translation="MSPANRELGRRVQDPGDFPRETAACRKAAAKRFFRRVLAACPEAP
FT                   KKIVTDQLGSYPAAKAEIPKLTNVKHVFVKASARVNNRAENSHQPTRERERRMRGFRDP
FT                   QRTQAFLSNFGPIRQHFALKRHLLRSSLYRKQLAARFVAWREITCRTQNPSMAC"
FT   mobile_element  481076..481552
FT                   /mobile_element_type="insertion sequence: ISBmu22"
FT                   /note="Inactivated IS6 family. No terminal inverted repeat
FT                   or target site duplication have been identified."
FT   CDS_pept        481601..482005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05784"
FT                   /product="ISBmu18 truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05784"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47594"
FT                   /db_xref="GOA:A0A0H3KV91"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV91"
FT                   /protein_id="BAG47594.1"
FT                   /translation="MPGVPVSAILTGANRNDVTQLLPLVDAIPPIRGTRGRPLRQPKIL
FT                   YADRGYDSDSHRRRLRERGIKPVIARRRTEHGSGLGKFRWVVERTHSWLHGFRRLRIRF
FT                   ERRSDIHEAFLKLACSLVCWNIFKIAERPF"
FT   mobile_element  481601..482005
FT                   /mobile_element_type="insertion sequence: ISBmu18"
FT                   /note="Inactivated IS5 family, no terminal inverted repeat
FT                   or target site duplication have been identified."
FT   CDS_pept        482496..483029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05785"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47595"
FT                   /db_xref="GOA:A0A0H3KRB0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRB0"
FT                   /protein_id="BAG47595.1"
FT                   /translation="MTQTIKRRPRPDSPTPDEIVAKRQQAGRTQMQVALLLRVSLRQVQ
FT                   RWERGEQDMPSATWRFFKLTCGYYYPVDFERVEDFERDWDGLRDRKRDTIEHGDMVELR
FT                   ALDGKRMRASVWLDRVHDGLVDEESYGAIVREFPDHPAQAQLGKFRIEDRVTFARSNVI
FT                   HLTQRLPADPVAQS"
FT   CDS_pept        483062..483730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05786"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05786"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47596"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYW2"
FT                   /protein_id="BAG47596.1"
FT                   /translation="MPEVGRLHEGLAVAGERYRVVIQPRSYPFALDESDVTLFIAVDAR
FT                   SQSWGNEWARISGDAVIPARRQDVRLAVTAGGSDELQVLPARHADLPEFRTGITLTLEP
FT                   GMRDPILTALSRVERVAQRTAADCQAIEPMLGRTLAPYSPTVLKPHEVNAIAAIVAGIV
FT                   LQGKGVPDAISWSVLLSPEYSTWAFGENGDHPHYAELGTALRQPAVQAMLAEAGRDVRA
FT                   "
FT   CDS_pept        484277..484528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05787"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05787"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQU3"
FT                   /protein_id="BAG47597.1"
FT                   /translation="MKTTARYTKGRGEASVHARAIVRAHADHDLVEIDIAGQLNSEHHF
FT                   RPISSADEAEMLARQLLDAAAKVRAVVPAARVSTPKVA"
FT   CDS_pept        484618..485481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05788"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05788"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47598"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQI4"
FT                   /protein_id="BAG47598.1"
FT                   /translation="MQRDYFSVTLSDLAEGDVLVDALERGDVVGRAWVPATDEGKYGEY
FT                   AKEVRIPLHRAAAARVQYTYYLRQYEYNERDTVTFWLRLLGRDYRLHAWLEDARQGRYN
FT                   RQRIARKERMDLLLWLIDESVAASRDRTSAYRSSLEFLTRQHTRRWLRHPAALDLMHYT
FT                   NFQLDSLRVQGLVEKDADGSGYRACPAALAEVDRYATEERRHAASQALQHWVILIGGLA
FT                   LVAAAAQAAANIKQAWFDKQETGGAVEQRLPSSNAVPSPESAATAHHDARGHQRDEPHN
FT                   NARESQ"
FT   CDS_pept        485619..485804
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05789"
FT                   /note="truncated transposase"
FT   CDS_pept        487399..490005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05790"
FT                   /product="putative Rhs element Vgr protein"
FT                   /note="COG3501: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47599"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV94"
FT                   /protein_id="BAG47599.1"
FT                   /translation="MDALELMRVIRGGLIQQDRLLRLDTAVGNDVLLPHQMIGESRLGR
FT                   DFEFVVDVVTTTPNVELKNLIAQPATLWIQQPGAVYAPHNGYVHTARRLGADGGLTFHQ
FT                   ISIASWMHFLRFRRDQRIWQDKPVDTIVADVFNAHPQARGFFEFHLSRVLPSLSFCRQD
FT                   ETDWNFVHRLLESEGLYGYWKHDADGRAHRLVITDRLAALEEALPVTFSRSGTTVASDA
FT                   LRQWSATRTLQSTSLTTRTFDYKSPASAVNAKGTSMPTMPNQGDLPDQAEIYEYTGAYT
FT                   FLTQERGDALSKTRLEEWESRSKRFFGIGGWRAADAGKRFTLNGHPDHDCDSPEQREFV
FT                   AIGVRWIVRNNLPIAASAARMPHSLDKPIAESGIDDLDVAGYVSSYADGSIGAYQVEVE
FT                   AQRTTIPFRSPFEHVKPQTHLETAIVVGPQNEEVYTDELNRIKVRFVWDRINPGNEGAS
FT                   CWVRVVQSDTGNGYGAVHPPRVGEEVLIDYVGGDCDRPIAIARVYNGATKPQWHTHGLL
FT                   SGYRSKEFAGAGYNQMVMDDSTGQNRLQLFSSQGNSALHLGYLIQQTGNVRGTYLGSGF
FT                   DLRTDNYGAVRANRGLYVTTYPNAADSQPLDARDTQQQLVRAESLLESLSDVGTAHNAE
FT                   SLQAGYDALKQLTDATQESIAGSASGGRTAGGGTGAANAFKDPVMLFGSPAGIGFSTNE
FT                   TVHMSAAQHVNIVSGQSTHFAIGKSLIASVANKLSIFVQSAGMKLFAARGKIEVQAHSD
FT                   NIELTAQKTVKVLSATANVEVAADQEVFLTSGGAYIRIANGDIQIHAPGKIDIKGATHS
FT                   LNGPTAQGYVLPGLPHAGDVPRYHEQFHLVDEDGKTVLPHTRYEIESESDCATSFL"
FT   repeat_region   complement(489974..489981)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(489982..491349)
FT                   /mobile_element_type="insertion sequence: IS406"
FT                   /note="IS256 family"
FT   repeat_region   complement(489982..490008)
FT                   /rpt_type=INVERTED
FT                   /note="IS406, terminal inverted repeat"
FT   CDS_pept        complement(490036..491202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05791"
FT                   /product="IS406 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05791"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47600"
FT                   /db_xref="GOA:P24575"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24575"
FT                   /protein_id="BAG47600.1"
FT                   /translation="MAMRVETNPLEAAYAALLENGLDGAGEALRILVNEAAKIERSAFL
FT                   GARPYERTETRRDYANGFKPKTVLTRHGELTFQVPQVRSSDFYPSALEKGTRTDQAVNL
FT                   ALAEMYVQGVSTRRVIDVLQRLLGPEISLSSAQVSRAAAKLDEGLRAWRERPLGETPYL
FT                   FLDARYEKVRLEGRIVDCAVLIAVGIEASGKRRVLGCEVATSEAEINWRRFLESLLARG
FT                   LKGVTLIIADDHAGLKAARRAVLPSVPWQRCQFHLQQNAGALTTRQEARKTVAAQMRAI
FT                   FNAPDRTEAERLLKAALTLWCKEHPKLAEWAETAIPESLTVFDFPAAHRIRLRTTNGLE
FT                   RINRELRRRTRVASIFPNPDSCLRLVSALLAELDDEWMTGKVYLNFNP"
FT   repeat_region   complement(491323..491349)
FT                   /rpt_type=INVERTED
FT                   /note="IS406, terminal inverted repeat"
FT   repeat_region   complement(491350..491357)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(491830..493000)
FT                   /mobile_element_type="insertion sequence: ISBmu8"
FT                   /note="IS630 family, no target site duplication has been
FT                   identified."
FT   repeat_region   complement(491830..491861)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu8, terminal inverted repeat"
FT   CDS_pept        complement(491843..492928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05792"
FT                   /product="ISBmu8 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05792"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47601"
FT                   /db_xref="GOA:A0A0H3KQZ5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQZ5"
FT                   /protein_id="BAG47601.1"
FT                   /translation="MRIAAKVELSEAQRKQLKTWATGRTIPVRLAERAKMILLAAQGKT
FT                   DKEISADLAIWRGTVARWRARFIADGVTGIERDETRPGRKPKISARKVKTVVALTTQQR
FT                   PDNATHWSTRSMAAVAGISEASVRRIWQAHGLKPHRLESFKVSNDKHFAEKLEDIVGLY
FT                   LDPPEHALVLCCDEKSQIQALDRTQPGLPLKRGRAQTMTHDYKRHGVTTLFAAMNTLDG
FT                   SVIGQCQTKHRHQEWLSFLRKIDRNTPKDKELHLIADNYATHKHPEVQAWLAKHPRFHM
FT                   HFTPTSASWLNMVERFFRDLSVNQLRRAAFRSVPELVSTIEQYVQKHNRHPKPFIWTAK
FT                   ASDILAKVTRARAKLNKMQSV"
FT   repeat_region   complement(492966..493000)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu8, terminal inverted repeat"
FT   repeat_region   493223..493225
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  493226..494541
FT                   /mobile_element_type="insertion sequence: IS401"
FT                   /note="IS3 family"
FT   repeat_region   493226..493251
FT                   /rpt_type=INVERTED
FT                   /note="IS401, terminal inverted repeat"
FT   CDS_pept        493276..493599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05793"
FT                   /product="IS401 transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05793"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47602"
FT                   /db_xref="GOA:Q51647"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51647"
FT                   /protein_id="BAG47602.1"
FT                   /translation="MNKTNKFSPEVRERAVRMVQEHRGEYPSLWAAVESIAPKIGCVPQ
FT                   TLLDWVKREEVDSGQRDGLSSSERERLKALEREVKELRRANEILKTASAFFAQAELDRR
FT                   LKS"
FT   CDS_pept        493596..494507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05794"
FT                   /product="IS401 transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05794"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47603"
FT                   /db_xref="GOA:A0A0H3KYW5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYW5"
FT                   /protein_id="BAG47603.1"
FT                   /translation="MKAYIDRYRDAYGVEPICKVLQIAPSCYRRHAARLRNPALRCKRA
FT                   QRDDALIPDIERIWHANWQVYGADKVWKQMNREGIRVARCTVERLMKRQGLQGVRRGKV
FT                   VRTTTPDTSAPCPLDRVQRVFKAERPNQLWVSDFTYVSTWQGWLYVAFVIDVYARRIVG
FT                   WRVSSTMRTDFVLDALEQALYDRQPASDTLVHHSDRGSQYLSIRYTERLAEAGIEPSVG
FT                   SRGDSYDNALAETINGLYKAELIHRRAPWKSRESVELATLQWVHWFNHIRLLEPIGYIP
FT                   PAEAEANYWRQLASETIALVST"
FT   repeat_region   494516..494541
FT                   /rpt_type=INVERTED
FT                   /note="IS401, terminal inverted repeat"
FT   repeat_region   494542..494544
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        494953..495519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05795"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47604"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQU8"
FT                   /protein_id="BAG47604.1"
FT                   /translation="MCAAIVGTFCAGAIAQTPQPQFVQLSAGPIVQEHSHRLVVTDTRH
FT                   GKLRTLEVPSAIRRALMSSSSVAFPAARSSVIDGHEFVMVVINQSSSDNPTGYCGAGEE
FT                   GTLYVLRLDGKHAEPVYSTLVQSCLKNIDLFTDSGNKSPYLAIAWTDGGDGFRIHWENY
FT                   AKPESLTRQYRYANGRFTVDSERPN"
FT   CDS_pept        496605..497783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05796"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05796"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47605"
FT                   /db_xref="GOA:A0A0H3KQI8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQI8"
FT                   /protein_id="BAG47605.1"
FT                   /translation="MRYVRATEEFVFAGRPRPGFPLILDDSMTPAQPFHDYLLYRLLER
FT                   GKTLDPKTWEAYGRRLWDFARFLQANDWSWNDPFMSVGQSVVRVYRDWQAQDLKLDPAT
FT                   VNDRLRLVAAMYQWAHERGRIDRLPFGCSDIAVYGIEHDLAHVTGGRKTLSRPAVLLNE
FT                   WDKEPAFLTVDQLKIARQSIRSASQRLLFDLMARVGLRSVEARTFPLSYVFDPSAQKAL
FT                   KPGTFIEVRLDPRDMEIKLNKARVVHVPYSLMEDMYAYTTYERNGLVGAAERKELVLTI
FT                   HGQRYSKEAAVKVCTDLSNRVGFRVRPLMLRHSYAIHTLLLLRSRPEIKLEPLMYVRDR
FT                   LGHASVQTTMVYLQQIERLLGAEALAMMDEFDRLYGVSKALASAPQVSTVDP"
FT   CDS_pept        498281..498769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05797"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05797"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KV98"
FT                   /protein_id="BAG47606.1"
FT                   /translation="MFVQGFIEGEPSRFFRHSALPWSCEDSLQTSLSDAEQERLAKAIK
FT                   SDLVDVHHGRLPLKQGAVQGLRLLLVAHRQGLNPTPLLEMCRDALAPGFLPGTIRMRTA
FT                   KHRSKKVRSSIGRAALERQASTQPSEPPAEQDLCFDLSEGAVLQQAIASTRDVARQSG"
FT   repeat_region   complement(498742..498747)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(498748..501634)
FT                   /mobile_element_type="insertion sequence: ISBmu7a"
FT                   /note="IS21 family, no terminal inverted repeat has been
FT                   identified."
FT   CDS_pept        complement(499074..499925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05798"
FT                   /product="ISBmu7a transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05798"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47607"
FT                   /db_xref="GOA:A0A0H3KRB8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRB8"
FT                   /protein_id="BAG47607.1"
FT                   /translation="MSLDIDVTRLSLLLNDLRLPAIKQIWSSFAERSDAEGWPAARLLM
FT                   ALAEHEIAERDRRRVERHLKDAKLLPGKTLENFDFDAVPMVSRAHVSALCAGDGWLRNG
FT                   TNLILLGPSGGGKSHLSSAIGLSLLEKGWKVLFARTTDLVQRLQVARRELALESAINRL
FT                   DRFDLVVLDDFAYVSKDQAETSVLFELISARYERRSLCITANQPFGEWDKVFPDRAMTV
FT                   AAVDRLVHHSTIFELNVESYRRRTALQRKQQGPGRPASRATPKNVGVPPTQEDQHGIDL
FT                   TE"
FT   CDS_pept        complement(499922..501406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05799"
FT                   /product="ISBmu7a transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05799"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47608"
FT                   /db_xref="GOA:A0A0H3KYW7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYW7"
FT                   /protein_id="BAG47608.1"
FT                   /translation="MRLYMKYRLKEGPPQAAARAGFSAATGYRIEEDPRLPSQKKAPRG
FT                   RRRADPLAAIFDTEIVPLLQSAPGIRPIAVLDEMLRRHPDLPGNVRRTLERRIRDWRAL
FT                   HGEEHDVMFRQVHQPGQLGLSDFTEMDSLGVTVAGVTLDHRLYHFRLACSGFEHAHVIL
FT                   GGESYVALAEGLQNAIWALGGAPREHRSDSLSAAFRNLDADARKDLTTRYDALCAHYGM
FT                   QPTRNNRGVAHENGSIESPHGHLKSAVRDALLLRGSHDFDDLGSYRRFIDEIVGRINAR
FT                   NGKRIEVERALLQPLPVQRTCDYEETRVYVTTTCGFVLRKVFYTVPSRLIGHHLRVRLY
FT                   DDRLELFLGGTALMTLQRGRAGPNGKHGHVINYRHVIHALRRKPMALLNLVYRDQVFPR
FT                   EAYRLSFDRLLEQLPERQACRTMVELLSLAHEHNCEAQLAEALQQCLDDGQLPDLDALC
FT                   SRFEAKPTSSMPEVNIQLAALSDYEALLDMATEVAA"
FT   repeat_region   complement(501635..501640)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        503723..504541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47609"
FT                   /db_xref="GOA:A0A0H3KQV0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQV0"
FT                   /protein_id="BAG47609.1"
FT                   /translation="MKMAEAAHRLNHVRGIGRHLVLGLNVKASDHLGTGSRVEVLSSTS
FT                   CAYQLKQLAVAAGTEWDLANHQCRRTFAYNVANSRLGRMGLVFLKWQLKHASMSWTQLY
FT                   AASPYQDHALYREFEEEMFEARLGLLEGWAHPDALLSGGAGKKIMQTRARAARDLKQLL
FT                   RQTAESVELRSTGHAWCISGTHGCHGQGVYDPSMCGGCSQAIIDQGQASAWQMIHLDNL
FT                   RLAAITDCGPVVADKARRAVERSKQVLHNLGCALPTDDQAQAYTAAREGA"
FT   CDS_pept        504538..504975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05801"
FT                   /product="TetR family transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05801"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47610"
FT                   /db_xref="GOA:A0A0H3KQJ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQJ2"
FT                   /protein_id="BAG47610.1"
FT                   /translation="MSTRAGTTPAEPQTESAPRRRSRGKTREELQLAMLRVKNKGLKLS
FT                   ISAVATEAGVSAGLIHNTYPDIAEEIRAQVGRGTRQQRDAKVAEVKEVRGRLKALRMER
FT                   DAALADVARLASINETLRQEVAMLRAAASGKMVVLPPQMDV"
FT   CDS_pept        complement(505115..505543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05802"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05802"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47611"
FT                   /db_xref="GOA:A0A0H3KVA3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVA3"
FT                   /protein_id="BAG47611.1"
FT                   /translation="MEIRPATVDDLASIETLLHQCGLPVVGVSDHLQDFVVAMEGSTMC
FT                   GCGGIEHYRDAALLRSIAVAEHARGSGVGQRIVSQLVAACHSLQVRSLVLLTTTAENYF
FT                   TRQGFVRVARDDVPPLVLASSQFQGVCPGSAASMLRVL"
FT   CDS_pept        complement(505566..506288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05803"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /note="COG0431: Predicted flavoprotein, Sinorhizobium
FT                   meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05803"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47612"
FT                   /db_xref="GOA:A0A0H3KRC2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRC2"
FT                   /protein_id="BAG47612.1"
FT                   /translation="MSEQLKDLSQLDATHFRVPDAAELRPAAPSTHPPRLLLLYGSLRE
FT                   RSFSRLLVEEAERLLTAMGAEVRVFNPSGLPLPDDAPESHPKVVELRELVMWSEGMVWC
FT                   SPERHGAMTGIMKSQIDWIPLSVGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRVLGRWM
FT                   RMLTIPNQSSVAKAFAEFDEAGRMKPSSYYDRVVDVMEELVKFTLLTRDIGPYLVDRYS
FT                   ERKESAEELSKRVNQRSI"
FT   CDS_pept        complement(506281..506703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC1"
FT                   /locus_tag="BMULJ_05804"
FT                   /product="arsenate reductase"
FT                   /note="COG1393: Arsenate reductase and related proteins,
FT                   glutaredoxin family, Mesorhizobium loti"
FT                   /note="KEGG, K00537"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05804"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47613"
FT                   /db_xref="GOA:A0A0H3KYX0"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYX0"
FT                   /protein_id="BAG47613.1"
FT                   /translation="MTDITIYHNPNCGTSRNTLALIRNSGEEPIIIEYLKTPPSRETLV
FT                   KLLADAGLTVREVLREKGTPYAELGLDDPKWTDEQLLDLIGQHPILMNRPIVVTPIGTK
FT                   LCRPSEAVLDILPNPQKGSFTKEDGEVVINAEGKRV"
FT   CDS_pept        complement(506725..507798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05805"
FT                   /product="ACR3 family arsenite transporter"
FT                   /note="COG0798: Arsenite efflux pump ACR3 and related
FT                   permeases, Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K03325"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05805"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47614"
FT                   /db_xref="GOA:A0A0H3KQV5"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQV5"
FT                   /protein_id="BAG47614.1"
FT                   /translation="MNTSNVAPPGKAVAKPAINFFERYLTVWVALCIVAGIALGQVLPG
FT                   LFQQIGRMEYAQVNLPVGLLIWVMIIPMLVKVDFGALHEVRQHVKGIGVTLIVNWLVKP
FT                   FSMAFLGWLFIRHLFAPMLPADQLDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFAPLVGLLLGMSAITVPWATLLTSVVLYIVIPVILAQIWRKVLLAKG
FT                   QAAFDAAMAKIGPWSIAALLATLVLLFAFQGEAILKQPLVIALLAVPILIQVFFNSALA
FT                   YWLNRAVGEKHNIACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVML
FT                   LVVRIVNQSKGWYECRA"
FT   CDS_pept        complement(507863..508357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC2"
FT                   /locus_tag="BMULJ_05806"
FT                   /product="arsenate reductase"
FT                   /note="COG0394: Protein-tyrosine-phosphatase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03741"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05806"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47615"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQJ9"
FT                   /protein_id="BAG47615.1"
FT                   /translation="MTTNVLILCTHNSARSVLSEGMLNHWAAKLGKDVRAYSAGSAPSG
FT                   RLNPFALEALTNAGVDVDGYRSKSSDEFVGDGAPEMRVVITVCDSAAAETCPYWPGSPV
FT                   NVHWGYADPSNATGGDEGKRLAFELTRQAIGYRMLQLLALPLDRMSNAGLQTALIEISQ
FT                   N"
FT   CDS_pept        complement(508374..508868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="BMULJ_05807"
FT                   /product="protein-tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="COG0394: Protein-tyrosine-phosphatase, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K01104"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05807"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47616"
FT                   /db_xref="GOA:A0A0H3KVA8"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVA8"
FT                   /protein_id="BAG47616.1"
FT                   /translation="MSDKPYNVLFICTGNSARSILSEGLMNQLGNGRFVAFSAGSHPKG
FT                   EVNPFALRELARWHLPTDGYRSKNWDEFAAPGAPTLDFVFTVCDKAAGEVCPIWPGQPI
FT                   IAHWGVPDPAEVEGSDEQKQQAMHDAALTLKRRIDLLLSLPITELDNVALQKSVREIGQ
FT                   Q"
FT   CDS_pept        complement(508878..509357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05808"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0346: Lactoylglutathione lyase and related
FT                   lyases, Mycobacterium tuberculosis CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05808"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47617"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRC9"
FT                   /protein_id="BAG47617.1"
FT                   /translation="MKRLHIHLSVEDLTASIRFYSALFASQPTVEKVDYAKWMLDDPRV
FT                   NFAISQRGAAPGLDHLGVQVENEAELAEMHARLSGAAVPVDEQIGTACCYARSDKYWAV
FT                   DPQGIAWETYQTLGDVPTFGESRNSQSAESNAEASACCSPARGKPIGVPVKSSCC"
FT   CDS_pept        complement(509354..509695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="BMULJ_05809"
FT                   /product="ArsR family transcriptional regulator, ArsR"
FT                   /note="COG0640: Predicted transcriptional regulators,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05809"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47618"
FT                   /db_xref="GOA:A0A0H3KYX3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYX3"
FT                   /protein_id="BAG47618.1"
FT                   /translation="METNSVVRALGALAQESRLAVFRLLVEAGPGGLPAGQIAERLGIA
FT                   PSSLSFHMKELTYANLVTVEQRGRFMIYSANYAAMNDLLGFLTENCCGGNPCTPIGAGG
FT                   CKPSKENAS"
FT   CDS_pept        complement(509840..512329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asoA"
FT                   /locus_tag="BMULJ_05810"
FT                   /product="arsenite oxidase large subunit"
FT                   /EC_number="1.20.9.1"
FT                   /note="COG0243: Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing, Aeropyrum pernix"
FT                   /note="KEGG, K08356"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47619"
FT                   /db_xref="GOA:A0A0H3KQV9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR014066"
FT                   /db_xref="InterPro:IPR041632"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQV9"
FT                   /protein_id="BAG47619.1"
FT                   /translation="MATNKDRVALPPVQAQRTNLTCHFCIVGCGYHVFKWPENVEGGRA
FT                   PNQNALGLDFRTQLPPLSIVMTPAMQNTITDKDGRRYNIMVVPDKTCSVNRGLSSTRGG
FT                   QLAKVMYNPDGGVAKERLRSPRIYLSDQWMDTSWEDALALYAGLTKKILDRDGPSVLAF
FT                   DCFDHGGAGGGFENTWGTGKLMFTALKTPLVRIHNRPAYNSECHATREMGIGELNNSYE
FT                   DAELADVIMAIGCNSYETQTNYFLAHWLPNLQGQTIDKRKQRFPGESVAAAKIIFVDPR
FT                   RTTTVAIAEKVAGKQNVLHLDIEPGTDIALFDGLLTYVVDQGWHDKAFVAEYTSAFDDA
FT                   LKTNRLSLDETSRITGVPVERLKQAAEWAYKPKASGHRPRTMHAYEKGIIWGNDNYLIQ
FT                   SALVDVVLATHNVGRRGTGVVRMGGHQEGYTRPPYPGNMKIYVDQEIIHGKGMMYTAWG
FT                   ANPFQTTLNAEEHRAVILHRAGIVREAMSRERGASTAQLVDVAYDAVKNKGGLFFANIN
FT                   LYPTKLAEAAHLMLPAAHPGEMNLTSMNGERRMRLSERFMDPPGSAMPDCLIAAAIANT
FT                   LKRMYEAEGKSDMAARFAGFDWKTEEDAFNDGFRQAGQAGVGPIDSQGGKTGNLVTYAR
FT                   LRAMGNNGVQLPAKSFEGGKLIGTEMLYMDGKFDTADGKAQFKPAKWTGLPKPVADQKA
FT                   KYKFWINNGRVNEVWQTLYHDQYNEFVRERVPMAFLELNPDDARSLGITSGDVVEVYND
FT                   YGSTYAMAYLEPAIKHGQTFMQFGHFNGIMGNVTTPWTDRNVVPYYKGTWANLRRVGSV
FT                   QDFKETVSFKSRRIDAT"
FT   CDS_pept        complement(512341..512859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asoB"
FT                   /locus_tag="BMULJ_05811"
FT                   /product="arsenite oxidase small subunit"
FT                   /EC_number="1.20.9.1"
FT                   /note="COG0723: Rieske Fe-S protein, Aeropyrum pernix"
FT                   /note="KEGG, K08355"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05811"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47620"
FT                   /db_xref="GOA:A0A0H3KQK3"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014067"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQK3"
FT                   /protein_id="BAG47620.1"
FT                   /translation="MEETMGLNRRQFLKLTGGAAAGVTVAGAPSAQAAQVDAGRTTLPY
FT                   TPKVIARAGQLRPNVPLAFTFPDASSPCAVVKMRTPVPGGVGPDKDIVAFSVLCTHMGC
FT                   PVAYDGTTREFNCPCHFSKFDAEKAGQMISGQATEKLPSIVLDYNASNGTVRAIAVDGL
FT                   IYGRQANLL"
FT   CDS_pept        513740..513934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05812"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05812"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVB1"
FT                   /protein_id="BAG47621.1"
FT                   /translation="MSCSLRDDVLAVFARSCEEGEFEVAEHLLCAIEVIALQSLDFEQL
FT                   DVAYAFLGRSLTNGQTGSH"
FT   CDS_pept        complement(514107..514898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05813"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05813"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47622"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRD3"
FT                   /protein_id="BAG47622.1"
FT                   /translation="MCYSAKIQANYREYVRRYGAEMDIETFRRLFFARAAGSDIKIPKA
FT                   VDAALAGLDDEISGAIAAYRTHRASELESDLFKQRARLAAAEKKLATKVTKAASEDVRI
FT                   ATDKIEAAMRGLDDLRRTDLQERDARIYPGWYAPVLIELEGKRLIVPMRYRCRIPGWTE
FT                   ADERAKPGSYNSRVDSLSTAWRKVFGFTHGLLLVDAFFENVKRDGQNVVLRFDPTPPQQ
FT                   MQVACLWTRTEIPGGDDLWSFAAITDDPPPEVAAAGHDRCV"
FT   CDS_pept        complement(515029..515355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05814"
FT                   /product="histone-like nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05814"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47623"
FT                   /db_xref="GOA:A0A0H3KYX7"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYX7"
FT                   /protein_id="BAG47623.1"
FT                   /translation="MTTELQDLQAQLRDLNIRLADVKKDEKQAYLAGVQERVALYGITE
FT                   DELLRAAGFRKARKRQAQAKYYDPSSGKQWSGFGPRPKWLEGKNLDDYLIERAAKPWWP
FT                   GEDA"
FT   CDS_pept        515520..516200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05815"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05815"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47624"
FT                   /db_xref="GOA:A0A0H3KQW3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQW3"
FT                   /protein_id="BAG47624.1"
FT                   /translation="MSNTVTRAAVLSPCQIRHLLRVTEATSRHPARDAVILLLGMSVGM
FT                   RITEVAQLTVADVMFRSGALRTEVSLRAAITKGCRQRAVYFSSRKLVDAIERYLAFRVT
FT                   HELGTTLDKSRFRGLIPDLPLILSRKRYPYSLNRKKRFSADGQLMDYWAADSLQSYVTS
FT                   LYKAAGIKASSHSGRRTFATRLLGRGATIEQVQLLLGHESIDDTRRYIDVDREVLSRIL
FT                   EEAI"
FT   CDS_pept        516392..516643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05816"
FT                   /product="PemI-like protein"
FT                   /note="KEGG, K07172"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05816"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47625"
FT                   /db_xref="GOA:A0A0H3KQK8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQK8"
FT                   /protein_id="BAG47625.1"
FT                   /translation="MELKIQKWGNSAAVRLPAVLLEQMHASVGGSLNADVRPDGVLLTP
FT                   ARRKYALDELVAQCDAKAPFPADMAAWGEVRPVGREGW"
FT   CDS_pept        516637..516987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05817"
FT                   /product="growth inhibitor PemK-like protein"
FT                   /note="COG2337: Growth inhibitor, Escherichia coli O157:H7"
FT                   /note="KEGG, K07171"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05817"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47626"
FT                   /db_xref="GOA:A0A0H3KVB5"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVB5"
FT                   /protein_id="BAG47626.1"
FT                   /translation="MVKRVKFDRGDIVRVSLNRTIGREQQGDFRPALVLSPAAFNALGV
FT                   ALVAPITQGGEFARFAGFAVPLSGSGTETQGVALVNMVRMLDLEARGARTIERAPAEVV
FT                   EDALARLQSIIE"
FT   CDS_pept        516998..517510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05818"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05818"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRD7"
FT                   /protein_id="BAG47627.1"
FT                   /translation="MQLSDADLRRPPARSSTGTRPLGAILGTVQVPAHVIRLSDQLVGE
FT                   CYTAAEESDFSDQVETFAIPSWAKRDGAPWLPNLAALGYCHADSGYRGRDEQFVATAAV
FT                   DMHTDDEGLVLMVVLHNDGLTFRQGTVRHKPKAGDWFIFDDRLPHGVVEAPGRAAFLGW
FT                   NIPIIPL"
FT   CDS_pept        517561..517758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05819"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYY0"
FT                   /protein_id="BAG47628.1"
FT                   /translation="MQEQMMFDTMRRELSELMQRVKRATEWDTTIACGKVHLDEVSPEA
FT                   LAKHRADTQRIAELMAKYGL"
FT   repeat_region   complement(521978..521981)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(521982..523191)
FT                   /mobile_element_type="insertion sequence: ISBmu2"
FT                   /note="IS5 family"
FT   repeat_region   complement(521982..521997)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   CDS_pept        complement(522113..523105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05820"
FT                   /product="ISBmu2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47629"
FT                   /db_xref="GOA:A0A0H3KT61"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT61"
FT                   /protein_id="BAG47629.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   repeat_region   complement(523176..523191)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   repeat_region   complement(523192..523195)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   repeat_region   523999..524001
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  524002..524915
FT                   /mobile_element_type="insertion sequence: IS402"
FT                   /note="IS5 family"
FT   repeat_region   524002..524018
FT                   /rpt_type=INVERTED
FT                   /note="IS402, terminal inverted repeat"
FT   CDS_pept        join(524089..524442,524442..524906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="BMULJ_05821"
FT                   /product="IS402 transposase"
FT                   /note="IS402 transposase is a fusion between two ORFs,
FT                   (88-441) and (441-905), as suggested by comparison with
FT                   other IS5 family members. At position 441, the sequence
FT                   5'-CAAAAACTGGGCC-3' is a potential site for a -1
FT                   frameshifting."
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05821"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47630"
FT                   /db_xref="GOA:A0A0H3KR69"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR69"
FT                   /protein_id="BAG47630.1"
FT                   /translation="MAKPIIDDELWTLIEPLLPPPKPRREKNPGRLPVSNRAALTGILF
FT                   VLKTGLRWRDLPAEMGCGSGVTCWRRLRDWQAAGVWDRLHELLLAKLRAADQIDFSRAA
FT                   VDSSSIRAVGAGQKTGPNPTDRARPGSKHHIVTDANGTPLAAILTGANVNDVTQLLPLI
FT                   DAIPPIRGLRGHPLQRPRVVYADRGYDSERHRRALRDRGIEPVIAKRRTEHGSGLGKYR
FT                   WVVERTHAWLHHFRRLRIRFERRADIHGAFLKLGCCLICWNTLRRADQSL"
FT   repeat_region   524899..524915
FT                   /rpt_type=INVERTED
FT                   /note="IS402, terminal inverted repeat"
FT   repeat_region   524916..524918
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        525640..526008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05822"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05822"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVB9"
FT                   /protein_id="BAG47631.1"
FT                   /translation="MKLLRTFILLLLCAVLPISGLAASGLTGECPMQQTMSMDADAGMP
FT                   ADAPGCDSMKPSSVDKAKAKGGFCKVTAQCQFGSLYHPAAKADISRPAVFGTPVVFHYI
FT                   QSLPVRDPNGLWRPPRLV"
FT   CDS_pept        526148..527392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05823"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05823"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47632"
FT                   /db_xref="GOA:A0A0H3KRE1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRE1"
FT                   /protein_id="BAG47632.1"
FT                   /translation="MHSLVAALLVAGVAHAQLAPFTLDAALQSATDRSLSMQAAQASVR
FT                   ASSEAAVKAGQLPDPMLKAGIDNLPINGPQRFTIGQDFMTMRRIGIEQEWVSGDKRRLR
FT                   SALADEMVGRERAGYLVQLANVRQQTATTWLNAVYAKQALALQQALLDHMHHEFAATKA
FT                   SYRGAKASAADVVQAQAMLAQTQDQVLKAQQAYQTALIGLSRWTATPVSEVTGEPPAPE
FT                   SFVSSLPLDELRLSQPTLVAAADDIAVAEADTAVASSERSPNWTWEVAYQQRGGAYSNM
FT                   VSVGVTIPLPLNQKNRQNRDVAEKAELATKARLMYDDALRQVQADIRTQSATLASGRER
FT                   IANLSRLLLPAADQRVQLANAAYRAGSGSLADTFAARRAQLEAQLQVLDLKREVSQTWA
FT                   QLEYQVVPSTMAAAQ"
FT   CDS_pept        527404..528933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="BMULJ_05824"
FT                   /product="copper efflux system membrane protein"
FT                   /note="COG0845: Membrane-fusion protein, Ralstonia
FT                   solanacearum"
FT                   /note="CusB protein"
FT                   /note="KEGG, K07798"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05824"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47633"
FT                   /db_xref="GOA:A0A0H3KYY2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYY2"
FT                   /protein_id="BAG47633.1"
FT                   /translation="MTKKPLVRAVLTVFAGAALLGAGYFAGTRHAATPAAAASTVAAWS
FT                   GDKLDPKTGRKVLYWHDPMVPNQHFDKPGKSPFMDMQLEPVYADEGGGSSGIKIDPGLQ
FT                   QNLGIRYTTVRRQDTAGGFDAVGTTQFDESRADVVQSRVTGYIDRLYANAPMQRIAKGA
FT                   PVASLFVPEWLAPQEEYLALQRGGMDASLLEASRARMRAMSIPDGIIASLDRTGKAQTH
FT                   VVLTSPEAGVVSELNVRDGAMVAPGQTLAKIAGLSKLWLIVEIPEALALNVQPGMTVDA
FT                   TFAGDPSQHFAGHIREILPGISTTSRTLQARLEIDNAALKLTPGMLMRVRVAGQKAVSR
FT                   LLVPSEAVITTGKRSVVIVKNGDGRLQPATVTVGNDIGNETEVLSGLNDGDTVVASGQF
FT                   LIDSEASLKSVLPRLEGGTGASAVAPASASAAAAQTYETTGKVEKVTAADITFSHQPVP
FT                   ALGWGAMTMAFNKPAPSAFPNVKAGQTVRFVFKQSDDGYQLTKVEPVGGPQ"
FT   CDS_pept        528930..532136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="BMULJ_05825"
FT                   /product="copper efflux system membrane protein"
FT                   /note="COG3696: Putative silver efflux pump, Ralstonia
FT                   solanacearum"
FT                   /note="CusA protein"
FT                   /note="KEGG, K07787"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05825"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47634"
FT                   /db_xref="GOA:A0A0H3KQX1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQX1"
FT                   /protein_id="BAG47634.1"
FT                   /translation="MIARLIRWSIHNRFLVLLATVLVTGWGLYSVADTPLDALPDLSDT
FT                   QVIIKASYPGKAPQVIEDQVTYPLTTTLLGVPGAKTIRAYSSFGDAFVYVLFDDKTDQY
FT                   WARSRVLEYLNQVQSRLPQGATVSLGPDATGVGWVYEYALVDRTGQHDLGQLRALNDWF
FT                   LKFELKAVPDVSEVASIGGMVRQYQVVLDPDKLRAYGITQAAVADALGKANQASGGSVV
FT                   ELAESEYMVRSSGYLRSLDDFRHVVLRTNDAGTPVLLGDVARIQIGPEMRRGIAELNGQ
FT                   GEVAGGVIVMRSGKNALKTIDAVKAKLADLKRSLPPGVEVVTTYDRSQLIERAVDNLKD
FT                   KLIEEFIIVGLVCAVFLFHLRSAFVAILSLPLGVLAAFIVMRYQGVNANLMSLGGIAIA
FT                   IGAMIDAAIVMIENAHKHLEAFDHQFPDTRMTAAQRWELIATSAAEVGPALFFSLLIIT
FT                   LSFIPVFSLEGQEGKLFSPLAFTKTYTIAAAAGLSVTLVPVLMGYLIRGRIPHENANPI
FT                   NRVLIRLYRPLLEATLRRPWAAIGLAVVALVLTIVPISRLGGEFMPPLDEGDLLYMPTA
FT                   LPGISAGKASELLQQTDRLIKTVPEVATVFGKSGRADTATDPAPLEMFETTIQFKPRSQ
FT                   WRPGMTPEKLVDELDRTVNVPGLSNVWVPPIRNRLDMLSTGIKTPVGVKISGPDLTQID
FT                   RIATQVETAVKAVPGVTSVLAERLNGGRYIDVDIDRLAAARYGLSVADIQSVVSSAVGG
FT                   ENVGEVIAGRERFPINIRYPREIRDSLEKLRELPVVTDRGAQIQLGDVAHITIADGPPM
FT                   IRSENARLSGYVYVDIRNTDLQSAVKAMQTVVAHQVQLPPGYSIAWSGQFEYLERATAK
FT                   LSTVIPVTLVVIFVLLFLTFNSAADALLLMSTVPFALVGGFWLIWTLGHAVSVATSVGF
FT                   IALAGVAAEFGVVMLLYLKGALSRRLEGGEPLTEPLLFDAIREGAVLRVRPKAMTVAVV
FT                   LAGLIPIMVGHGAGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAWFLLQRRRARQANAAR
FT                   FPHAVPFGTKVPVNPTGEVQ"
FT   CDS_pept        532133..532483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05826"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05826"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47635"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQL6"
FT                   /protein_id="BAG47635.1"
FT                   /translation="MKTLIVTSAVLAAVFAMPAFAGKDMASMDMPTQAPAMKVSSSNAL
FT                   TDAEVKKVDAATGMVTLKHGALENVGMPPMTMAFKAKDLAMVKQIKEGDKVKVRVEEVN
FT                   GTLTIVKLEKRS"
FT   CDS_pept        532658..532984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05827"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05827"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47636"
FT                   /db_xref="GOA:A0A0H3KVC3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVC3"
FT                   /protein_id="BAG47636.1"
FT                   /translation="MERKCVIAVLRPDVLAVLERRLGALHIHGMTVTNARGFGAHPNLF
FT                   ANDWTTEHIKIEIFTAAENVDALIEEIVTVANEQSGGDGVVAVVPVERFLRVRTATEAT
FT                   HDQT"
FT   CDS_pept        533290..536229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05828"
FT                   /product="ISBmu19 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05828"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47637"
FT                   /db_xref="GOA:A0A0H3KRE6"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRE6"
FT                   /protein_id="BAG47637.1"
FT                   /translation="MDHWRLAYLGMRHFPHELTEFELNTFFTFSARERALIDGRRSHLY
FT                   RLAVGLHLGFVRMTGRTLDAYKQVPKRLWHHLGEQLGIEPPDLGTLRALYDDRTDTLAD
FT                   HQKLAYKALGFRPMAEHQRRYVVRWLKERLSGRQDRSTALYDLKQWFYDHRVLIVQDRV
FT                   LRTLIVQAVQDVETALTNRLEASFGTATLDQWGVLLPRPEASGASLQQWLWSVPLRNST
FT                   NQMGDLFRKIERLTKLGVHDHWPAECNEAVVRHYARRCANRPPSVSKRIRQPVRRLEAA
FT                   CFVRYALCVATDQLLWMLSRWQRKIVNEARAKVDAARPDLKALLHHFATEVKALAVDTC
FT                   LSRDALAERLVELADTTLAQGGPSRASLVRAQLLTKQRVARAMLAKLLTLPFESQAPHP
FT                   VIGALEVLRTLYVCHVRELPTDVPVQLGRAWQAVVEGDDRANALLAFEWATLSALRVAL
FT                   RNGSVFVGHSFAFRSQATLLIPDAIWQAQRNHYYGHLKLPQDPEEFLAPVCEHLNEGLE
FT                   RLQQASVHGEVRVDRAIHLDAASAQRAEPAIEALRRAIFGTHPDGQLPRIILEIDSETR
FT                   FSWLLLGREPRSRIELLMVYAAVLAHGTSMSAAEVARMVPELSSGAIRQMMHRVADERV
FT                   LRQAADAVLEFMHRHPIGEHWGRADLASSDMMSLETTRTVWQARADPRRRTASIGIYTH
FT                   VRDRWGIFYDQPIILNERQAGAAIEGVIRQEGTDDVAQLAVDTHGYTDFAMGLARALGF
FT                   DLCPRLAHLRDRRLHVPVGFAVPDGLSAVVDCDVRLEAIGGIWDDFVRVVASVQSGHCT
FT                   AVQALTRFGSAARGQPLYDGGVALGRLFRTIFLIDYFTMPAFRTELQHVLNRGEALHTV
FT                   QRAIHQGKIPAELTRHRHSIMAVSSALSLLTNAVLAWNTMHMQQAVDRIETLGQLPVRP
FT                   EYLRRIAPTFLEGINLRGTFDFPVADFADRLMPSVAISEPVRGSHQARG"
FT   mobile_element  533290..536229
FT                   /mobile_element_type="insertion sequence: ISBmu19"
FT                   /note="Tn3 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        536544..537074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05829"
FT                   /product="conserved secreted protein"
FT                   /note="contains internal repeats"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05829"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYY4"
FT                   /protein_id="BAG47638.1"
FT                   /translation="MKKLVVAVIAGLALSGQLLPASAAAQGTQTKKATPAQVPNTAEFD
FT                   KQLAQVQEQMKAMQAQMDQIRQTQDPQERQRLLQQHWATMQSAMNAMHGLWGPGMMGGP
FT                   GMMGGPGMMGGAGPGCCGGGWGHMGGYYSNLTPEQLRRRQYMSDQYLNMQQQMMNNMMW
FT                   NQQYWMGPPASSK"
FT   CDS_pept        537252..537947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05830"
FT                   /product="cytochrome c553"
FT                   /note="COG2863: Cytochrome c553, Neisseria meningitidis
FT                   Z2491"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05830"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47639"
FT                   /db_xref="GOA:A0A0H3KQX5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQX5"
FT                   /protein_id="BAG47639.1"
FT                   /translation="MKRGSMFRLSAPILFAGFGAPFALGQIPPGPPGQPNFQSSGPAIN
FT                   DADRGARLAASKCAACHGADGNSTNAQYPKLAGQKAAYLYSQLWAFKDGYRRSEVMSGI
FT                   AATLSNADIADAVSFFSQQSVHPDPVKDPRLRADGERIFLYGARSGRVPACAMCHGSTS
FT                   QAGMPMMGMMPMMANVPSLNGQHSAYIVDQLNRFASGERQAMMMGGIAAALSDSDKKAI
FT                   AEFLSNLPR"
FT   CDS_pept        538016..538402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05831"
FT                   /product="hypothetical protein"
FT                   /note="COG3439: Uncharacterized conserved protein,
FT                   Methanosarcina acetivorans str.C2A"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05831"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47640"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQL9"
FT                   /protein_id="BAG47640.1"
FT                   /translation="MNYYFAKTLPIDFDDAVRRTTEVLKAEGFGIVTEIDIQDTLKRKI
FT                   NIDFRRYRILGACNPVLAHEALQIEDKVGTMLPCNVVVQDIGGGRTEVAAIDPVASMQA
FT                   IDNPRLKDAAARVQAKLRRVIEGL"
FT   CDS_pept        539420..539926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asoB"
FT                   /locus_tag="BMULJ_05832"
FT                   /product="arsenite oxidase small subunit"
FT                   /EC_number="1.20.9.1"
FT                   /note="KEGG, K08355"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05832"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47641"
FT                   /db_xref="GOA:A0A0H3KVC7"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014067"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVC7"
FT                   /protein_id="BAG47641.1"
FT                   /translation="MSLNRRQFLKLTGGAATAATVAGAPSARAAQADAGRTTLPYTPKV
FT                   IVRAGQLRENVPLAFTFPDASSPCAVVKMGTPVPGGVGPQRDIVAFSVLCTHMGCPVSY
FT                   DAATREFKCPCHFSTFDAEKAGQMVSGQATEKLPAIVLDYNASDGTVRAIAVDGLIYGR
FT                   QANLL"
FT   CDS_pept        539938..542427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asoA"
FT                   /locus_tag="BMULJ_05833"
FT                   /product="arsenite oxidase large subunit"
FT                   /EC_number="1.20.9.1"
FT                   /note="KEGG, K08356"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05833"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47642"
FT                   /db_xref="GOA:A0A0H3KRE9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR014066"
FT                   /db_xref="InterPro:IPR041632"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRE9"
FT                   /protein_id="BAG47642.1"
FT                   /translation="MATNKDRVALPPVQAQRTNLTCHFCIVGCGYHVFKWPENTEGGRA
FT                   PNQNALGLDFRKQLPPLSIVMTPAMQNTITDKDGRRYNIMVVPDKACSVNRGLSSTRGG
FT                   QLAKVMYSPDGGVAKERLRSPRVYLADQWMDTSWDDALALYAGLAKKILDRDGPSGLAF
FT                   DCFDHGGAGGGFENTWGTGKLMFTALKTPLVRIHNRPAYNSECHATREMGIGELNNSYE
FT                   DAELADVIMAIGCNSYETQTNYFLAHWMPNLQGQTLDKRKQRFPGESIEAARIIFVDPR
FT                   RTTTVAIAEHIAGKQNVLHLDIEPGTDIALFDGLLTYVVDQGWHDKAFIAAYTNGFDDA
FT                   VRTNRLSLDETSRITGVSVERLKQAADWAYKPKASGHRPRTMHAYEKGIIWGNDNYLIQ
FT                   SALVDVVLATHNVGRRGTGVVRMGGHQEGYTRPPYPGNTKIYVDQEIIHGKGMMYTAWG
FT                   ANPFQTTLNAEEHRAVILHRAGIVREAMSRERGASTAQLVDVAYDAVKNKGGLFFTNIN
FT                   LYPTKLAEAAHLMLPAAHPGEMNLTSMNGERRMRLSERFMDPPGSALPDCLIAAAIANT
FT                   LKQMYEAEGKHDMAARFGGFDWKTEEDAFNDGFRQAGQAGVGPIDSQGGKTGNLVTYAR
FT                   LRAMGNNGVQLPAKSYEGGKLIGTEMLYTDGKFDTADGKAQFKPAKWTGLPKPVADQKA
FT                   KYRFWINNGRVNEVWQTLYHDQYNEFVRERVPMAFLELNPDDAHSLDITSGDVVEVFND
FT                   YGSTYAMAYLEPSIKRGQTFMQFGHFNGIMGNVTTPWTDRNVVPYYKGTWANLRRVGDV
FT                   QDFKETVSFKSRRIDVT"
FT   CDS_pept        complement(542540..543325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="BMULJ_05834"
FT                   /product="phosphate transport system substrate-binding
FT                   protein"
FT                   /note="KEGG, K02040"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05834"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47643"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYY7"
FT                   /protein_id="BAG47643.1"
FT                   /translation="MRLKRLILSAAIALVATQSLSALADTVDVRGSTTVNSVLITPYAA
FT                   DIERLSGQKLKVTASNSGEGLTDLIGFSADIAMTSAPFKDVAEQLGKTPNLKGLKIDQN
FT                   EFNVVNLGHAEVLFIVNPSNKVAHLSQSQLVGLLTGKIANWKEIGGADQPVIRVSEQST
FT                   GAMRTEINRNLLDGKDFPTATKVVDLASQIPAVVAATPGAIGFMSSALPASQRADVRVI
FT                   PNDSKIEQTLFVITRPHPDANVESVISAIKGVASKALTH"
FT   CDS_pept        543537..543899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05835"
FT                   /product="ArsR family transcriptional regulator"
FT                   /note="COG0640: Predicted transcriptional regulators,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05835"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47644"
FT                   /db_xref="GOA:A0A0H3KQY0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQY0"
FT                   /protein_id="BAG47644.1"
FT                   /translation="MDKSTATTVFESLSSGVRLDVFRLLVRKGEEGMVAGDIRVALDIP
FT                   PTNLSFHLKAMTHAGLIHATQEGRFLRYRANLGMMIDLVAYLTEECCGGQPDRCGDFDV
FT                   HAICPECTDQHELDGQ"
FT   CDS_pept        544087..544428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05836"
FT                   /product="ArsR family transcriptional regulator"
FT                   /note="COG0640: Predicted transcriptional regulators,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05836"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47645"
FT                   /db_xref="GOA:A0A0H3KQM3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQM3"
FT                   /protein_id="BAG47645.1"
FT                   /translation="METNFVVRALGALAQESRLAVFRLLVEAGPGGMPAGQIAERLGIA
FT                   PSSLSFHMKELTYSNLVTVEQRGRFMIYSANYATMNGLLGFLTENCCGGNPCTPVRPNA
FT                   CKTSQKDES"
FT   CDS_pept        544638..545132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="BMULJ_05837"
FT                   /product="protein-tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="COG0394: Protein-tyrosine-phosphatase, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K01104"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05837"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47646"
FT                   /db_xref="GOA:A0A0H3KVD2"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVD2"
FT                   /protein_id="BAG47646.1"
FT                   /translation="MSDKRYNVLFVCTGNSARSILSEALMNQLGEGRFVAYSAGSHPKG
FT                   EVNPFALRELERWHLPTDGYRSKSWDEFAQSDAPTLDFVFTVCDKAAGEVCPVWPGQPM
FT                   TAHWGVPDPAEVEGSDERKQQVMHEVALTLKRRIDLLLSVPIAKLDNVALQKAVRDIGQ
FT                   Q"
FT   CDS_pept        545143..545637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC2"
FT                   /locus_tag="BMULJ_05838"
FT                   /product="arsenate reductase"
FT                   /note="COG0394: Protein-tyrosine-phosphatase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03741"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05838"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47647"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRF4"
FT                   /protein_id="BAG47647.1"
FT                   /translation="MTTNVLILCTHNSARSVLAEGMLNHWARKLDKDVRAYSAGSAPSG
FT                   RLNPFALEALTGAGVDVSGYRSKSWDEFVGDGAPEMHVVVTVCDSAASETCPYWPGSPV
FT                   KVHWGYADPSNAVGGDEGKRLAFELTRQAIGYRMLQLLMLPLDRLDHAALQRALTEISQ
FT                   N"
FT   CDS_pept        545712..546782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05839"
FT                   /product="ACR3 family arsenite transporter"
FT                   /note="COG0798: Arsenite efflux pump ACR3 and related
FT                   permeases, Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K03325"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05839"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47648"
FT                   /db_xref="GOA:A0A0H3KYZ1"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYZ1"
FT                   /protein_id="BAG47648.1"
FT                   /translation="MNTSNVAPQGKAVAKPAINFFERYLTVWVALCIVVGIALGQALPD
FT                   LFQRIGRLEYAQVNLPVGLLIWVMIIPMLVKVDFGALHEVRQHIKGIGVTLVVNWLVKP
FT                   FSMAFLGWLFIRHVFAPMLPADQLDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFAPLVGLLLGISAITVPWATLVTSVVLYIVIPVILAQILRKALLSKG
FT                   QAAFDAAMAKIGPWSITALLATLVLLFAFQGEAILKQPLVIALLAVPILIQVFFNSALA
FT                   YWLNRAVGEKHNIACPSALIGASNFFELAVAAAISLFGFNSGAALATVVGVLIEVPVML
FT                   LVVRIVNQSKGWYECA"
FT   CDS_pept        546803..547225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC1"
FT                   /locus_tag="BMULJ_05840"
FT                   /product="arsenate reductase"
FT                   /note="COG1393: Arsenate reductase and related proteins,
FT                   glutaredoxin family, Mesorhizobium loti"
FT                   /note="KEGG, K00537"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05840"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47649"
FT                   /db_xref="GOA:A0A0H3KQY5"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQY5"
FT                   /protein_id="BAG47649.1"
FT                   /translation="MTDITIYHNPNCGTSRNTLAMIRNSGAEPRVVHYLETPPSRGELV
FT                   DLIAAMGVPVRDVLRRKGTPYDELDLDNAKWSDADLIGFMLDHPILINRPIVVTPLGTR
FT                   LCRPSETVLDLLPNPQTGPFTKEDGEVVIDAEGKRV"
FT   CDS_pept        547218..547940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05841"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /note="COG0431: Predicted flavoprotein, Sinorhizobium
FT                   meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05841"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47650"
FT                   /db_xref="GOA:A0A0H3KQM7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQM7"
FT                   /protein_id="BAG47650.1"
FT                   /translation="MSDHLNDLPQVDATLFRVPEASQLRTPAPSTHPPRFLLLYGSLRE
FT                   RSFSRLLIEEAARLLTAMGGEVRVFNPSGLPLPDDAPESHPKVVELRELVQWSEGMVWC
FT                   SPERHGAMTGIMKSQIDWIPLSVGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRVLGRWM
FT                   RMLTIPNQSSVAKAFMEFDDVGRMKPSAYFDRVVDVMEELVKFTLLTRDIGAYLVDRYS
FT                   ERKESAEELARRVNQSNI"
FT   CDS_pept        548109..548477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05842"
FT                   /product="putative SOS-response transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05842"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47651"
FT                   /db_xref="GOA:A0A0H3KVD7"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVD7"
FT                   /protein_id="BAG47651.1"
FT                   /translation="MKKLEVFDPAMCCSTGVCGVDVDPVLAQFAADLKWVEAHGVTVAR
FT                   YNLGQAPEAFAANAAVVKEMEAGMDRLPILVVDGHIVSTGMYPSRQQLTQKLGITLATG
FT                   EKPHVKAGSCCSPGSGCC"
FT   CDS_pept        548487..550250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA"
FT                   /locus_tag="BMULJ_05843"
FT                   /product="arsenite-transporting ATPase"
FT                   /EC_number="3.6.3.16"
FT                   /note="COG0003: Oxyanion-translocating ATPase, Listeria
FT                   innocua"
FT                   /note="KEGG, K01551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05843"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47652"
FT                   /db_xref="GOA:A0A0H3KRF9"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRF9"
FT                   /protein_id="BAG47652.1"
FT                   /translation="MSLPDTQTRYLFFTGKGGVGKTSLSCATGLAMADAGKKVLIVSTD
FT                   PASNLDEVLGVGLSQLPTAVPGAPGLFALNIDPEAAAHAYRERMVGPYRGILPTAAIRN
FT                   MEEQFSGACTVEIAAFDEFSKLLGDPAVTADFDHVIFDTAPTGHTLRLLTLPSAWNEFI
FT                   SSSTGGASCLGPLAGLEKQKALYAATVERLSSATETTVVLVSRPEVAALREANRTRHEL
FT                   AELGVRNQMLAINGLFATDRHDDAIATAMAERAQQALADMPRELAGLPQTRIPFLPRGT
FT                   VGLDALRDMAQPERVRMPSDCRMPETTLPPGLGGLVDELSIVGHGVIMTMGKGGVGKTT
FT                   VAAAIAVALAQRGHDVILSTTDPAAHVAATIDGVVPGLTVTRIDPAHEVRQYTEEVLAK
FT                   AGTALDAGGRAMLEEDLRSPCTEEIAVFRAFARAVDQGKSGFVVLDTAPTGHTILLLDA
FT                   AEAYHREVMRTQGDMPESVRQLLPRLRDPDYTRILIVTLPEATPVHEAERLRADLARAG
FT                   IEPYAWVINQSLLASGTTDPLLCQRGTYEVPFVRRVADDLAPRTALIPWLAEAPVGEAG
FT                   LEQVITSRMNT"
FT   CDS_pept        550270..550680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05844"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05844"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47653"
FT                   /db_xref="InterPro:IPR021219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYZ4"
FT                   /protein_id="BAG47653.1"
FT                   /translation="MKALPILWQRLVTSGKTCPRCADTGEEVNRAIRQLREILLPLGIE
FT                   PVLERREIDEATFKATPAESNRIWIAGKPMEAWLNGTVGSSRCCSVCGDTECRTVEVEG
FT                   ASYEVIPEALLVKAGLIAALTLNAQGSKQDPS"
FT   CDS_pept        550699..551808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05845"
FT                   /product="putative flavoprotein"
FT                   /note="COG2072: Predicted flavoprotein involved in K+
FT                   transport, Corynebacterium glutamicum"
FT                   /note="KEGG, K07222"
FT                   /note="involved in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05845"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47654"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQZ0"
FT                   /protein_id="BAG47654.1"
FT                   /translation="MPTHVDVVVIGGGQAGLATAYFLRRAGIDYIVLDDQSAPGGAWRH
FT                   TWESLHLFSPAEWSSLPGWQMPTSQDTYPSRNDVIDYLVNYEHRYHLPVQRSVHVEAVS
FT                   RTREGLLVTTDRGEWLAQAVVSAAGTWSAPYIPDYPGRELFRGRQVHSAQYRNPDDLRG
FT                   QNVLVVGGGNSGAQILAEISTVCNATWVTLHEPVFLPDDVDGRILFERATAKWKALRDG
FT                   QATGVAVGGLGDVVMVPPVRDARARGVLHAVRPFARFDADGVVWADGTHSRVDAVIWCT
FT                   GFRPALGHLDALQIRDADGLVATDGTRARDEPRLWLVGYGEWCGAASATLIGVMRSARD
FT                   TVREIAEYLRPTQEQVASAPPSMSGGGVH"
FT   CDS_pept        552269..552436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05846"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05846"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQN1"
FT                   /protein_id="BAG47655.1"
FT                   /translation="MLDTDKAPIERVLRIRNEQRATTPTHRYLDTADKRNRFRFEGLKS
FT                   PISAVPRTES"
FT   CDS_pept        complement(552433..553905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05847"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05847"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47656"
FT                   /db_xref="GOA:A0A0H3KVE0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVE0"
FT                   /protein_id="BAG47656.1"
FT                   /translation="MSFADWIDIGATPPQRLPGEADAVTAYLTDALGHVVYTRWTLATV
FT                   KQRYPSLAEAKAAKPAVMRLLLDQSTAVEYWDRGRARAVPATEAPAPETIVERVLRAHA
FT                   RRFKRDPGDVSTSTIGEGKQESLLVAGLSGTLLQWVARAGRYANPGSATNTLGVGDDAQ
FT                   AIVLFLRDRGSRSTHTTRAYVTEICRLAAWCIAHELGPFSDLTRHDLLAYRRALHHPAR
FT                   DVNEDDARSLTAASQARALAVVASLFRYWTETGYLTANPAAGLVRGQRRHVGLASSRIL
FT                   TAAQLAACDAKVNEVMADIDPVVAARRRAIWMLYRYAGVRLVELVWSDDQKLPVAEVES
FT                   DGRWTLHVYGKGQKTRAIPLPQGCVSVLQAYRQLRGLPAHPESGERVALIHGLKGGSLQ
FT                   SSGLYDEVKAIFVAAAATLEYTDPGGAATLRRASPHWLRHAYARTLVVDRQVPLPAAQA
FT                   LLGHASIQTTAAYAKTDLSQLRAFVDRAFSSD"
FT   CDS_pept        complement(553948..554898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05848"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05848"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47657"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRG4"
FT                   /protein_id="BAG47657.1"
FT                   /translation="MPRPATTTPDQIRSTVLAMLAEAGDATPATGARFRKLVSVRKLRA
FT                   RLGAGDPATLSRALNAIEAEVVRSGLSEIAIPGLPPEIAEQMHALWQAAVAVQLDDVVR
FT                   LKREAQEAIDAAEAARTDAEMRVELLRQEITELRSALTARDAELADVRAQHALVHERCA
FT                   TLDAAAVERQAALDAAVTKHAELDRAHVEALAAAQHRYEALSKQLLQETAHQREALKKE
FT                   HAQSASQLKFAERRIAALEAERDRLDGELAHEREARQQAVGEALALKAVNAQQHAQLGD
FT                   LLRDIAPKPSRATTHTGLASAKRTASGTAAKRKSK"
FT   CDS_pept        555470..555700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05849"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05849"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYZ8"
FT                   /protein_id="BAG47658.1"
FT                   /translation="MTKSGRPNPDLLPDGDYWATCRERNEMSAAINGHSAVFPQARMTV
FT                   AKGWAVFYRNGEEVWTCNARYAAANFNIQKA"
FT   mobile_element  555726..556896
FT                   /mobile_element_type="insertion sequence: ISBmu8"
FT                   /note="IS630 family, no target site duplication has been
FT                   identified."
FT   repeat_region   555726..555760
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu8, terminal inverted repeat"
FT   CDS_pept        555798..556883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05850"
FT                   /product="ISBmu8 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47659"
FT                   /db_xref="GOA:A0A0H3KQZ5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQZ5"
FT                   /protein_id="BAG47659.1"
FT                   /translation="MRIAAKVELSEAQRKQLKTWATGRTIPVRLAERAKMILLAAQGKT
FT                   DKEISADLAIWRGTVARWRARFIADGVTGIERDETRPGRKPKISARKVKTVVALTTQQR
FT                   PDNATHWSTRSMAAVAGISEASVRRIWQAHGLKPHRLESFKVSNDKHFAEKLEDIVGLY
FT                   LDPPEHALVLCCDEKSQIQALDRTQPGLPLKRGRAQTMTHDYKRHGVTTLFAAMNTLDG
FT                   SVIGQCQTKHRHQEWLSFLRKIDRNTPKDKELHLIADNYATHKHPEVQAWLAKHPRFHM
FT                   HFTPTSASWLNMVERFFRDLSVNQLRRAAFRSVPELVSTIEQYVQKHNRHPKPFIWTAK
FT                   ASDILAKVTRARAKLNKMQSV"
FT   repeat_region   556865..556896
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu8, terminal inverted repeat"
FT   CDS_pept        558181..560139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05851"
FT                   /product="hypothetical protein"
FT                   /note="COG2865: Predicted transcriptional regulator
FT                   containing an HTH domain and an uncharacterized domain
FT                   shared with the mammalian protein Schlafen, Fusobacterium
FT                   nucleatum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05851"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47660"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQN8"
FT                   /protein_id="BAG47660.1"
FT                   /translation="MTKYTTEDLLALGESVDVEFKRAGGRDGKGEVPKEFWPTYSAMAN
FT                   TEGGEILLGVEELKPTGIRPHNLANAAAMRQDIFNLVNNRQKVSANLLRDDDVQTIHID
FT                   HCTLLRVRVPRASRKQRPIYVGENPLRGTYERRHEGDFLVDEAKVRQMLAEQSDAPRDA
FT                   TILAHYGIEDLDLETVQAYRQIFASRVPTHPFIAQSLPDFLRAIQAWKKDRESGAEGLT
FT                   TAGLLMFGKLNSILDAVPNYIVDYQERPEARTEARWIDRLTTDSTWSGNLFDFYRKVLA
FT                   KLTSDLKMPFRLEGDVVRQGVTPIHEALQEALVNALVHADFSGRVSILVVKRPDMYGFR
FT                   NPGLMRVPIEQAIRGGDSDCRNRLIQKMFQLVGAGDQAGSGVPRIFGVWKEQSWRMPVV
FT                   HEKREPEQTLFELRMASLLPVEMVAQLEATHGAKFAELSALEKLIVVTASVEGYVDHKR
FT                   IREITDEHPADITKTLSKLSREGLLSATGHGRGTVYFDTRQLDELLADAEAEVFAAPAG
FT                   GLSTRPLAEVFAPERVAPQPPNLDSGGLGASSEGFEPSSEGLISLPTASLDGARLVVLS
FT                   RYPGGLPGKMKPEALRELILELCAIEALSLRDLAALHDRSPDFIRIQYIRPLVVEGLIV
FT                   PEFPDRPRHPAQRYRRI"
FT   CDS_pept        560938..561252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relE"
FT                   /locus_tag="BMULJ_05852"
FT                   /product="cytotoxic translational repressor of
FT                   toxin-antitoxin stability system"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05852"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47661"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVE5"
FT                   /protein_id="BAG47661.1"
FT                   /translation="MYTIIETPIFQRYADEIWRNDEREAFINWLADNPLAGDVIPGTSG
FT                   LRKVRWSRAGMGKRGGSRVIYYNLLDDGEIWLLIAYTKAKFDNLPTSFLNQLREEIDRG
FT                   "
FT   CDS_pept        561245..561532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05853"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG, K07726"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05853"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47662"
FT                   /db_xref="GOA:A0A0H3KRG9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRG9"
FT                   /protein_id="BAG47662.1"
FT                   /translation="MDKELEQFQADLLESARQMKAGVAGRVTRVQPTEASIARAKVGMS
FT                   QSEFAGLLGVSVRTYQQWEQGRRNPTGAAQTLLRVAVQHPEALKDLQAAG"
FT   CDS_pept        complement(561877..562203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05854"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05854"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ02"
FT                   /protein_id="BAG47663.1"
FT                   /translation="MTDTLRLSAFALPPTFPPESVPDACTCFVRECVPGLTKRQLLART
FT                   RARGWAPAWRPLAHLVREGFEAFAFDLIVDGTRVPVIAWMQRAGKDVGCVSVATRDPRQ
FT                   LPLF"
FT   CDS_pept        complement(562643..562939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05855"
FT                   /product="putative histone-like nucleoid-structuring
FT                   protein H-NS"
FT                   /note="COG2916: DNA-binding protein H-NS, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05855"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47664"
FT                   /db_xref="GOA:A0A0H3KR01"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR01"
FT                   /protein_id="BAG47664.1"
FT                   /translation="MATYLELKAQAEALAQQAEEARIAELESIIATIREQIAEYGITPE
FT                   QLFGRRRAPASGTRAPVAPKYRDPKTGATWSGRGKAPHWIANAKNRDRFLIEQ"
FT   repeat_region   complement(563819..563823)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(563824..566432)
FT                   /mobile_element_type="insertion sequence: ISBmu1a"
FT                   /note="IS21 family"
FT   repeat_region   complement(563824..563873)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu1, terminal inverted repeat"
FT   CDS_pept        complement(563909..564697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05856"
FT                   /product="ISBmu1a transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05856"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47665"
FT                   /db_xref="GOA:A0A0H3KQP3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQP3"
FT                   /protein_id="BAG47665.1"
FT                   /translation="MNPSPELNSILKQLRLSGILDSLEQRNRQAIDGQLAYTEFLAMLL
FT                   HDEVARREHKKLGTRLLRAGFAMGKTLETFDFDRLPTLNRSHVHDLATGRYLDEKVAIL
FT                   IAGPTGTGKSHLAQALGHCAARQGRDVLFISQTELLKRLNAARATGAYDRKFQQYARVP
FT                   LLIVDDFALKPLRTPQDEDFHDLVAARYEHAATILTSNLDFGEWGAAFPDNRILGTATL
FT                   DRLRHGAYRLVLEGDSYRTPKPMPDPPQNAVAKNGKKPQP"
FT   CDS_pept        complement(564702..566234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05857"
FT                   /product="ISBmu1a transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05857"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47666"
FT                   /db_xref="GOA:A0A0H3KVF0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVF0"
FT                   /protein_id="BAG47666.1"
FT                   /translation="MANRRFELFEYRQVLVRMRQGDSDRDIARGGLMGRKKLTTVRREA
FT                   EARSWLDPVQPLPDDATIAGVFGRTPHLPHTCVSTVEPYREQVREWLAAGVQGTTIHAA
FT                   LQRNHGYAGSYCAVKRMLRHLAAERSVATTTILDFAPADAAQVDFGAGPVLTVEGIAVR
FT                   TWIFVMTLCWSRHQYAEIVLDQTVETWLASHRRAFEWFGGCPDRVIIDNAKCAIIRACR
FT                   YEPAVQRSYAALAEGYGFRIDACPPHDPQKKGVVESGVKYVKKSFVPLREFRDLADANR
FT                   QLREWVMQQAGTRIHGTVHERPLTRFGVERPLLAALPDVPPVLSVWKEVAVHRDGHVVY
FT                   KHALYSAPFTLVGKSLWLKATDTVIQLFHRHELVATHPRQRAGGRHTVRDHQPPEAQAW
FT                   LEHDPQWCLARAKEIGPSCHGVILALFNDKVLVNLRGAQGIIRLRQKVGDQRLEAACER
FT                   ALAFSSAKYSTIKGILDKGLDSEPVPRPASAPTGAYQNGGRFGRDLQSLLIH"
FT   repeat_region   complement(566382..566432)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu1, terminal inverted repeat"
FT   mobile_element  566433..568037
FT                   /mobile_element_type="insertion sequence: ISBmu11"
FT                   /note="IS3 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   repeat_region   complement(566433..566437)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        566764..567978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05858"
FT                   /product="ISBmu11 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05858"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47667"
FT                   /db_xref="GOA:A0A0H3KQT0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQT0"
FT                   /protein_id="BAG47667.1"
FT                   /translation="MVGKAGRPAVSLATRQLAVYELCTREGSAQAVAQKLDVDRVSLYN
FT                   WKNQLLGRGAPASMKRDKGSPSETDRDELERQVEELRRDIRNLKLEHDLLKKANELVKK
FT                   DLGVDLSLLSNREKTTLVDALREEYGLTELLERLDLARSSYFYHRSPIRVADKYADVRR
FT                   TVAEIFEDNHRSYGYRRVQAALSRQRVFLSEKVVRRLMKQGGLHAARPKRRRYRSYIGE
FT                   ISPAPDNIINRDFHANAPNEKWVTDISEFQIPAGKVYLSPMIDCFDGMVVSWSIGTSPD
FT                   AELVNSMLDAAIETVTEDDETPIVHSDRGGHYRWPGWLSRVAKAKLIRSMSRKACSPDN
FT                   AACEGFFGRLKTEMFYPGDWRSTTIAEFVEVLDAYVRWYNEKRIKGSLGYLSPIEYRES
FT                   LGLAT"
FT   CDS_pept        complement(568376..568678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05859"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05859"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47668"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ06"
FT                   /protein_id="BAG47668.1"
FT                   /translation="MTKLALFVRLEAKPGQEAALADFLASALPLANAESGTTAWFALKF
FT                   GPSTFGVFDAFADEAGRQAHLNGQIAAALMANAATLLSSPPNIEKVELLAAKLPA"
FT   CDS_pept        568742..569755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05860"
FT                   /product="AraC subfamily transcriptional regulator"
FT                   /note="COG4977: Transcriptional regulator containing an
FT                   amidase domain and an AraC-type DNA-binding HTH domain,
FT                   Agrobacterium tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47669"
FT                   /db_xref="GOA:A0A0H3KR06"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR06"
FT                   /protein_id="BAG47669.1"
FT                   /translation="MTAIPIDNNDNFDIIVAMKLHILVCDGVFDLGLAALTDTVGLANA
FT                   MSGSLPQAPSRIELTLVGVRRRIRTAQGLTVPVLPVRGVPEPDVVLVPAFGDKMPDTLS
FT                   ARLTRPDLPDAVAALKQWSTAGAHLGAACSGSFLLAESGLLDGHRATTSWWLGPMFRQR
FT                   YPNVTLDESRMIVNSTRFTTAGAALAHVDLALRIIRGRSPALAALVARYLLVETRSSQA
FT                   EFVIPDHLAHADPMVERFECWARRRLAQGFSLAEAASAAGTSERTLARRLQSVLGKTPL
FT                   SYFQDLRVEHAVHLLRTGNASVDQVAAQVGYSDGVTLRALLRRKLGRGVRELRRGG"
FT   repeat_region   complement(570470..570476)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(570476..571633)
FT                   /mobile_element_type="insertion sequence: ISBmu20"
FT                   /note="IS5 family"
FT   repeat_region   complement(570476..570486)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu20, terminal inverted repeat"
FT   CDS_pept        complement(570603..571565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05861"
FT                   /product="ISBmu20 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05861"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47670"
FT                   /db_xref="GOA:A0A0H3KQP9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQP9"
FT                   /protein_id="BAG47670.1"
FT                   /translation="MKQSSLGLGTSTKRTRRREFLDEMDRVVPWSDLVAQIAPFMPEGK
FT                   RGRPPFPVESLLRIHFMQQWFTLSDPAMEDALHDMPLFRDFAGLGGWDDRLPDESTILR
FT                   FPHVLEKHKLAERILATVNLLLGAKGLMLRSGTVVDATLISAPSSTKNASGERDPEMHQ
FT                   SKKGQQWFFGMKAHIGVDADSGLVHTVRGTSGNVNDVVEANSLLHGQETDAFADAGYQG
FT                   AHKRPDAKEDVQWHVAMRPGLRKLLDKADPADALTEQVERIKASIRAKVEHPFRVIKRQ
FT                   FGHVKVRYRGLAKNTAQLHTLFALANLWMVRKRLTGSLA"
FT   repeat_region   complement(571623..571633)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu20, terminal inverted repeat"
FT   repeat_region   complement(571632..571638)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        571648..571941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05862"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05862"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47671"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVF5"
FT                   /protein_id="BAG47671.1"
FT                   /translation="MMYMPIIVVASITLQPGSRESAEAALRKAVARSRKEPGCDQYQLH
FT                   EDTEQPDRLVMIERWRDEAALQDHLEGPVFRELSETLEGHITLDVMKLSLLA"
FT   CDS_pept        complement(571997..572920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05863"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05863"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47672"
FT                   /db_xref="GOA:A0A0H3KRH8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRH8"
FT                   /protein_id="BAG47672.1"
FT                   /translation="MVRIEDLQLFVRTAALGSFSNVAREVGLLPGQVAAAIKRLERELD
FT                   IRLFARSTRSLRLTAEGEQYLPFAREALHTLHEGQDRIRRESTQLQGLLQVSAPSDLGR
FT                   NMLLLWLSEFRRQHPALSLRLLISDQVADVFRDPVDVALRYGVFDDASWVALPLAPWNR
FT                   RVLVGAPDYLERNGRPQKPTDLAQHHCLLYSLNGRAHDRWPVGDQTVQVTGPLFSNDAD
FT                   IVRRLAVAGEGLAYKSWLDVRDDIEAGRLEIVLAHYQGEPTPLNLVCPHRKQYSPAVQQ
FT                   LHALLRSRLDPLKQELPPPGLNGSAK"
FT   CDS_pept        573032..574042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="BMULJ_05864"
FT                   /product="NADPH2:quinone reductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="COG0604: NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases, Pseudomonas aeruginosa"
FT                   /note="KEGG, K00344"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05864"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47673"
FT                   /db_xref="GOA:A0A0H3KZ09"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ09"
FT                   /protein_id="BAG47673.1"
FT                   /translation="MKAIVFTEYGLPIDDPRALFDSELPEPTPGPHDLLVQVRAIAVNP
FT                   VDTKVRSGKGATPQPKVLGWDTVGVVRAVGSDVTLFQPGDEVFYAGAIDRPGSYSELHL
FT                   VDERIVGRKPRSLDDASAAALPLTSITAWELLFDRLGIGEHGGAGQSLLILGAGGGVGS
FT                   ILTQLARQLTGLKVIGTTSRPETREWVSALGAHHVIDHSRPLAEQLKHIGIEVVDYVIS
FT                   LTHTDSYLPQLIEVLRPQGHLALIDDPAVLDVVPLKRKSLALHWELMFTRSLYGTDDMI
FT                   KQHQLLNRVAELIDTGVLKTTVGEHFGRIEAANLRRAHALIESGKAMGKIVLEGF"
FT   CDS_pept        574537..575661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05865"
FT                   /product="Old Yellow Enzyme family NADH:flavin
FT                   oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="COG1902: NADH:flavin oxidoreductases, Old Yellow
FT                   Enzyme family, Pseudomonas aeruginosa"
FT                   /note="KEGG, K00540"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05865"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47674"
FT                   /db_xref="GOA:A0A0H3KR11"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR11"
FT                   /protein_id="BAG47674.1"
FT                   /translation="MTQSELFKTTQLGPYTLKNRIVLPPLTRSRSSQPGNIANDLMATY
FT                   YRQRSGAGFMVTEGTQIEPRGQGYAWTPGIHSAEQIQGWRKVTDAVHAEGGVIFAQLWH
FT                   VGRVSHTSLQPGGEAPVAPSAIRADNVKVFIETGPGTGTLADPSTPRALSTKEVKELVE
FT                   LYAQAARNALDAGFDGVELHCANGYLVNQFISAHTNQRDDEYGGSLQNRLRFLREITLA
FT                   VAGVVGKERVGVRFAPLFATTDEDRVYLGLVEEDPHQTYIEAVKILEEVGIAYLSLAEA
FT                   DWENAPELPETFREAVRKTFSGKIIYAGKYTAERANRVIKAGWADLIAFGRPFIANPDL
FT                   PARIANNWPLNPVDPSSMYGGTDKGYTDYPTYKS"
FT   repeat_region   575725..575728
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  575729..576964
FT                   /mobile_element_type="insertion sequence: IS407b"
FT                   /note="IS3 family"
FT   repeat_region   575729..575754
FT                   /rpt_type=INVERTED
FT                   /note="IS407b, terminal inverted repeat"
FT   CDS_pept        575797..576060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05866"
FT                   /product="IS407b transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05866"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47675"
FT                   /db_xref="GOA:A0A0H3KVG6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVG6"
FT                   /protein_id="BAG47675.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKNLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   CDS_pept        576195..576917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05867"
FT                   /product="IS407b transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05867"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47676"
FT                   /db_xref="GOA:A0A0H3KVG1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVG1"
FT                   /protein_id="BAG47676.1"
FT                   /translation="MLAARLVELAHERRRFGYRRLHALVEREGTHANHKRIYRLYRDAG
FT                   LAVRRRRKRHGVMIEREQLALPGAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVD
FT                   IVVDHGISGLYVARALDRAARFRGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAG
FT                   KPTQNAYIESFNGKFRDECLNEHWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEF
FT                   AAKHRATADAPAAFQELV"
FT   repeat_region   576940..576964
FT                   /rpt_type=INVERTED
FT                   /note="IS407b, terminal inverted repeat"
FT   repeat_region   576965..576968
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        576968..577951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05868"
FT                   /product="favin-dependent monooxygenase"
FT                   /note="COG2141: Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05868"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47677"
FT                   /db_xref="GOA:A0A0H3KRI2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR020020"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRI2"
FT                   /protein_id="BAG47677.1"
FT                   /translation="MYQPSTIPYQEHRGFKRTFRQGHLSLGLFFPLEAFEGDTPSMLDQ
FT                   VALAKRAEALGFSALWFRDVPLRDPSFGDVGQVFDPWVYLGYMAAHTTKIALGTASIAL
FT                   TLRNPLHTAKAAASIDQLSGGRLLLGVASGDRPVEFPAFSVDPEKRGETFQENLNVIRQ
FT                   AHRTHFEPIRWSHGELLGADLVPKPTTREIPLFVTGHSRQSLDWIARESHGWINYPRPP
FT                   KMQRLIVEDWRQETAKQCGAIYKPFLQSLYIDLVEHPPTPPSPIHLGFRLGRNHLLALL
FT                   DTLQEIGVDHVILNLKYGKRPAAEVIEELGKHIVPQFGAQEPDSSI"
FT   CDS_pept        578089..578394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="BMULJ_05869"
FT                   /product="ArsR family transcriptional regulator"
FT                   /note="COG0640: Predicted transcriptional regulators,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K03892"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05869"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47678"
FT                   /db_xref="GOA:A0A0H3KZ13"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ13"
FT                   /protein_id="BAG47678.1"
FT                   /translation="MTIDVNEALKALANPTRLAILNWLKDPRTVFPEQEVDPETVGVCV
FT                   SIIQERTGLSQSTTSLYLAALQRAQLVTSQRIGPWTYYKRHDENIDAFFKALQERI"
FT   CDS_pept        578607..579596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05870"
FT                   /product="Zn-dependent NADPH:quinone reductase"
FT                   /note="COG0604: NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47679"
FT                   /db_xref="GOA:A0A0H3KR16"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR16"
FT                   /protein_id="BAG47679.1"
FT                   /translation="MARIVRIHEYGDASVLKLEDLEVSAPAANEVQISVKAIGLNRAEV
FT                   MFRNHAYLQEAEFPSRLGYEAAGVVTAVGSDVTEITIGDSVALIPPLDIARWGTYGELA
FT                   NVPAHLVVKSPENLSFEEAAASWMQYVTAWGALIEQAKLRQGDFVIVTAASSSVGLAAF
FT                   QIARMVGATSIAITRTRAKKQALLDAGAAHVIVSDEEDIVERVMTITAGQGARVVFDPV
FT                   GGPSFEPLTQSMARGGILLVYGALSSEPTPFPLFTVLGKSLTLKGYIYAEIVADPEALE
FT                   RAKAFILQGLKSGTLRPIIAKTFALSDIQDAHRFLEANQQIGKIVVTV"
FT   CDS_pept        complement(579847..580065)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05871"
FT                   /note="truncated excinuclease ABC, A subunit"
FT   mobile_element  complement(580081..581316)
FT                   /mobile_element_type="insertion sequence: IS407b"
FT                   /note="IS3 family"
FT   repeat_region   complement(580081..580105)
FT                   /rpt_type=INVERTED
FT                   /note="IS407b, terminal inverted repeat"
FT   CDS_pept        complement(580128..580850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05872"
FT                   /product="IS407b transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05872"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47680"
FT                   /db_xref="GOA:A0A0H3KVG1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVG1"
FT                   /protein_id="BAG47680.1"
FT                   /translation="MLAARLVELAHERRRFGYRRLHALVEREGTHANHKRIYRLYRDAG
FT                   LAVRRRRKRHGVMIEREQLALPGAPNEVWSIDFVMDALSNGRRVKCLTVVDDFTKEAVD
FT                   IVVDHGISGLYVARALDRAARFRGYPKAVRTDQGPEFTSRALDQWAYANGVTLKLIQAG
FT                   KPTQNAYIESFNGKFRDECLNEHWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEF
FT                   AAKHRATADAPAAFQELV"
FT   CDS_pept        complement(580985..581248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05873"
FT                   /product="IS407b transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05873"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47681"
FT                   /db_xref="GOA:A0A0H3KVG6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVG6"
FT                   /protein_id="BAG47681.1"
FT                   /translation="MKKRFTEQQIIGFLKEAEAGMPVKELCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKNLEVENARLKKLLAEAMLDMEALKVVVKGKP"
FT   repeat_region   complement(581291..581316)
FT                   /rpt_type=INVERTED
FT                   /note="IS407b, terminal inverted repeat"
FT   mobile_element  581317..581481
FT                   /mobile_element_type="insertion sequence: ISBmu1d"
FT                   /note="truncated ISBmu1, right part."
FT   misc_feature    581317..581396
FT                   /note="Truncated transposase, orfB remnant. C terminal
FT                   part"
FT   mobile_element  581580..583040
FT                   /mobile_element_type="insertion sequence: ISBmu10"
FT                   /note="IS110 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        581812..583017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05874"
FT                   /product="ISBmu10 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05874"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47682"
FT                   /db_xref="GOA:A0A0H3KRI4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRI4"
FT                   /protein_id="BAG47682.1"
FT                   /translation="MQDTQQRDAVDVFVGVDVGKGHHHAVALDRNGKRLYNKALPNDEA
FT                   KLRALIAELKTHGRLLFVVDQPSTIGALPVAVARAEGVLVAYLPGLAMRRIADLHAGEA
FT                   KTDARDAAIIAEAARSMPHTLRSLRLADEQLAELTMLCGFDDDLAAQVTQTSNRIRGLL
FT                   TQIHPALERVLGPRLDHPAVLDLLERYPSPAALAGTSEKTLANRLTKLAPRMGKGLAAE
FT                   IVQALSEQAVTVPGTQAATIVMPRLAQQLAALRKQRDEIAAEVERLVLAHPLWPVLTSM
FT                   PGVGVRTAARLLTEVAHKSFASAAHLAAYAGLAPVTRRSGSSIRGEHPSRRGNKVLKRA
FT                   LFLSAFAALRDPVSRAYYSRKIQQGKRHNQALIALARRRCDVLFAMLRDGTIYQLKSAP
FT                   SA"
FT   CDS_pept        583060..583803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05875"
FT                   /product="short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /EC_number="1.-.-.-"
FT                   /note="COG4221: Short-chain alcohol dehydrogenase of
FT                   unknown specificity, Nostoc sp. PCC 7120"
FT                   /note="KEGG, K00540"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05875"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47683"
FT                   /db_xref="GOA:A0A0H3KZ18"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ18"
FT                   /protein_id="BAG47683.1"
FT                   /translation="MSNNISGKVVVITGASSGLGEATARHLAALGARVVLAARRKDKLD
FT                   ALVAELTNAGGQAIAYQTDVTSQEEVKTLIQGAVDTYGRIDVLINNAGLMAIAPLSDTR
FT                   TDEWDRMIDINIKGLLYGVAAALPVFQKQNSGHFINIASVAGLKVFSPGGTVYSGTKFA
FT                   VRAISEGLRHEVGGSIRTTTIEPGAVDSELKFGSTHQQSRDFVVDFYKHAIPAESVARA
FT                   IAFAIEQPADVDINEIVLRPTVQEF"
FT   CDS_pept        583864..584088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05876"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05876"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47684"
FT                   /db_xref="GOA:A0A0H3KR21"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR21"
FT                   /protein_id="BAG47684.1"
FT                   /translation="MPHGPEEKKQALDAGAECPAILQQLAAVRGAVNGLMATVLESYLR
FT                   EEFPSSEIRSDSQNKSIDETISIVRSYLR"
FT   CDS_pept        584148..585257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhC"
FT                   /locus_tag="BMULJ_05877"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /note="COG1062: Zn-dependent alcohol dehydrogenases, class
FT                   III, Escherichia coli O157:H7"
FT                   /note="KEGG, K00121"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05877"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47685"
FT                   /db_xref="GOA:A0A0H3KQR3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQR3"
FT                   /protein_id="BAG47685.1"
FT                   /translation="MKSRAAVAFGPGKPLEIVEIDVEPPRKGEVLVRITNTGVCHTDAF
FT                   TLSGEDPEGVFPAVLGHEGAGIVVEVGEGVTSVKPGDHVIPLYTAECGECLFCKSGKTN
FT                   LCVAVRATQGKGVMPDGTTRFSYNGQPIYHYMGCSTFSEYTVVAEVSLAKINPDANPEH
FT                   VCLLGCGVTTGIGAVHNTAKVQPGDSVAIFGLGGIGLAAIQGARQAKAGRIIAIDTNPA
FT                   KFELARTFGATECLNPKDFDKPIHEVLIEMTGWGVDHTFECIGNVNVMRSALEAAHRGW
FT                   GQSIVIGVAGAGKEISTRPFQLITGRTWKGSAFGGVKGRTQLPGMVEDAMKGEIDLAPF
FT                   VTHTMGLDDINKAFDLMHEGKSIRTVIHY"
FT   CDS_pept        585301..585699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05878"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG0346: Lactoylglutathione lyase and related
FT                   lyases, Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05878"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47686"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVH2"
FT                   /protein_id="BAG47686.1"
FT                   /translation="MSTPVISGDGIFSHIFIGAADLQKSVAFYDAALGALGIKNLGPFN
FT                   NGWVLFGREKPAFIIARPGNGEAPSSNGVTIGFAAATPAEVDAFHAAGLAAGGIDEGQP
FT                   GARGHLPGAYAAYLRDPAGNKVCSYTFV"
FT   CDS_pept        586086..587219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05879"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG4949: Uncharacterized membrane-anchored protein
FT                   conserved in bacteria, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05879"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47687"
FT                   /db_xref="GOA:A0A0H3KRI7"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRI7"
FT                   /protein_id="BAG47687.1"
FT                   /translation="MSELSHRFGVAEPDHATPLHGVTWDEGDLHCEKHTEFSTYLWCAS
FT                   LDSKTGEPCGENPFKHGFVPPGPVVSGIRLRLLPWTPETEKEADRFDPASLCYSLVENG
FT                   SAAILTDFRQDEDGLTQILILARDLTPARAGALAQRLLEIETYRTLALLSLPLTRSMTS
FT                   ELRHMESRLAAITDEMCTNLVERRDSDVLLSELTGLAAELEAGVAANLYRFGASRAYYE
FT                   IVEERLAALSEVAVSGYSTWADFLQRRIAPAMRTCQSVKERQAKLSDKLTRAIALLRSW
FT                   IDVELERQNRDLLASMNNRAKLQLRLQQTVEGLSVAAISYYVVSLLGYLLKGIPLVHDS
FT                   VAQVMAVLVPAVMLTIWWIVRRIRHAHSDTAAEEKSS"
FT   repeat_region   complement(587409..587415)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(587416..590100)
FT                   /mobile_element_type="insertion sequence: IS408"
FT                   /note="IS21 family"
FT   repeat_region   complement(587416..587461)
FT                   /rpt_type=INVERTED
FT                   /note="IS408, terminal inverted repeat"
FT   CDS_pept        complement(587514..588263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05880"
FT                   /product="IS408a transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47688"
FT                   /db_xref="GOA:P55923"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55923"
FT                   /protein_id="BAG47688.1"
FT                   /translation="MLMQHTLTQLKALKLDGMARAFEEQSTLTASTSLSFEERVGMLVD
FT                   RELAWRDTRRLERLLRAAKLKNPQACVEDIEYRQTRGLDQRIVATLAGCDWVRNAQNLI
FT                   LTGPTGAGKTWLACAFGQQACRQGFSVFYVRVARLFEELKIAHGDGSFTRRLAQLAKID
FT                   VLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHAWLQDPTLADAILD
FT                   RLVHQAHKLPVKGDSMRKKTKSESADA"
FT   CDS_pept        complement(588280..589836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05881"
FT                   /product="IS408a transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05881"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47689"
FT                   /db_xref="GOA:Q51649"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51649"
FT                   /protein_id="BAG47689.1"
FT                   /translation="MPTPRMSMRKLKEVLRLKWACGLTHRQISRAIGISVGAVSKFAAQ
FT                   ASQAGLDWAAAEAMSDDELDARLRPAATNAAATTTRRIEPDYTALHRELRRKGVTLQLL
FT                   WEEYAEANPGQRTYRYTQFCQKYKDWAKSIKRSMRQQHRAGEKLFADFAGPTVPVLASD
FT                   GGVEFEAHVFVAVLGASNYTFACATRTETMADWIGSLCDALEFIGGVPELLVPDNPKAL
FT                   IARPDRYEPGLGTTTQDFVNHYGTAMLPARPRKPQDKAKVEVGVQIVERWVLARLRHYR
FT                   FYSLAELNKAIAELIADLNQRPFKRLEGNRREWFERLDQPVLRPLPVRRYEIATFQKCR
FT                   VNIDYHVDVGGHYYSVPHSLARQEVWARITRHGVEILHGGKRVAAHARSRLKGKHTTIA
FT                   EHMPAAHRAHMEWTPGRLLNWGASVGPGAEAVVRHLLTNKPHPEMGYRACLGLLSLARK
FT                   YGKHRLEAACQRALKIGSPTRRSVLSILEAGLDLQPSLPTTPAEWRSPEHENVRGPDYY
FT                   H"
FT   repeat_region   complement(590054..590100)
FT                   /rpt_type=INVERTED
FT                   /note="IS408, terminal inverted repeat"
FT   repeat_region   complement(590101..590107)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(590298..591020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05882"
FT                   /product="ISBmu21 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05882"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47690"
FT                   /db_xref="GOA:A0A0H3KZ21"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ21"
FT                   /protein_id="BAG47690.1"
FT                   /translation="MMAKTKTPRKTLPAGIGKVLKRLHYPMDVILLCVRWYVAYSLSLR
FT                   NLEEMMAERGIEVDHSSVHRWVIKLLPVFEKAFRKRKRPVGRSWRVDETYVKVKGQWKY
FT                   LYRAVDKQGNTVDFLLRAHRDKAAARRYFEKAIEQNGEPETITVDRSGSNLAALEALNA
FT                   ERSVPIKVRQNKYLNNIVEQDHRAIKRIIRPMMGFRNFRCARIILAGIEIMHMIRKGQM
FT                   RDDGVASTAAEQFYSLAA"
FT   mobile_element  complement(590298..591020)
FT                   /mobile_element_type="insertion sequence: ISBmu21"
FT                   /note="IS6 family, No terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        complement(591790..592911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05883"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05883"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47691"
FT                   /db_xref="InterPro:IPR015315"
FT                   /db_xref="InterPro:IPR035948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR26"
FT                   /protein_id="BAG47691.1"
FT                   /translation="MSTFRTEQDLRHALSEAGLDSLSDRIVATMRPAIQFVRRQQPDDA
FT                   LPPGTSKIGGLPDLPPGFGWPHRRSPVDADTQIRALREQRIRDRERSASSRSQRPSDDI
FT                   LALLSEHEREAWLRSIEANRPDPDKLTAIHAQEDRYDDLMVVALGCEFPLAFLAQINLG
FT                   ALSNESGFDRDFPRHGVFSLFEDLTARDGDGSFQMHWFDVTAETLERRAPPATLIELSD
FT                   ARQPDFPWHEQMMAEVLQPHSTLVVPFHWIEAVGPERDAVFDFLHRPVGGYFPQPDVVE
FT                   GEQAGNFGDFLGGWPKPIQGDPERMFIGDARSFLRPGDDRIRHLFSWGGEYYAGTRRMH
FT                   APSGGDGTTYLMIQRDDLLSRRFDKAQSLYQCD"
FT   CDS_pept        complement(594190..595068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05884"
FT                   /product="predicted epimerase"
FT                   /note="COG0384: Predicted epimerase, PhzC/PhzF homolog,
FT                   Corynebacterium glutamicum"
FT                   /note="KEGG, K06998"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05884"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47692"
FT                   /db_xref="GOA:A0A0H3KQR7"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQR7"
FT                   /protein_id="BAG47692.1"
FT                   /translation="MSNILFKQVDVFTSVRFKGNPVAVVLRADGLTTEQMQQIANWTNL
FT                   SETTFVLPTMDSRADYRVRIFTPGAELPFAGHPTIGTAHALLEAGLVHAKEGMLIQECG
FT                   AGLIRLKVAREDDGEQWISFDLPESTITPLDDAQIDELDAILGSPSCRQFNPSLIDVGA
FT                   RWIVAQLADAQAVLSTKPDLQRMRVQDTKAKATGVVIFGEYDEKAPSRIEVRAFAPAHG
FT                   VNEDPVCGSGNGAVGVFIQHTGQTAHFGSEFLASQGKVVGRAGVLRLAVTDQRIQVGGV
FT                   AVTCIDGQLSI"
FT   CDS_pept        595498..596634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05885"
FT                   /product="transcriptional MocR family regulator"
FT                   /note="COG1167: Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05885"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47693"
FT                   /db_xref="GOA:A0A0H3KVH6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVH6"
FT                   /protein_id="BAG47693.1"
FT                   /translation="MRPAPPSGSLYRALADELSVAITSGRLPAGSGLPSLRECAAKRKL
FT                   SLNTVTAAYRLLEDRGLIAARPQSGFYVCSKLPEPQYSLRRIPKDPMGGAQEDLMSLVL
FT                   ESQHRPEHIDLAFAGPRGKKFYPGERLARITNSVLHRQTELISAYALPPGSDLLREQIA
FT                   RRGMRLGMTLSADDIVLTHGAMEALHLALRAVTSAGDHVGIEAPSYFNLYPLLSSLGLK
FT                   AIEIPTHPQRGLDVDAVETLLREKRIAALVAMPTVHNPLGCTMPVDAKQRLAKLVNQHG
FT                   VPLIEDAVYAELQYVEPLEPAVKAFDRKGWVLVCAGFSKTLAPDYRLGWVDGGRFGGAV
FT                   RRLKFSARETLINGPTSEVAGEMASNFLDDEANRRSIQ"
FT   mobile_element  complement(596541..597750)
FT                   /mobile_element_type="insertion sequence: ISBmu2"
FT                   /note="IS5 family"
FT   repeat_region   complement(596541..596556)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   CDS_pept        complement(596672..597664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05886"
FT                   /product="ISBmu2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05886"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47694"
FT                   /db_xref="GOA:A0A0H3KT61"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT61"
FT                   /protein_id="BAG47694.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   CDS_pept        complement(597694..598014)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05887"
FT                   /note="inactivated UvrD/REP helicase"
FT   repeat_region   complement(597735..597750)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   CDS_pept        complement(598032..598925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05888"
FT                   /product="putative chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05888"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ26"
FT                   /protein_id="BAG47695.1"
FT                   /translation="MSTINEEAHVGTDTADVAPVHAAANVLEGETVLAATGDSAATDRR
FT                   PTTDGADDGDVERELDEMERSAGILQREGLISAEEAVTKLEEVARTRTLFRDLPPEQRA
FT                   RIVQRRREIGRELMNKQLSGAAVVTARVTMKHTRLKPLFEQWWPYLNRMTINMQRFGRA
FT                   TYGANEQGIVSTWFEKQLDQLEGYVNEQLDVAKGFREKTEAEMRERGETVFEPTVTKPS
FT                   LDIEVEAYSRFSMRLLSVILKFDQVMDHFDFLVWNGVRDQSDVDDETARFLRKFHPVGL
FT                   RGYTTHLKLMNTVRGN"
FT   CDS_pept        complement(599280..599885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05889"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05889"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47696"
FT                   /db_xref="GOA:A0A0H3KR31"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR31"
FT                   /protein_id="BAG47696.1"
FT                   /translation="MAGSRFVGHIKMWFFFVPLLSVALMPAAPDPSLFDIPDAEAASVA
FT                   SSLGEVRTADAIDTTNRTFKHYFVATGLVQASMASSGETQIEDGGVANFASRWVHNFWR
FT                   LVYRMVYRITVMKYWLLGMLVFGIAMFTDGTVRRKVRAAAAGYVSPLSFHLAGHGILLV
FT                   FGVTFTVLIAPLPLIAPYWLAIAACLGALLWKAASTYQ"
FT   CDS_pept        complement(600095..600610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQS1"
FT                   /protein_id="BAG47697.1"
FT                   /translation="MSAVFKKIIREHKLSAHLTPVFTLAPELELVCTRVAEFVGEHFIG
FT                   KAEPLVKEMFVDGLAAFKRVRKTGDPHVAFMQGLFGSAHMLYARRFVVRDGDRCHVWSP
FT                   MFESVTAFESRFKLAPEMVDERCPENISQKSAAFQLAARALTGETFRLYFEEYDVAHTY
FT                   SDSDADAA"
FT   CDS_pept        complement(600621..602489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="BMULJ_05891"
FT                   /product="type IV secretion system protein"
FT                   /note="TraG protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05891"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47698"
FT                   /db_xref="GOA:A0A0H3KVI1"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVI1"
FT                   /protein_id="BAG47698.1"
FT                   /translation="MRGYINHFRPIYEVRAAFGWLIALLALPLSGMPYGWAFTLFALVS
FT                   FAIRSGQTWRALKFRMGLSTKWLTTLAVPTLLAIQNRMRAEVNAMYLGTGFEWTQKHCQ
FT                   MAHDILRMPTTEIPGLPKWLPKTKAGRAFEEMIENLFAPKDSIRDRTPQGASWIHGLEP
FT                   AKGFVPFHYKAMGGHTAVGGTTGSGKTRTYEVISTQVIHCGDVLIDIDPKNDKEWKARA
FT                   EREAQRTGRKFLYFNQAKPSESIRLEPLDSWSQPSEIPSRIAQLMEEGPFRDFAYLFIS
FT                   RSVNGELYIGDKPNLRSILKYAQLGIDPLLEKALKRFFIESGMAEWEELVAADTVKFAN
FT                   KPGSTRVDAMISLYQARFGANDRGHEAIDGLIATHVHDREHYMRIIASALPLLQMLATG
FT                   ETGLMLAPKVDDFEDEREIWTIEKVIRQKAVLHIGLDSLSNSIVAKAIASMILADVSAV
FT                   CGSIYNFYDKAPEVVLIIDEIAEAINEQVIQILNKGRGAGFKAFVAFQTRADLEAKLGN
FT                   AAKMLQVLGNLNNQIILRLEDTDTAEWFSKKVGDTAIRNLIVSSSTSKASEGHVGEFTG
FT                   SVTRSQQLEAVPLIPTRLIQTLPNLQYFMRISGGAVYQGRIPILTG"
FT   CDS_pept        complement(602486..603826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05892"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05892"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47699"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRJ7"
FT                   /protein_id="BAG47699.1"
FT                   /translation="MVATVLFEAADVAELVLRNERRIDLIAQCANESSRHEFERKWMSV
FT                   ILRCADWYSSIPLSPELYREPAGAFRWTVETAFYAMRLSGGLKFGTNLPSERRRRVEPQ
FT                   YNYGVFLAAICSGLDEPYRHFDVERTTDCQVWNPSVHGAVGPWLGGARYRMTRRSTPLP
FT                   VERMRTGMLAHALVGPELLSGLDAEVQAEIFGAINPTQSPQGVETLTHKVVRQAIATAA
FT                   DFDRKAQRAVFEPVTFAVPSAIHVAAELEPKLDPAASSATSLAAAPTPAAAAEPETAAP
FT                   APATDARVGTSIPSPPLPLATAGIDGSSRAALSAAANAAPKAPDQRQMALELPPAAVVN
FT                   PAEIRQERPGAIVTPAEDRFDEILKGAPRMISDFFVALQQDVAGGKVKVRWAEKGLVVS
FT                   KRTIGGYGVASDTLIEHMRRRNLLLANEPTEVTLAPRIGELIQGRDA"
FT   CDS_pept        complement(603826..604728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="BMULJ_05893"
FT                   /product="type IV secretion system protein"
FT                   /note="TrbL protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05893"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47700"
FT                   /db_xref="GOA:A0A0H3KZ30"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ30"
FT                   /protein_id="BAG47700.1"
FT                   /translation="MSSGWSSSYVNGEVAKGASAAIDTIGQIMKDLIDLAVELSRTLDK
FT                   ESNKMAFGLSVTTVVLASLRFGATKDPIAAWQSLFEDLAILGIFAAIYIAYDRWAPGFY
FT                   KWFNEMAIAISGTDADSLPMAMVKSAGAIYDSVIEALKAEHWWNYIALLINLAPLLFAW
FT                   LFLMLAALVFLFYVSLGTIQMAVAIVMGKIAFALGMSEFTRGWFKSWLDYTISAGMYMV
FT                   VAAILQRLMTTTIAKSFGDTISKGLTTPYAGSLTLDMSIFVLILAFEIPKFASMFGGGA
FT                   SASGSAFKSLTKMATKGLA"
FT   CDS_pept        complement(604833..605573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="BMULJ_05894"
FT                   /product="type IV secretion system protein"
FT                   /note="TrbJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05894"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR36"
FT                   /protein_id="BAG47701.1"
FT                   /translation="MKLLPTLRAAAFAASLFVAQHASAMIVFDPTNFAQNVITAAKAVQ
FT                   GEIYQNTNIIYQYQMMANQLLQATNLNPAAWKAAYDQITGDINKVKNLVGTLNGLYGDL
FT                   KKGGEWVNQVQGLISRSGKSNAQWFADMNTLFEQNDKVARNLFQMGSNIMQHTNDMAQR
FT                   RQELQSQLSMSPTQQATAEITTHYLDIVTSQNADILQLSAAKAQKDAQKDAQQAEEDKE
FT                   KAGDAQKFISKQQAERAAYGVGQQ"
FT   CDS_pept        complement(605806..608283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="BMULJ_05895"
FT                   /product="type IV secretion system protein"
FT                   /note="COG3451: Type IV secretory pathway, VirB4
FT                   components, Mesorhizobium loti"
FT                   /note="KEGG, K03199"
FT                   /note="TrbE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05895"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47702"
FT                   /db_xref="GOA:A0A0H3KQS6"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQS6"
FT                   /protein_id="BAG47702.1"
FT                   /translation="MSANPKRRAVQEIAPWATMVTPEIILDKDGSLLTLYSFEGVDADS
FT                   PNSDEISAARDNLDHACKNFDHRITAWWRVSHRRVRGEIGGKFASEMDRHVDAINQKSI
FT                   GSGKYFRNTHSLALAYTPETGINKLFEKVAYHMTVGGKSVPIALLETVKDMVLARSAFV
FT                   FDMERITSDIKRFEGILDAFKGGVARLKMKRLQLQSALAFLHQTANPSVPPRRVRYPVT
FT                   MLDTHLTETFVTYGAEHIMFESAYGTRYAKIISVKEWMGFQEAALDVLTDVDAELDVCV
FT                   MFRFLSTSKAQAFIEKMRKFYKVAAFSPMKILKGFFSKDEKKENMENEKGREILAEEAE
FT                   NALARLIADGQQYGFVNISVVVYGDTVTECDDNAREIVGRIGNAGFGVLVEKRNLPAAW
FT                   ASTLPGRWDQQKRLQFVETPVVSDIAPVRGVAEGSDVNPWLTQQLGERIGPLTLLPTRH
FT                   RTLQRVSLHDPSGKSHALIVGPIGAGKTIFLNFLVSQTGRFRPRRIKFDKNRSTRIPTV
FT                   FANGKFVDVTGKFAAATQVNPLSLLADPRHYTYVSGWVQMAIEGDGEDFRCTPQQERTI
FT                   YERVVTLAQGYGPEYWTLSFLAPLLPAELRDRLQIWTKGEKNGRFFDHVEDAFSLSDDL
FT                   AIEMGELFESYPVAAALFMDYAFYRISQWLDGKRVTIIEVEECGFFFRYPRFYARLEMW
FT                   VVTIRGLNGTLVMATQSLSQLERVPNFEIMKENIPNFFFLPNRDARNNKRLYRDVFGLT
FT                   DDQIDMISDGVPNRDYLWVTPDHSRMLQAKFPKEALAILRADGAAQRTLDKHLASGSPT
FT                   WREDYLAEMATLD"
FT   CDS_pept        complement(608280..608543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="BMULJ_05896"
FT                   /product="type IV secretion system protein"
FT                   /note="TrbD protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05896"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47703"
FT                   /db_xref="GOA:A0A0H3KVI8"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVI8"
FT                   /protein_id="BAG47703.1"
FT                   /translation="MGGADRGLAIANGTLTTLLCYTSMSPTFLVVGIVVHWVLRWLSSS
FT                   DPWWREVLVVYNRYPDVHEPLATADVAARFRRPYGFDQELPL"
FT   CDS_pept        complement(608584..608964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05897"
FT                   /product="putative type IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05897"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47704"
FT                   /db_xref="GOA:A0A0H3KRK0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRK0"
FT                   /protein_id="BAG47704.1"
FT                   /translation="MKKHLQSLRSLVRKKVRHTAHYYFGRGHRLSTLIALALTFAAPAA
FT                   KAVDLSDLGSATAIICLIQAYVSGPWLMAIGVVLIIVGAVAIANSESNIGKFLSSVIVG
FT                   IGLAACAIPIVKNQLKINYTCA"
FT   CDS_pept        complement(608983..610029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbB"
FT                   /locus_tag="BMULJ_05898"
FT                   /product="type IV secretion system protein"
FT                   /note="TrbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05898"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47705"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ34"
FT                   /protein_id="BAG47705.1"
FT                   /translation="MSEIAENPFLKVARLEENAVQLFFESLKLIKPYLDSPNVAEVMIN
FT                   SANNIWVEERGVMRRLEIEFNPATLTGAIHSLAASVEKSAHAGTAQGIINGGHKNLRIA
FT                   TVMKPTAIDGDALAIRRHRETNLSIKDYARMGAFSLVHAKRSIERPIFPPGVADEALAE
FT                   AFTTMVQQRANVLVAGGTSTGKTTFLNALNGLIPSEERVITIEDTMELKVDLPNRVRLL
FT                   SNPDKGVTTQVLVALCLRFRPDRIIVGEVRGGEAFDFIQALSTGHDGGMGSIHSNDARG
FT                   GLSRLESLAMLGIPRGSRWELTDMRKAIADCFHYVIHLRRSGELRHVSEVLAIKGFKDG
FT                   DYVLERVF"
FT   CDS_pept        complement(610304..611512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05899"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3864: Uncharacterized protein conserved in
FT                   bacteria, Deinococcus radiodurans"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05899"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47706"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR42"
FT                   /protein_id="BAG47706.1"
FT                   /translation="MDARIAKQRTALVLDHPFIGALALRLKVREDPGCKTFWTDGESLG
FT                   YNPVYAAGLTDLQIRAVLAHEVWHVAGGHCWRQGPRDPEGWNEACDYVVNLIVEGAGMQ
FT                   LPPGALIDSRFQGMSAEEVYGIRMHEKRQAAKQHAGSQLSAPRPGSKPGRSAGSPNGRP
FT                   SGSGDDLAAEPAPSCGEVRQYAGPDKPAKEAEWKVAVLQAAKAAQACGKLGGALQAAVE
FT                   QSAAAVVDWRSLLHRFAQDAAPTDYTWAQPNRRYLHLGMYLPSLNEPAVGDAVFVRDAS
FT                   GSVWDETQAQFAAEILAVSEAVRPRRLIVMDCDERVTQVQVFESDDPVELAPLKGGGGT
FT                   SFVDPFRWLAREDIEPAFLVYLTDMDGTFPSEEPAYPVLWASTTPLKRARRAPFGETIE
FT                   VVC"
FT   CDS_pept        complement(611520..612449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47707"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQS9"
FT                   /protein_id="BAG47707.1"
FT                   /translation="MNITELQSKVMLSSLTISTWVARRYDGKVTEEVEKSHSARGIGRF
FT                   NKRLLPEHAPSYAEVLSIGSRIRSHYYGRTLKYDQLGVRLLPTMVYMELADRLRAMKDE
FT                   FDLAVSVFLTNYLDLKEQARAEMHTLYNEADYPSLAELKGKFGVKLSVLPFPDASQFGV
FT                   DLPTDVLTTLRTEVDAHAMASIQTANKDLVGRLYEAVSTMASRLYASGNVRLDVANHVR
FT                   ELCDLLPKLNFSDDPKLAHILSEAKRHLAAHNGAELKESSVLRSQVASKATEIEGLMAA
FT                   FMGGAPAVPLTDQVTAPPATAVSFLAAA"
FT   CDS_pept        complement(612553..613578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05901"
FT                   /product="MoxR-like ATPase"
FT                   /note="COG0714: MoxR-like ATPases, Deinococcus radiodurans"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05901"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47708"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVJ4"
FT                   /protein_id="BAG47708.1"
FT                   /translation="MKLSPARLAKLLSAYIPRRLPVLITGRPGIGKSDIVESATEAAGH
FT                   DLLISHPVVEDPTDSKGLPFPSADGQHARFLPFGDLERALSATRPLVWFFDDLGQASPA
FT                   VQAAKMQLLLARRIGEHQLPDFVTFVAATNRRGDNAAVSGILDPLISRFAAVVELEATV
FT                   DDWTTWAVQQDVPPELIAFLRFRPDLLWEERSGRDIVASASPRKWGFLAKTMSAVPADL
FT                   LPDAINATVGEGAGAELLSFLAIYRALPSVDAILLNPDLGVIPDEPSILYALTAALAHK
FT                   ASDGNFERVLQYADRLVDAGRREFTALLVRDATARRPDLANHHAFIRAQGGEIGKIIRG
FT                   E"
FT   CDS_pept        complement(613696..613947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05902"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05902"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47709"
FT                   /db_xref="InterPro:IPR022191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRK2"
FT                   /protein_id="BAG47709.1"
FT                   /translation="MNQPDSSAPVPPDAVSIAEIEAAINVWRNRSPAPTGPDELLVLCA
FT                   EARVLADVYGVMIVSCSTSVPRSSLTATQAAALLGART"
FT   CDS_pept        complement(614202..614669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05903"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05903"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ35"
FT                   /protein_id="BAG47710.1"
FT                   /translation="MRFDRKVRYEDYVWTRRKELAFLNRHKRVAQKLERDCPLFADQLV
FT                   PAPETNIEAEKVRRIMRAREDEQMMRDLDARHWRAGRASYFACDPEIRARIMAEWRSWR
FT                   GPAKPTYFIYVVEKHNGVGEERRRRIREEDDALRARLARRLCSQGDLLFGT"
FT   CDS_pept        complement(614684..616204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05904"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05904"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR46"
FT                   /protein_id="BAG47711.1"
FT                   /translation="MYTIHTPKDAIHVDTLAHVFHVFFHDASLSAYETAEIFLTRGNTA
FT                   LPVLRYNGILTVRQPGTAHAIFTALFAELRDRWFTKDGKQLLPWQVTRKRWEIFQFVFE
FT                   LATKPAWLLSAEQLENETDAARAAGRRFHLADVCDEVAVGVFGYTSQGPQLSLSGGVNG
FT                   RHEVHVAYALFQDRPIPESVLADYRGNAKHFKYDLQWFPVLLDIPVLRNPLPYNAMQSA
FT                   VAIFRHENQPIDAELGERIVEALRTAPADSTYVDVDDRLFAAGLVAKPDLPERYQQSVD
FT                   VGTARSPVAERLRELIGDAVLKKSLDRLDAERRQGRISQRRYSLQVEMAKLDRGRTTFE
FT                   RPNQFAAVVEARDVAALLKVLDQPAGSNDQSKQVLREQFGLSLRGLNSAGRQRVIFAFC
FT                   GYDEAAQAEWEAKQDAARVQRLAEEAANDAKEQAGRARYRRRDNVVISGVEHVDQAIAE
FT                   GYSEIRTFRRGAATRYVLAKPGSTEGRTLHAKNGTLEYARSRLTSPAA"
FT   CDS_pept        complement(616281..616676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05905"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47712"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQT2"
FT                   /protein_id="BAG47712.1"
FT                   /translation="MSEVLDLPVELANVPFEPVGKTIGEVAGEIDRALRSAGLAPEYVV
FT                   PANGYADAPEELHGLRGTSVWPKVPYRAGYPCVSVLRFDRGAGVLVSFVGAVDGCWRIQ
FT                   RAIRIAARCRSHAWAIAAAVSRLFDLD"
FT   CDS_pept        complement(616892..617365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05906"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05906"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47713"
FT                   /db_xref="GOA:A0A0H3KVJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVJ9"
FT                   /protein_id="BAG47713.1"
FT                   /translation="MEFVDVRVEFPSGLTLADRGSYDSDEQIVFISVPMRAMLDAAKEM
FT                   EPPPAVTATWDGFEATLIQATADSFDVVSVTELGAKPRSKLGARLVRASWSKDQRQQFG
FT                   RFCHTLTVSSIVGVVGYVHAISEFSIWAAMNVAALVAIGVITYIVGMDSMNGE"
FT   CDS_pept        complement(617375..617767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05907"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05907"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRK6"
FT                   /protein_id="BAG47714.1"
FT                   /translation="MFKVPKVLYADRRAGGVASDAALTHQATRMLHRVARDLRLRAGEH
FT                   EVVAEPAKAGRGCRVTLRTSRMMLEVADSTSRQHVAVSFRTRRGHRDLSGGGDNVVPLA
FT                   QLDTDEGYQALLGGLRLVDGLDSDRR"
FT   CDS_pept        complement(617854..618315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyB"
FT                   /locus_tag="BMULJ_05908"
FT                   /product="outer membrane lipoprotein"
FT                   /note="KEGG, K06077"
FT                   /note="SlyB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05908"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ40"
FT                   /protein_id="BAG47715.1"
FT                   /translation="MFKLLISALLLASLTACASYDFGSPDVYQRYDVQRAGEIEAATVV
FT                   SVRGVTISNESDRSGLASLLSAGVSAFLGSRTIGGGNGRYIAGALAGAGAAYVSQRLSE
FT                   SLARHAGLEVVVRTVSGRTLVVVQSDEQRFAPGDRVMLVSSSSGMRITR"
FT   CDS_pept        complement(618584..619411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05909"
FT                   /product="UBA/THIF-type NAD/FAD-binding fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05909"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47716"
FT                   /db_xref="GOA:A0A0H3KR52"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR022500"
FT                   /db_xref="InterPro:IPR030468"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR52"
FT                   /protein_id="BAG47716.1"
FT                   /translation="MSEVITHSIPADMIRRPWRVVVVGAGGTGSAFLPSLARLHHAMIE
FT                   LGHPGGIECTVYDDDTVSETNVGRQGFYPNDVGHYKALLLVNRLNNLMGTNWVAEPRRV
FT                   DSSVRIVADIVVGCVDSRRARHAIVQAAKRGSCRYYLDCGNETDRGQVILGEFGKTRRD
FT                   RLPHVGDLFPQLLNARNDKDDETPSCSMADALRKQSLVINQAISVQAFNLLWTLYRTGT
FT                   LSYSAVFVNLETGRTNPVPIDPVAWARFGYDAPKPQKARSRKRFDRMDPHIPR"
FT   CDS_pept        complement(619411..619971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47717"
FT                   /db_xref="InterPro:IPR018560"
FT                   /db_xref="InterPro:IPR022499"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQT7"
FT                   /protein_id="BAG47717.1"
FT                   /translation="MTRSGERLLITSDGVYLEVLRPWVRVVRRIAHYAVSTAVPYGQVE
FT                   ETTAFSCGQIPAALVAEFHAMARAALPNEVGAWIVWNSMTGAFRIVALPSVSHGPGHLV
FT                   YERPRLADGEWLVVDCHSHGTGSAFFSRTDNQDDKHDVKLALVLGHCDRTPSVVLRLCA
FT                   KGIFEKFERVPESWATALTAEVV"
FT   CDS_pept        complement(620043..620771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05911"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05911"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47718"
FT                   /db_xref="InterPro:IPR022280"
FT                   /db_xref="InterPro:IPR032787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVK5"
FT                   /protein_id="BAG47718.1"
FT                   /translation="MSGISAGRTGSDVALSQALLLYTSADGAHFATAHAVIADRKSGRP
FT                   IIGAGRPLDRKVLIRTLQQLAEHVAPRAEFLPATVLGVSPEAVTWWCPAAMRRVFFECE
FT                   NLGKRSAVVPHPGLVFQASNQGFRVFAVACSDRPVRETPLFEPPYFNTWDHGRICIGSA
FT                   QVPKRVDVASIDGWEAGFFDSAFTHPNVGGKRIEYKDGEYAFWRDMLDGKFGEVFPQTV
FT                   MVPTKLTVGLLVNSQIGMGA"
FT   CDS_pept        complement(620784..621926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05912"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05912"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47719"
FT                   /db_xref="InterPro:IPR022283"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRL0"
FT                   /protein_id="BAG47719.1"
FT                   /translation="MFFDPALPDSSIAAGSAARWQPPRAAPARRRPTFDLLTLPSFSTE
FT                   VPGEVRLKWRDDVQLSDLVRKHFQYGPLRAGDVRDPADAGDAFQQAFYAWVGRQYGKFS
FT                   RLQFVPRLFDAHAVRDVLDCLDNGNNDDDPTPLFFGFGLEDEWVYSLEGAIETLRSTHP
FT                   SLFRTVMAALYRASSRTMFIRLPDWFMYEFSCWYWDGDPNISDEEADRMLKERFGDDVE
FT                   TRNAHLPSVVREQLCPDDADPCSYSGGRWLDRRALTVSELLSLRGRSKGMPRRVCTEVL
FT                   KLRALMRRSRTRDLFHVSYYTNPAYALCSVIVEGNDFVGDLLDCHFDNESQSGDATTYS
FT                   GFSGLASTPQAIRRQYADLALAFRILTHIDRLLALVSQPI"
FT   CDS_pept        complement(622026..622244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05913"
FT                   /product="putative carbamoylphosphate synthase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05913"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47720"
FT                   /db_xref="InterPro:IPR022289"
FT                   /db_xref="InterPro:IPR032866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ45"
FT                   /protein_id="BAG47720.1"
FT                   /translation="MSISIAALVREFTYNGVALMDPGPAFSPDQVRDLYTAQYPELTTA
FT                   AVDGPDMKGEVAHYKFVRAAGAKGAHA"
FT   CDS_pept        complement(622256..622633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05914"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05914"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47721"
FT                   /db_xref="InterPro:IPR022273"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR58"
FT                   /protein_id="BAG47721.1"
FT                   /translation="MDGDNIVVFLTPAGGKDAMLRQPLILKATAAELDEGFASAIGSFT
FT                   TAHQSLGEQVAATNAILEAQQQTQVKKAQKVLSKASTPTAANAGADEDADDEDGADAAS
FT                   PNVAPDAAEKPAGTDLSSLIL"
FT   CDS_pept        complement(622769..624358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05915"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05915"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47722"
FT                   /db_xref="GOA:A0A0H3KQT9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR022396"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQT9"
FT                   /protein_id="BAG47722.1"
FT                   /translation="MAEMKASISARGVDTPVIVRPVDDGYFELIAGGRRYKAALETRGE
FT                   DYDMPVNVKDVSDEEAEEIALIENIQRDDMSPGDEAVEAARLLGRCKGDREEAARRIGW
FT                   SLPTLNSRLALLNCSNEVLAALNTRRILLGHAELLAALSKENQDRVLPVIIDEKKSVAE
FT                   VRKLVESAACSLSAAIFDKADCAACPHNSALQSEMFGESIATGNCTNRQCYNGKTDQRL
FT                   EAIAEGLRDEFPVVRVVRAGDNHTRVQLAVDGPNGVGEAQAKACHACQNFGVAVSGLPD
FT                   SLGKTYRGQCFDTVCNMRKVADRITAEKVAAKAATTDAEGSPVPGKAAGKSASGSDASA
FT                   PTAVTVVAESDRVKQYREALWRKALRRDVGKDAALARQYLIAIVLAGYARQIKDEVFRS
FT                   VYEKVTDEKAPAADLSKALILACATSDEQAATLVTGMFVAAIEGLDVTYLKQLCKHHNL
FT                   DLTQYWKLDKEFLELVTKAEMMVIADELGLRAAMGDNFKKVFSKSKADVISALLAVEGF
FT                   TYEGKLLKVLKY"
FT   CDS_pept        complement(624722..625723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05916"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05916"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47723"
FT                   /db_xref="GOA:A0A0H3KVL0"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVL0"
FT                   /protein_id="BAG47723.1"
FT                   /translation="MSRKSAERKLVREADPHQAELVKLIKQFGYAHQPSVVFADFVEMA
FT                   AIALSNSVDKPQFEPREKRYVEIARKYKPEELQLFARMFAELTLSFEHRLGVEEGLAPG
FT                   DLPCPGNLTDVLGETYMTMGIGNDGAGQFFTPYSVSRLMAGIAIGDRSEAVERDGFMRM
FT                   QEPACGAGGMVIATADALLSIGQNYQQTLHATCIDIDARCVHMTYLQLSMMHIPAIVVH
FT                   GNALTMEVWGMWYTPAHILGGWRSKLRQRRQLDAMRKVLALDRSIAATDPGADPDPNGE
FT                   MVCDSDVAVEPPVAVEAAATVHHVDSLSDLFDEAVERSKDSIFEAVDQLALF"
FT   CDS_pept        627516..628748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05917"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05917"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47724"
FT                   /db_xref="InterPro:IPR009553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRL3"
FT                   /protein_id="BAG47724.1"
FT                   /translation="MKANTSPGKVSISGIAVPLDEVQENPAAFVRQLERAKLNPGYAQC
FT                   LCRGTAAPLRLQIRRYGSLLHLAGWPDEGPLHDRQSCSFHKDPNEAGSETGRTLPGVVT
FT                   TAVGLLAKLDVALTQRTINTVSRGTRQAGAPTSSRRSTPLLGFLQALWLVAGLNRWSAT
FT                   DRVRNWGVCNARILAGLGDAMINGEPAEKILHVMRRFQEADRVAINSEFDAFLGRVGQR
FT                   NGTNHRGLVVGEISEIGTTPYGRSITLRQSAKRYYCSNDLIDLAEKRYAHALRALGDRA
FT                   ARVAAILVIERTAKGHHVIVDFAAMLCSSTYVACDSIHEVAMANRLVAEGRSFDKPIRL
FT                   DTGGDMLPDFVLTDTPAPTHVEVYGMNGMATYEARKREKQRLRLSRGIPAVEWNVDAID
FT                   LAEIRLPPAGR"
FT   CDS_pept        629347..630018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05918"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05918"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ47"
FT                   /protein_id="BAG47725.1"
FT                   /translation="MIEQLYPCEHCGGRPTVGRSQRLIDCDENRRFDFSQFGRFGGPPE
FT                   LGDVLPRPPEAPLTEHLVCIYCTACGISTRWEAIGEDEAAAKDRCAESWNRRVARPRTT
FT                   HDDLRRLIEREVGACDSQLVLDMLARVEGDWAEIGPIFKLLAQRIVDATVVTFDTWPIA
FT                   PVLEDASRYRKLVQLAKWIEVDGEDYIQFPKIHSPGEHRDFLFEDRIATAVDAKPDRDR
FT                   W"
FT   CDS_pept        630104..630685
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05919"
FT                   /note="truncated cold shock protein"
FT   repeat_region   630722..630725
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  630726..631935
FT                   /mobile_element_type="insertion sequence: ISBmu2"
FT                   /note="IS5 family"
FT   repeat_region   630726..630741
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   CDS_pept        630812..631804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05920"
FT                   /product="ISBmu2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05920"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47726"
FT                   /db_xref="GOA:A0A0H3KT61"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT61"
FT                   /protein_id="BAG47726.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   repeat_region   631920..631935
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   repeat_region   631936..631939
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(632103..633233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05921"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05921"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47727"
FT                   /db_xref="GOA:A0A0H3KQU4"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQU4"
FT                   /protein_id="BAG47727.1"
FT                   /translation="MAAILNVRAVVGRYRLAPEFRDALLVLFDQHVAEIHSTTRISKRA
FT                   LSIKTQEYRATAICKAFVELREGGFALQSPWSLKSKHVAYLVDRWVKDQQSGGTIENKL
FT                   TYLRALAQWLGKGNLVGTLGDYVDRREAGLERSYVATEDKSWGANGVDAVAKIEEIART
FT                   CPYTAVQLKLQAAFGLRVEESFMLRPAEAVRNPNILAVTRGTKGGRPREVPIERKIAIL
FT                   EEAARLSNGVTGSTIPAGRTLKQWRDWYYYVLAKHGVTKSGIGVTSHGLRHEYLQTLYE
FT                   RVAEVPAPIKGSPARPDPAAHEDAKRRVVEAAGHSRPSKANAYLSTFARQATLKKPLPT
FT                   VEETKAALEAAGGNKSHAAAALGISRQALYRLLASS"
FT   CDS_pept        634742..635659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05922"
FT                   /product="actin-like ATPase"
FT                   /note="involved in cell morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05922"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47728"
FT                   /db_xref="InterPro:IPR022389"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVL6"
FT                   /protein_id="BAG47728.1"
FT                   /translation="MFPSLAPLAASRSIAGYGESVLTARKVATIVIDQVEYEVGPDVSL
FT                   TAAYGNTGRALADDYVLSANYAGLLFGAIHFAGVDHIERLVLGLPVHNMKKYSAELKER
FT                   FTGELNFGAGRVTIDKVMVIPQPLGSLVLASSNRQGGFGRDVEHLVVDVGYFTTDWVYA
FT                   NGFTMDDKRSGGMPGGASQIYQRIAALIARDQGDEVEDIERIDKALREQTPFFFYGSNI
FT                   DLAPYLEMAQPLISGVVKEMQNNVGRLANVRSIILSGGGAALYAGVIRRAFPRVVIEVI
FT                   DAPCLANVRGFLLVGESSLARERR"
FT   CDS_pept        635669..636004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05923"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05923"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRL7"
FT                   /protein_id="BAG47729.1"
FT                   /translation="MSDKIEMTITINELVSPLLFERLSACSSARRRAALLKALAESALR
FT                   HEMTGRFVAAPTTAGRVAELASRQDTPARSLSAVENDEFKVLSVGDGSDDRTTFDEALH
FT                   DQLGAWM"
FT   CDS_pept        636074..636277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05924"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05924"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47730"
FT                   /db_xref="GOA:A0A0H3KZ53"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ53"
FT                   /protein_id="BAG47730.1"
FT                   /translation="MSQRTRRPTPNNTEKNMLELIGWIRNGELIHKLASPYFWLAMAAT
FT                   AIAAEYCVAAWQTYMVNAKEDQ"
FT   CDS_pept        complement(636574..636798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05925"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR71"
FT                   /protein_id="BAG47731.1"
FT                   /translation="MGSFRLVLDEFEVVEVAAAAVPEGAADLCEGPRFDVIDRLLEGDD
FT                   RYILRDEAFQPAVDFCIAWLDEKAKSKKH"
FT   CDS_pept        complement(636894..637373)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05926"
FT                   /note="inactivated hypothetical protein"
FT   CDS_pept        complement(637370..638035)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05927"
FT                   /note="inactivated hypothetical protein"
FT   CDS_pept        complement(638431..638985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="BMULJ_05928"
FT                   /product="single-strand DNA-binding protein"
FT                   /note="COG0629: Single-stranded DNA-binding protein,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K03111"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05928"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47732"
FT                   /db_xref="GOA:A0A0H3KQU7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQU7"
FT                   /protein_id="BAG47732.1"
FT                   /translation="MASVNKVIIVGNLGADPEVRYLPSGDAVANARVATTDRYKDKATG
FT                   EYKETTEWHRVSFFGRLAEIVSEYLRKGSSIYVEGKIRTRKWQGQDGQDRYSTEIVADQ
FT                   MQMLGGRNSGGRGDSDGHGGDGDFEQGSRRQATAPAARQASGQPPANTRAQTQHSAPRP
FT                   AQTQSYGGGGGFDEMDDDIPF"
FT   CDS_pept        complement(638997..639830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05929"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05929"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVM1"
FT                   /protein_id="BAG47733.1"
FT                   /translation="MGGVAMFFTRILAQAFPGGARVSTADPPSTSRQAERTVGTGASNE
FT                   TFVTIDGIAHLFVDEGDCVVEFVPAFDDAPGDTMFGTKILPALAPHWALAHEYSASLKD
FT                   AIAAAIRRESVPASPALNTASAPDAADLWTLQPADVPKARSHDEDDGRGLSPTPQSSRT
FT                   QYQRGRRDDSSRSSVVEGSITGWGEETFPDRRPGKSGSYRSFALRLETRDGEQVLQGEG
FT                   LKEAINECGCCVGDIVSVKRLRKIKVPAFRKEDGSPIYKDGQQVMWDKWLWSITK"
FT   CDS_pept        complement(639818..640267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRM2"
FT                   /protein_id="BAG47734.1"
FT                   /translation="MEQQVAAWQLDIFGSASPILVTRPKPDPLPDPELWEPHVREKLAE
FT                   AVVFFALDSRHSDNVPEALIDCAEMLHQRLCNRPVDKGDYYATLGWIMELWTGAIPYQV
FT                   VCALGRVRPRAMQDAIRDIPLLNYDFNRLNRWCSGQLSLEAQWVA"
FT   CDS_pept        complement(640381..640740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05931"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05931"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47735"
FT                   /db_xref="GOA:A0A0H3KZ57"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ57"
FT                   /protein_id="BAG47735.1"
FT                   /translation="MLQSLIGGAFKSPGKFLALCFAVYLAAHSILVSVFLAIAGFHYFK
FT                   NAAKTARRDAERDAAIRHDRDENPQHANRAQATAARSDVKASTTPQRQYAKSAVVIPLK
FT                   PAINPAVETMKTGTK"
FT   CDS_pept        641163..641864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05932"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05932"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47736"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR76"
FT                   /protein_id="BAG47736.1"
FT                   /translation="MILTIILLCGAWALYKQYADSHRGQRSTRPVTRSQASGDAGEARV
FT                   NAELRRVLAHLCGSDFYVHPTALLLLHAPGTEFPTAEVDHLVVTPFGIFVIETKNWAGT
FT                   ILPGQTADQLVCHLPSGRLEERRSPISQNRAKVAFLRGTLPATWNVQGLGVFSHDACTL
FT                   SAGLPLALVNLRDLGYWLRTQRDRHAESGNPNINVSAAWDVVRRLSVDDPTGSAISAHR
FT                   HKVARNSSVNI"
FT   repeat_region   complement(641872..641875)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(641876..643085)
FT                   /mobile_element_type="insertion sequence: ISBmu2"
FT                   /note="IS5 family"
FT   repeat_region   complement(641876..641891)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   CDS_pept        complement(642007..642999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05933"
FT                   /product="ISBmu2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05933"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47737"
FT                   /db_xref="GOA:A0A0H3KT61"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT61"
FT                   /protein_id="BAG47737.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   repeat_region   complement(643070..643085)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   repeat_region   complement(643086..643089)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        643308..644540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05934"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05934"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVM5"
FT                   /protein_id="BAG47738.1"
FT                   /translation="MSKKPQKQSQVESFNPTVPDHPTSEADAVDLPATFAHVPDKLELS
FT                   TTAREMFGDLPENLIRNIIHETEEVAHSTRKILQEHMRIGGNFAHIHAAVIGHYVSTQG
FT                   DTRQVRNTAAELVYSFLTKLFRKSKSSVSLYIRCYNKFSNNIGAVEMLTISDMSLLVHN
FT                   NISDEIVEKVIDAKREDPTLTKSQVTALINSLKEQIAGKDNSIEEATSQLTTAVGKLDD
FT                   AQREIDRLSAELANVRQEQAREKTKAQETQVSLASAGKQVSTLQHTIAGKEREVEQLTA
FT                   EIAKLKANPTKVEVEVPTVPSSYATLEDAVAAKLAEHTAVKAQLEQAQAELAELEARAQ
FT                   EHRAAIEASEVLEKKIRGLIDTFSSFVHEYHSAQLLATADGNPGRFKPLFQAFGDLIGK
FT                   FHGEVMAAARA"
FT   CDS_pept        644593..645798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05935"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05935"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47739"
FT                   /db_xref="GOA:A0A0H3KRM7"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRM7"
FT                   /protein_id="BAG47739.1"
FT                   /translation="MEKKNSRETYRSIERLYVPDWLADRIRETNFDLVDQMRWLLEMDG
FT                   AFNDILAVERKEIDHVKHNEASLRNLLRAPFLMVAPTLESVEDWRCFVDDTATTVAVDR
FT                   LIRKLPPLDALAKMSVEHHNRVFLDLVTSVIHISVLAAPLLGITTEVASYLVSVPTYKL
FT                   RIALGKMNGLPLFRWRFNSPTFWYQFTASNLTDEMVAHQIMATSPIRMNSAPGKAGWSE
FT                   LRLPRDRNETYASALMAYGCRASTAASLFRLNQNAMRQRFFEMHGTSSPCGNTPNSLSW
FT                   FVETPTNRLHGTIFTWLYRAALAAGANAPQALIATNDVYQQIFGGQHAISVDRGCNLTR
FT                   AMAADNRLTIAPCRSCRTEYLVSNNETKIEMHHSFDCPACTGQLGPKRRGTKARARNDA
FT                   QQ"
FT   CDS_pept        645984..646349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05936"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05936"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47740"
FT                   /db_xref="GOA:A0A0H3KZ59"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ59"
FT                   /protein_id="BAG47740.1"
FT                   /translation="MDDLAYLVADSSAAWLDGRGDGRFERYERFYRSEREKLADAFELE
FT                   QVNEAYATWIGSQPSRVLGALSRPWFGKVLVALTCMYVGAQVVPAVSTAIPYKSTVLLG
FT                   VAFVGLRIFHRKRRRAR"
FT   CDS_pept        646574..647596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05937"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05937"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47741"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR81"
FT                   /protein_id="BAG47741.1"
FT                   /translation="MQKITTTTVSALAAAAVLALAACGGGGDGGSTNTGSTGNNPNPPN
FT                   PGNASATVPGTVEIPQYAAGSAQLAALTLLNQYRSQCGFPALKQNTVLDQAAQNHAKYI
FT                   GENNAVTDTEVPGNAGYTGATYIDRAVAAGFPGGVIGIGASGANAVFTNNFNATVAGQQ
FT                   FVGSLLGGAYHAVVATFPVDLVGFGESETQTTSGSYTFTESWQSISMYAAKPQALQGGP
FT                   KTFPCDGVTGVPYRGIGEVPTPPNVSSSGWGTPITVMGNLTDVINMQSASVTGPSGTVD
FT                   VQILNSDSDPNKLLGKYQAVAYPTSPLQPNTTYSVTINGTVNGAAFSRTFSFATANTAG
FT                   "
FT   mobile_element  complement(647630..649074)
FT                   /mobile_element_type="insertion sequence: ISBmu6b"
FT                   /note="IS3 family"
FT   repeat_region   complement(647630..647641)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu6b, terminal inverted repeat"
FT   CDS_pept        complement(647663..648499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05938"
FT                   /product="ISBmu6b transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05938"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47742"
FT                   /db_xref="GOA:A0A0H3KQV3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQV3"
FT                   /protein_id="BAG47742.1"
FT                   /translation="MRELRQHHPVAALLKVAGLARSTFYYQLGTLNADDRHADLKAKIR
FT                   TVFEHHKGRYGYRRVTAAIRQAGYLVNHKAVQRLMQQLQLKSLVRPKKYRSWRGEIGQA
FT                   APNLLQRQFSATQANQKWVTDVTEFNVGGQKLYLSPVMDLYNGEIVAYQMDQRPSFELV
FT                   SGMLKKALAKLRRKDKPLLHSDQGWQYRMPAYRRELKKRKLTQSMSRKGNCLDNAAMES
FT                   FFGTLKSECYNGHCFTCVEQLRDTLDHYIHYYNHERIKLKLKGLSPVQYRTQPLGA"
FT   CDS_pept        complement(648499..649023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05939"
FT                   /product="ISBmu6b transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05939"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47743"
FT                   /db_xref="GOA:A0A0H3KFV9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KFV9"
FT                   /protein_id="BAG47743.1"
FT                   /translation="MTKYDEQFKQRVVSAYLRGDSGFDALAARHGIHSGMLQRWVAAYR
FT                   AHGRAGLQSKYSSYDARFKLRVLQHMQRDELSLREVSALYDIRDAGSVARWARLYDEGG
FT                   INALTPRPRGRPRKMVTSLPPKPTEAGTPDERSREELLKENEYLRAEVAYLKKLDALLA
FT                   KKQAAQKKKRK"
FT   repeat_region   complement(649062..649074)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu6b, terminal inverted repeat"
FT   CDS_pept        complement(649111..649902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05940"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRN0"
FT                   /protein_id="BAG47744.1"
FT                   /translation="MKRWIKRVVAVLQSVAVGAAFADGSCQSGFTLRSYPFYDKTGAYI
FT                   GMRQACAPIPCTSGYQDSTCAAPLRNGAIPQPQCQTGAGWVTVSSAVWQGSRWSDPQCS
FT                   YSAQPQCPAGFDTSVPSSWTGSGWTQPECVKFTPPPPVVIDPDVACTAAASSHKLSAFD
FT                   MQVFNSIEQTLTRDAPFQQKTQWRDWSTLPGVNPDWPYGIAGYKGDKVFTGTWTGPWYN
FT                   KQLACTQQNSWATYCYVNPSNGAVDFLWVNTAGAGNGQCNH"
FT   CDS_pept        complement(649914..651116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05941"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05941"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47745"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ63"
FT                   /protein_id="BAG47745.1"
FT                   /translation="MLSIIEAVIVLVATALMTLQGIQHDVETRRRDVLSVEGKNQAVIN
FT                   AALSKWVTDKYALLVAQMVGSKATAVTPPTLADLRAGGYLKADYATGPIWGGTYMIQMS
FT                   VGPDNCSTGSGSCQVSYVFYSSQPVTRLGKPDVSGAGVVAQAAGNDFGFSTSQNPVTIK
FT                   GLSGRWQAVNPVPGAPAAVVMATNGPSSDGNSVFIRRDGSLKWTGSQDVNGVDLHNVGN
FT                   IDATGTIGAPTLAASNVAVSNAVRSPGTLLVQNAAGTAPAPISTGDSTVNGQLQVTQTI
FT                   TPGAIATPRAWCPVNGAMAQNSDGRGQLLSCQDHAWLPIGGPALRQGYFMVQNGWGVPA
FT                   PNCATGGTPQIVFSPVTFYVNPTATVNVSASGSGPWTVFITDGNGNGITGTAVVETYCS
FT                   Y"
FT   CDS_pept        complement(651126..651719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05942"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05942"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47746"
FT                   /db_xref="GOA:A0A0H3KR85"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR85"
FT                   /protein_id="BAG47746.1"
FT                   /translation="MKKFNQMNKTKRLYVGKGRRRQKGELSLVEAAGVMAAAALIALVV
FT                   YMGRGYVMDRIHAMQFKSEAQYFVSGIQDATAGEIDFSSVTMLSLTQNRAFDTAGRRLN
FT                   KSTGALTGIFGGAVTAAPATVTATNDAIAVTYPIPAKVCALSADSISQAYTQVKVNNTT
FT                   ISGPSTTFDSGTAAAACASAGGTASVIMYATKGN"
FT   CDS_pept        complement(651731..652771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05943"
FT                   /product="type II secretory pathway component"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05943"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47747"
FT                   /db_xref="GOA:A0A0H3KQV8"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQV8"
FT                   /protein_id="BAG47747.1"
FT                   /translation="MFYRETRLDVAKKGLRNSETLLERLDTLAERHRKRKNMSWLAFQK
FT                   IAQRMRAGDDFATAMKPFIPNDEFVLLELASESPRDDAAIRGLELAEMAAHAKGVLSAT
FT                   TSMQMAYPAFLIVYLYAFCVLFGSEILPATLDVQPLEKWSAFGRFVYAFDTFCADYWWL
FT                   TSSVVAGLILGYFQTLKRWTGKFRNKVDAMPLMWRNRRDLRAALLIVSLAGLFDSGLTL
FT                   RAALDRLMKMSDPWMRWHLRRMSTRLTANPDKPMQALDTGIFSETTIDIMTDAAGRDQF
FT                   VESIKELGQHSLSRVVDAVKRNAKITHYVLLGGAVLLFLVFGLGSYFATGAVAFDGVST
FT                   SLNQKF"
FT   CDS_pept        complement(652861..655068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05944"
FT                   /product="ATPase PulE/Tfp pilus assembly pathway"
FT                   /note="COG2804: Type II secretory pathway, ATPase PulE/Tfp
FT                   pilus assembly pathway, ATPase PilB, Aquifex aeolicus"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05944"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47748"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVN6"
FT                   /protein_id="BAG47748.1"
FT                   /translation="MPIVGREPTDTGDPAVSAEPNGGREPRFKSASKPVNPRQGDHGQP
FT                   MTMGMRLRRAQEEAEDVAIIGEARNGEWPAKAEIDVAVALAQQEPDDGRASAKSSAAVP
FT                   MAAVGENISATPAHVADVPADPATESPQERAGVAEPPAPAQATTTPSVDAASQWTSGYD
FT                   VPPTVRRIGMDVTETSEIAIEGGRPRLVHADSLSFKRVLCQRDEHAALAVTEAARREFI
FT                   AVELQAGISIVVATQRFHESQLYATYLKDLARADISVHEEMVADEEVIASLYGKEKQRA
FT                   ASVVPESSRAIGLFRDVIEAAHAYDASDVHWEYRDFSDNVALRLRVDGEMYSYRELPKP
FT                   MVRKALSASYQDLVQRNTNSGESFQMTAPQSAMIPLVAHTDIINIRWQSAPLVGGFDVA
FT                   LRLLDGNFSRVRVLMPHEMGLEKSQIEILESLGKVTGGATFLTGETGSAKTTLLRAMSY
FT                   LVPNRDRIKQFAVNEPSEVPAPWLSDISIQRRTNESEEDANRKIVEVVRTLMRMDPDDL
FT                   TIGEVRDSVLAGLVAELALTGHPVRTTLHGNSILGAVMRLVGGRLKLPMDEVASGSFLN
FT                   AVGNQKLIPKLCPHCKRPARDVLSATQVATLERKFALDTSMMACRDENGCAHCRRPGLF
FT                   TRDGKVAAGIKGQTLAMELYRPTPEFLACVAARDWRGAEHVWRTSRKTDFANADMTGKT
FT                   VYEHALYKASQGLIDPRFIDESMCAFEAYRLFPDAHGGSPS"
FT   CDS_pept        complement(655170..655751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05945"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05945"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRN4"
FT                   /protein_id="BAG47749.1"
FT                   /translation="MSSIKHALIAAGVGFAVSAHAEPVGAKLSIDDIDQLARASVVRSL
FT                   GGAATAPGMLPPGAMTQPQPGIAASGVTAEVPPKPVEKPIRPPRAHAESVAFLGAFNDE
FT                   AGAHVLYSYRDAIYPARVGSTLLNGWNVKGVDGYAVTVAEGKRIWKEPIRGVAPIQMSP
FT                   ATAAVRSLVDLNSPLPSGVPLPGISLGGTQ"
FT   CDS_pept        complement(655738..657066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05946"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05946"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ65"
FT                   /protein_id="BAG47750.1"
FT                   /translation="MMHITEPLPTDKRARLVFGIDWRAYPVKGGSAERRRYTDAFNATH
FT                   FVEFKVGTELIGGFAEPDMSEIKGARLFSGAARVAQHERIKNRSAALVLLQDGPRVYFV
FT                   FVVRGAVRSDEVLTLEQAQSRRLEIEQACLKSNLSLDTLGTGDRIGGVDEAFQASELLA
FT                   NRKVGLLRRPPISLPTAIPVLAIVVGAFFGVPKIADMLSPPPPPARPPTFAEQYAVAVR
FT                   DVFARMQPRASELAPALLTAVGAKESVRKGWLFQEANCPSSGFCTMTFRRNGGTFAAFD
FT                   EAATADMRPLSFARDGRTLTSRGPAVPKAAPLMESESKSWPSEQAFIDMLQTPPQRMSV
FT                   QPLELRAYGYTVNLGEARPLVTTPGAVDGAQVGRMLKQGDWTIEGFRWQSPLLAKLPPN
FT                   MALESLKVELRLNEGAPANADKETGDSPYGVHFTAKGKYYVFN"
FT   CDS_pept        complement(657071..658627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05947"
FT                   /product="type II secretory pathway component"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05947"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47751"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR89"
FT                   /protein_id="BAG47751.1"
FT                   /translation="MAAGCAVTQQDVNDSYDAAHRTISDALGKGPAPMALVEDVPTAFL
FT                   GDRLVPLAYEATLPAVFRDKTVTLPANLGIKQIATLISTATGYPVHLSPDVFVPRDSLV
FT                   PGQTESKGQINAARTEEPVYRQAFSGKAGMYMRNMTTDLGLDWSFDGSTINVNRFVTRM
FT                   YQIAAIPGKVSIKSTMSKGMDTSTGNQSGNGGGGSSGGNTGSFSAQTSTGREGDFDQIA
FT                   AITAEIEKLKSPMGRVSVNPQSRLVMVYDTKEAADNIGKLLKHENAISTRQVAITVRTL
FT                   QIALNKGSQAGVNADVVFNAMHAGLARYAISFTSPTSLATGGGAVGVSVLRPDAPFSGT
FT                   NAVVNALNQYGRTVQDNTMTKMTLNGLPVSVASFKSDDYLRSTTPSSGSLTATSGGVPG
FT                   LTPGTITTGDFVNVLPAVNDHNQIVLAYWADSSKLNGPFTSAGAGSGQTQQQIQLAHTV
FT                   GTKDDQTIALSDGQTVVLYGAITDQADSTTNTGIAGLTGSWNKSKTFQVIMLKATVVPS
FT                   M"
FT   CDS_pept        complement(658681..659232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05948"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05948"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47752"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQW1"
FT                   /protein_id="BAG47752.1"
FT                   /translation="MHKIHSNQARIRALVAGGLAVLHLAAHAAVDPVTNSIDADGWQVL
FT                   ASAPKAQPATAESPKPNQALLPPAPTSATAAPSADVAAVVLPGAGAAAASGTLTFSVTP
FT                   ADVNLRDALDRWLQQQGWQLAWKIDDDLPLEFNASFTGDFTSVLQQVMKATNHMRTPTR
FT                   ACRHTNNVIRVIARAGNCQD"
FT   CDS_pept        complement(659235..659660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05949"
FT                   /product="lytic transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05949"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47753"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVP0"
FT                   /protein_id="BAG47753.1"
FT                   /translation="MIRIAPIVAAVLAFIALPSRADCLDDAAAFHRVNPRLLRVIAQHE
FT                   SGMRPNAVNRNSNGSEDIGLMQINTSWLPTLARYGIRREHLFNGCVSAYVGAWILASNV
FT                   RRFGPNWKAVGAYNAVTPSKQLVYASAIYRRFMQQGR"
FT   CDS_pept        complement(659657..660925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRN9"
FT                   /protein_id="BAG47754.1"
FT                   /translation="MKHTIKFLACATSAIVCATASAANTDPFDFDYDILGGISERPALI
FT                   FNDGEKTYIQPRAGQVIVAEGGNTEGPYVVVEGTPSSITYKVGAHSATARWKKANTFIG
FT                   AAAGGTAAMKDDQPAGFDGFTNRLVMIGTRPALEPVRRLHASMTVGGFVKALVPQGWTG
FT                   SAQKDVDLTTPENFATRDGENWMQALDRLMTQAGLYADVDFTARHVRLHRDAPKSAALN
FT                   YASTSRDADEAGLNRVVARVTAEAPPVSRLAERFGAQAIRDSDDSHMQIRFTSKPAKTV
FT                   TFKTPDGKELRTSWDESKSVMTIDRAERFIVADATNRVEVTRDAKTVYDFDQPNAAKLE
FT                   AVFDRDGRTYFKFAGSVVRVGVTDTRNLGIGEQKGRYFMFEGTSDMFTVTADGNTIHVK
FT                   RRKEVVYREVPDAPLQASGGPTP"
FT   CDS_pept        complement(660922..661728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05951"
FT                   /product="putative soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05951"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47755"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ69"
FT                   /protein_id="BAG47755.1"
FT                   /translation="MIARAAFALAFALAASYAQSAVIAQVISPVSVVIQDGQSRRVAML
FT                   PGKPVYYCGLDAFIEWASPLVGQPVRSSRETGITVSIDGRDVALDDLFIDRGWLQPPVL
FT                   DDGAQAALVERRGGWACSRAVVPFELLHTNVDPKILAGIALNESNYRGRAWPWTLNVAG
FT                   QGYFFKSREEAYKAIESLLARDRCDFDVGLMQVNWCYHGKRFRSAWDALAPATNVAVAE
FT                   AILTENFARTDSVAKAVAYYHSANPNPGRAYLARFVQHLSMIEAGL"
FT   CDS_pept        complement(661725..662999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="BMULJ_05952"
FT                   /product="type IV secretion system protein"
FT                   /note="KEGG, K03195"
FT                   /note="TrbI protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05952"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47756"
FT                   /db_xref="GOA:A0A0H3KR94"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR94"
FT                   /protein_id="BAG47756.1"
FT                   /translation="MAKNTDPTSSEEKALFKGKVPRNVMIAVGAIAAVAIGALGFYTQT
FT                   QQANKAEEEALKAKRERAAEAVDKSNGNKADVDKIIEEQQAQARRRAAEAAAAASAAAA
FT                   ANVKKPALSADAVLPTGNTTEIKASNDQDSIFVSPIFRAGIKIKEGQAQQPEGPPGIVT
FT                   PQQMLLQQAAARDAAMKDSIAQAAMAARGAQGTSPMTSQQRDSAFMHDVAQLSEGDKDF
FT                   ARAGFVGQSHGCTLSPPAKIPVLSNEALNSDRPGTASLTVETDVYANNGDGRCLVIPWG
FT                   TTIVAPYSADIQPGQESILVAGAEMRLPNGKHVPLYGAQGADGNGAAGFSGHVNNHFLR
FT                   IYSTSFLTAILVRAFSNSDQSTTTGPLGVTQAGSTAGQIAAQTAQSVLDRYKNIPPTIT
FT                   SSPGERHFMLKVNRDMVLEEYRGAR"
FT   CDS_pept        complement(663007..663882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="BMULJ_05953"
FT                   /product="type IV secretion system protein"
FT                   /note="KEGG, K03204"
FT                   /note="TrbG protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05953"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47757"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQW5"
FT                   /protein_id="BAG47757.1"
FT                   /translation="MKRTRSLLGWGALAVIAASANAFAAKSAANPIAPVPNFDVGSIIG
FT                   DAMSPVNPYNSGADPITMPGDARMAVFTYSRDKIFRVMTAPLKLTTIELERGETLVSEP
FT                   AMGDSVQWVLDTDGANHVYVKPTKPGLVNTLHLSTNRREYELTLVSSPLGGLFYQNVRF
FT                   SYANSLMAKVRARGNATGEEHDTDQGAPSDSGPIGVSPDKLNFEYTVSGTNSLKPETVF
FT                   DDGTFIWIRMPPRTPFAVPTIKDGGDVVSPNFIRRGPYIVIQRLADEVKLTRPGEEVTI
FT                   TRGRRGLFGF"
FT   CDS_pept        complement(663879..664343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="BMULJ_05954"
FT                   /product="putative type IV secretion system protein"
FT                   /note="TrbF protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05954"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47758"
FT                   /db_xref="GOA:A0A0H3KVP5"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVP5"
FT                   /protein_id="BAG47758.1"
FT                   /translation="MVKQLAAYNPDDQAKRTAIKQDVEHWFTIEPVLTDDIRTSRLAKN
FT                   INAVKAKMIGNAKNQFASWISDDKPFDQITTNPKLVREPKVTNVSLLEDSTVVVEFTTS
FT                   TRQSPADKPVEVRFALTMRYQIIPPTAEDVLGTNPYGLYYPFFTLQKTGA"
FT   CDS_pept        664997..665635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05955"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47759"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRP3"
FT                   /protein_id="BAG47759.1"
FT                   /translation="MTHFDSCNGSAIEASDICRDRLAAIERHEDLRRAGSPPIVLGEFY
FT                   RKQLDRELWPSQAKLAADLNMSKPLVTRSIQASLLPPEVVAAFGGPYHISYRTAGLAMR
FT                   LINSVGRAVVVQRALTVPNTTPSAKKVISILATGVVQTDDAAKLRISLGANGKHLIIDG
FT                   PHIDRVIPHLALVQRLLNVMLPSVLPPCADGILLAGDRGLTGKRLRRER"
FT   CDS_pept        complement(667415..673339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="BMULJ_05956"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="COG0178: Excinuclease ATPase subunit, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03701"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05956"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47760"
FT                   /db_xref="GOA:A0A0H3KZ72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ72"
FT                   /protein_id="BAG47760.1"
FT                   /translation="MSSSHLIRIRGARQHNLKNLDLDLRTGEMTVVTGPSGSGKSSLVF
FT                   DTLYAEGQRRYVETFSAYARQFLDRMDRPQVDRVDGVPPAIAIDQTNPVRSSRSTVGTM
FT                   TELNDHLKLLYARAAELFDRKTARPVRHDTPETIHADLLARTAEHDPRLAITFPVELPD
FT                   SVTDEEVEQWLSASGYTRVQAQREVASPTGPRKVLDVVADRFRLHQVEKARAVEAIEAS
FT                   LKRGGGRVNVYVLAQAPEGDGAVAREPEVWRFSTGLHDPESDLRYAEPQAALFSFNSAY
FT                   GACETCRGFGRVIGVDLGLVIPDARKTLRGGAIKPMQTPAWKECQDDLMRYAAKAGIRR
FT                   DVPWSELTPAEQDWVINGSPDWTGSWQSQWYGVRRFFGYLESKAYKMHIRVLLSKYRSY
FT                   TPCETCGGARLKTESLLWRLGSKENADAVLAPADRFMPHGVDWSRAQLEALSGLTVHDL
FT                   MLLPIDRIRRFFDTLTLPSALLDDALKLLLAEVRTRLKYLCDVGLGYLTLDRQSRTLSG
FT                   GEVQRINLTTALGTSLTKTLFVLDEPSIGLHPRDLNRIVEAMQRLRDAGNTLVVVEHDP
FT                   SVMLAADRLIDMGPGPGERGGTIVYDGTPADVRGAATLTGEYLGGRRQVAHASHWARRP
FT                   VDAQTPRIVLEGAREHNLRDVTVEIPLQRLVCVTGVSGSGKSTLIQDVLYPAIARQLGR
FT                   PTESPGAYRALSGAEQIGDVVFVDQSPIGKTTRSNPASYVGAFDEIRKLFAKAPLALQR
FT                   GYGAGTFSFNSGDGRCPTCGGSGFEHVEMQFLSDVYLRCPDCDGRRYRAEVLEVRIARD
FT                   GRALNIADVLDLTVSEAAAFFAGDADVLRVLQPIVDVGLEYVKLGQPVPTLSGGEAQRL
FT                   KLAGFLAESAAAGNGRRVVTQEARVARSRLFMFDEPTTGLHFDDIAKLMQAFGKLLAAG
FT                   HSLIVIEHNLDVIRAADWLIDLGPEGGDGGGLVLCAGTPDDVKACAGSHTGAALRDYER
FT                   AMDASAAERADEGVPLQAALNAARARRAIEGEDVVRIVNAREHNLKALDVDIPHGKFNV
FT                   ITGVSGSGKSTLAFDILFHEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAIEQ
FT                   RLSRGGRKSTVATTSEVWHFLRLLYVKLGLQHCVHDGTPVASQSVESIAAQLLREHRGQ
FT                   HVGLLAPLVVNRKGLYTDLAKWAKARGHTHLRVDGEFVPVDPWPKLDRFREHTIELPVA
FT                   DLVVSPDDEAELRQRLDETLEIGKGVMHLLVPLDDLHHAIANGHSTARVGDVKVLSVKR
FT                   ACPVCGTSYPELDPRLFSYNSKHGWCTTCVGTGLALTREQRAAYDDTVFAEDGRGREQT
FT                   LPSDEQEPEGVGEEPCADCGGTRLNPTARAVTFDGHPIVEVAQWTVSDTRRWIDGLRLV
FT                   GRDAQIARDIVSEIGSRLAFLEEVGLGYLSLDRAAPSLSGGEAQRIRLAAQLGSNLQGV
FT                   CYVLDEPTIGLHPRDNQILLNALRQLGDKGNTLVVVEHDEDTIRRADHIIDIGPGAGKR
FT                   GGTLVAQGKVADLAAQSSSLTGRLLAQPMVHPLQPRRRVVAPGRRNAEAVPGHWLTVHR
FT                   ANLHNLRDVTVGIPLARLVAVTGVSGSGKSTLARDVLMTNLLDAVGRSVLSSPAVRRAR
FT                   KSAAQDAPAANRRASVLARSAPRPALNVAHVWQGCESIDGWQHIDRVLEVDQTPIGKTP
FT                   RSCPATYIGVWDAIRRLFADTLEARARGYTASRFSFNTGDGRCPACEGQGVRTIGMSFL
FT                   PDVKVPCDVCHGQRFNPETLAVTWRGRNIGEVLTMEIDEAVEFFASITTIAHPLQLMKD
FT                   VGLGYLTLGQPSPTLSGGEAQRIKLVTELSKVRDDITRRGQKAPHTLYVLDEPTVGLHM
FT                   ADVAKLIRVLHRLVDGGHSVVVIEHDLDVIAEADWIIDLGPEGGVGGGTIVAAAPPEAL
FT                   VEVAASHTGRALAPVLAREHGQGQRHDESREVERADEAGGD"
FT   CDS_pept        complement(673511..674473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05957"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases),
FT                   Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K00540"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05957"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47761"
FT                   /db_xref="GOA:A0A0H3KRA0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRA0"
FT                   /protein_id="BAG47761.1"
FT                   /translation="MQGTTAGLVAGVAMPAVAQTGAPSAGDTAPRDPRPLYPHAPFPAQ
FT                   HQPWPGLAGRMTPRPDHGERSYRGSGRLAGRKALITGGDSGIGRAVAIAFAREGADVAI
FT                   VYLPEEEPDAREVVQLIRSAGRTAVPLPVDIRSEAACNRLVEQAATALGGLDILVNNAA
FT                   RQQSHPSILDISTEQFDWTLRTNLYAMFWITRAAIPRMPAGAAIVNTTSVNAYDPSANL
FT                   LDYAMTKAAIANFTKGLAKQMIERGIRVNGVAPGPFWTPLQVTGGQTEQNVEKFGEQVP
FT                   MGRPGQPAEIASIYVELASAQASYVTGQIYGASGGAGQP"
FT   CDS_pept        complement(674635..674925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05958"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05958"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQW8"
FT                   /protein_id="BAG47762.1"
FT                   /translation="MTQSKQQQDHDTRGTRPGTQDEQPLQPAEPPHRPEAGRPPGHAPG
FT                   GGELDEIPDADVGKVAPDDPRETEVRDPANDKPWPEEHDGPDDAGDRPRPL"
FT   CDS_pept        675451..677733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05959"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05959"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47763"
FT                   /db_xref="GOA:A0A0H3KVQ0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025847"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVQ0"
FT                   /protein_id="BAG47763.1"
FT                   /translation="MVSPLEPAPSGADHFVQFYDSVEQLLPEVVAFAGDALRSGGSAIV
FT                   IVRADRLADVVERLGALVAAIGEPARRRVFVSDAEALLARFMDGDMPDRDRFLRSVGAI
FT                   VEAAIAAGRPVHAFGEMVAVLCARGQPDAALRLEALWNELIERHRFSLYCGYPHDAFPG
FT                   AEQSTLFRHVCALHRRVLPAASLRNDERELHLTLALSQQRSRALGAEIRRREDAERQRN
FT                   GVLMHAPLPIALLAGPEHRIVLANHRFSAMCGRTDIVGRPLASVMPGADSPAVTRALDD
FT                   ARAHGVSTTIGEHRDRATPEGARVYRLHFNPQPQADGIGVIVSAVEVTEHVAAREKLQA
FT                   ANAERDRLLAELRDANHAKDQFLAVLGHELRNPLTPISLALELVRSREGHATPNEIAII
FT                   QRQLDHMVRLIDDLLDVSRITRGKIELKKEAVRIGDIVDRAVEVASPLLEQRRHRLHVD
FT                   IDADVRCHGDPVRLSQVVANLLTNAAKYTAPGGDIGLHVARSDGDTIVIEVRDSGAGIP
FT                   PDRLDSIFEPFFRLGGEPGRMDGGLGIGLALVKSFVMLHGGTVRADSAGPGLGSTFTVT
FT                   LPEYRPTALDADAREPEHRPAAVPVGTRRRVLLVDDNEDAAATLAQWLRDAGHDVAVVH
FT                   DPLSALGAFRSHEPDVAILDIGLPVMDGYELIRRLKAIETDKPCTFLALTGYGRIADRE
FT                   RCLEAGFRHHLVKPVDPAALHRAIDDSDPVHAPAPLAPAAPIAAVAPVPAASPVPPLPQ
FT                   VDGQPQL"
FT   CDS_pept        complement(678345..678617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05960"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47764"
FT                   /db_xref="InterPro:IPR021327"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRP8"
FT                   /protein_id="BAG47764.1"
FT                   /translation="MDDQQNVKNGDREAQIRERAYRLWQDAGSPDGNAEAYWLMAERQL
FT                   DAEGGATAATEPPLEQSAKRRIPGEPLQEDDTALSDELAHDRRRI"
FT   CDS_pept        complement(678680..679105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05961"
FT                   /product="putative signal transduction protein"
FT                   /note="COG0517: FOG: CBS domain, Pseudomonas aeruginosa"
FT                   /note="contains two CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05961"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47765"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ74"
FT                   /protein_id="BAG47765.1"
FT                   /translation="MTIVADVMTRDAATIGPTQTLRDAAKLMDDLNVGALPVCDGTRLI
FT                   GMLTDRDIVVRAVSMGVPPDESIEGVVSGPANWCYEDDDIAEVQKKMEDAQIRRVPVVD
FT                   REKRLVGIVALGDLATSADGGMSSTLGAVSSPSRPER"
FT   CDS_pept        complement(679198..679908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05962"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05962"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47766"
FT                   /db_xref="GOA:A0A0H3KRA6"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRA6"
FT                   /protein_id="BAG47766.1"
FT                   /translation="MDTMPIVLQWGDILARVALSLIAGALIGFDRSEAGKTAGLRTAML
FT                   VCAAACLAMLQVNALLGQSGKTPQSFAQLDLMRLPLGILTGMGFIGGGAILHRDGLVTG
FT                   VTTAATLWFVTVIGLCIGGGQLQLGALGLAVGLVVIWPLRHVEQRLRRTRTALVTVEYE
FT                   IASTSRDRLLALMREAGFKCRVRGFHEAATQSLREETFVVQWRETPDNDAMVHRLTGMA
FT                   GPAGLKSIRCSAEN"
FT   CDS_pept        680357..681466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05963"
FT                   /product="putative ADP-heptose:LPS heptosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="KEGG, K00754"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05963"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47767"
FT                   /db_xref="GOA:A0A0H3KQX2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQX2"
FT                   /protein_id="BAG47767.1"
FT                   /translation="MSVIPFAASMQQRIADTPPLARPLRSIVVFRALRLGDMLCAVPAL
FT                   RALRDAQPAAAIRLVTLPSAAQWMRRYDRYVDDIAVFPGDARLPERTVDEAARADFGAT
FT                   LARWQPDLAIQMHGDGRVTNAIVGRFGARAVAGFTRTDAVPTTRAWLPYPDRGPEPLRL
FT                   LQLVRALGASTPSADASHLEFPLTPADHAELRDSGLLARLGDRPLLCVHPGASAAHKCW
FT                   PPDAFAHVARHLAACHGLTIVLTGSAAEQPLARHVAARTGGDTIDATCGLSIGAMAALI
FT                   ARARLLLCNDTGVSHLAAALRVPSVVVLGRADPERWAPLDRNRHVCVRDPDATRVNDVL
FT                   EAGCMLLSRDARAHAAAALSPPRDDVSAR"
FT   CDS_pept        681500..683278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05964"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05964"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47768"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR025350"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVQ6"
FT                   /protein_id="BAG47768.1"
FT                   /translation="MQPIHAADITYFHDAALLARVDDDCGATVDDVGPAWRQIHRNHDC
FT                   NASLWRHEDEARRRDVADRAIVENKRAIDRLNQQRNDAVEALDEVLLAALPPAHADARL
FT                   NSETAGSIIDRLSILALKIHHMGLHVARDDVDAAHRASCRAKLERLREQRTDLAACLDA
FT                   LLADAAAGTARFKVYRQFKMYNDPALNPYLGGQVANDTAAANAGPVASAAAPTAAPAEP
FT                   TRDDAPEPAAPDDPPPTRPTDDPPPTRPTDVPPDMPPTPPMDVPPDAPPTPPGPPPGVP
FT                   RGSAADAHAAASRHAAHGADDMHDTIARPSPTQPASHAVDVLIPTCDRPHALALTLTTV
FT                   ALQTHRPLRVVVSDQSALAAADDALLRAAVRFAGAQGVDVQLERHMPAMGLAEQRAFLL
FT                   AHARAPRCLFVDDDVILEADLVARLVHALDTHRCGFVGSALHGLSHIGDVRAHHQHVEF
FT                   WDGRVRPEVLAPGGPEWARHHLHSAANLYHAQCRLRVPRNASRVYRVAWVGGCVLFDTA
FT                   KLRACGGFEFWRALPARHCGEDVLAQLRVMARFGGCGLFPSGAYHAELPTTVRERDVDA
FT                   PFVLAHLIDEAAHAIR"
FT   CDS_pept        683265..684344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05965"
FT                   /product="putative ADP-heptose:LPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05965"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47769"
FT                   /db_xref="GOA:A0A0H3KRQ3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRQ3"
FT                   /protein_id="BAG47769.1"
FT                   /translation="MRSVDGHIGDVRSIAVVGPDALGDTMMTLPALRALRVAYRDACIV
FT                   YVGLDWHASFFRDRPGPIDVVRVRPAAVDPGRPLPPDAPPIDRTFRVRADDPPFDVAVQ
FT                   LFGGGAQANPFTRALGARIAVGACAPGAPPLDRWTPYGRWQNRRLLALEIVSLAGATLW
FT                   PAGPDLAVIERDRHAMRAALPPDIAEQLHELVVVQPSARDPRRRWSPRHFAAVADRLAA
FT                   RGLRIAVVGTAQERPIVRAVLDAMHAPALDLAGALDIGGLAALLEHAALMLSNDTGPLH
FT                   LAAALGTPCVGIFWFTNALQALPLAQGRCRAAVSPRIVCPVCGEPNLTSRCAHDDSFVD
FT                   DVTVDEVATLADEVLAERT"
FT   CDS_pept        684396..685607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmpA"
FT                   /locus_tag="BMULJ_05966"
FT                   /product="nitric oxide dioxygenase"
FT                   /EC_number="1.14.12.17"
FT                   /note="COG1018: Flavodoxin reductases (ferredoxin-NADPH
FT                   reductases) family 1, Sinorhizobium meliloti"
FT                   /note="KEGG, K05916"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05966"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47770"
FT                   /db_xref="GOA:A0A0H3KZ78"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ78"
FT                   /protein_id="BAG47770.1"
FT                   /translation="MLTQQTKDIVKATAPVLAQHGYDIIQCFYRRLFDAHPELKNVFNM
FT                   THQEQGQQQQALARAVYAYAENIEDPGSLAAVLKNIANKHASLGVRPEHYPIVGEHLLG
FT                   AIKETLGDAATDEIISAWAQAYGNLADLLAGMESGLYEQSATRVGGWTGWRTFIVRDKR
FT                   PESSVITSFVLEPADGQPVANFEPGQYVSVAVDVPTLGLQQIRQYSLSDMPNGRTYRIS
FT                   VKREGGGPYPPGHVSCLLHDHVNVGDEMRLAAPYGCFHIDVDASTPIVLISGGVGLTPM
FT                   ISMLKRAIQDPKRQVVFVHGARNSGVHAMRDRLRETARTHTNFSLIVFYDDPLPQDLPG
FT                   RDYDHAGLVDVNAIKDAILLPDADYYICGPVPFMRLQHDALKQLDIPEARIHYEVFGPD
FT                   LFAE"
FT   CDS_pept        686084..686767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05967"
FT                   /product="putative intracellular protease/amidase"
FT                   /note="COG0693: Putative intracellular protease/amidase,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05967"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47771"
FT                   /db_xref="GOA:A0A0H3KRB1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRB1"
FT                   /protein_id="BAG47771.1"
FT                   /translation="MTRRILHVVTNIAHYADPSQPTGLWLAELTHAYDIFAARGYTQQL
FT                   VSPKGGVSPLEPRSLKWPHADAAAKAWRADPAHQTLLANTARPDDIDAAAFDAIYFTGG
FT                   HGVMWDFPDDAGLQRLTREIYERGGIVAAVCHGYCGLLNTRLSDGSLLVTGRRLTGYAW
FT                   IEEVLAGVANKVPYNVEEEMKRRGARYEKALLPFTSNVVVDGRLVTGQNPQSAKATAEQ
FT                   VAALL"
FT   CDS_pept        complement(686908..688149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05968"
FT                   /product="putative saccharopine dehydrogenase"
FT                   /note="COG3268: Uncharacterized conserved protein,
FT                   Synechocystis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05968"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47772"
FT                   /db_xref="GOA:A0A0H3KQX8"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQX8"
FT                   /protein_id="BAG47772.1"
FT                   /translation="MTQASYDLVVFGATSFVGQILTRHLAEHLSSGADTLRWAIAGRSE
FT                   AKLAQLRDSLGDAARTLPILVADASDDAQLQALCAQTRVVVSTVGPYALYGEPLVRACA
FT                   QSGTDYCDLTGETQWIKRMIDRYEAAATQSGARIVHCCGFDSIPSDLGVYVLQQRARHE
FT                   WGAPAEHVTMRVKTLKGGASGGTVASMINVVREAAADPALRRMLLDPYALCPRDHRFTV
FT                   RQHAVRSAEFDRDCDAWIAPFVMAAVNERVVHRSNALAGDAYGSGFRYDEAIVTGRGIR
FT                   GSVVARATVVALGAFMAGVLVKPVRSAMERFLLPKPGEGPSLAAQRAGCFDLRFFGHAP
FT                   DGRIVRLKVTGDRDPGYGSTGKMLGQAAICLALDCRAGNDGTRGGGFWTPATMFGERLV
FT                   DRLVRHAGLRFDAI"
FT   CDS_pept        complement(688146..688448)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05969"
FT                   /note="inactivated hypothetical protein"
FT   CDS_pept        690168..691088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05970"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="COG0583: Transcriptional regulator, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05970"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47773"
FT                   /db_xref="GOA:A0A0H3KVR0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVR0"
FT                   /protein_id="BAG47773.1"
FT                   /translation="MKPPKSHSSLPSLRALRYFVSVGKHRSIKAAAAELHVTASAISQQ
FT                   ILKLEDELGVSLLHRSARGIDITPHGMRYMQELNQVFDRILRATDRLRSNANHTEIVTV
FT                   SCAHSFAMQWLVPRLAQLAIAEPTVDLRISTTNRYAAFAEDQIDFAVRHGTGRYHGLHS
FT                   ELLLDDPLSPVCNPRLIKQIGPFSSFSDLVRTTLLHDERHNEWLAWLEKYRADGIRGNK
FT                   GAIFTDSNVAIHAAMACHGVALARKSLVRSELDDGRLTILFDAPLTPEYAYYLVYPNET
FT                   LDNPSAILFRKWIMKNVMQSLASSG"
FT   CDS_pept        complement(691131..692027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05971"
FT                   /product="drug/metabolite transporter (DMT) superfamily
FT                   permease"
FT                   /note="COG0697: Permeases of the drug/metabolite
FT                   transporter (DMT) superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05971"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47774"
FT                   /db_xref="GOA:A0A0H3KRQ7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRQ7"
FT                   /protein_id="BAG47774.1"
FT                   /translation="MNATNFAFLLTLAALWGASFLFIRVGAPEFGPVPLMAVRILIAAV
FT                   FLAIVLGSKRGFHRMSGKIVPLFAIGVLNQALPFCLFAYAELTLPAGVTSVINATTPLW
FT                   AAIVAFVWIGDRLSRTRVAGLFIGFAGVLILVWKDLSGLRSFSESAIAPIAVLCATLLY
FT                   GISANATKRFLAGVDSLAIATGSMIGAAIVLAPFAVVYWPSTPISTTAWVSVIALGVAC
FT                   TGIAYIIYFYLIATAGPARAVSVTFLVPIFGLLWGTLFLDESISPMMIAGCGVVILGTM
FT                   LASGVLKPSVLVGKRPV"
FT   CDS_pept        complement(692910..694640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="BMULJ_05972"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Pseudomonas
FT                   aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05972"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47775"
FT                   /db_xref="GOA:A0A0H3KZ82"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ82"
FT                   /protein_id="BAG47775.1"
FT                   /translation="MTTCDVARRSRRPRALRRATAVAVAAAALAAGTLLGACTVGPDFT
FT                   PPRADLPAGWHALQRADAAAPASGASAPASTPTTDADPDPRWWRAFGDPLLDRLVERAA
FT                   RDNLDVQAAVLRIAQARAQVRAAAAQGLPDVRASASYQREQLGLKGFVEDQGLDRQIDR
FT                   LGAPGSPLDRLGPGTGAAVQQRARGALDALESPVNLWQAGFDASWELDLFGRVRRTVEA
FT                   ADAQAGAAVASRDDALLSLEAEVAQTYLQLRGAQTQRALADELVDAQRELRDLTREQAA
FT                   HGLASDLDVRSADARLAQLRAQLPQFDQQIVLLKNGLAYLVGGAPGALDDWLDTPRALP
FT                   GVPPAVPVGLPSTLARRRPDIRRAEADLHAATADVGVAVAQFYPDVSLTGQVGLRATHV
FT                   RELAHWSHLFYAFGPAVSLPIFSGGALVSNLRLTQARQAEAALAYRQTVLVALRDVDNA
FT                   LAVCRTDQTRAAALDDAVRAEQGALELARDRYRKGLSPFLDVLDAERQWSEGRQQAVQG
FT                   ALQTTTDLVALYKALGGGWREGEGGRDGGARADARRVDAARADASRTDAARDAQAPAQP
FT                   "
FT   CDS_pept        complement(694642..696234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrB"
FT                   /locus_tag="BMULJ_05973"
FT                   /product="multidrug resistance protein B"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Pseudomonas aeruginosa"
FT                   /note="KEGG, K03446"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05973"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47776"
FT                   /db_xref="GOA:A0A0H3KRB5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRB5"
FT                   /protein_id="BAG47776.1"
FT                   /translation="MNRPADQAAAPGGDWRPAANPWLVAVVVTLAAFMEVLDTTIVNVA
FT                   LPHIAGTMSASYDEATWTLTSYLVANGIVLPISGFLGRLLGRKRYFVLCIAAFTACSFL
FT                   CGIATNLGELIVFRVLQGLFGGGLQPNQQSIILDTFPPEQRNRAFSVSAIAIVVAPVLG
FT                   PTLGGWITDHFSWRWVFLLNVPIGVLTVLAVMQLVEDPPWRRGAVRGLSVDYVGIGLIA
FT                   IGLGCLQVMLDRGEDEDWFGSTFIRIFAVLSALGLVGATLWLLRTKKPVVDLSCLRDRN
FT                   FALGCVTIATFAAVLYGSAVIVPQLAQQHLGYTATLAGLVLSPGALLITLEIPLVSRLM
FT                   PHVQTRYLVGFGFVLLAFALAYSRMLVPDIDYRHLVMIRCAQSLAIGFMFVPITTLAYL
FT                   TVPQRLNDDASALFTMFRNVAGSIGISVSTALIRERTQARMAHLSAHTSPLSQNFQDAL
FT                   HANARAIAELSGGTPAAALQTANGRLYETFVSQATILAYIDVFALLAVFCAACIPLTFL
FT                   FSPVKAARAGGGH"
FT   CDS_pept        complement(696322..697548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrA"
FT                   /locus_tag="BMULJ_05974"
FT                   /product="multidrug resistance protein A"
FT                   /note="COG1566: Multidrug resistance efflux pump, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03543"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05974"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47777"
FT                   /db_xref="GOA:A0A0H3KQY1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQY1"
FT                   /protein_id="BAG47777.1"
FT                   /translation="MRVARAGDDAADRGSGTGSGHGEPRGERDADAPGGGGGDGHPHDD
FT                   RGGRTGSDGDGAGDGGERKRPGRKPLIILGAIALLLVVGGLVWWFATRNQESTDDAYTD
FT                   GNAIAVAPHVSGYVTRLAVDDNVYVHRGDVLVEIDPRDYRAQVDAAHAQLGLAEAQLDA
FT                   ARVQLDIARVQYPAQYRQARAQIESAEAAYRQALAAQARQRAVDVRATSQQAIDAADAQ
FT                   RASADANVAMAQAQARTASLVPQQIRQAETVVEERRQQVLQARAQLEQAELNLAYCTMR
FT                   APSDGWVTRRNVQLGSFLQPGTSIFSIVTPRVWITANFKESQLKRMRVGDRVDVSVDAY
FT                   PDLDLHGHVDSIQLGSGSRFSAFPAENATGNFVKIVQRVPVKIVLDGPLPRNPPLGLGL
FT                   SVEPTVHLK"
FT   CDS_pept        697964..698170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05975"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47778"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVR5"
FT                   /protein_id="BAG47778.1"
FT                   /translation="MTRPTPLDTDTRGEDRGDSTPGPEGKRGGTATPPPRSARDPAEGK
FT                   PQSDDARPGAQPADHGDRAADKD"
FT   CDS_pept        698333..699259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05976"
FT                   /product="Mn-containing catalase"
FT                   /note="COG3546: Mn-containing catalase, Pseudomonas
FT                   aeruginosa"
FT                   /note="KEGG, K07217"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05976"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47779"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRR3"
FT                   /protein_id="BAG47779.1"
FT                   /translation="MFIHNTRLQYTVRVDAPNPGLANLLLEQFGGPQGELAAAMRYFTQ
FT                   AITEEDPGRKDMLFDIATEELSHLEVIGSLVAMLNRGAKGELAEAVDEQAELYRKLNGA
FT                   GNDSHVTQLLYGAGSPLTNSGAVPWSAAYIDTIGEPTADLRSNIAAEARAKIIYERLIN
FT                   VSDDPSVREALGFLMTREVSHQKSFEKALYAITANFPPGKLPPMEPYDRVYFRMQEGAE
FT                   PMPGPWNRGDALSVRRGEPAVDGGDGLATGAVDPTQSQALEAMARRLASDPNCDPTTGA
FT                   ELGAGAPHDSTTSPVPPVSGTPGTPGV"
FT   CDS_pept        699322..699843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05977"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3685: Uncharacterized protein conserved in
FT                   bacteria, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05977"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47780"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ85"
FT                   /protein_id="BAG47780.1"
FT                   /translation="MASEANVVDERLMEWLRDAHAMEEQAETMLSSMAGRIEHYPDIKR
FT                   RIEQHIEETREQARLIRSCIERRGGSVSTMKDLGAKTMAWVQGMSGMFVSDEIVKGGMA
FT                   SYMFEHFEIAAYRNLIEAARVAGDIETQTICERILPEEQAMAAWLEHNMAGVVRTYLAR
FT                   EMRPNTTAKR"
FT   CDS_pept        699945..700472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05978"
FT                   /product="putative oxidative damage repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05978"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47781"
FT                   /db_xref="GOA:A0A0H3KRC0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRC0"
FT                   /protein_id="BAG47781.1"
FT                   /translation="MNTFAACPLPDMKLPDPADFPVRAVPLAPLAKERATVLCHRNGRV
FT                   LLVARRPSSRWTLPGGVIRRGESALDAAHRELHEETGLTGLDLAYFFYVDGNVKRHHVF
FT                   VVDLPPGMHACPGREIALCRWVPIDAVTRWPASAPTQRIVHQLAQLRGIASAHAPAALT
FT                   RGPCRPPLQSAP"
FT   CDS_pept        complement(700429..700920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05979"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05979"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47782"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQY6"
FT                   /protein_id="BAG47782.1"
FT                   /translation="MAERLPDDTTPPPSEPNAHDALERLLGSLHRHGFLRFANDVVSAN
FT                   AKIAEVLVGALDKPGTQTGVQNLAMLVMALSRVPPEQFGKTMFAAADALRHIGTWQPAE
FT                   HEHVAPGVRGVYRLLNDDALWEAITPLLEGLKVFAQGLAREPEQSVTALTAKAGGTDRA
FT                   "
FT   CDS_pept        complement(701173..701622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05980"
FT                   /product="predicted periplasmic or secreted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05980"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47783"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVS0"
FT                   /protein_id="BAG47783.1"
FT                   /translation="MNLAAAVACGALAMYFLDPASGRRRRAYVCDKAAAGGHGVVDYAS
FT                   SCAKQATERARSAITGLRQHWQPEQVDDALIAARVRAELARLTGRPHDIDVSVEDGHVR
FT                   LSGAIDEAERQAIVDGVSAVDGVRTVDDGLGTRSEYRADAGDGAS"
FT   CDS_pept        complement(701819..702367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05981"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47784"
FT                   /db_xref="GOA:A0A0H3KRR9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRR9"
FT                   /protein_id="BAG47784.1"
FT                   /translation="MSATELADGYLRFFVLPLWIAAGFVDWLCHRRSQIASTSGLRESL
FT                   LHVAQLVEVGIPLLVALLFEIDLTVLALMAAGFVLHEFTALADVRYAVSRRDVSPFEQH
FT                   VHSFLEMMPLVALSLIAWIVLPARLRDGVQATDFALRWRPTEPLYIVVLLAAVLVFAVI
FT                   PYAEECLRGWRCARRAASR"
FT   CDS_pept        complement(702468..702980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05982"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5478: Predicted small integral membrane protein,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05982"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47785"
FT                   /db_xref="GOA:A0A0H3KZ86"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ86"
FT                   /protein_id="BAG47785.1"
FT                   /translation="MREANDSSRVRPDAADRHETDRASGPHPVTRAFERFASGVTAWAG
FT                   SPIAFGSAVAVTLLWLVSGPLFHYSDAWQLVINTGTTIITFLMVFLLQRNQNRDSVALH
FT                   LKLDELVAATRSASDRLIGIEDASEEELNQLAQAYMKLAKRAGTREGLEEDCARVRDMA
FT                   DAPRDAS"
FT   CDS_pept        complement(703383..704126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05983"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05983"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47786"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRC5"
FT                   /protein_id="BAG47786.1"
FT                   /translation="MGRERARDAGETIDSVADYMARIGAQDDGRAARLFRGQCNAGWAL
FT                   APSIARGRSTPDIEARMLDEFMRSALPHLEPAPNLDACDWLAIAQQHGMRTRLLDWSGS
FT                   ALAALWFAVRSASEAGVDGVVWCLRHDADDIATIAERRAPLSVTRTKVFRPRHVMPRIT
FT                   AQDGWFTIHSYDADAQCFAPLDEQPDFAGRLTRIVVPGKRFAAIRHELARVGVSVATIF
FT                   PDLDGIAQWTDTRYFPDDEDTHAPR"
FT   CDS_pept        complement(704167..705180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="BMULJ_05984"
FT                   /product="cytochrome bd-I oxidase subunit II"
FT                   /note="COG1294: Cytochrome bd-type quinol oxidase, subunit
FT                   2, Ralstonia solanacearum"
FT                   /note="KEGG, K00426"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05984"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47787"
FT                   /db_xref="GOA:A0A0H3KQZ1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQZ1"
FT                   /protein_id="BAG47787.1"
FT                   /translation="MTGLDLVPLWAGVLALSVLMYVLLDGFDLGVGMLFFWRRDEAERD
FT                   RMIASVSPVWDFNETWLVLGSTLLLAAFPGAFSVVVPGVYFPVLLMLLGLLFRGVAFEF
FT                   RGVVGARKRLWSGAFACGSLVATAAQGAVLGMFVQGFRVVDGRFAGTSWDWVAPFPLLT
FT                   AAGLVVGYLLLGATWLVMKTEGPLQLAARRAARHALLGVIVFIVAVSIWTPFADPAIAA
FT                   RWFAWPNLLFFSPVPVLTALLAWLAWRALNGRGEVLPFVASIGLFFLGFSGLTISLWPH
FT                   VAPPSVTLWSAASAQMSQEFLMIGTAFMLPVLLMYVGWSYWVFRGKVRGDAGYEHM"
FT   CDS_pept        complement(705167..706594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="BMULJ_05985"
FT                   /product="cytochrome bd-I oxidase subunit I"
FT                   /note="COG1271: Cytochrome bd-type quinol oxidase, subunit
FT                   1, Ralstonia solanacearum"
FT                   /note="KEGG, K00425"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05985"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47788"
FT                   /db_xref="GOA:A0A0H3KVS4"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVS4"
FT                   /protein_id="BAG47788.1"
FT                   /translation="MDIDALLLSRFQFAWVIAFHILLPAFTVGLSCFIATLEVLHWATR
FT                   RAVYLRLSTFWLRIFAVSFGMGVVSGIVMPFQFGTNWSRFVAATSNVVGGFMAYEVLTA
FT                   FFLESAFLGVLLFGRRRVPPWAHATSAVLVALGTLLSSFWILAVNSWMQTPTGYRIVDG
FT                   RFYPDSVLSVLLSPSFPFRLAHTVTAFLVTTAFVVLAVGAHYLLQRRAPDESRVMVRMG
FT                   LWFLTIAVPVQIALGDAHGLNTLAHQPVKLAAMEGLWDTGRGVRATLFAWPDQARETNR
FT                   FELSIPRLGSLYLTHDWNGLVHGLKDWPRDQRPSVPVVFFAFHLMVGLGIVMLAIVVRG
FT                   LTLWRGRKLYAARGWLHACRFAMPIGFVAVLAGWTTTEAGRQPWTVYGLMRTADSVTPS
FT                   LTTGDVALSFALYAIGYLAIFGAGFVLLRRLVRLGPDTAPAHAGTPAAAVSERPARPLS
FT                   AVSDSGAQPPGANDDRA"
FT   CDS_pept        complement(706637..707029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05986"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05986"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47789"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRS4"
FT                   /protein_id="BAG47789.1"
FT                   /translation="MPIHTHRFVRPLRCAAACAALAAGAAAMPAAAQLRPTDPTVVPDS
FT                   STQAFQRADHRMMEAMDAARYTGDADRDFVSHMAPHHQGAIDMAQVELKYGKDPTLRQL
FT                   ASRIVAAQRDEIALMERWQKAHGATP"
FT   CDS_pept        complement(707135..708715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05987"
FT                   /product="choline dehydrogenase"
FT                   /note="COG2303: Choline dehydrogenase and related
FT                   flavoproteins, Halobacterium sp. NRC-1"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05987"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47790"
FT                   /db_xref="GOA:A0A0H3KZ88"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ88"
FT                   /protein_id="BAG47790.1"
FT                   /translation="MRMFRDDDPVDFVIVGTGAGGGTLACKLAEYGYSVVALDAGAWWR
FT                   PLEEFASDESHQRKLFWTDERICDGADPLTLGTNNSGRAIGGSTVHFAMVSLRFRPEWF
FT                   RSRSALGYGVDWPLDWREMWHYYREVEQALKISGPVRYPWGPPRPRYPYRAHELNAAAL
FT                   VLARGAEALGMDWTPTPLATLSAPRGRAHPCVYRGFCIAGCATNAKQSALVTWIPRAVA
FT                   AGAEVRDLAMALRIEAEGDRVTGVHYRRDGRTRFQRARNVVVAGYAIESPRLLLLSANG
FT                   RHPHGLANSSGLVGRYLMAQLNQASWGTMDDEVRWYKGPPSLSLTEHWNYVDEGKDFFG
FT                   GYCWMSQGPLPIEWARKLASRGLWGDALKREMARYNFQAGLKIVGETLPRADNRVTLAD
FT                   ERDAYGLPVARVTYAYDDNDRRMIRHALAQMSRALEAAGARDIWHEEDDTCHLAGTVRM
FT                   GDDPATSVVDADCRSWDIPNLWVCDGSVFPTVGGVNPSLTIQAIACRTADRIRTLVARG
FT                   EGHARARRR"
FT   CDS_pept        complement(708795..709445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05988"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05988"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47791"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRD0"
FT                   /protein_id="BAG47791.1"
FT                   /translation="MKRDNERAAMLPRYPDYDVLAKRDTPSWNDATRRAIDARLKVAAT
FT                   APRALDAERFATLRALCARIAPQPAGSDAIPTAALIDARLANDEGDGFRDARLPPLRDA
FT                   WQIGLAALDAMAHRAHRASFASLDGDTADALLRTVQRGEIDAADRAAWAGMDARTFFAK
FT                   RVLMDICGAYYSHPYAWNEIGFGGPASPRGYVRMDFNRRDPWEARVGGDDDGR"
FT   CDS_pept        complement(709442..710296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05989"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05989"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47792"
FT                   /db_xref="GOA:A0A0H3KQZ6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQZ6"
FT                   /protein_id="BAG47792.1"
FT                   /translation="MRVFRPPATARDEQLLRDAARLLNRSALLLAGSVLADSGVEHYRG
FT                   TFHNRAMVAPLVMSTLSVIASVHGHADDTPARHRLRDAVHVASAATGLAGSAFHLYNVT
FT                   KRVGRFSWHNLFYGAPLGAPVALLLSGALGAAGERMRDSPAAAPHIGGRPAGRVLAGLV
FT                   AAGLVGTLGEVGLLHFRGAFQHRAMFAPLIAPPVAALAAAHVALSRPRAARPFCRFWMR
FT                   TTALLGLVGVAFHARGVARQMGGWRNWSQNVLSGPPLPAPPAFTALAIAGLAATALAER
FT                   EGR"
FT   CDS_pept        complement(710331..711431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05990"
FT                   /product="mandelate racemase"
FT                   /EC_number="5.1.2.2"
FT                   /note="COG4948: L-alanine-DL-glutamate epimerase and
FT                   related enzymes of enolase superfamily, Sinorhizobium
FT                   meliloti"
FT                   /note="KEGG, K01781"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47793"
FT                   /db_xref="GOA:A0A0H3KVS8"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVS8"
FT                   /protein_id="BAG47793.1"
FT                   /translation="MSLSDAPALGDVRARAYRVPTDRPEADGTYAWTATTIVVVEIDAG
FT                   PVTGLGYTYTDASAAALATSLLADVLRGRPLADVPAAVDALWRAVRNVGRAGVAATAIS
FT                   ALDVALWDAKAKLAGVPLATLLGRRRERVPVYGSGGFTTYDAATLAAQLGGWRDEGIRA
FT                   CKIKIGVQDACDPARLQTARDALGADVALFVDANGAYSARTALAFADRAARYDVRWFEE
FT                   PVSSDDVAGLRFVREHVGARVDVAAGEYAYTPDDFRRLLEAGAVDVLQADATRCGGVSG
FT                   FLAAGALADAYHVDLSAHCAPALHRHVGCVAPRMRHVEWFHDHVRIERMLFDGAPPLSD
FT                   GALEIDAGRPGLGLELRTADAQRYAI"
FT   CDS_pept        711577..713397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05991"
FT                   /product="thiamine-pyrophosphate requiring pyruvate
FT                   decarboxylase"
FT                   /note="COG0028: Thiamine pyrophosphate-requiring enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05991"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47794"
FT                   /db_xref="GOA:A0A0H3KRS9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRS9"
FT                   /protein_id="BAG47794.1"
FT                   /translation="MATVADFIVERLYDWGVRRVYGYPGDGINGFFGALNRAEGKIEFV
FT                   QARHEEMAAFMASAHAKFTGELGVCVATSGPGAAHLVTGLYDARLDHMPVLAIVGQQAR
FT                   AALGGHYQQEVDLPALFKDVAGAFVQLATVPGQVRHLVDRAVRTALGARAVTALVLPND
FT                   LQELDYAAPKRAHGTVHSGIGYTRPKVVPYADDLQRAADVLNAGSKVAMLVGAGALDAT
FT                   DEVIAVADRLGAGAAKALLGKAALPDDLPWVTGSIGLLGTKPSYSLMSECDTLLMVGSG
FT                   FPYSEFLPKEGQARGVQIDLKADMLSLRFPMEVNLVGDSAETLRALLPLLNARHDTAWR
FT                   DRIAQWNDEWRDTLAARAAASASPGRGVNPQRAFTELSPRLPDDVILTSDSGSCANWYA
FT                   RDLMMRRGMMGSLSGGLASMGAAVPYAIAAKFAHPVRPVIALVGDGAMQMNNMAELITV
FT                   SKYWRTWADPRWICMVLNNEDLNQVTWEQRVMEGDPKFDASQQIPNVPYSRFATLLGLK
FT                   GIYVDDPAQLGAAWDEALASDRPVVLEVKSDPEVPPLPPHVTLQQAKHFAETLLKGDSR
FT                   EHNVIVETARQVLSAVLPGNGERGGGKKET"
FT   CDS_pept        complement(713443..715233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05992"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="COG3387: Glucoamylase and related glycosyl
FT                   hydrolases, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05992"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47795"
FT                   /db_xref="GOA:A0A0H3KZ91"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ91"
FT                   /protein_id="BAG47795.1"
FT                   /translation="MSATPIEDYAPIGDGRSAALVARDGSIDWLCWPDFDSPPCFAALI
FT                   GTPENGRFRLAPRDPDARATRRYLPGTAILETTFDTSSGRIVVIDWMSWAADDPCLIRS
FT                   VRGEHGRVALDVELGVRFDYGYALPWCRRFGRRWRMMTGGDAMWVDADARLEVQDDRLV
FT                   GTPTIAAGERIDICISYARSYDRAPVVPDAYASLRDTHAFWRAWSRCNAAQGSYGDAIE
FT                   RALITIKLLTSRRTGGIVAAPTSSLPERFGGARNWDYRFCWLRDASFTLRALARCGYRD
FT                   EAAGWRDWLVRAIADHPSQLQVLYAADGSRRADEWHAEHLAGYGGARPVRFGNAAAQQQ
FT                   QLDVYGEVLGALYQARRHGLPPDDDAWLLERRLIDHLATIWREPDEGIWEVRSGRHQFT
FT                   SSKAMVWAAVESAYRSARAFGHHAPLDEWRRWADTVRDEVLARGYHAKLGRFVDRFDGD
FT                   GLDVSLLLIPLSGMLDARDPRVAATVAAIERELLEDGLPFRYRPERFADGCEGDEGAFV
FT                   AAGFWLVQVYRLQRRDDDAHALFERLLALRNDVGLLSEEYDVHTRRMCGNFPFTLAHVA
FT                   LVNAALALQCDVQQDDVGVA"
FT   CDS_pept        complement(715230..716213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05993"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases), Nostoc sp.
FT                   PCC 7120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05993"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47796"
FT                   /db_xref="GOA:A0A0H3KRD5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRD5"
FT                   /protein_id="BAG47796.1"
FT                   /translation="MKTVAITGASAGVGRATAHAFARRGANVALLARDPRALEDAAAEV
FT                   RAYGVQALPIAVDVSDAAALDAAAERIERELGPLDVWVNNAMVTVFAPFDAIAPEDFAR
FT                   VTDVTYLGCVNGTRAALARMRTRDRGTIVQVGSALAYRSIPLQAPYCGAKHAIRGFTDA
FT                   LRCELLHDGSRIRVTMVQLPAIDTPQFDWAESELPNKPRPVAPVYAPEVAADAIVRAAH
FT                   RPCRERWVGWSSLAAILANGVAPGCFDRYLAYTAVRGQQRAEPAGVRASNLWETVPEGH
FT                   ATRGAFTDEAHRTGADGALGSARALAFGAAFVLVAAGVAAARKLNR"
FT   CDS_pept        716495..717514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="BMULJ_05994"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="COG1622: Heme/copper-type cytochrome/quinol
FT                   oxidases, subunit 2, Sinorhizobium meliloti"
FT                   /note="KEGG, K02275"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05994"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47797"
FT                   /db_xref="GOA:A0A0H3KQZ9"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KQZ9"
FT                   /protein_id="BAG47797.1"
FT                   /translation="MPVPLFPNARRVACAAACIVASAASSRAQAAAEPLPLAYVAHAAG
FT                   PAARPVFVLGWALLALCTFVCIAIATLLALALFRRRKREARGGDGVRFVAIGSAVSAVL
FT                   LFGALVYMLRVLGAVAYPPRPPALTITVIAHDWWWAVRYPGEPALVTANEIHIPVGEPI
FT                   AIELKSADVIHAFWVPQLAGKTETIPGQTNRQWLQADEPGVYRGQCSQYCGAQHAHMAF
FT                   DVVAQPPDAFRAWLDAQRQPAAAPRAGAAAHGARVFAARCAGCHTVRGTDAAGDAGPDL
FT                   THLASRRSLAAGTLDNTPDNLRRWIAHAQQIKPQTLMPSFALAPRDADDLAAYLATLH"
FT   CDS_pept        717522..720158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="BMULJ_05995"
FT                   /product="cytochrome c oxidase subunit 1"
FT                   /note="COG0843: Heme/copper-type cytochrome/quinol
FT                   oxidases, subunit 1, Mesorhizobium loti"
FT                   /note="CyoB2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05995"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47798"
FT                   /db_xref="GOA:A0A0H3KVT2"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVT2"
FT                   /protein_id="BAG47798.1"
FT                   /translation="MPMAVTHDSRPVLERVPDLGDAPPGSPEERALAALWESEPGWRGW
FT                   LGTVDHKRIGLRYIVTAFAFLLLGGVEALVMRIQLARPNATLLTPAQYDALFTMHGVTM
FT                   IFLYALPVLSGFANYLWPLMLGSRDMAFPRLNAFSYWVFLFAGLFLYASFPLGAVPDGG
FT                   WFNYVPLTSLDYSAGANIDIYALGMILLGISTTGGAANFVVTLLRMRAHGMSIDRLPII
FT                   VWGTLTASVANLVAVPSVSLAFFLLWLDRNAGTHFFDVAHDGRPLLWQHLFWMFAHPWV
FT                   YVVVLPAMGIVSDALPTFCRRPLVAYEAVAVSTVATMLIGFEVWVHHMFATGIAPLALA
FT                   FFGAASMLISIPSAVAVFAWIATIWTGRPVFRTPFLYFAGFVLMFVIGGVSGVMTAAVP
FT                   LDWQLTDTYFVVAHLHYVLLGINVFPVLGGITYWFPKFTGRMMNERVGRWTFWVVLIGF
FT                   NVGFFPMHVSGLLGMPRRIYTYPSGMGWDTSNLLTTIGSFVFGIGIVMFVINALVSARR
FT                   GARAGDNPWGAPGLEWSVASPTPAYNFAVLPLIASRHPLWETRGEPHRSSLRVGYRLAD
FT                   GREALAVSPLAATPSAILKMPEDTCVPFVLSLLATAVFAAMLVRSPTLVAISTLGCAIA
FT                   LGAWLWPRRSLGERAAAPERDGVPPPAPFTMHEPAAAAAPPAAPAPYNAPLPVGSCGKR
FT                   AGGWWGVLTLVVTEAGLFGYLLFSYFYLQSQSAAPWPPEGMPKLGLAGVNTAVLLSSSV
FT                   FVWLAERAVRAGRRPRAVAALAVALVLGVAFALVQLHEWRDHPYGPTAHLYGSLYFTIT
FT                   GFHLAHVVAGLAVLALLAGWTAAGFFDRERRVALSVGALYWHFVDFVWLFIFTALYVTP
FT                   YWLRRPG"
FT   CDS_pept        720155..720556
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05996"
FT                   /note="truncated cytochrome c oxidase subunit I"
FT   CDS_pept        720547..722160
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05997"
FT                   /note="COG2010: Cytochrome c, mono- and diheme variants,
FT                   Pseudomonas aeruginosa"
FT                   /note="truncated cytochrome c oxidase subunit I"
FT   CDS_pept        complement(722579..723289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="BMULJ_05998"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /note="COG0479: Succinate dehydrogenase/fumarate reductase,
FT                   Fe-S protein subunit, Ralstonia solanacearum"
FT                   /note="KEGG, K00240"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05998"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47799"
FT                   /db_xref="GOA:A0A0H3KRT4"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRT4"
FT                   /protein_id="BAG47799.1"
FT                   /translation="MDDDTRILHIYRYDPDRDAAPYMQRYEITVQPDDRMLLDVLGRLK
FT                   REDETLSYRRSCREGICGSDAMNINGSNGLACLTNMKTLPREITLRPLPGLPVVRDLIV
FT                   DMTDFFNQYHSIKPYLINDTPPPERERLQSPAERDQLDGLYECILCACCSTQCPTFWWN
FT                   PDKFVGPAGLLQAYRFIADSRDLATGERLDNLEDPYRLFRCRTIMNCTSVCPKGLNPAR
FT                   AISNIRAMLVRRAV"
FT   CDS_pept        complement(723355..723597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_05999"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_05999"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47800"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ95"
FT                   /protein_id="BAG47800.1"
FT                   /translation="MQHQQDAQVRDPYRGHEIRVWARRNERGAWRDEVQLYVDGARIEL
FT                   IVPEPAGPEWLTEDEALRAGVERGRYLVDKRVDDD"
FT   CDS_pept        723779..724474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtC"
FT                   /locus_tag="BMULJ_06000"
FT                   /product="putative Mg2+ transporter-C (MgtC) family
FT                   protein"
FT                   /note="COG1285: Uncharacterized membrane protein, Yersinia
FT                   pestis"
FT                   /note="KEGG, K07507"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47801"
FT                   /db_xref="GOA:A0A0H3KRE0"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRE0"
FT                   /protein_id="BAG47801.1"
FT                   /translation="MIGHVELLGRLLLAALLGSVIGLERERLNWAAGLRTHMLVCVGSA
FT                   LTMLVSTYGFEDVAGRNGVVLDPSRVAAQVVSGIGFLGAGSILLRGEVVRGLTTAASLW
FT                   AVAGVGLAVGGGMIVASVGATVIVLVILAGVKPLERRFIAQRQQRTLRLVVERGGLTLR
FT                   TLHDALGTRHVRVKRFIVQQSDDDPDTDDISVSFSRTSPVEFAAICRTLQNLAGVRICR
FT                   PDTSSRSLV"
FT   CDS_pept        724471..724809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06001"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR04"
FT                   /protein_id="BAG47802.1"
FT                   /translation="MTQTDLLSYLVTSQLAARMRSGAWLTISQVVGALRAWLAYHHAEC
FT                   DWLDRIRIVEAASAIAEGIYEVATAHGQPADGERVRLDAHSPEMQALRARCDVLLQRID
FT                   GDRDVDAR"
FT   CDS_pept        724806..727046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06002"
FT                   /product="putative phosphatidylserine/
FT                   phosphatidylglycerophosphate/cardiolipin synthase"
FT                   /note="COG1502: Phosphatidylserine/
FT                   phosphatidylglycerophosphate/cardiolipin synthases and
FT                   related enzymes, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06002"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47803"
FT                   /db_xref="GOA:A0A0H3KVT5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVT5"
FT                   /protein_id="BAG47803.1"
FT                   /translation="MIVPARGSRTGFATAGPARADDAQNGAAQRDAIVRHGLLEVGRNC
FT                   DTIRHADRFATLIDGDAYFSTLRAALLRARHTVFILGWDVDSRMRLMPGGADDGFPDTL
FT                   AAFLHALASRRHNLRIYVLAWDFAMIYALERDWPPVYRASWRAHRGIVFRLDDAHPRGA
FT                   SHHQKLVVIDDRLAFVGGLDLTRARWDTPAHAADDPRRRDEQGMPYGPFHDVHTMFDGD
FT                   AAAAIGEQARARWLLACGRPIAIRAHKHLERDDDPDPWPPGAQVDVRDVQLGIAYTAPR
FT                   HRDAAPVSQVRELVADTIRTARRHLYLENQYFTAAVVRETLSARLADDDGPDVTVVAPR
FT                   VQSGWLQEATMGVLRARLHATLVAADRFGRYRLLYPHVDGLGDGCVNVHSKVAIVDDEC
FT                   LMIGSANLNNRSMLLDTECCVALVAAGDARVRAAIAGTRDRLLAEHLGTTPAAVADAFA
FT                   DALARGQRPNDALDRLRKDRGRSLRTLDPSVAPQLDALVPVSAWLDPEQPIEPDRLIRE
FT                   FVPREQHRTLSARFLVLGAIVLLIAALALTWRFSPLGERLNVASLAHAAAGMSRLPAAP
FT                   VLLLLGYVIAATLAVPITLLIAATGLVFGAWPGFAYAGAGTLMAAVATYGLGRWLGRDA
FT                   VRRLAGARANRLSEHLGKRGVVAMTVLRLLPIAPFTVVNLVAGASHIGLRDFVIGTAIG
FT                   MLPGIVLTVIFANQLLAAFSHPGPTAFAWLAAIGIALVGVSALLVRMLRRWR"
FT   CDS_pept        727037..727873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06003"
FT                   /product="metal-dependent hydrolase"
FT                   /note="COG3568: Metal-dependent hydrolase, Brucella
FT                   melitensis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06003"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47804"
FT                   /db_xref="GOA:A0A0H3KRT9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRT9"
FT                   /protein_id="BAG47804.1"
FT                   /translation="MALIRHAAAPPEVVTAPAPPAAAPGGRDLRIATYNIHGGHGPWHA
FT                   RAVDRIAAVIDELDADVIALQEVPLGGTRAPDVLAPLRDATGMHVAAGPTIDTAERRYG
FT                   NAVLSRYPIRAARTLDLSFHQREPRGALDADIDCRTGPLRVVATHLGLSARERSAQVQR
FT                   LLAAFDTGAMPVILLGDINEWFVRGRALQALVTRFRRAPAPRTFPTVCPLFSLDRIWVH
FT                   PGELLVDVVVHRSARARHASDHYPLVARMRAPQPAPEPAAAPFDRPGTPLARKDAP"
FT   CDS_pept        727888..728376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06004"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase E1
FT                   component beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06004"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47805"
FT                   /db_xref="InterPro:IPR019701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZ99"
FT                   /protein_id="BAG47805.1"
FT                   /translation="MQIDELDGTALDYWCVRGLCADHEDTLRFTAVTPTVVVTAACDAL
FT                   RRLDAHFTPSRSWADAGAVLDRVTDLRIVRRGGEVECDASFADGPSTCAARGPNARVAL
FT                   LRAYVRACFGDTVDAPPDLPHRIERGAIVRYDPGAPLPEADDASALGDSTDIRSVPRM"
FT   CDS_pept        728555..731950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06005"
FT                   /product="alpha amylase-like protein"
FT                   /note="COG0366: Glycosidases, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06005"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47806"
FT                   /db_xref="GOA:A0A0H3KRE4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRE4"
FT                   /protein_id="BAG47806.1"
FT                   /translation="MEPVPTFAPHLYFCDARLVGPLDAWSATFAHVAAMGFDHVLVGAF
FT                   WASSPAGFPRHVADFDRPADVFGTRDSALDIFARLAQLAHGHGLRVLLEVVPERVARDN
FT                   PLRAAHPHWYVERAHDDALIDPRSAAHAQDIAHANLTDDEARDALSAWWRAHLTAYAQA
FT                   GAAGFLVDAPQHLPAAWWAQWRAALQRVRPSLALIAGVPGHARDALAPLESAGFDAVFS
FT                   SARWWDLRAPWFVDEHRFLRRIGAPIAFPDAFDGPRLADDWRDAPDERVARAYRRALWT
FT                   AAAVGTGWLVPMGFERGVALPLMARDASAARYRAAFEAARFDLSSTLADANAWRRATPV
FT                   AAARGELLQLSAPDAPATVLLRGTSASLEYDDDALLIALNPDLDAEARVDPATILPGVP
FT                   GGFTHVATPNDAPSHAPAALDAFTLAPGACALRDARRAPPATLPADPERDQDALSAALV
FT                   ADRIAIERVEPAVDGGRFAVKRVVGDTLVVRASIFSDGHAHLAAVLAWRAAGESDWREV
FT                   PFVAEPNDRWRAQVTLDRLGRHEFRVIAWRDDWASLVDDVAKKRAAGQDVSLELREAQL
FT                   LLATAAKLADPVDPQARARIEQLTKEFRRASPEDRLALLGAPALADAVAALRYRPFVTH
FT                   DDTVYPVDVDRRAACFSSWYEMFPRSASNDPDRHGTFDDVIAHLPRIRDMGFDVLYFPP
FT                   IHPIGTTARKGRNNSLQAAPDDVGSPYAIGSPDGGHTAVHPQLGTLDSFRRLIDAARDH
FT                   GLEIALDFAIQCSPDHPWLKAHPGWFAWRPDGSLRYAENPPKRYQDIVNPDFYAPDALP
FT                   GLWLALRDVVQFWIDAGVRIFRVDNPHTKPLPFWAWMIADIRGRHPDVVFLSEAFTRPG
FT                   MMGRLAKLGFSQSYTYFTWRESKREFIEYLTELTQGPAREYFRPNFFVNTPDINPRHLQ
FT                   NAPRTQFVIRAALAATLSGAWGMYSGFELGESAPLPNSEEYADAEKYELRARDWSKAAH
FT                   IGAEIARLNRARRDNRALQTHLGITFVDADNDAVLVFMKATPAFDSVVVVAISLDPWHP
FT                   QAANFTLDGALWRGLGLVEGEPLDAHEHDAAHPTTWRGHRQYVSLDPHVRPYTIWRLAP
FT                   AAGAARAHRPATDDDRRSSGGHGR"
FT   CDS_pept        731947..735357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06006"
FT                   /product="maltose alpha-D-glucosyltransferase"
FT                   /EC_number="5.4.99.16"
FT                   /note="COG0366: Glycosidases, Ralstonia solanacearum"
FT                   /note="KEGG, K05343"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06006"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47807"
FT                   /db_xref="GOA:A0A0H3KR08"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR08"
FT                   /protein_id="BAG47807.1"
FT                   /translation="MKREDSLDDVRRAQFASHPHAGSPRQRRVRRPAPALCADDPLWYK
FT                   DAIIYQVHVKSFFDSNNDGIGDFPGLIAKLDYIAELGVDAIWLLPFYPSPRRDDGYDIS
FT                   DYRDVHPDYGTLADVRRFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSMYRN
FT                   YYVWSDTDTKYAGTRIIFLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVL
FT                   QVMRFWLDLGIDGLRLDAVPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAE
FT                   ANQWPEDVQEYFGNEDECHMAFHFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQWA
FT                   VFLRNHDELTLEMVTDSERDLLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSL
FT                   LLSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMG
FT                   SLYGYDAINVEAQTRDPHSLLNWTRRILATRRATQVFGRGSIRFLRPENRKVLAYLREL
FT                   EGHDPVLCVANLSRASQAVELDLSEFAGRVPIEMTSDSPFPPVGQLPYLLTFPPYGFLW
FT                   FVLSAHGREPAWRQPHAEPLPEYVTLVMRRGDTRPDVAQLHTLAHDALASWLTRRRWFA
FT                   SKDRTIADARLNVVTPIPGESFQYAEACVTVRGDSHAERYVVPLAVAWGGETSGPLFAQ
FT                   LALARVRRGHTVGYLTDAFALPAFAHGMLRKLRAGATVPTSDGGHLAFLPEAALASLDP
FT                   GDEAEVRWLAAEQSNSSLVIGEAIVLKLVRKVAHGVHPEAEMSRHLTRIGYQNTAALAG
FT                   EVVHVDPDGRPHTVAILQRFVDNQGDAWTRSFDFLKRAVDELALPAADDVDTVEPDAET
FT                   DALLGYAAFAGVVGKRLGELHVALAQPSDDPAFAPERATPEHVDGWCADAIASFEQALD
FT                   CLGTRLDALDADTRAAAERLLASRDAAVRALGELVPRTLDAHCTRIHGDFHLGQVLDVQ
FT                   GDALLIDFEGEPARALERRRAKSHPLRDVAGFLRSLSYVSATGQFAIEKAPPQAADRKR
FT                   ALFERFGRAAADAFVDCYRAAAEHAPVRFVDPRYTDRLLALFLIDKASYELCYEAANRP
FT                   DWLCVPVGGLAALVERLLEHRGAEDGDES"
FT   CDS_pept        735354..737552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="BMULJ_06007"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="COG0296: 1,4-alpha-glucan branching enzyme,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00700"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06007"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47808"
FT                   /db_xref="GOA:A0A0H3KVT8"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVT8"
FT                   /protein_id="BAG47808.1"
FT                   /translation="MTDALFDRADIDALLGARHPDPFACLGPHAHDGRTIVRALLPGAE
FT                   HVRVLAPDGAELGTLARVDDAGCFAGALAHDGRYRLAVEWPGARHVIDDPYAFGLLLDD
FT                   AALARFAAGNPFAVLDCLGAVPTCIDSVDGVRFAVWAPNAQRVSVVGDFNAWDGRRHPM
FT                   RLRLPWGVWELFVPGIGAGERYKYELRAADGRVLPHKADPCARATEAPPRTASIVADTG
FT                   AVDGFAWHDHAWLQARAHGDRYRRPWSIYEVHPESWQRYPEQMDRNATWDELAERLIPY
FT                   VRGMGFTHVEFMPIAEYPFGGSWGYQPLAQFAPSARFGPPDGFARFVDRAHAAGIGVLV
FT                   DWVPAHFPDDPHGLAQFDGSALYEHADPREGMHPDWHTCVFNVGRNEVGAFLIASALAW
FT                   ARRYHVDGIRVDAVASMLYRDYSRAAGEWVPNIYGGRENLESVAFLRALNDTLHGDDAP
FT                   PGVVSVAEESTAWPGVTAPTRDGGLGFDFKWNMGWMHDTLAYLHEDPVHRRYHHDRMTF
FT                   GLVYAFSERFVLPLSHDEVVHGKGSLASKMPGDAWQRLATLRAYFGFMWAHPGKKLLFM
FT                   GSELAQWAEFAHDGTPHWDLLDAPAHRGVQRLVRDLNRTYAAQPALHALDCDAAGFAWL
FT                   IGDDRDNSVFAFARRDDAGHTVVAVCNFTPVPRTGYRVGLPAPGAWRELMNTDAAVYGG
FT                   TNAGNDGAVWAEDVPAHGEAWSATLRLPPLATLWLSPA"
FT   CDS_pept        737585..739711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="BMULJ_06008"
FT                   /product="glycogen operon protein"
FT                   /note="COG1523: Type II secretory pathway, pullulanase PulA
FT                   and related glycosidases, Ralstonia solanacearum"
FT                   /note="GlgX protein"
FT                   /note="KEGG, K02438"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06008"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47809"
FT                   /db_xref="GOA:A0A0H3KRU3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRU3"
FT                   /protein_id="BAG47809.1"
FT                   /translation="MPTALPPRLEPGRSYPLGATWDGLGTNFAVFSAHAHRIQLCIFDS
FT                   TGRKELARLDLPECTDEVWHGYLPGAHPGTVYGFRADGPYQPQAGHRFNPTKLLIDPYA
FT                   RKLLGHFRWSDALFGYRVHSNRGDLSMDRRDSAPAMPKCIVVDEAFDWSNDRRPCVPWR
FT                   STVIYETHVRGASMRRPGLRAPERGTFAALAHPAFVDHLLALGVTTVELLPVHAFLQQR
FT                   ELLNRGLRNYWGYDTAAFFAPEPSYLSTRRLDEMRIAIRQLHAAGIEVVLDVVYNHTCE
FT                   GNQLGPTLSWRGLDNASYYRLVPDDRRYHVDETGCGNTLNLSHPRVLQMVMDSLRYWAT
FT                   AFNIDGFRFDLGVTLGREDHGFDPGAGFFDALRQDPVLAQRKLITEPWDVGPGGYQLGR
FT                   HPPGFAEWNDRFRDTVRRYWRGDAGQRPELAARLAGSADLFNHQRRRTWASINFVTAHD
FT                   GFTLADVVSYAGKHNEANGEGNRDGRDDNCSANWGVEGPTDDPAIRDVRGRVARSMLAT
FT                   LFTALGTPMLVAGDEFGRTQHGNNNAYCQDNELSWLDWEAAQQPEAVQMTRFVSRLAAL
FT                   RRMYPVMSTPRFPSGDRDGAPGMREIAWFDEHGDEVSVPAWQDRERRALTMRRVGTGRT
FT                   GRTEALLVMLNASAETITFKPPPPALAYRVLVDTATPDGGPRDWPADGLEVAAHAAVIA
FT                   VAPVPTDLSSKETP"
FT   CDS_pept        739708..741567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treZ"
FT                   /locus_tag="BMULJ_06009"
FT                   /product="maltooligosyltrehalose trehalohydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /note="COG0296: 1,4-alpha-glucan branching enzyme,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K01236"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06009"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47810"
FT                   /db_xref="GOA:A0A0H3KZA2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZA2"
FT                   /protein_id="BAG47810.1"
FT                   /translation="MTSHSAASSSTHAFELSFGATCLDAGHTRFRLWAPASRRAQVELH
FT                   GAQTLEMTAAGDGWFELVAPVGAGALYRYRLDDELVVPDPASRFQPSDVHGPSQVVDPA
FT                   AYRWRHGAWRGRPWHETVLYELHVGACGGYVNVERRLPDIASVGVTAIELMPINAFPGT
FT                   RNWGYDGVLPFAPDASYGRPEELKSLIDAAHGLGLQVFLDVVYNHFGPDGNLLPRYAPA
FT                   FFRDDRHTAWGPAIDFSRAQTSAFFIENALYWIDEYRFDGLRIDAAHAIDDDAWLRELA
FT                   RRVRAAAGGRHVHLVLENERNTASLLGPDRFDAQWNDDFHNSAHVLLTGERDGYYRAYA
FT                   DAPLRHFARTLGEGFAYQGEPSPLHDGAPRGEPSAQLPPTAFVSFLQNHDQIGNRAFGE
FT                   RLRALANDDALRAVTALLLLSPQIPLLFMGEEDGSTQPFQFFTDYRGALADAVREGRRR
FT                   EFAAFPAFADPAHRDAIPDPNDPATFARSALHERPDTWPDADAWRRFYRSALTVRAALV
FT                   TPHLPGARALGVDVLADDETARALVARWRLGDGSTLTLALNLGPRATALPELPVGKIVF
FT                   ETPPRARDALVDARLPARACIAWRDGAVNHDALNHRANGHARP"
FT   CDS_pept        741564..743774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="BMULJ_06010"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="COG1640: 4-alpha-glucanotransferase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K00705"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47811"
FT                   /db_xref="GOA:A0A0H3KRF0"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRF0"
FT                   /protein_id="BAG47811.1"
FT                   /translation="MTTDIPIASLARAAGLQTDWTDAVGVPRRVADDALFALVDALGWP
FT                   CGTPVERVDSLAALVDADAAPPRMITADAGMPIALPATVAGPGARYRVTFETGGHVDGR
FT                   VGGTSGDPLLPPIVRPGYHALDVGEQRIAIAIAPRRVRAAERLRGTPDAGNRWGIAAQL
FT                   YGLRRAGDDGAGDYTALAQLATQAARHGAHAVAISPTHAGYPALPAHDSPYSPSSRRWH
FT                   NVAYLDCHAVPGVGRVAGDEADGAADARLVDWPRVLPQKLRRLRARFDALRAGGGTALD
FT                   GFERFRAAGGAALDAHARFDALQAFCVARGLGADWRQWPAPWRMPTSVEVDAFAQAHAD
FT                   TVAFHAFLQWCAAHALTDAQQAARRAGMAIGLIADLAVGSDRAGSDAWAHGTTLLRGLS
FT                   LGAPPDAFNAAGQAWGVTTWTPAALRANGFAPFIELLRAAFAHAGGIRIDHVLGFARMW
FT                   VVPDGASARDGAYLHYPCDDLLRLVALEAARHRAIAVGEDLGTVPDGFRDRLGAQGVAG
FT                   MRVLWFEREPDGAFRPPSSWDRDALAMTSTHDLPTVAGWWRGIDLGWRRIAAEHEQARA
FT                   RPANAEPEDRHVVSEASDTADTNDVNAADTAERTYVDPDAAAARAATPDDLAERDAARA
FT                   ALWRALQQAGCAPSDAPPPPADAPPVGAVLAFVARGASPLAIVPLEDLLALDAQPNLPG
FT                   PPCGHPNWRRRLPRTVDALFDADTRARIAAIADARGTPERRA"
FT   CDS_pept        743771..746533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06011"
FT                   /product="putative maltooligosyl trehalose synthase"
FT                   /EC_number="5.4.99.15"
FT                   /note="COG3280: Maltooligosyl trehalose synthase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K06044"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06011"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47812"
FT                   /db_xref="GOA:A0A0H3KR13"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR13"
FT                   /protein_id="BAG47812.1"
FT                   /translation="MTPRATLRLQLHAGFTFDDAAAHADYFARLGISHLYLSPITTAEP
FT                   GSRHGYDTVDYGAISAELGGEAGFVRLVEALRARGLRVIVDIVPNHMGVGGSSNGWWND
FT                   VLEWGPASPYARYFDIDWHPPDPTLDGKVLLPCLGSPYGDALAAGDIALGIDAAAGRFT
FT                   IACAGRQLPVAVATYAEILRVANRADLNALAERFDTAATRGSARVAAAHAALRAHAAAH
FT                   GPHAFDAVLHGTDARRARSRACLHHVLERQHYRLAWWRTAADELNWRRFFDIATLAGVR
FT                   VEDDAVFDAVHALPLRLHAAGLVDGVRVDHVDGLADPRAYCRRLHARLAAQRDTPPTIY
FT                   VEKILAPGETLRADWPIDGTTGYDFMNDVAALLHDPAGAEPLGAHWAAVSRSTRTFAQE
FT                   AVDGKRRVLLRQLAGEHARVARKLHDIARASPATRDISRIAIHRVLGELAVHLSVYRMY
FT                   PADDELAPDDRRVLAQAYACARAAVDPTDRIALERVAQWLGLPGTRAPRADAARRHAAR
FT                   VAFAQLTAPLAAKGVEDTANYRYGRLLSRNEVGADAGDFSLSRGAFHARNRRRARHSPH
FT                   ALVATATHDHKRGEDARVRLAVLSEIPDAWRAVSLDWSALNQPHRGRAHRDLDWSPGPA
FT                   AEAMLYQTLVGCWPPSLAPDDAAGLAALADRVVQWQTKALREAKQQTDWLAPEPDYEQD
FT                   SEAFVRAILTPHGAGDFVHRLHAFVMRIAPAGVVNSLTQTTLRITSPGVPDLYQGTERW
FT                   DHSLVDPDNRRDVPFAALAAERVDGPVSAYLPTWPDARVKRALIERLLALRAQRPSTFA
FT                   NGSYVPLRVRGPLARHVVAFARCDDAATIVVVTTRLACRLLGDAPALPRVEPAQWDDTA
FT                   VVLPPGATGPWADWLDASEAGDTPDGLLRVAHCLRALPVAVWVGPPPRA"
FT   CDS_pept        complement(746632..746865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06012"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVU4"
FT                   /protein_id="BAG47813.1"
FT                   /translation="MSNTQQTNEQAAGETRRDGARTVAPTRPRLRAHASRAKRRPQDGA
FT                   AHGTLTAGHDARGASDAHWEEDGAPLPPEEWS"
FT   CDS_pept        746987..748228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BMULJ_06013"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG, K01613"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06013"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47814"
FT                   /db_xref="GOA:A0A0H3KRU8"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRU8"
FT                   /protein_id="BAG47814.1"
FT                   /translation="MPNDNDTQAGRRRLGGWLAGEEKHMAAFRTRIAADARARAGERLR
FT                   TPAVQELARLFDDHAVLHMGLSRAIDEALATGHDLGYRSIGELMTVIDYLMTYTPPFSE
FT                   SSLIVCPLNAFLDWPMCMPSGRAVFRDATVNAHLKRVLNVWCDFLGGPHSRDHLVTTAP
FT                   DGWLCEEARKRIGMSQFQYREDQPHWGFDSWNDFFTRRFRAGARPVASPDDSHVIVSAC
FT                   EAAPYHTATNLRLRDRFWIKGQPYSLRDIFTPARLPLAEHFVGGDLYQAYLAAYNYHRW
FT                   HAPIRGTVTHAYRIDGTYYSIADVEGEDPSGLNDSQGYMTAVATRAIVAIASDDPGLGT
FT                   VAAVFVGMGDVSSCVIEVVPGQRVEKGDEIGYFQFGGSTYCLLFEPGVIDRFLHAPSDD
FT                   APPVQVNAAVALAR"
FT   CDS_pept        complement(748283..748507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06014"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06014"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZA8"
FT                   /protein_id="BAG47815.1"
FT                   /translation="MLTAHEFAALFLVQRAPEQIQLDRDDIVALVERQLVVMQSDASGA
FT                   RRPELTPDGLSILRSVQRGSGGYTNDNSL"
FT   CDS_pept        complement(748762..749094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06015"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47816"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRF5"
FT                   /protein_id="BAG47816.1"
FT                   /translation="MSTRATIPADPPPVFDGATLQLQFVVEIDGVQAECAITAEALEDH
FT                   FGARSALEADLREAFERGRQRIAEACADVVADGHGGAVLHSGYFRVQRRAAAALARQAT
FT                   SHAPRS"
FT   CDS_pept        complement(749091..749660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfpI"
FT                   /locus_tag="BMULJ_06016"
FT                   /product="protease I"
FT                   /note="COG0693: Putative intracellular protease/amidase,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K05520"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06016"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47817"
FT                   /db_xref="GOA:A0A0H3KR19"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR19"
FT                   /protein_id="BAG47817.1"
FT                   /translation="MSGKLANCKVAILAVDGFEEAELVEPQRALSAEGAQVDVISQQPG
FT                   EIQGFRHVDKGARVKVDHTFDDAKQGDYDAIVLPGGVVNGDAMRMIPAAREFVTAAIGA
FT                   DKPVAVICHGGWLLVSAGLVDGRTMTSWPSLQDDIRNAGGKWVDERVVRDGNLITSRKP
FT                   DDLDAFNGALIECLAADRAHAPRERP"
FT   CDS_pept        complement(749981..750343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06017"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47818"
FT                   /db_xref="InterPro:IPR021389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVU9"
FT                   /protein_id="BAG47818.1"
FT                   /translation="MQSNPRIGIEPYDIDDDPDADDLNTTVHLDVATGRITFHAAWAIA
FT                   PDAPPHAVRHSVVLALDCDTMERYADLDDGARMRVHAMLHDSVQAMLERLHDLDEDQTL
FT                   TVELTDAMLDVATRLQ"
FT   CDS_pept        complement(750430..750813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06018"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47819"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRV4"
FT                   /protein_id="BAG47819.1"
FT                   /translation="MTSALSTTKSPACRVLGCAAAAMLAAAAAASPALAQNSQQSDHGS
FT                   GAPLSAGTSSSYTGNGDTAAPPPPNMQQSDGGRGAMSSHSGASGHAKPGAKGAGAGNGR
FT                   SPGATGSGGGGAGGQGSADSSGY"
FT   CDS_pept        750968..751324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06019"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47820"
FT                   /db_xref="InterPro:IPR021513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZB3"
FT                   /protein_id="BAG47820.1"
FT                   /translation="MPSSSPPHARGKRLTRRAGRARSTDRGHAKRWSADVTRDSDALDL
FT                   EPDIFKSDDPGEIAASLKRSAERSRRRKATPFQSAMSMLNFYVNRAGRNLPKTRRTTLE
FT                   RAKRKLREAFGRKP"
FT   CDS_pept        751364..752683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06020"
FT                   /product="putative NhaP-type Na+/H+ and K+/H+ antiporter"
FT                   /note="COG0025: NhaP-type Na+/H+ and K+/H+ antiporters,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47821"
FT                   /db_xref="GOA:A0A0H3KRG0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRG0"
FT                   /protein_id="BAG47821.1"
FT                   /translation="MHETLWYLITGAVLMGMGIATSALRHLPCSTAMIYLVLGIALGPA
FT                   GAGLLHVDIEHDAALLRMIVEIGLLVSLFAIGLRLRVPLSDPLWLVPCRLGLLAMIVTV
FT                   PLLAACAVFALGIGWAPALLLAAILAPTDPVLAHDVQVHDPGDRDLVRFALSGEGGMND
FT                   GIALPFALAALALCGAPEATHGRAPLSLSFALATAWGIVGAAAIGGGLGWITTKTIGWL
FT                   RMRYAQALGFEGFFALALIVLSYGAAEVAHAFGFIATFAAGVAMRRVEHRASGDRDPRE
FT                   VIGQVDSADVVATEKDPDKAHAFMAESVLGFTIELERIAEAVVMTMVGSVLATLPGPLI
FT                   TWRALALAALLFVVVRPLAVRLTLAGSRATIAQRRLMAWFGIRGIGSFYYLLFALEHGP
FT                   TDTVRPLSAPVLAVVSASVVAHGISATPLMNWYHRRQRRH"
FT   CDS_pept        complement(752690..755473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06021"
FT                   /product="putative ATP-dependent DNA ligase"
FT                   /note="COG1793: ATP-dependent DNA ligase, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06021"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47822"
FT                   /db_xref="GOA:A0A0H3KR24"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR24"
FT                   /protein_id="BAG47822.1"
FT                   /translation="MAGKLDPYRRKRHFDATPEPEGTRRRRAPADAQPAERGRHPLRYV
FT                   IQEHHARRLHYDFRLELDGTLKSWAVPKGPSFDPSVKRLAVHVEDHPLEYASFEGEIPA
FT                   GHYGAGSVIVWDEGTWTPEGGLAKAREGYRAGKLKFRLDGEKLHGGWALVRSGRQEGRQ
FT                   EQWLLIKERDDDARSAEAYDVVAQQPGSVHDGATRGHATNGHARARRRGEKAAGKEPDA
FT                   EADADTDADAPRARATKAKRPPALSRVEGAVRAPLPERIAPQLATLVDAPPAHGDWRYE
FT                   LKFDGYRMLARIAGKGARRRVTLMTREGRDWTPKLRALRDALAALEVDDAWLDGEAVVL
FT                   GENGLPDFQLLQNALGSGQSDAVTLFVFDLPYLNGYDLRDAPLTARRAQLEPLFDAADP
FT                   ARLRFSPDLGSDAAGLIANACDTGLEGLIGKRADARYRAGRSPAWIKLKCRRRQEFVIG
FT                   GYTEPTGSRHGFGALLLGVHEPAPNGKRTRGASPLRYVGRVGTGFDTRMLDKLAPLLRE
FT                   HERASSPFDPPPQGWSRTRVHWVEPTLVAECEFAEWTGDGIVRQAAFVALREDKPASQI
FT                   VREVARHPTTENTMDERTSSSARRGRAAADTHDGGQDRAQHRAQERAPAARGKSAPDQV
FT                   GQVRITHPERVLDRESGTRKIDLAHYWERVAPWALPDLAGRPVSLVRAPQDIGGELFFQ
FT                   KHAERREIPFVTQHPGLDPGHGPLLSIDSVDALIGAAQMGTIELHTWNAHASNIERPDR
FT                   IVFDLDPDPALPWRTMIEAAQLVRGLLDELGLVSFCKTSGGKGLHVVVPITRHSGWDEM
FT                   KDFSRAVAQHIAGALPDRFTATMGPRHRRGKIFIDYLRNGRGASTIAAYSVRARPGMGV
FT                   SVPIDWDEVPATTGGAQWTIDTVHERLDALERDPWEAYADTRQRITAAMRTRLAAR"
FT   CDS_pept        complement(755498..756541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06022"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1273: Uncharacterized conserved protein,
FT                   Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06022"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47823"
FT                   /db_xref="GOA:A0A0H3KVV3"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVV3"
FT                   /protein_id="BAG47823.1"
FT                   /translation="MAARMIWKGAISFGLVHVPVQLFPATRTVKPSFRLLDKRSMDPVG
FT                   YRQINKRTGKEVSRDDIVRGYEYEKERYVVLTDDEIRAANPESTQTVDILTFVDQEAVS
FT                   FLYLDTPYYLVPDRKGEKVYALLRDALKDSGKIGIALVVMRDKQHLGALIPVGPLLALD
FT                   TLRWQDELRGLDELSTPVEDAKRAGVSARELAMAKKLIDDMSGEWTPEQYHDTFRDDIL
FT                   ELVERKVRQGRIEEIEERPADRGHVPSNVVDLTELLKRSLRGGGRGSERAAANEDEHDE
FT                   DADTRPRGRRQPAAAKRGAKTAAKTSAKTATKTAAKRTSAAKPGDKRGDGAAAAKKTAA
FT                   RSKKRAA"
FT   CDS_pept        complement(756717..757103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06023"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47824"
FT                   /db_xref="InterPro:IPR021389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRV9"
FT                   /protein_id="BAG47824.1"
FT                   /translation="MTAASDRSQRIAEIEHALANGFPSQSTVVVHADDASGRLTIQVSW
FT                   VRAPVEASAREWRCAVDLRFEPDVIAGYAALDAAERLRVRTYLCDLARRAIDENKPRVE
FT                   DAAIECSAALDVSAADIGDASRGP"
FT   CDS_pept        complement(757100..757261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06024"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47825"
FT                   /db_xref="GOA:A9ATU4"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9ATU4"
FT                   /protein_id="BAG47825.1"
FT                   /translation="MLRYALIFFVIAIIAAVFGFGGIAAGAAEIAKILFYIFVVIFLVT
FT                   LLLGVVRR"
FT   CDS_pept        complement(757308..757496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06025"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47826"
FT                   /db_xref="InterPro:IPR021553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZB6"
FT                   /protein_id="BAG47826.1"
FT                   /translation="MPAKSQAQQRAAGAALSAKRGRTKMQDLKPPSKSMAKSMSEKELE
FT                   KMASTPTHGKPRHKHDS"
FT   CDS_pept        complement(757561..758988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="BMULJ_06026"
FT                   /product="RNA polymerase sigma54"
FT                   /note="COG1508: DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma54 homolog, Ralstonia solanacearum"
FT                   /note="KEGG, K03092"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06026"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47827"
FT                   /db_xref="GOA:A0A0H3KRG5"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRG5"
FT                   /protein_id="BAG47827.1"
FT                   /translation="MSVTLALQMRQHLALTPRLQQSLRLLQLSSLEFQQELRQALDTNP
FT                   FLEDGQGDDEVAAPDPAAEAAAPEAAPERDEVRPVDGELSYTAAPAPRGGSRQGEDGGD
FT                   LSPGEWMAAEPSLHQHLHEALRLYPLNRRDREAARLVIDALDDDGYLRQEPGDLLGAAD
FT                   PALLLSERDLSVALRLVQMLDRPGIAARSLSECLLLQLDAIPAGTPALPEAKAIAREHL
FT                   ERLARRETAEIQRRIGCNQQTLQAACALVRGLDPRPGNHYGSTRGDYVVPDVIVRQVRD
FT                   EWVVTINPAVLPRARLHERYATLFAQSSGERDSPLGQQLQEARWLIRNVQKRFDTIQRV
FT                   GECIVARQRDFFRYGEIAMKPLVLRDIAEELDLHESTVSRATGNKYMATPHGTFEFKHF
FT                   FPRKLEAAGRGVCSASAAKVLIRDMIAAERHTDPLSDVALTQNLAGRGILLARRTVTKY
FT                   RQAMKIPPAELRRRDAA"
FT   CDS_pept        complement(759177..759686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06027"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3685: Uncharacterized protein conserved in
FT                   bacteria, Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06027"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47828"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR30"
FT                   /protein_id="BAG47828.1"
FT                   /translation="MATPHAHLEDWLRDAYAMEHHAQALLDAQARRVGHYPLLQDRLRR
FT                   HRDDTLGQQALVEACLQRLGTTPSTIKDLGARIGAYGQVATAMLSGDEVVKATMAAYAF
FT                   AQVEIAAYTALIAAARAAGEAEIHACCERLLQQERDMAAWLLRELPDVTTAFLDRSAVD
FT                   RIDAKR"
FT   CDS_pept        complement(759707..760018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06028"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47829"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVV8"
FT                   /protein_id="BAG47829.1"
FT                   /translation="MKSIHSLSVAVCAAAAACAMSACTQPNTYGTTGAPPPPHQGGNAS
FT                   PPTETMPDANTRYDTRPSPGNTMPQRSTGTPTGVPDPNVGGAPTNTRPAPGTPPPMQY"
FT   CDS_pept        complement(760063..760374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06029"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRW5"
FT                   /protein_id="BAG47830.1"
FT                   /translation="MSILVKQGMLRDIAEMLGRHFEARAMPFHVEEQPAGALHIGFRVD
FT                   GHPASLTVTFDADAFAALEQADVARQRGALARMAAEFDAMMARRGPTAYAADFHFNRL"
FT   CDS_pept        complement(760969..761274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47831"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZC2"
FT                   /protein_id="BAG47831.1"
FT                   /translation="MIPIKRQPRVRYEVNVCGGGFDSVKHHFTAWKQEPLIYRPERRMF
FT                   EGKADVRPLGDETFGATEPARFALQRACEPGDAYALAARVEDEGRNLWLVMAAYDT"
FT   CDS_pept        761426..761686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06031"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47832"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRH0"
FT                   /protein_id="BAG47832.1"
FT                   /translation="MNDTTRSEERTPSSGQQPDPTPPLKDRDSARTRHSERHIDKSLED
FT                   TFPASDAPSTGGVTRIEPDTPPGTHDDGPWQEKREQDEGGR"
FT   CDS_pept        761740..762171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06032"
FT                   /product="putative signal transduction protein"
FT                   /note="COG0517: FOG: CBS domain, Pseudomonas aeruginosa"
FT                   /note="contains CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06032"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47833"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR35"
FT                   /protein_id="BAG47833.1"
FT                   /translation="MHRVNEIMSQDVVRIAPTDSIRHAAELMARYDIGALPVCDNNRLV
FT                   GMVTDRDLAVRAVSAGKPPDTRVHEVASGPIEWCFDDDSLDEIQHYMADAQLRRLPVVD
FT                   HDKRLVGMLSLADIATRTAGPSRDALANTLEGVSQPKQA"
FT   CDS_pept        762260..762745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06033"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47834"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVW4"
FT                   /protein_id="BAG47834.1"
FT                   /translation="MQTPDQGQTRIVGKGAATADGPGPDVMAADTLEGNKVYTTDGDDV
FT                   GKIKDIMLDVRSGRVAYAVLSSGGLLGIGDKLLAIPWSALTLDTERKCFLLSVSSERIR
FT                   NAPGFDKDHWPAMADPQWAGPLHEYYGSTPYWSAGDELGLTDPTEDLNDPRARDGRL"
FT   CDS_pept        complement(762848..763396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06034"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06034"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47835"
FT                   /db_xref="GOA:A0A0H3KRW8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRW8"
FT                   /protein_id="BAG47835.1"
FT                   /translation="MPIAPGDDPAADDVLLWRSPDSVPRRPRRVLVVDDYRDAADALQL
FT                   LLDARGFECRVVDDPFAVCDVARDWQPFAIVLDIAMPRLDGLQLARRLRGDPRTADMLL
FT                   VACSAFASPVDRERAREAGFDAHCAKPLTPHPLLRYLEAACGARAAQRADGAERVDGAG
FT                   RADGADGLDGADGAVTRGL"
FT   CDS_pept        763602..764261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpo"
FT                   /locus_tag="BMULJ_06035"
FT                   /product="bacteriophage-type DNA polymerase"
FT                   /note="KEGG, K02334"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06035"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47836"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZC7"
FT                   /protein_id="BAG47836.1"
FT                   /translation="MTRASSASGADDTPDDQRPATLDACRRCGLWEHATQPVPGTGPRH
FT                   ASIVLVGEQPGDQEDRTGVPFVGAAGHVLDRALDAAGIDRRSVYLTNAVKHFKWEPRGK
FT                   RRLHKTPAQREITACRYWLDRELESVHPRVIVALGGTALRAVLQDNDATLQRTPTPTRT
FT                   AQGYLVVATYHPSYVLRTRGADSREHAYQTLVDALRTASKLARDDGKPKAGRGDAE"
FT   CDS_pept        764258..765562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06036"
FT                   /product="putative Mn2+ and Fe2+ transporter of the NRAMP
FT                   family"
FT                   /note="COG1914: Mn2+ and Fe2+ transporters of the NRAMP
FT                   family, Sinorhizobium meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06036"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47837"
FT                   /db_xref="GOA:A0A0H3KRH5"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRH5"
FT                   /protein_id="BAG47837.1"
FT                   /translation="MSSARRDAPPADDTARPARPPWYRRLGPGLLAGASDADPSNVAVY
FT                   AQAGSQVGFNMLWMIVVTLPMMVAVQIASACIGRSNREGLIAGIRQHYSARAAKALIAL
FT                   VVIVNVVNVGADLAAMGDATALVVGGRSYWFAPVYGIVSLALQVTMSYERYARWLKWLT
FT                   FALLAYVIELAFVHVDWLHALHALVLPQIAFSHAYATTAVAVLGTTLSPYLFVWQAALE
FT                   VEDAQAAQRNGASARDTALCDRQAQRIRVDTWAGMVVTNAVSFCIMVVGAAVFYARGEH
FT                   DIASTAQAAEALRPIAGEAAFLVFAFGIVGCGLLAIPAFAGSAAYGCAEAWRFREGLNE
FT                   PVRRAPAFYTVLTLCVVVGIAICFSPIDPIRALYWSAVLNGVAAVPMLVMVMLLSARRG
FT                   IDGRPGTGIVSKCFGWLAVALMAAAVVTMVVDMVA"
FT   CDS_pept        complement(765638..766813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhC"
FT                   /locus_tag="BMULJ_06037"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /note="COG1063: Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases, Sinorhizobium meliloti"
FT                   /note="KEGG, K00121"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06037"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47838"
FT                   /db_xref="GOA:A0A0H3KR39"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR39"
FT                   /protein_id="BAG47838.1"
FT                   /translation="MMALCWHGKRTVRYERVPDPAIEHPRDAIVKVRRCAIGGADLHLY
FT                   DAAMPGLKDGAILGREFVGEVVEVGRENRHLHVGDRVVVPFVVACGECEQCRRGNYSVC
FT                   EASNPNRAFVERVYGQGTGGLLGGGHLAGSYAGGHAEYVRVPFADVAPIRLPDELDDER
FT                   ALPLGDTLPAGWQAAAQCAIQPNDVVAVWGAGAVGLFAALAARLLGAREVIAIDCVPAR
FT                   LECARTLGATPLDFTKLSVADTLAKHTRGKGPDKCIDAVGLHAHAIDAVDAPLDRFKET
FT                   SAPGVDPPHVLREAVYACRPGGIVSIAGLYGGLVDNVPVGAIVNKGLTLRAAQTHVPRW
FT                   SDELLKRIADGQIDPSFVVTHRARLEDGPALYELSRTRSDGCIKAVMQPGE"
FT   CDS_pept        complement(766842..767450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06038"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47839"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVW9"
FT                   /protein_id="BAG47839.1"
FT                   /translation="MAQRQAKHEGIQELLCQAYETELGGEKVYQAALQCAVDEDLHKEW
FT                   EKYHRETQHHQEVLRKVFDALGLDPDTQTPGRAAVAATGKSLVQVIEHAKKQADPAVAQ
FT                   VVAAECVVLAETKDHLNWELIGYAADQLSGDAAKVLKEAHDEVEPDEDHHLYHTRGWAR
FT                   EMWIQSMGFKAVLPPPEEVKKVESAAEAARAERSRGKMM"
FT   CDS_pept        complement(767508..768122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06039"
FT                   /product="putative membrane protein"
FT                   /note="COG3652: Predicted outer membrane protein,
FT                   Pseudomonas aeruginosa"
FT                   /note="KEGG, K08995"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06039"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47840"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRX3"
FT                   /protein_id="BAG47840.1"
FT                   /translation="MRTQHWTIAALAAAGVLGLSTAAHAQMPSEPPASNSHVPGGVVNP
FT                   SSGAAAADSGIAKSPQGTDAEFVDKAALGGKTEVQASQLALKQAKSADVRTFAKRMVAD
FT                   HSKANAQLTKLAARKGIKPQAEQIADPDVEALRGKQGHDFDVAYVAAAGPDAHRKTIAL
FT                   FESEARDGKDADLRAFAKSTLPTLKHHLSMAEALQRKVGAQ"
FT   CDS_pept        complement(768149..769006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06040"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases), Nostoc sp.
FT                   PCC 7120"
FT                   /note="KEGG, K00540"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47841"
FT                   /db_xref="GOA:A0A0H3KZD4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZD4"
FT                   /protein_id="BAG47841.1"
FT                   /translation="MTTAQTPPPQKQTQQPGTEREMNPKPRDEAADYVGSGKLAGKVAL
FT                   VTGGDSGIGRAVAIGFAKEGADVAIVYLKESDDAAHTKRLIEQAGRRCEAIACDVGDRQ
FT                   QAFDAVARTVERLGRLDVLVNNAGEQHPQPSVEEVSEEQLERTFRTNVYGMFFCTQAAL
FT                   KHMQPGARIVNTASVTAYHGSPKLPDYSATKGAIVAFTRSLSIELAERDIRVNAVAPGP
FT                   IWTPLIPSTFTAEQVAKFGSNVPLKRPGQPDELIGCYVLLASEGASYMTGQTLHPNGGS
FT                   IVGG"
FT   CDS_pept        complement(769138..769704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06041"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47842"
FT                   /db_xref="GOA:A0A0H3KRI0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRI0"
FT                   /protein_id="BAG47842.1"
FT                   /translation="MAMIVAGRFTTFEEAEGGARRLYERAFGPDDVSIFFLNPGGQHAR
FT                   FPVGGDVYADTAAKPGGRGAVVGVMRGLAIGLVVGLIVYAIGLRYWFVPVAGALAGAYL
FT                   GAFGGALGRMRGQQAEGRGTLAKTESGVILAARVTPGSATTAEDVLRATGATSIERVEG
FT                   DWQNGEWRDFDPVRRPDEAGAAGPR"
FT   CDS_pept        complement(769763..770062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06042"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47843"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR45"
FT                   /protein_id="BAG47843.1"
FT                   /translation="MTSRQHTGHEHSHSRAHEGERTQQDHDKGGHQTGHGKPPSPIDVQ
FT                   KALKGLDYPASKSDVVECAERSHADPDVLEMLKQIPDREYETPASVSKELGRLM"
FT   CDS_pept        complement(770094..771122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06043"
FT                   /product="putative short-chain alcohol dehydrogenase"
FT                   /note="COG1028: Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases), Bacillus
FT                   subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06043"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47844"
FT                   /db_xref="GOA:A0A0H3KVX4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVX4"
FT                   /protein_id="BAG47844.1"
FT                   /translation="MNCMLKPVGEQTIVITGATSGIGLVTARKAARRGAKLVLFARNAD
FT                   ALNTLCEEIRQHGGLAVPVAGDVANIEDLQRAAAQAVETYGGFDTWVNNAGVSIFGTAA
FT                   TVPLEDQRRLFDTNYWGVVHGSLVAADHFRRQNDLRGGAIINMGSEASDAPLPLQSAYV
FT                   ASKHAVKGFTDSLRLELESDRLPVSVTLIKPAAMDTMFVMHAKNYMNVEPKLPPPIYDP
FT                   ELVADAILFAAAHPRRTLFVGGAAKLTSASAYHAPRLFDRLAATLFSRGQRTVRPARPR
FT                   DDNALYESRHALHEREGMEGPVLRSCAYNTVVQRPKVASAVALTAAALLFAAVARSRRA
FT                   AA"
FT   CDS_pept        complement(771151..771555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06044"
FT                   /product="probable periplasmic or secreted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06044"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47845"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRX6"
FT                   /protein_id="BAG47845.1"
FT                   /translation="MKLNSLQARSPRLRGRRTRRIGLAIAVAAATCALAAPNVYAAGDD
FT                   SASSSSSSSSSHSSTGTKIRDATITTKAKAELVGTSGLTSGDIHVKTRHGVVMLTGSVP
FT                   DEQQRTMAVDAVKKVDGVQSVRDQLTIRPK"
FT   CDS_pept        771822..773138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06045"
FT                   /product="putative glycosyltransferase"
FT                   /note="COG0438: Glycosyltransferase, Nostoc sp. PCC 7120"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06045"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47846"
FT                   /db_xref="GOA:A0A0H3KZE0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZE0"
FT                   /protein_id="BAG47846.1"
FT                   /translation="MQRIALISEHASPLGVIGGVDAGGQNIYVANVAKQLAERGLDVDV
FT                   YTRCDNAHLPEVVRIGTRMRVIHVPAGPPVDVPKEKLLPYMGAFADYMIARMRREPDPV
FT                   DVMHANFFMSGEAALRVKKRLGIPLVTTFHALGRVRRLHQGAADGFPDARFAIEDTLAR
FT                   RSDRLIAECPQDALDLTTHYRADASRIEIVPCGFDAREFRPVPRAAARAQLGWPNDAFV
FT                   VLQLGRLVPRKGIDNVIDALARMPRDPQRPTRLYVVGGSQATPDPANDPELARLVALAH
FT                   DVGIADRVTFVGRRDRDALHLYYSAADVFVTTPWYEPFGITPVEAMACATPVIGSDVGG
FT                   IRTTVEDGKTGYLVPPRDPAALAERLVQLRAQPDHCAALGRAGYERAHRFYTWRGVVDR
FT                   LVDVYRDVARERAGTTAATSRRTPVATTPAVLATRKENA"
FT   CDS_pept        773138..774184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="BMULJ_06046"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="COG0451: Nucleoside-diphosphate-sugar epimerases,
FT                   Xylella fastidiosa 9a5c"
FT                   /note="KEGG, K01710"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06046"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47847"
FT                   /db_xref="GOA:A0A0H3KRI5"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRI5"
FT                   /protein_id="BAG47847.1"
FT                   /translation="MKGYDRKRVLVTGGAGFLGSHLCERLVTAGHDVLCVDNFYTGAKD
FT                   NIAHLLDAPNFELMRHDVTFPLYVEVDEIYNLACPASPVHYQRDPVQTTKTSVHGAINL
FT                   LGLAKRVKARILQASTSEVYGDPDVHPQDERYCGRVNPIGIRACYDEGKRCAETLFMDY
FT                   HRQYGVDVRIARIFNTYGPRMHPADGRVVSNFITQALAGEPLTVYGDGTQTRSFCYVDD
FT                   MIDALVRLMDEPGDACEPVNLGSDDEIAMIDVAREVVRVVGATVPIEFRPLPADDPRQR
FT                   RPNLDAARKRLGWRATTPFASGLAHTARYFIHRQAAHHAPGDLVRSTQIASHMLAQIGT
FT                   RNRAAPTS"
FT   CDS_pept        complement(774204..776507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06047"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00936"
FT                   /note="contains a signal receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06047"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47848"
FT                   /db_xref="GOA:A0A0H3KR50"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR50"
FT                   /protein_id="BAG47848.1"
FT                   /translation="MSEKMRTHAGNCATAVMFVAIATVLQALAIRFGGANMPLAVYYPL
FT                   LAAIAWATSFLFGLIATLASSVLVWTLFLSDPAAYAMSLSERLVRLGEFALIGVLACAV
FT                   VAAVRHARVTNERARRREAAGRAQFEALLNALPDGVIAADTNGRLTYVNAAAAALLGCR
FT                   PDDAAGRALRDVLQLTDRDGRRVQTSAVEHALGGTRTTCERHWLRAAGGEPVPVAETAA
FT                   PIADADGNVDGAVLLLRDASADRARADAAQVRRAVVDASPDALIGIDRDARIVSWNPAA
FT                   QRIFGYDEEAAYGRRFDSLIAMRWLKRHPLVQTFDHLREIVGPVDLLCVRRDGGRFRAT
FT                   VAARPVRGEARDGVALSITLRETGAQRRQDRRTQRSLRSARDAGEQAATSNRLKDELLA
FT                   TVSHELRTPLNVIYGWIEVLRNSGDDALRVQAIDAIDRSARSLTRMVGDILDASSLSTG
FT                   KLRLDTMPVDVVRLFADVVAAFQTAASSAGIALEFESRVATCIVSGDAERLRQMLSNLV
FT                   SNALKFTPAGGDVTVSVAHDDTHAVLTVTDTGQGIAPEFVPHVFDMFRRADDSPASSRR
FT                   GLGLGLSIVRHIVQLHGGTVVVDSAGRNRGTTFTVKLPAGWQPIGAMAWGMAQTIVERE
FT                   RLGLDTQRILIVDDDATTRASLTAALRTLGAEVAVASSGHQAVTIAAQMRPTVVLSDLA
FT                   MSDGDGFWLLDAIRRRAAEGDDACNPRVVAVTAHAGLADERRARAAGFDGYLCKPVDVG
FT                   DLAREIARVTSRDD"
FT   CDS_pept        776624..777319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06048"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47849"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVX9"
FT                   /protein_id="BAG47849.1"
FT                   /translation="MTAPTRWLVVSPHLDDAVFSCGQLLAQAPGSVVVTVFAGIPPAGT
FT                   VAPPWDRRAGFRSADEAMRARREEDRRALSILDARPVWLDFFDDQYGTPAAPSAIAARV
FT                   AAAIAEHPGYGVLAPAGLFHRDHLQVQQAMLMLLRDDDTARVWRFYEDVPYRRIEGLMA
FT                   KRVVGWREHGWIARPVGAPAGEGTGGRDAKARAVEAYASQIALFEPHMLADLRKPEMYW
FT                   QLECDVTYA"
FT   CDS_pept        777358..778224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06049"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06049"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47850"
FT                   /db_xref="GOA:A0A0H3KRY0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRY0"
FT                   /protein_id="BAG47850.1"
FT                   /translation="MTAVVLTYRRPDELARTLARLTALPDRPAIVVVDNAADAATAALV
FT                   HARFPHAALVAAPGNPGAAGRNLGVAVARTPYVAFCDDDTWWAAGSLRDAADLLDAYPH
FT                   VAALTARVLVGPDEREDPTCGVMAASPLEAPVPLPGRPILGLLAGATMFRRDAFVRAGG
FT                   YHPRYFLGGEEALLALDLCAAGDWLVYVPTLTVHHYPSTARDARTRASVAARNDAWTAW
FT                   LRWPAGAALVHTVRMLPRLRRERGLVRAFAGLPWILRERRAIAPHVERMRRLIAADDAR
FT                   RNARARA"
FT   CDS_pept        complement(778242..779609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06050"
FT                   /product="sigma54-dependent DNA-binding transcriptional
FT                   regulator"
FT                   /note="COG2204: Response regulator containing CheY-like
FT                   receiver, AAA-type ATPase, and DNA-binding domains,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47851"
FT                   /db_xref="GOA:A0A0H3KZE6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZE6"
FT                   /protein_id="BAG47851.1"
FT                   /translation="MPYVLIVEDDADTRTMLATLARSQQLTCDTAATLEEARTLVATHT
FT                   PDLVLCDLVLPDGNGMDLFDALPKRAHCEMVLTTGHASLETAIDALRRGATDYLVKPLN
FT                   MQRLNSIFARVPRTTALHEEIAELRSELQRLGRFGRMLGSSPAMQAVYDAIGRVARTEA
FT                   SVLLTGESGTGKELAAQTIHDLSLRRRGPFLAINCGAIAANLVESEMFGHDRGSFTGAE
FT                   RQHKGFFERADGGTLFLDEITEMPLESQVKLLRVLETGRLTRLGSTREIDVDVRIVAAT
FT                   NRDPEAAMADGKLRPDLYHRINVFPIPLPSLRERGDDIPMLADAFLQRYNEESGRNLRF
FT                   APAAREALKTYAWPGNVRELRNFVQRASIFSDVDVIETLPPPIMDELSSMVDSHEDRVT
FT                   VPFGTPLEEVDRKLILGTIAQCGGVKAQAAEVLDVSLKTIYNRLAQLENESDKSDS"
FT   CDS_pept        779958..781001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06051"
FT                   /product="sigma54-dependent DNA-binding transcriptional
FT                   regulator"
FT                   /note="COG2204: Response regulator containing CheY-like
FT                   receiver, AAA-type ATPase, and DNA-binding domains,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06051"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47852"
FT                   /db_xref="GOA:A0A0H3KRJ0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRJ0"
FT                   /protein_id="BAG47852.1"
FT                   /translation="MSKSDDDGTRLFGRSRSIQTLMLKVSRVATTRASVLIVGESGAGK
FT                   DIVARLLHDMSPRRRGPFVPVNCGAIPGDIAESQLFGHEKGSFTGAVAQHVGMFEAARG
FT                   GTLFLDEIAEMPLELQVKLLRTLESNTIMRVGGHEAIPIDVRIVAATHHDPVEAVRSGR
FT                   LREDLFYRIATVALHVPALRQREDDVGEIALQIVERLNTRHRTRKRLSTQAMKALRAYT
FT                   WPGNVRELRNAVERAFILADEQIDLQLPRRQPPREEVRHNAMTLHIGTTLAHTQQRFIV
FT                   ASLRHFNGDKPRTAKALGISLKTLYNRLALLPEHERNLVANLSGGTGNAGGGSGSGTNP
FT                   TTNASSQ"
FT   CDS_pept        complement(781044..781994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06052"
FT                   /product="putative LPS biosynthesis related
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06052"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47853"
FT                   /db_xref="GOA:A0A0H3KR54"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR54"
FT                   /protein_id="BAG47853.1"
FT                   /translation="MSRKRLRVLTWHVHGNYLYYLSQAPHDFFIVTKPQHPPGYAGRVG
FT                   HLPWGDNVHEVPVECVRDTAFDCVLYQHHSHYQHDRLHLLSDAQRALPTLFVEHDPPRE
FT                   HPTDTLHPVQDPNVMLVHVTPFNALMWDNGITPTRVIEHGVLVPDNVAYHGTLPKGVSV
FT                   VNNLARRGRRLGVDVFEQVRRSVPLDLVGMGSSELGGIGEVPNPALPHFLSHYRFFFNP
FT                   IRYTSLGLAVIEAMMIGLPIVALATTEMAQLVKTGVNGAADTRPAVLIEAMRMLIRDAD
FT                   LARAWGEAARRDARERFGIERFVRDWDAALTEVAA"
FT   CDS_pept        complement(781984..783060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06053"
FT                   /product="putative ADP-heptose:LPS heptosyltransferase"
FT                   /note="COG0859: ADP-heptose:LPS heptosyltransferase,
FT                   Neisseria meningitidis Z2491"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06053"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47854"
FT                   /db_xref="GOA:A0A0H3KVY5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVY5"
FT                   /protein_id="BAG47854.1"
FT                   /translation="MTLDTSSPPAPRTIAVFRALQLGDMLCAVPALRALRRGAPDAHIT
FT                   LIGLPWAREFASRFGDYINDFIAFPGAPGLGEQAEPDAAARDAFLAKCRAREFDLAIQL
FT                   HGSGARTNAIVASLGAARTAGFMPADGDAAALDCSIVWRDEEPEVTRYLRLMRALGYPD
FT                   WGDYLEFPLGGLDYALWHVLCDEYALEAGRYVIVHPGARMASRRWPVERFANAARRLAD
FT                   DGWQIVLTGTRAEIALAGAFAEQLGRPCVNLCGRTPLGALAALIGRARLLLCNDTGVSH
FT                   VAAALGTPSVVVACGSDTARWAPLDGERHRVLANYPSCRPCMYDACPYEHECAVAIGVD
FT                   DVIDQASALLAEERRHVT"
FT   CDS_pept        complement(783057..784058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06054"
FT                   /product="putative glycosyltransferase"
FT                   /note="involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06054"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47855"
FT                   /db_xref="GOA:A0A0H3KRY4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRY4"
FT                   /protein_id="BAG47855.1"
FT                   /translation="MNMRDTQLPPVVSVVVPTYRRPDLLERCLDALCVQVFDPTTYEII
FT                   VVDDDPAGSARPVVDACRARMTDVPAIRYLSAPDTQGPAGARNVGWRSARGALIAFTDD
FT                   DTIPDPTWLRHGAAALLAEPSAAAAAGRIEVPLRPRPTDYERDAAGLAHAEFATANCFV
FT                   RRAALERVGGFDERFTRAWREDADLMFALREHAGPIVDVEDARIVHPVRPARWGASIGQ
FT                   QSKVYFDALLYKKHRTTYRRHIRPVPPWHYYGAVFAALAAIVCFVARWNAAGAVFAGIW
FT                   AAITAWFCCKRLRGTALTPSHVAEMIVTSIAIPPVSLYWRIRGALHFRVFFL"
FT   CDS_pept        complement(784055..785800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06055"
FT                   /product="carbamoyltransferase"
FT                   /EC_number="2.1.3.-"
FT                   /note="COG2192: Predicted carbamoyl transferase, NodU
FT                   family, Ralstonia solanacearum"
FT                   /note="KEGG, K00612"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06055"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47856"
FT                   /db_xref="GOA:A0A0H3KZF1"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZF1"
FT                   /protein_id="BAG47856.1"
FT                   /translation="MPEPIYTLGINAAFHDSAACLVRDGVVVAAAEEERFTHVKHAKRP
FT                   VPFSTWELPYHAIDYCLAEAGIALADVQHVAYSYDPWLELDRHAGQPSLTLPLEPSAHA
FT                   RPPGGESPWHPLFLSSIVNAPRQLADGAPHHLQRRFRGVTHDGPFRWHFVEHHLAHEAS
FT                   AFLAAPYERCAVMTMDGRGERATTSYGVFDGRTYRRIAQVDLPHSLGLLYERVTRYLGF
FT                   LHSSDEYKVMALASYGKPIYADQMRQLVRYRGDGRYDVDEADLVALFGPARERGGPITP
FT                   NHCDIAHALQLVLEETTLRAVEWLAAETGEKQLAMAGGVALNCVMNARIRDRGPFDDVW
FT                   VQPAAGDAGTALGAALWTDFRERGARGDWRMDHAYLGPSFEDDAIEAFIREAQLPYRRL
FT                   NDVAAQTAALLAQNRVIGWFQGRMEFGPRALGARSILASPIDPDMQRKLNRIKDREDFR
FT                   PVAPVALESKAHEWFSGGRREPLHAPFMLFVYDVRPERAERIPAVRHIDGTARVQTVGP
FT                   QQNPLLHALLTEFDALTGVPVLVNTSFNTRGEPIVCTPRDAIECFWTSPLDALVIGSFL
FT                   MEKPR"
FT   CDS_pept        complement(785804..787021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06056"
FT                   /product="putative ADP-heptose:LPS heptosyltransferase"
FT                   /note="COG0859: ADP-heptose:LPS heptosyltransferase,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06056"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47857"
FT                   /db_xref="GOA:A0A0H3KRJ4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRJ4"
FT                   /protein_id="BAG47857.1"
FT                   /translation="MSAPAWDRARRILCVRLDNLGDVLMTTPALRALKESGNGRHLTLL
FT                   TSSTGAALGAHLPMVDDVWTYDAPWVKHPDAPANPVADLDMIDRLLSARFDAAVIFTVY
FT                   SQSPLPAAMMCWLAGIPLRLAHCRENPYRLLTDRVAETEPDQQVRHEVARQLALVRTIG
FT                   AKTADWRMAFEPGDAARRAVQARLRAALQRFGGPRRGDAQGCGRWLVVHPGASAASRRW
FT                   PAERFGDAAARLVSQFDGVAVTGGSGERALVDAVCERVGPRALPLAGTLPLGELGALIE
FT                   TADLLLSNNSGPAHLAAALGTPVVDLYALTNPQHTPWRVPHRVLNVDVPCRNCYRSVCE
FT                   QPGHPCLRGVRVDDVVDAAHALLRGNARGARHAGARAAAASDTSLAGSAAGASNVIPFA
FT                   HVITRS"
FT   CDS_pept        complement(787018..787629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="BMULJ_06057"
FT                   /product="D-glycero-D-manno-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /note="COG0241: Histidinol phosphatase and related
FT                   phosphatases, Escherichia coli O157:H7"
FT                   /note="KEGG, K03273"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06057"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47858"
FT                   /db_xref="GOA:A0A0H3KR57"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KR57"
FT                   /protein_id="BAG47858.1"
FT                   /translation="MALKHDPRPRGAVLLDKDGTLLDDVPYNVDPARMRLAPGAARALR
FT                   SLASTGMPIAVVSNQPGVALGRFTESQLGAVRQRLAELFEENGAALADFFYCPHHPQGS
FT                   VPRYACDCLCRKPRPGMLRRAVAALGVEAGASWMIGDILDDIEAGRAAQCRTILVDRGY
FT                   ETEWRIDATRTPHFVVDRLDLAADIVVRETARRHGSRVRQ"
FT   CDS_pept        complement(787620..788369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06058"
FT                   /product="short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /note="COG4221: Short-chain alcohol dehydrogenase of
FT                   unknown specificity, Halobacterium sp. NRC-1"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06058"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47859"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVZ0"
FT                   /protein_id="BAG47859.1"
FT                   /translation="MNGTHDPAQLPLAGRTALVTGGGRGLGEAICEELARNGAHVVVAD
FT                   LDGDRAAAVAQRLTRHGVKAVGRPLDVRDEASVLQAVHDAREVVGDLDVIVNNAAIDVT
FT                   APIDDVSVDAWQQVLMTNLFGPYLMCHAVVPMMKARGGGHIVNIASTASKRAWPNASAY
FT                   HATKWGLLGLSHALHAELRPAGVRVSAIVAGGMRTPFLLDRFPDIDEDTLQPPENVAAA
FT                   VRFVLTQPPGTVVPEVMVLPMKETSWP"
FT   CDS_pept        complement(788557..789081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06059"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47860"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRY8"
FT                   /protein_id="BAG47860.1"
FT                   /translation="MPTHLNPSPEGLTARRGGSAFADRQAAIAAVELLLPTLSAALQSD
FT                   FVGDSGCLHIVIMDPALGPHDASFEDAILYEFSLPDPKDWDADYRAYARAKARLSWETG
FT                   RDGHVVQALEPYRLRAGDTNLWGAVAQHGIVVGVSGAQPWFDEAFAGCIAHCLRALAKH
FT