(data stored in ACNUC7421 zone)

EMBL: AP009388

ID   AP009388; SV 1; circular; genomic DNA; STD; PRO; 167422 BP.
XX
AC   AP009388;
XX
PR   Project:PRJDA19401;
XX
DT   04-JUN-2008 (Rel. 96, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Burkholderia multivorans ATCC 17616 plasmid pTGL1 DNA, complete sequence.
XX
KW   .
XX
OS   Burkholderia multivorans ATCC 17616
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
OG   Plasmid pTGL1
XX
RN   [1]
RP   1-167422
RA   Ohtsubo Y., Yuji N., Tsuda M.;
RT   ;
RL   Submitted (17-APR-2007) to the INSDC.
RL   Contact:Yoshiyuki Ohtsubo Tohoku University, Department of Environmental
RL   Life Sciences, Graduate School of Life Sciences; Katahira 2-1-1, Sendai,
RL   Miyagi 980-8577, Japan
XX
RN   [2]
RA   Ohtsubo Y., Yamashita A., Kurokawa K., Takami H., Yuhara S., Nishiyama E.,
RA   Endo R., Miyazaki R., Ono A., Yano K., Ito M., Sota M., Yuji N.,
RA   Hattori M., Tsuda M.;
RT   "Complete genome sequence of Burkholderia multivorans ATCC 17616";
RL   Unpublished.
XX
DR   MD5; a51d39a96fb6fe4b0664fb81deb2cb6a.
DR   BioSample; SAMD00060926.
DR   EnsemblGenomes-Gn; BMULJ_06182.
DR   EnsemblGenomes-Gn; BMULJ_06184.
DR   EnsemblGenomes-Gn; BMULJ_06211.
DR   EnsemblGenomes-Gn; BMULJ_06214.
DR   EnsemblGenomes-Gn; BMULJ_06253.
DR   EnsemblGenomes-Gn; BMULJ_06254.
DR   EnsemblGenomes-Gn; BMULJ_06309.
DR   EnsemblGenomes-Gn; EBG00001436886.
DR   EnsemblGenomes-Gn; EBG00001436887.
DR   EnsemblGenomes-Tr; BMULJ_06182.
DR   EnsemblGenomes-Tr; BMULJ_06184.
DR   EnsemblGenomes-Tr; BMULJ_06211.
DR   EnsemblGenomes-Tr; BMULJ_06214.
DR   EnsemblGenomes-Tr; BMULJ_06253.
DR   EnsemblGenomes-Tr; BMULJ_06254.
DR   EnsemblGenomes-Tr; BMULJ_06309.
DR   EnsemblGenomes-Tr; EBT00001814537.
DR   EnsemblGenomes-Tr; EBT00001814538.
DR   EuropePMC; PMC2553346; 18793444.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   StrainInfo; 39670; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..167422
FT                   /organism="Burkholderia multivorans ATCC 17616"
FT                   /plasmid="pTGL1"
FT                   /strain="ATCC 17616"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395019"
FT   CDS_pept        1108..1326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA5"
FT                   /locus_tag="BMULJ_06174"
FT                   /product="replication initiation protein"
FT                   /note="repA5 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06174"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRW2"
FT                   /protein_id="BAG47967.1"
FT                   /translation="MATRLIKAHKTAPAVFFVPKAFARRFLWAGQGGETFESAGFFDFR
FT                   FANPALCPLTPFGDGARGKSQIKEANP"
FT   CDS_pept        1323..2543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06175"
FT                   /product="putative twin-arginine translocation pathway
FT                   signal protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06175"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47968"
FT                   /db_xref="GOA:A0A0H3KRH2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRH2"
FT                   /protein_id="BAG47968.1"
FT                   /translation="MKNISPESGQALPRRLPYPSSRLFGLLLAVLSTGTSLWISVVAGE
FT                   ERGGSSIERGVWAAIGLVLLVAAHLIPAVTRGTAARIRLPALLLWAVCMVITGYGHATF
FT                   FLAAQRHAGDVRATTVHRSSQLAEIRQPDGRSLAAIARDQAHVRQQLAVARYMRCLNRC
FT                   EQQTIRRETLAAQLAALDVEAGEARRREEAADHIRSTIERQQAREEQARIDPVTAQAAQ
FT                   LVNASRETIDLMVALVHGAVLECVACLGWLLALHPGRRYAESHLQTLAALNAGVTGRSN
FT                   VGGTDSLFPQQKLHTTAEQGKATVTPRRSIGAAGNVSPREALSRQIVDSDFFRLSHAIA
FT                   EGRLRPTVKDIRGFLRCSQDKAMRMRRRLLAVIEGGPSIPPSAAARVRAEQRPRLVHSS
FT                   PDQPWAA"
FT   CDS_pept        2701..2958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06176"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47969"
FT                   /db_xref="GOA:A0A0H3KW99"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KW99"
FT                   /protein_id="BAG47969.1"
FT                   /translation="MILKRSKNLVDIKASRYGLRRAIAFFIIWSIACDLIFTRTLGWST
FT                   AATPYNLARAGVVLAIGVAFAMIVGRRAETRFKAKQAPTL"
FT   CDS_pept        3430..3933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06177"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47970"
FT                   /db_xref="GOA:A0A0H3KSA1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSA1"
FT                   /protein_id="BAG47970.1"
FT                   /translation="MNAVSLDLVGACLPLALAIGYLPRLVRSLDAWTWMLLVGSLGISA
FT                   TFSFCDSKAVHVVPGIYLLCFVTWLRRGRGQCRRVPAAGIFSATMITIFPGDLYGALTC
FT                   HAIGIARIGGGGHLDALLLTPLLLSTMHAAVYYFCELDEHRRVPVGSFLRRQFSLFEYS
FT                   VRSR"
FT   CDS_pept        5356..6537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06178"
FT                   /product="phospholipase/lecithinase/hemolysin-like protein"
FT                   /note="COG3240: Phospholipase/lecithinase/hemolysin,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06178"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47971"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZR4"
FT                   /protein_id="BAG47971.1"
FT                   /translation="MKRNETTPCSTTSIKRLTLAIVAASMLSTLAACGGGGGDSGAAAG
FT                   TPSNNSQTNAKLQVVAFGDELSDVGTYSPKILLGFGGGKYTTNPGDVWAQKVAASYGGT
FT                   LSPAYQGGFGLPLAAANGLGYAQGGARVQESIGIGHAAEGTPDADYAQATTTPVTQQLQ
FT                   NYLQAHQSFNSGQLVLINGGMNDILALAPALQSAVATDVAGGMDPAIAVQKEGGAVLAP
FT                   IAQALASTVQQIVAAGATRVVLVNVPDLGQTPYAVRSGAAAQQLLSGLSTIYNTFLAQS
FT                   VQSLGIPASKLIAVDLAGWQDGVLASYKSNGFAVGNTGTACNIDAMIGNAAKAGVANPQ
FT                   AFGSALFCSPQTYVTEGADQSYMYADLFNPSSHLHALFADQVQQQLKASGMTN"
FT   CDS_pept        complement(6720..7298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06179"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47972"
FT                   /db_xref="GOA:A0A0H3KRW9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRW9"
FT                   /protein_id="BAG47972.1"
FT                   /translation="MRKARCFVTPSAIVPSPFAKVAHSSVLYSTHLCAAMLYLLPPIAG
FT                   AALLLKFARSGALFAALCLPATIAHELLHFVVGHLVWARPTRLSIFPHRSPNGVYVYGM
FT                   VAFENVRWWNAAPAALAPLLSLPIAAASALWRTRTLATLEASDIAIWFGLAQLLVGAWP
FT                   SPTDLRLAGRSWPLLAIVGISASAYFALH"
FT   CDS_pept        complement(7318..8547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47973"
FT                   /db_xref="InterPro:IPR009553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRH7"
FT                   /protein_id="BAG47973.1"
FT                   /translation="MVRFEIDGKTYSEDDPGLQGALARIHGSAIRPLCLCVDPKPGIPM
FT                   YVSKVHGQYLIKRMPDSGPLHSAEKNCPSYEAPAQLSGLGEVMGHAIKEDVDDGTTSLR
FT                   LDFALNKIAGRAPPTPTDSEQDSVKGETSKLTIRSLLHYLWDEARLTHWHPGMEGRRSW
FT                   ATVHKYLLRAAQGKFTKGMHLPSTLYVPEPFYVDRKHEIEQRRRALLAAAHKPGRGGQR
FT                   LFIAIGEIKAVTAARYGHKIELKHAPGFFFMMSADLNKRLKVFEAEKSLWNAYPDIHLV
FT                   MIATFSVDVAGVAELEEMALMTVNEQWIPFSTVEEKSFLETLVSDRRRFVKGLRYNLPS
FT                   TRPLASVVLNDTEGKHTAVYMVPGNASEAYKVALAELLADERMNHLQWESGNAMPVLPP
FT                   PSVRTVSEAA"
FT   CDS_pept        complement(8597..9688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06181"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47974"
FT                   /db_xref="GOA:A0A0H3KWA3"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWA3"
FT                   /protein_id="BAG47974.1"
FT                   /translation="MPKTAKNRNLETVRIRVLPPVLLAPLRRPSPAPLRRPATLFTENL
FT                   AGPRVSGRDTVYFLTGSPGAGKTSMVLKSGELPRDAVMVFEGQMSNFETSRAKIQQVLD
FT                   AGYRAHIIVVHARVENALDNTLQRFYEEGRGSSIATIANIVGRLPESLEQLNSVFGPNL
FT                   LLDVVDVRDRANPVQLQGFENIEVLKSEGNYEHIQRRLQQRVEDQREFGRIDEDAYRQA
FT                   LGLAPRDRVGLDRAGHDWDQGNARERAGAERSGGQTLLTAPPSRSHITHVPPGLRITES
FT                   TSLGPDVVVQGKVIDVSDKQVLVQTSRTDAVRFSKDELSGNVYQGQNVQLNFQPNELAR
FT                   TTERAKEIKQPGVNEKARGIADT"
FT   repeat_region   complement(9567..9571)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(9572..14037)
FT                   /mobile_element_type="insertion sequence: ISBmu1c"
FT                   /note="ISBmu1 carrying ISBmu4. Because this IS unit exists
FT                   three copies, this IS unit seems transpositionally active,
FT                   although orfB of this insertion sequence is interrupted by
FT                   ISBmu4."
FT   repeat_region   complement(order(9572..10101,11959..14037))
FT                   /note="IS21 family, this copy of ISBmu1 has experienced
FT                   insertion of ISBmu4."
FT   repeat_region   complement(9572..9621)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu1c, terminal inverted repeat"
FT   misc_feature    complement(9657..10101)
FT                   /note="Remnant of ISBmu1 transposase, OrfB. Interrupted by
FT                   ISBmu4."
FT   CDS_pept        complement(9657..10055)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06182"
FT                   /note="inactivated ISbmu1c transposase OrfB"
FT                   /note="inactivated by ISBmu4 insertion, C-terminal portion"
FT   mobile_element  complement(10102..11958)
FT                   /mobile_element_type="insertion sequence: ISBmu4"
FT                   /note="IS110 family, no terminal inverted repeat or target
FT                   site duplication have been identified."
FT   CDS_pept        complement(10151..11512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06183"
FT                   /product="ISBmu4 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06183"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47975"
FT                   /db_xref="GOA:A0A0H3KHX3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KHX3"
FT                   /protein_id="BAG47975.1"
FT                   /translation="MASISNAPVRHRTVGIDLAISAVQVAQIFDDGRAIGKPIRFRLTS
FT                   TDLRRFVSAIKSGVGADTPITAVMEPTGMAWFPVANWLQRAGIKVIRVKGQRVKALRKY
FT                   LSEHAKTDAADAHVLGAIPGFGGRGLDPVHVPGPEQHSLQRLTKQRHRYQELVCSARRR
FT                   VLDLIRWACPALEPVLPDTVTQLTLAILGELLDPRKVVAMRRDVLARFLSQHASGNHPK
FT                   SGPFIDSLVEKLKAAAEETIELHGDSVDFTALQFEVAQEVEHLRLWDRHVRAIEREVEQ
FT                   IYQRVHPSDALRSIPGIGATLAPLLIGVLGYAKRFRNEDHIRGFCGMFPTRSSSGGIEK
FT                   PGQRLTKSGSDRVKRALYIAADVARKIDPDLAAVYWRLMVNKGHHHKQAICAVATRLIN
FT                   RIYRVLKTGEPYVLRDQEGNSISVQEGKRIVAAQFKVPLEVRQSRRNQPMPEPA"
FT   CDS_pept        complement(11934..12302)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06184"
FT                   /note="inactivated ISbmu1c transposase OrfB"
FT                   /note="inactivated by ISBmu4 insertion, N-terminal portion"
FT   misc_feature    complement(11959..12302)
FT                   /note="Remnant of ISBmu1 transposase, OrfB. Interrupted by
FT                   ISBmu4."
FT   CDS_pept        complement(12307..13839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06185"
FT                   /product="ISBmu1c transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06185"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47976"
FT                   /db_xref="GOA:A0A0H3KVF0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KVF0"
FT                   /protein_id="BAG47976.1"
FT                   /translation="MANRRFELFEYRQVLVRMRQGDSDRDIARGGLMGRKKLTTVRREA
FT                   EARSWLDPVQPLPDDATIAGVFGRTPHLPHTCVSTVEPYREQVREWLAAGVQGTTIHAA
FT                   LQRNHGYAGSYCAVKRMLRHLAAERSVATTTILDFAPADAAQVDFGAGPVLTVEGIAVR
FT                   TWIFVMTLCWSRHQYAEIVLDQTVETWLASHRRAFEWFGGCPDRVIIDNAKCAIIRACR
FT                   YEPAVQRSYAALAEGYGFRIDACPPHDPQKKGVVESGVKYVKKSFVPLREFRDLADANR
FT                   QLREWVMQQAGTRIHGTVHERPLTRFGVERPLLAALPDVPPVLSVWKEVAVHRDGHVVY
FT                   KHALYSAPFTLVGKSLWLKATDTVIQLFHRHELVATHPRQRAGGRHTVRDHQPPEAQAW
FT                   LEHDPQWCLARAKEIGPSCHGVILALFNDKVLVNLRGAQGIIRLRQKVGDQRLEAACER
FT                   ALAFSSAKYSTIKGILDKGLDSEPVPRPASAPTGAYQNGGRFGRDLQSLLIH"
FT   repeat_region   complement(13987..14037)
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu1c, terminal inverted repeat"
FT   repeat_region   complement(14038..14042)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        14562..14894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06186"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06186"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47977"
FT                   /db_xref="GOA:A0A0H3KS02"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS02"
FT                   /protein_id="BAG47977.1"
FT                   /translation="MRIDHCKSVLSRYRTPSLLGVVAALQILDWHSTLTAPHTRGETNR
FT                   LINWLVQWVSFESAVSTFKLLCLAMLLYGFLFWRKHKGLYETEFALALGVVAVVYGGVV
FT                   FNNYVA"
FT   CDS_pept        15309..16079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="BMULJ_06187"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="COG1651: Protein-disulfide isomerase, Ralstonia
FT                   solanacearum"
FT                   /note="DsbC protein"
FT                   /note="KEGG, K03981"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06187"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47978"
FT                   /db_xref="GOA:A0A0H3KRL1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRL1"
FT                   /protein_id="BAG47978.1"
FT                   /translation="MHRLAKLAISMICASIATLAHAGFPEELTKRFPAAQGAKIERAFP
FT                   GFWSVAKGSDVFFVRDDLSILISGEVVDLNQHRSLTQSVRDANPPRIDVAQLNLKDAIK
FT                   FGNGSRRLFIFSDPDCPYCRKLEGTLTKLQDVTIFIFPFPLAGHENAAEIAEGIWCQKD
FT                   RAAAWRAYQDLTLTTREPELLSAWQDYLRQHNQPARPTCANPIARNLEFGRQWNIAGTP
FT                   ALVFEDGTLIPGLVPAARIEAQLAKSHSNLAASK"
FT   CDS_pept        16326..16850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06188"
FT                   /product="putative transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06188"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47979"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWD3"
FT                   /protein_id="BAG47979.1"
FT                   /translation="MTFRFATIALVVLLACSNASSADLNACFENAARKRHISVDLLRAI
FT                   GHVESRFRPWVTNAQSGAIGVMQIMPVHLKWLRKYGIEREDLYDGCTNINVGAFVLADM
FT                   IRMFGPTWRAVGAYGAGIAANKEQARKEYATLVQASLEQLKRSGSPALPPVRAQLITTP
FT                   AAPSRPKMVVD"
FT   CDS_pept        16850..17518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traW"
FT                   /locus_tag="BMULJ_06189"
FT                   /product="putative type IV secretion system protein"
FT                   /note="TraW protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06189"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSD6"
FT                   /protein_id="BAG47980.1"
FT                   /translation="MNRIPKLLIGLAASLQLSISYAEDLGTKAQTYPLDRDAAEQIKDI
FT                   FRRKQQSGELDAFWKNYRDRTIESIKNPPSLGIATSYGVRTELRELRFQIPQDYRDHTG
FT                   KVIVRRGTVVEPLKVMPLTNGLLFIDGTDARQVEYAIRRSQSERLKIVLTAGSPYALRV
FT                   KYAKVPWHGGTGVPFYFDQRRMIISTLSKLYNIQINSVPAAIFQQGDRLAVQFGMEGAN
FT                   "
FT   CDS_pept        17527..18540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traU"
FT                   /locus_tag="BMULJ_06190"
FT                   /product="type IV secretion system protein"
FT                   /note="TraU protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47981"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZV1"
FT                   /protein_id="BAG47981.1"
FT                   /translation="MRLWASVVLALCLSGNANAQALCNGSFPNLITDVCYDCIFPISIM
FT                   GGFINMGVSGDDYDTGASHFPVCVCANNLAVGTPVSFWEPRYMVDTTTKPGCMPLLGGI
FT                   DIKTPYNAAEYGAENVTNAAISGKRKAAFMQVNEYVNPIMSALGVVVNNPCLDNRSFDV
FT                   PFLSWADPTWNDDALSLMLTPYAYPFAGIPSIAAELPDAISATFGFPMEILFWVAGAWG
FT                   PMYPLNGNVAIANTPEQVSHLMIARLFAKLHAAGAAQATAGNDALQSCGALGVPQLVMD
FT                   KRQYKTNRVFPFPDNKCTPIGRPLAFQEIGAARPQDKDYGYIIFQRKDCCATKTIQ"
FT   CDS_pept        18552..19049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /locus_tag="BMULJ_06191"
FT                   /product="type IV secretion system protein"
FT                   /note="TrbC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06191"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47982"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS08"
FT                   /protein_id="BAG47982.1"
FT                   /translation="MNRLIVALALFAAAPVHGEPSLSETIAAPWNTYIFVSSRMPLQSI
FT                   IQVTREASRAHAVIVLTGFAGEEPTLTSTQRYAADINRACCTTQPARWIVDPVLTRRYG
FT                   VTAAPSFVIAHGASENPGEFSKVAGDMSLSQALKFFAQNSRLPSARDYASKLYYATYGT
FT                   KY"
FT   CDS_pept        19934..20533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traE"
FT                   /locus_tag="BMULJ_06192"
FT                   /product="type IV secretion system protein"
FT                   /note="TraE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06192"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47983"
FT                   /db_xref="GOA:A0A0H3KRL6"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRL6"
FT                   /protein_id="BAG47983.1"
FT                   /translation="MNRTARDKSIAEYKQLNRYLSIGIGCLGIAVLLLSLRVIFQNVIV
FT                   QMQVPGMPDGAKIERNGMDVGAMQAYAFAVTNALASVNPSNGESTKRFVQPFLSPAAYT
FT                   KVSLAIDQKIETLKSQRELGSYYFVLKRFDADEKLGRVFVQGDVHTVNAAKDTGEPWVF
FT                   EYPVRFGNYRMTMDDVIAYPGDKAHTSEWIKAQQKK"
FT   CDS_pept        20539..21498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traK"
FT                   /locus_tag="BMULJ_06193"
FT                   /product="type IV secretion system protein"
FT                   /note="TraK protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06193"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47984"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWD7"
FT                   /protein_id="BAG47984.1"
FT                   /translation="MKTRYLSALMAVYFGSTLSTVAFAQGASASVDFGVATPPAIESAA
FT                   TTTTTTKTKPKLHGHVKRTRDPLKVDASIAVKNTPQKEIVLPGVLTVPGEGIGVPDPSN
FT                   VQKVSWTNTGNKTVYLSADEPNRILLPFKNAYIVHTSDVQVDKREQSNNVYVYWTNAPS
FT                   QARHLYIEPPDGGSALGLAIVPKKIPAQTILVTDDTGIVSGRRPKSSPGSEYTSHIQDL
FT                   MAAIALGKAPDGFSQVDIQLPPIAMNGLSATVDTRYSSQEGDLYVYTVRNPTQSRAVLR
FT                   EEEFDGPEVIAVSIYPKPVLLPGEKTRVIVMARKREEQ"
FT   CDS_pept        21498..22859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="BMULJ_06194"
FT                   /product="type IV secretion system protein"
FT                   /note="TraB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06194"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47985"
FT                   /db_xref="GOA:A0A0H3KSE3"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSE3"
FT                   /protein_id="BAG47985.1"
FT                   /translation="MAMQFKWLEDRKQEWRDMEPKFRYLLVTVAVTGTAFILYQHFTRA
FT                   PKADTAGAVAQGVVAPAAGLPPQPAQPAPAPQGFAGTVGILPTSNRNQGLEDLAAQVGS
FT                   LQQQVVTLTKAVSDGKAGGAPDASKLTTTWTPASAPSASTPTPSDGSNNSPLGKDLPDA
FT                   VNFDQPGNRPSSASGSIAGTAAADPAAFAAARPAEPPAPARPTLVVDKPAPSTASAGNP
FT                   KPDPTFPIYSGIEAVMLSGFNARQGGSNGGPAGAVTKAIDVGAPFVSRVKGATIMPNSW
FT                   KSSDLENCFIGGSATAVLSAERAYVISDKISCVFKNGEIYEGDIVAYGLDVDGNLGLAG
FT                   KVVNKQGSMLMQAALTGMAAGLGSALAPTAVSSYNSNVSAGSTGAYTYPSPSFLLGTSV
FT                   GTGVNKAATELSQFYLNFAKETFPVIEVTAGTRVTWILKQALTLKRKTPPKDQR"
FT   CDS_pept        22883..23572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06195"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47986"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZV6"
FT                   /protein_id="BAG47986.1"
FT                   /translation="MMILPAIAVSLAACSSAFNPIGSNTYDCNRKQDPTSIYCHSFRAV
FT                   EASTNGRLPDSRFDTELKFSEYDKATDIAPPNRRDLTAPPLLTAGGQPVQLGSGGAASQ
FT                   PAPADATPLHAEMPVRMGPVIQRTWIKRFVDENDMWTSDLTVLKEIAPSRWTGFDGGNP
FT                   ARAAGGVYPHKVADTPQDPSAGAVASAQSAPPAAAPPTTNDFIQPGGPAPGGENPAGIP
FT                   MPMSMPQ"
FT   CDS_pept        24049..26631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="BMULJ_06196"
FT                   /product="type IV secretion system protein"
FT                   /note="COG3451: Type IV secretory pathway, VirB4
FT                   components, Salmonella typhimurium LT2"
FT                   /note="TraC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06196"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47987"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS15"
FT                   /protein_id="BAG47987.1"
FT                   /translation="MTATTLKVRRSPASDILNIETYTSDSNLVISKAPGAERPLIGAVY
FT                   RMSPLAGGGGEFSTVVQNVFKAVPDQSVIQVTLVIHPDHDAPDTYLKGKLYGGPVVQDL
FT                   IKRQADLYRRGLASGELPDLPGINKRTVYVSLAVPHRKADDEAVEKSASLQQEFFTNMR
FT                   GCGFHDVVQLNINQLVGVYRQITNIYEPATVPELDPTLDLRYQVFGPDQTFDFRDPHVG
FT                   EINGNTYCTTVTVKKYPERPFHGIMNLLSGAPFNSGSVREGGGQRIEGPCIITTTVRVA
FT                   NQRREWTRVESAIRSRRQHQPLPIKLGVEDTPRVLADLEEIKRQCAEDGTKFVYVSTNA
FT                   FLFGRDRDEAVRAGASVKGTLDKLGFDGRDVVATGLVRLAQTLPLNFSNTIADDLAGEA
FT                   TMASSEVGCLLPVYGDYLGNVNSDFPLTGMAYPTRRGTMHYFDPYVSNSNFNGVMAAES
FT                   GVGKSFSLQAKITAELAEGDNIVLFDNGRSSLKFCALIGGEYNEFGGAKAWRPSLQPFS
FT                   NLTDEEFDEQQETITSLHMLMAYDEEKPDPGARIALSEAVKAAWGQRGKDAEVSTTIAC
FT                   LQAIVESAAENQIQNQVHVAAANLIPRLKAFVDSPTRGPYFRGPSTLDPKAQFTVFELA
FT                   GLGDDNHLKRVVLFCCVNILLSRIKKFKGRKRIYVDEAQDLFSIDSAADAFEGLYLKGR
FT                   KNGVSVWVIVQSLLKLASFKAGSVILRQSAWKMIMAQKKDEIDAVIDQKVMTAFADDPY
FT                   FQKLIKSVESKKNFWSEILIMSDKTYEVVRLYVDKFTATLFSSEGAARDDVLQMMEEGV
FT                   GPLEAVRKVMGDKKARRREWMSEFLDMCKNIDGLTFNEIVRELKEIAK"
FT   CDS_pept        27062..27589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trhF"
FT                   /locus_tag="BMULJ_06197"
FT                   /product="conjugation signal peptidase"
FT                   /note="TrhF protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06197"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47988"
FT                   /db_xref="GOA:A0A0H3KRM0"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRM0"
FT                   /protein_id="BAG47988.1"
FT                   /translation="MTTVSEIDVETPRPGERGKFAAFFFAILVLVLFFWIQPPITFGFD
FT                   PQSERCLPDLHLAMMVHRQPGEVHRGDLLFWRPDGALAGFKEQYILKMVAGTPGDHLTI
FT                   RAGRVFINGKQVVQGFPLAASYGRDQRAFERDEVVPPNAYFMVGVHPNSNDSRYWGYLD
FT                   ARKVSGYAYRLF"
FT   CDS_pept        27570..28586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="BMULJ_06198"
FT                   /product="putative type IV secretion system protein"
FT                   /note="TraF protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06198"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47989"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWE3"
FT                   /protein_id="BAG47989.1"
FT                   /translation="MHTACFDIARGRRIAQWIALALLPVSIHVVAAPATDSPRGDAYGD
FT                   AFLNYQPYVTPAAPVQASAPASKPPTQTAPAPATVAETGPQKVDVVFLRKVYPVLEERA
FT                   INDPTDANISAYMYTKRIILDKAQRFSQSVARVLRQDPLLDENNRVPYASTGALSVRNA
FT                   DYQAQQKAVEELARIGGLVAFVDSTCRFCAMQIPVLDMLKRAHKIEYLVVSLDGARPKG
FT                   FNGPLISDNGLFRKLGLKLTPSIVFVPRPRAYVGADDPNRYLVVSQGFYAMDELVKQIA
FT                   YAGHDTKLLSAEVMRDLNVWDRGVTTTQDLNKLRLDPNKPGSFREILQPYLLKQYQN"
FT   CDS_pept        28597..30078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traH"
FT                   /locus_tag="BMULJ_06199"
FT                   /product="type IV secretion system protein"
FT                   /note="TraH protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06199"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47990"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSE6"
FT                   /protein_id="BAG47990.1"
FT                   /translation="MRVKKFLLIVAMVVVPHLAFAGILADLGSMVMANSTAPGAMTTKD
FT                   RVGVFMGAFTMRSPIKAVNLVTFDPPRIDAGCGGIDLYGGSFSFINSQQLIQIFRQVAA
FT                   DAAGLAFKAAIKSISPSLDALITEFQTLLQNLNNLAKNSCQMAHLIVDPIDNALSNAVN
FT                   GDGNTGGTNSNMFTDVMGGLKSYLSDANSYFKNQSANNPKSGNPLVKKVVASGASSIMG
FT                   LAGLPNVDGSSDNPSDPNSLNNMVLYALLGYNIDAAPCNSLNQAGQGIQSSRPANNTIG
FT                   QVTCSGPAVMTLDDLVKGGGTGSLRPDVPLQLYRCANPNGSVFGGVDNQICTQMQVISF
FT                   NYVGIEGWVNSMLFGSVDPALSVAGNSIVGQINSVNSTTFSAQQVAFMKQAGVPLAGLL
FT                   SKTSNTATRVAIAQRLAPHIVDCVAARIGEVLYKGANLIQTTPGYDLTDDQKDRIKTLR
FT                   TDYLAKQNACNNSDALLRIITEINEGTRFVNTNIK"
FT   CDS_pept        30092..33514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="BMULJ_06200"
FT                   /product="putative type IV secretion system protein"
FT                   /note="TraG protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47991"
FT                   /db_xref="GOA:A0A0H3KZW2"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZW2"
FT                   /protein_id="BAG47991.1"
FT                   /translation="MAIPTLTIYSATADPTTLRAILDSVAMVCKNNLMVWGFAVMVALW
FT                   RLSASTAAAALRSASGQGGAVLGNGALSAAMPFILATVLTNPMLKSTVQIESTVNGSLT
FT                   EVDNVPLAISIIPVAGSVLSMDLNDTVSTAFQRASAEYPTISASANGFLNPLKALLSAR
FT                   TATSRLSGIDSEVKTVLASCLGPDSGVNYSNIQRLVMNAGNTGATSAQSIPVNGINPTA
FT                   IGALLYQASLNSTGKVNDIGLDSTNILSCSDAAYRVADDITNALNSLEFPRVVQGAVNG
FT                   LDSPRPGADYSFNSLASQYYAVSRANTLGGVFAGGTGQANAEFMNLLFSEMVQGDLSCL
FT                   RAGGDTLIQCQASVLQAAEVERNNLQAAASEIPAMRYAGAFGNYLIAVIIGLGPVIIMF
FT                   MMFAGIEAGKSVKTAAHIIVWPLLVNNVGAEIVNGIISIDIANYLQALRQGGWLSQATT
FT                   YTAYKELSLQIGVGSHIMSSLPVLMSIIFGLGESSAMTTVATNIAPRSKETTDNVAPAP
FT                   QATRPMFEGGPVGTISQMGHGAGKLSMTGSVDAVSTSMNFGNMARDASRSLTQSEVRSH
FT                   NLSAGESNLAEFRRAFSTGDFSRLNIDRQVGQTLAENFNNEIRSGKEQHAGNAVTGTRS
FT                   NSNRTTIGAGGSVSASLKSGFSAGLGAHADTSTSADDALQRNDNRGQSDNYSDSVALSR
FT                   ALAKTMAQYSNTSAGSQSTSELSRALSTQRSYQQTLSEVQSVSDAATQGVRESSGFVSM
FT                   SGKIGSEEIAWQQRANPEYAAFQMTQGRRFEENGATRPYLQTAAADAASGATGRLVGDR
FT                   AGQAAINRHRAAVMLAQDQNARPEDRIAAARYLADEARAMQHMKFDPTNPAPMNLEIGS
FT                   PRDGTGVSSSEIAPFARRHLPPPTAPAARIASTTSASPGDDGAHEGAIHPRGGRVGTVP
FT                   AYRGPGASNPVAESQLPQANTSARAVQPGSNDHHAVRAEMPLSRARESKDLGGVTGRRS
FT                   TAADTGAAVASGRQPSGTAADHSTSAPQIPPHTPNGPVHSPRVAPPPVPEQLPAFGGDF
FT                   ERQMRDELASRRDRVSASVQSGDTQAANAGLDAKGHGTAIRAAANVVDNVADIGRTAGA
FT                   GSRTGLAPPVNPQKGRPSTPSANPDLTPGKRGN"
FT   CDS_pept        complement(34698..35345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06201"
FT                   /product="putative thiol-disulfide isomerase or
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06201"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47992"
FT                   /db_xref="GOA:A0A0H3KS20"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS20"
FT                   /protein_id="BAG47992.1"
FT                   /translation="MTSIAWCKTPLLSLAVGLWLCGPLPAIAQVPAGMEQLKPYLQVKP
FT                   VEGEEETVRVFFSPSCQFSRNYFQFFNNLEATLPRQKIFKFTPLVNKADGIQFALSFIA
FT                   VQKYYPTYLRNFMEASFIGAQERGISTSNWAGIERIGHAAHVPVPVPRLVADHATELER
FT                   ELRAALVRQKLLGITNTPAVSVAGTYIVTPEFTSGDAALFSQLVNGLISMAK"
FT   CDS_pept        complement(35342..36844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="BMULJ_06202"
FT                   /product="twitching motility protein"
FT                   /note="KEGG, K02669"
FT                   /note="PilT protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06202"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47993"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRM4"
FT                   /protein_id="BAG47993.1"
FT                   /translation="MQDVHACLPVVEGLDELTDDERRAIMMVREGGNENASVELAIRQV
FT                   FVWAITTQSTDVHVSGRDRRGSIEIYLHIRTPEGFRNFRFRYPKQEGRHWETKLLQLSG
FT                   TPQGASTPEIASTRFEIELPLDFAKAHGLRPFEDAPTYAVDVRVEYTKTFNGFAFICRL
FT                   LDAQRAPELHELGLSYSVYRTIMRAISKPSGLILVTGPTGSGKTTLLNAILSVLNDETR
FT                   AIETIENPVEIALRGNGPIRQRQVSGNITFARALRSILRSDPDVIMVGEIRDSETMEIA
FT                   LQAAQTGHIVLSTLHTNNSAETYTRALDLTKDKARDAYRLAETLKAVISLRRIDRYAGE
FT                   SVVRALTRDEQLWLEANGIDLGDSIREVVPSKHVGKVAIVEVIVTTPEVKQLLRAKRVD
FT                   VTAIYRAACEQDQYEPLAVGGVRAVQSQQTLLRDCIAGLEGSSDAKGYPCSRLRLAKEF
FT                   GLDLVEVACAIDDYHRAADAGGDKPLEAFLVSSRETAYGEVA"
FT   CDS_pept        37042..38148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06203"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06203"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47994"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWE8"
FT                   /protein_id="BAG47994.1"
FT                   /translation="MVAYAQENGIEPGAVKGLAESTFSSPVFADLVNGYRTQNGSIVKS
FT                   VTADVVDRAKALLPKANQLGERLRFGDHNVVSNDGETVVMWMIEAANATGEKRKALLAK
FT                   LAELSARGVPEAMTFQGFASEYGLFGFPKDLGRALSLYRSAAASKYQPAIYNLAIAAGY
FT                   GKLQRPDLASALMYAGQAAAIAADASYRVCGFASFLSYRQGDRVRALQYATSCWSDLAG
FT                   LSRARYDARASLSERVTLLRNSISTGIDDGYALLEQVTRDAGAEPQYLACKYELVNKYR
FT                   RPTGGRNLRDDAVLCYRRYTPTGTQREASIRFNTVVPGIIGFVPTEIAALEKLRASNKF
FT                   HYGWSVPYLPFRQQDVDLFAPYVSHAKQ"
FT   CDS_pept        38706..40007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06204"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSF2"
FT                   /protein_id="BAG47995.1"
FT                   /translation="MKVFIVALAFAFASTALAQNASDVNNGRTFANSIAPTSQTQIVNP
FT                   AGVNASAWAGQTNMPTSVPSGFAAFSNPNTSSAALMAARGSSLTALGNQAQIDCAAFVP
FT                   GNDPYQNQYCAAVNFLNNQCMQPTTGQKSVLGKTGQTISSNANCAGTFGAGQSQFGYGD
FT                   QVTIDDPMFKVILGLGDSARDALSTICTPKTVVTQPAQYENNTCVVSIDKEENGCSQYL
FT                   NATITNSISQALSVESCPDGMTLQGGMCLHQVTYTPWISCPAGYIQSGANRDQCVQISN
FT                   LQGTPYCPGGFGTGHTDNGTMVCVSMSSYPDPPPNVLNNMPLIDRGLCIGGSCYNPSYL
FT                   PLQSCPDGYTFDGTQCTKTTTVGATYSCPNGGALQGQTCVTNDSANPTVTYSCPPGQTL
FT                   NGSNCVKQVVKTSWTDTCTAYEQSAGVALPTPAN"
FT   CDS_pept        40018..41421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traN"
FT                   /locus_tag="BMULJ_06205"
FT                   /product="type IV secretion system protein"
FT                   /note="TraN protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06205"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47996"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZW7"
FT                   /protein_id="BAG47996.1"
FT                   /translation="MLITRIRRLFTSLVVTVLSLPLPTTAQTYGPGACSPVPGSQTCID
FT                   TTPCKTSGTGQQICLSTATPPAGALQVPYSCWQYSYSYACTGTTVDTCGQYRSNSACGV
FT                   VGSVCNDTIAETGQCDEWTYTYRCQTKAEQTGQQMNCSNGLFDNSGFPTPPNNNNSFLT
FT                   GAIGLELLGEAQKYTDGNSIFAGVEESCRKGYEGIQNCCKSTPGAQSNNMVMTAAIGAA
FT                   GSVAKYAGEKLIDLASPYVFDAMYTNGIFSEALTQNFTTAFSLDAANGGGTLGTQLASG
FT                   GIQFGVYGFTVGFGTMTPGLFGANMQLASFGSNGYLAFNPYVFAAMVAIQVIQGLSKCS
FT                   QGEQLLALHKGAGLSTFIKEECAKKALGACVQYVDTYCSFNSQLAQIINIQGKTQLGLP
FT                   LEGCSGLTPDQISKIDFKKIDFSAFSSQMMDQAMKGLPKNITGNYTPIMQNTPSGSSQK
FT                   GGSAVLPTY"
FT   CDS_pept        42972..43625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06206"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47997"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS26"
FT                   /protein_id="BAG47997.1"
FT                   /translation="MASDAHKRLVTLGERWLKREGFSVVATELVTSGTREQADVIGFRS
FT                   NCSAVIEAKATRSDFLADARKPHRISGGLGVYRFYLCPPDVIRVSELPVRWGLLYADRR
FT                   GVREVLRPTGNGWPSFRSTIGDWPAFQHEPDLEAERGVLFSIARRRSLSRSDELYERKL
FT                   QDATRRADRLARENAALAENIRRLELALYLAERGLNAGVPDAHELKSAIRRKVA"
FT   CDS_pept        45156..47306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06207"
FT                   /product="putative Rhs element Vgr protein"
FT                   /note="COG3501: Uncharacterized protein conserved in
FT                   bacteria, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06207"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47998"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRM9"
FT                   /protein_id="BAG47998.1"
FT                   /translation="MSFAPNGGLPTGLGGSPLGALTPISSALGGLGGSLASGVGGQLGP
FT                   LAGLAGHVDTLQRATQLAQTGFSLMEKTPGAIAAALNNATGTARLTQLNRYATIDTPLG
FT                   PDVLLLSAAIIDEHVNRLPEIHLDLLSHQHDLTPDQLIGQQVKLKLDHNARQSTLERIV
FT                   AAGATDNERYFDGYVSAFDRVSHPGRVTQYQMTVVPWFWFLTRSTDCRIFQHKTAQDIL
FT                   NEIFLEHGFYDFVFDIRTEQKPLEYIVMYQESYFNFCTRLMEQEGLIWTHRYEKDKHFL
FT                   VIGDTNLLFRPIDGLATVPYAASQSSEFNGIDQLYEGRRFGVGKVTYQDFNHQNPSSPL
FT                   MRVEASPENLKHARLDSTERFEHQSLYDHGDDGNRYARLAMQAEEAQAHRYAGGGYAWR
FT                   MTTAGCVTVTGHPVPANNQEYVILHVRHEVVNDYTQHETKLPYRNSFALLPKKISYRAP
FT                   RITPKPVIHGTHSAKVVGPKGEEIHTNGSCVKLHFPWDRRGKQDGSDSMWVRVSQPWAG
FT                   DGWGAAAIPRIHQEVLVAFNQGDPDNPVVVGRVYNGEQSNPYHGAGGQTMGIKSQTHKG
FT                   AGSNELRFSDVNGQEEFFMHAQRDMNTVVENSETHKVLGPLRTVLIATGSEEKQIPQGN
FT                   LTETIAEKRSTTATTVEVTTPAKDGGGGTQVYMAERGILLKVQDSSISLAPEGIRLEHK
FT                   GSVILMTDDGVMVNGKRIDLNK"
FT   CDS_pept        47333..47806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06208"
FT                   /db_xref="EnsemblGenomes-Tr:BAG47999"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWF2"
FT                   /protein_id="BAG47999.1"
FT                   /translation="MHYAIHEGTFDLPDAALDRTVNMLILPIGTGGLSLVVSRGRLRDA
FT                   ESIDAFVDREWGLASRTAKDLTLQTRRPVTVGRNECPGVQTESTHEQDGRTFHQHQTAF
FT                   QLDAGGHVIVMTLTSAAPLTDEQRALANRMLESFEPRPHDPAAPSLVSDSHRP"
FT   CDS_pept        47803..52068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06209"
FT                   /product="Rhs family protein"
FT                   /note="COG3209: Rhs family protein, Salmonella typhimurium
FT                   LT2"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06209"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48000"
FT                   /db_xref="GOA:A0A0H3KSF7"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSF7"
FT                   /protein_id="BAG48000.1"
FT                   /translation="MSQPAARKDDPFTHTTLMGDLIGMGGSLLAGMGIGWLLTEGALLA
FT                   AAAVLEVGTAGLATPLVLAIGVGVAATMQASGLNDKIDEAAKGLGNAISPPQEKGHIKS
FT                   GSPDVFINGEHAARAADGADMDTVECQDHPGPQMIAQGSESVYINDLPAARVDDKTTCD
FT                   GTISKGSPNVFVGGGTKTVRDISAARPWVAWLGMAIGIALALCGRGNMKWGNLKGKLPC
FT                   LGIGLLAGLGGTLLGSLMRGHPVNVITGGKILDGADDTDFELPGPLPIVWRRFYSSHDD
FT                   RADSLFGPGWSVPISVELQLVRERGEVVSITYWDEQGRDIVYPAVSPGESYYSVPEGMY
FT                   LICTAGGHYVVETVDGLYRDFGRARTIADTETLKLRRLEDRNGNWIEVTHETAGDVIRP
FT                   ARLHDSAGRLLTLAYDNAHPQRIAAVELTLGVDGEQSETLVRYAYTDAGELAAVTDRSG
FT                   HTGRKFVYEHGLMVQHTLRGGLKCFYAWQGTGRDARVVRHWTDDGEAYTFDADLTQREV
FT                   TITDQLGRITRWTWNEDRQPTHHVDAEGHVWLLEWNAMRQLISATDPAGHVTRFEYDER
FT                   GRQTARIDALGQTARTEWNGFYDLPVAEIDPTNARWIYRYDARGNLTMTRDPAGFATEY
FT                   HRDERGLVHTIRDARGGYKFLAWNARAQLTSYTDCSGKTTRFEYDARGALARVTDAAGH
FT                   ATVYEADAMGRVTAIATADGARQTFHYDDAGRLVEVVAPNQRRTRYELNPRGLLLSRTD
FT                   AADRVVRFGYDNAFRLASLTNENRETYRFRYDRRDLLIEEVGLDGNVRAYEYDMRGLGI
FT                   ALREGKRQTIFERDAIGQLVAKQAARERCEYRYDKAGRIAAGELYALTGRKPSLKNRVT
FT                   LKYGSRGEVLEEYTPTGWLAHTYDELGNRVSTTVSGQQTIDWLHYGSGHVHQIRVDGAA
FT                   IADIERDDLHREVLRTQGKLTSQFGYDAVGRRARAAAQRGASAEVLLAKQWQYDAAGDV
FT                   VQKRDQRYGTTSYRYDPTGRIEQATGPGLPSEVFRWDAAANLVSSDHPGGYVEYNRLRM
FT                   FDDKRFEYDAYGRLARKLSGHGPAREQTFEYDDWNQLKTVVTKDRLGVSTTHFEYDAFG
FT                   RRIRKLNGSYSSTDFLWDGMRLVQETYHDRCGEEALTYLYEANSYAPLARIDHAAPAAN
FT                   DAEARDAVYYFHNDVSGLPEELTDADGELVWQARYKVWGNAVQEEWIARAPQQPAAAWG
FT                   EVQTAATPGHVPRPQNLRFQGQYLDRETGLHYNTFRFYDPDIGRFINPDPIGLNGGHNL
FT                   YRYTPNPITWIDPWGWAGCTLTKAKSKDYDYTLRLKRSEYPQTFGHISDAIGNGHADIV
FT                   TVQRGSAKLNRKLSLAGIKTKAGMDRDEWPMAMFKEGGDGASVRYIDPSDNRGAGSSIG
FT                   NALSDLPDGTRVKVEIFDE"
FT   CDS_pept        52061..52549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48001"
FT                   /db_xref="InterPro:IPR020354"
FT                   /db_xref="InterPro:IPR038691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZX2"
FT                   /protein_id="BAG48001.1"
FT                   /translation="MSDNLSQTVDLLISHSQILVRSRPYDEGLSQWGTGNIDQGAVLHA
FT                   DYLIFDPLPDDAFGAKVYLQVLDKFEMDERAARCIVAPFHITDRNALEVASATEKFKIS
FT                   LQLPLNAYDVYYEVCEGDEVFYKFTFVSEAKHHQAKYLRDDPWGGKKDMPLVSGKFDR"
FT   CDS_pept        52780..53337
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06211"
FT                   /note="inactivated hypothetical protein"
FT   repeat_region   complement(53288..53294)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(53295..55979)
FT                   /mobile_element_type="insertion sequence: IS408"
FT                   /note="IS21 family"
FT   repeat_region   complement(53295..53340)
FT                   /rpt_type=INVERTED
FT                   /note="IS408, terminal inverted repeat"
FT   CDS_pept        complement(53393..54142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06212"
FT                   /product="IS408a transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06212"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48002"
FT                   /db_xref="GOA:P55923"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55923"
FT                   /protein_id="BAG48002.1"
FT                   /translation="MLMQHTLTQLKALKLDGMARAFEEQSTLTASTSLSFEERVGMLVD
FT                   RELAWRDTRRLERLLRAAKLKNPQACVEDIEYRQTRGLDQRIVATLAGCDWVRNAQNLI
FT                   LTGPTGAGKTWLACAFGQQACRQGFSVFYVRVARLFEELKIAHGDGSFTRRLAQLAKID
FT                   VLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHAWLQDPTLADAILD
FT                   RLVHQAHKLPVKGDSMRKKTKSESADA"
FT   CDS_pept        complement(54159..55715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06213"
FT                   /product="IS408a transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06213"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48003"
FT                   /db_xref="GOA:Q51649"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q51649"
FT                   /protein_id="BAG48003.1"
FT                   /translation="MPTPRMSMRKLKEVLRLKWACGLTHRQISRAIGISVGAVSKFAAQ
FT                   ASQAGLDWAAAEAMSDDELDARLRPAATNAAATTTRRIEPDYTALHRELRRKGVTLQLL
FT                   WEEYAEANPGQRTYRYTQFCQKYKDWAKSIKRSMRQQHRAGEKLFADFAGPTVPVLASD
FT                   GGVEFEAHVFVAVLGASNYTFACATRTETMADWIGSLCDALEFIGGVPELLVPDNPKAL
FT                   IARPDRYEPGLGTTTQDFVNHYGTAMLPARPRKPQDKAKVEVGVQIVERWVLARLRHYR
FT                   FYSLAELNKAIAELIADLNQRPFKRLEGNRREWFERLDQPVLRPLPVRRYEIATFQKCR
FT                   VNIDYHVDVGGHYYSVPHSLARQEVWARITRHGVEILHGGKRVAAHARSRLKGKHTTIA
FT                   EHMPAAHRAHMEWTPGRLLNWGASVGPGAEAVVRHLLTNKPHPEMGYRACLGLLSLARK
FT                   YGKHRLEAACQRALKIGSPTRRSVLSILEAGLDLQPSLPTTPAEWRSPEHENVRGPDYY
FT                   H"
FT   repeat_region   complement(55933..55979)
FT                   /rpt_type=INVERTED
FT                   /note="IS408, terminal inverted repeat"
FT   CDS_pept        55959..56330
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06214"
FT                   /note="inactivated hypothetical protein"
FT   repeat_region   complement(55980..55986)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(56515..59985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06215"
FT                   /product="relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06215"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48004"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS30"
FT                   /protein_id="BAG48004.1"
FT                   /translation="MISKEPIRSVADAARYHDKSFNKDAGKKADNYYVNEKATAHWQGR
FT                   GADFLGIRGKAVTKEEFIQFLSGRMPHPDTGKIQNLANNSKGDKRRAGIDFTIAPPKSV
FT                   SIAALVGKDDRVIAAHLAANARTMEWFEKHASLIRVKDEKGRNRPEVAGNLLYATVLHE
FT                   TNRENEPQLHNHNVIVSAVYDGARHSWRSLTNDLLYTLRARGDIIYKAELAAALRHLGY
FT                   QLVYAENGIDFELKGFSRDHVDTFSTRAVQVREALLKHGIDPGEASFDARRVAKLDSRA
FT                   AKQEHPREILQSVWEETAKEANLDVASIVERAREAFADRQVPRRGVERTVEHGAAMGQD
FT                   SGPSRGAAVSVSNDARANALRAVSWAIEHLTEREQAFTLVDLEVTALKFSRGSISEIEW
FT                   AIDQHVRNHMLVDRGITVGGQIQYTTHKAIDNELKLAEHILAGRGQGNVVLDAEDQFDA
FT                   AVAAFEAKKTAEIGEQFKLSGEQIQAARNVLMHEDSIQGIQGEAGTGKTAALAMVKDVA
FT                   QAMGWEVIGVATSAAAAKELEASSGIQSDTVAGYFAKRDSAIRAVELRLQDLRKSISER
FT                   ATLRGLDDQRIEARTLAVKSEDIDYGTHRYTFDHQRGEVFRSPENLRNAIGAALSEIAA
FT                   RHREAAGTEQGHPVTLGEQARETVRAAAANVAASLGRRLMTFEQIGTAEAVAARNTLYL
FT                   ERQGSATELDAEYARTQAKLENLRRYGNVDGKKTLIVMDESSLTGVDDTEKLLRFAREI
FT                   GARTVLQGDVKQHGSVAAGRAFEQAQIAGMNVSILEETRRFRDATAQTRQALADMKAGN
FT                   YAQAIARLDTLRVAESDLAKTVAERYLENLQELTAKGVDAPKVGVVAITNSDRKLINAA
FT                   VHQALTDVGIISGPHFEKPHLDDPKMTGAEQRYASMLSRNRVDALIYRKSYREIGVEKG
FT                   DVLTVTGYDVQKNRIYALNAKGKSVEINPQRQDYFSPAIQESRVFAVGDRVETRAIIRL
FT                   PGQELNRLDNGTQGVIVAIDSLGAKIRWYRDGKESDLKNDDLRFVDHAYAHTSYKEQGA
FT                   TNHREIVAVSKIGARVFNREAAYVAASRAKDNTEIITSDLDTLLRNAGREVGKTTAVEF
FT                   ERAESSLDQSADQGAKHGATRSIEVAPTRSVETERTLERSPDPGNLLGF"
FT   CDS_pept        complement(60461..62488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="BMULJ_06216"
FT                   /product="type IV secretion system protein"
FT                   /note="COG3505: Type IV secretory pathway, VirD4
FT                   components, Salmonella typhimurium LT2"
FT                   /note="TraD protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06216"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48005"
FT                   /db_xref="GOA:A0A0H3KRN8"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRN8"
FT                   /protein_id="BAG48005.1"
FT                   /translation="MTEKVISDAGAGRALFMTRVKLTVHAASMAFFVGALPAMVLPSVW
FT                   WMNTLTAHDVDLVKANILSHVVDQEVPRRWRIRDGVGEKKILTVVKSDGELAQWLTPPQ
FT                   FRNVVPDLARPVTAFRYVAWVSVGLGAAGYYAVWRSLARLGRRARENKRVDGALDVVSA
FT                   EELSKAVRREEAGPYTVLDVALPRSAPMQGIMFVGAQGTGKSLGIHDLMGQVFARGRKS
FT                   VIYDHAGEYFRAYYRPGKDLFFNPALLGSVPWSMFMEMENTYDSDTLAHAFLPPKAGVV
FT                   HGASAFFEDAARVLFSVMALRLRQRGAVYTRLISEAILSMPEDELELLIKNSVASSAVG
FT                   GDSKGQRQGVISSIAIYLNGIAAVQDGTWTLREFYEKDDDTRLFLIGTEDTYAMFAPLF
FT                   RLLITMAFQTIAARREIRHEDRYWFFLDETHVLGDIKLDARQAELRKYGVCVAAGIQAD
FT                   KQFNTSMGADRAETLMNCFNTTVTLRLNEPNMQERMARRLGKSETAVVRAGQAIAVTDW
FT                   RDGGQLSQDEREKWVVMPSKIGLLKNCMAYVQVAGDFPPALVNYRHWLPRWYRPWPRTL
FT                   RFRERQPDPPRDPRFKISAADGQDAIESVRAEAEAMKAQAAAAAAAAATSPTAAVTTQG
FT                   KWIVTDLDTGEVMLPTADVGRGDEHSDGREPVSQENEGLF"
FT   CDS_pept        63602..63916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06217"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWF7"
FT                   /protein_id="BAG48006.1"
FT                   /translation="MNQEKSGTHKPRGRRPAASLEERIAEAERLVASLKEQKKLEERQN
FT                   LERNRKAILDLFKSEGVDTIPIEKWKAAMPELKTVLGVGRGATDVGSGVSEAKGAEQAA
FT                   "
FT   CDS_pept        complement(64742..65041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06218"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48007"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSG2"
FT                   /protein_id="BAG48007.1"
FT                   /translation="MIQEIKMRGLDVRVNYALAKIKAIVDPQSDLVIASLYDAQAEGYY
FT                   DYQAGVYSVPTMFADVPELVAEWEWGQQMAEECDAVSQCPDCQNDSGNPCPVHG"
FT   CDS_pept        complement(65105..65305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06219"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZX8"
FT                   /protein_id="BAG48008.1"
FT                   /translation="MKSNLLRRIAAFFLGCDLNAEIRVLHRWRREEDDVRAVRVETVVN
FT                   GQRKRVTLYRHAPGAWSPMPL"
FT   CDS_pept        complement(66296..66478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06220"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS34"
FT                   /protein_id="BAG48009.1"
FT                   /translation="MEIGMTAYTYEDACDMTVTRAEAEAEIGRHDVEGGFSAFLAEVGD
FT                   RPEYEGKEVLDWLGY"
FT   CDS_pept        complement(66478..67041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06221"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06221"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRP2"
FT                   /protein_id="BAG48010.1"
FT                   /translation="MQIPCTITREHYADIDRAGRSYTLEFVHYAHAETGNRVRTKAHII
FT                   PTVEPFNREPDAPECQLTGTDPARPTTRSSVYLDANENPAIRLSFGYSHQTRATTQVLA
FT                   VERGRVVTQWMTQEQFDAEYAESDVPPLVAAHALMNIGRTGGIDPTAHRYLLFALNAPA
FT                   WRLALNAYGAVARNWIRRTTQQLY"
FT   CDS_pept        complement(67051..67251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06222"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06222"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48011"
FT                   /db_xref="InterPro:IPR022191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWG0"
FT                   /protein_id="BAG48011.1"
FT                   /translation="MRNQYLARTSPAPEGTNECPTLCAEARELANVYAVMIFNRETFID
FT                   AAGLNAFQAVALQGALDAREN"
FT   CDS_pept        complement(67911..68111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06223"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZX8"
FT                   /protein_id="BAG48012.1"
FT                   /translation="MKSNLLRRIAAFFLGCDLNAEIRVLHRWRREEDDVRAVRVETVVN
FT                   GQRKRVTLYRHAPGAWSPMPL"
FT   CDS_pept        complement(68672..69283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06224"
FT                   /product="putative nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06224"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48013"
FT                   /db_xref="GOA:A0A0H3KZY0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZY0"
FT                   /protein_id="BAG48013.1"
FT                   /translation="MTLKLLSWTAPAVIAGCIAELAIALAAFASPVASVATVLTTAAPE
FT                   GRVTSYAFSPDGKGMDLVLYGVGSAHRSIHVLAYVMTYRPLIEALAAKARAGVPVAIAV
FT                   DYGESIANDRDGYIRRGLDYLARAGAAICVVDRYRLMHDKAMILDHRSVQTGSINYTAA
FT                   GAKSNSENVVIAWNDPVLAEAFEQHFRSRLAQCRPLDQVR"
FT   CDS_pept        complement(69280..69753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06225"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06225"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48014"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS38"
FT                   /protein_id="BAG48014.1"
FT                   /translation="MPTIRYFFELDSSQQLQARALVGDLLPEWHCYLVSGRGEVAQALP
FT                   LHPIVETGSIKMSTAARAVLASLDRREMEFVIRHAIGDWSELPSTEHLANQLAIAEGGI
FT                   VTSRFSLDPATWVYVTTQADRCQTHVSVGRVIPANQFPPVARLRPVTSGSART"
FT   CDS_pept        complement(69757..71328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06226"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06226"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48015"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRP6"
FT                   /protein_id="BAG48015.1"
FT                   /translation="MYSTTMAKRSTSGQARAVERFLASVPQGKSSRQQGNIKSNASQAQ
FT                   RIYLAVPPRDIPKARSLGAHLDYDRRLCWIDASMDRTPFAEWIVDETVLANAGIDPEEA
FT                   IADFSLAMRTFGLIPDTVRADGAWHTAKVETPAGPRNSGSYKLERVGGEWRGYIRNFKG
FT                   ASGPWRFQKGRLTREQRAALEAADSDRRAARAAKVIEEQREIAARALKVLVTLPEVECD
FT                   AHPYLARKGVAAHGLRIASGRGMDMITLLNLEHFKSTSDEYLIAPGRDIQDRLRTVQAL
FT                   GPDGSKLFTKGARKTGAFHLIGARRVADLVSAPAVLLSEGYATGASIYEATGLPVVVCF
FT                   DAGNLVAVAKDLVHVLPRRQPKLVCADNDQFFLETAVTRIAELGSVAPETECSFKVNAG
FT                   PRDATRTVRIVDAIADGQWHASAHGKYRLAVECRCGVARSVTVDVITGSDGKHVRSTTS
FT                   NRGVDSAAEAARILRCQAIVPVFNSLVGRPTDFNDLASAEGLAAVREQVRVMLPRELVS
FT                   TNATER"
FT   CDS_pept        complement(73000..75255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06227"
FT                   /product="putative plasmid segregation protein"
FT                   /note="COG1475: Predicted transcriptional regulators,
FT                   Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06227"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48016"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWG5"
FT                   /protein_id="BAG48016.1"
FT                   /translation="MKTVIAQDANVNADALPADMPNMLRAGQREVMIPLKRLVASPYNQ
FT                   RKKKRDQATIVAIADNMLAVGQLQNLVVHKMPQRAKKAQEWGVDAGETRRQAFLFNVER
FT                   GYMSMDDEVRCIEISEAQAILASASENDLHVPPHPADQFAAYKALADEGRSPEFIAAVF
FT                   NVSPKVVAGRLKLANVSPKLFELFAADVISLEQIKALAITDNHERQEAAWFGAKGHWNQ
FT                   SPNALRNVLKGEKLSFGDRMVRFVTVAAYEAAGGEVERDLFAEQDDGFIVNRELLARLF
FT                   DEKIACTVESIKAEGWNWVEARPTFDYDDRNQFTQLYSTPVPLTSDEKAKYEEAQMRAD
FT                   ELSEKIEASYDAEVGDAAYLSDEDREKLDGECNQLYAIMQEMDDRDGEFTSEQMKVSGA
FT                   IVTVGYDGALEIVRGLVRRENRAQARAMMEEAGQSVPRSLTKKVKGLHSEKLLLNLTSH
FT                   RTAAVQTALVANPGVALVAVAHRLLLEFVYEHYSDLSAVQIKEQQPMYSADRAVPGIKE
FT                   LPQYDQLARSVLAVTRMIPKNPNELFGWLLEQPQAVVLNILAVCTALSLNGVSRTEEPN
FT                   AINALAGALELDLTKYWKPTCESYLNHVSKDRIVAIVSDVISKEHGARLGKMKKAEAAQ
FT                   EAEKLLADKNWLPEFMAAAEVRTARTYFGDDGNEQEDADGELATADNLGAHEEVLGDEP
FT                   AQPDTVSDSPDGAETGVKPADVAPTEFAGGRVTQSARFPWPFATPTPNVLAGSRPAA"
FT   CDS_pept        complement(76098..76451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06228"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSH2"
FT                   /protein_id="BAG48017.1"
FT                   /translation="MVETIEIGPAPCDEACAQVGDMRYLERSRAECTAFINQIRRTLGE
FT                   PPDGASLFIKSSAHDFGTYWEVVVKVTGGLSADAREAAIAYAYRCESESPTTWDDDARR
FT                   ELTEAGFPVSEVV"
FT   CDS_pept        complement(79370..81163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06229"
FT                   /product="putative 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06229"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48018"
FT                   /db_xref="GOA:A0A0H3KZY5"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZY5"
FT                   /protein_id="BAG48018.1"
FT                   /translation="MQTIDLFPHLQQRPTLDQRVERAVAALRRLFHERRIAICQFSAGK
FT                   DSGVVAALTLEAARRHAAEGGEAVVYVVTADTGVESPEIVAHAQRELAKMHAYGKRHNV
FT                   RVHVQTVAPSLATSWQVTILSGRALPSYAGTNSDCSVSLKIEPSRVFRNQLARAAKQQG
FT                   YAEPVVCLGSRFAESAKRKAGMQARGDRADTPVRNDEGDLTLCVIADWETEDVWEYIGE
FT                   VTSGLRSTYTDFRETSRIYAHAGNSSCAIVSDLSFEEASAGKRKRRGHCDARTGCWTCQ
FT                   QAEDRSLEEMIKFDEDRYAYASGLNRLNKFIRAIRYDWSRRNWVGRTIKEGYICIEPDT
FT                   FNAATVRELVRYMMTIDRDELVRAKRTGSRPKFQTLPLTMMIAVDAMQSLQGLAPPFAI
FT                   WADYRDIYCNGVRYDVPDVMPVAPQPMPEPMFLHVGEHWDDTADQWTGFRDPLFEALTE
FT                   DSPCARKVHHLKGGRTTWEVPTGKRFEVDEESAEMILDFEFERLVEMHDAGFFPGGITA
FT                   GYRWYLNYGTLTLSRAQQREHDEIARRTDFKDRLGLTLDYAVADLLRRAVRFAALPSPA
FT                   RTAWAHKATTSSAQADLPFVL"
FT   CDS_pept        complement(81657..81926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06230"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS44"
FT                   /protein_id="BAG48019.1"
FT                   /translation="MIRTLPQPFVDALAVLDASIDSRNESLLDVLASIVHPDMICSLFD
FT                   VCALEAEAKRVALRCIDYALTSGLDAEQSAALFAVIEPKIAGRF"
FT   CDS_pept        complement(84386..84571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06231"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48020"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRQ0"
FT                   /protein_id="BAG48020.1"
FT                   /translation="MVFDMMKREMRELVNLVEETTQWETSVACGKVNLADVSAEARAAH
FT                   HARLERIVELRAKYDL"
FT   repeat_region   complement(84816..84821)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  complement(84822..87708)
FT                   /mobile_element_type="insertion sequence: ISBmu7a"
FT                   /note="IS21 family, no terminal inverted repeat has been
FT                   identified."
FT   CDS_pept        complement(85148..85999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06232"
FT                   /product="ISBmu7a transposase"
FT                   /note="OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06232"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48021"
FT                   /db_xref="GOA:A0A0H3KRB8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRB8"
FT                   /protein_id="BAG48021.1"
FT                   /translation="MSLDIDVTRLSLLLNDLRLPAIKQIWSSFAERSDAEGWPAARLLM
FT                   ALAEHEIAERDRRRVERHLKDAKLLPGKTLENFDFDAVPMVSRAHVSALCAGDGWLRNG
FT                   TNLILLGPSGGGKSHLSSAIGLSLLEKGWKVLFARTTDLVQRLQVARRELALESAINRL
FT                   DRFDLVVLDDFAYVSKDQAETSVLFELISARYERRSLCITANQPFGEWDKVFPDRAMTV
FT                   AAVDRLVHHSTIFELNVESYRRRTALQRKQQGPGRPASRATPKNVGVPPTQEDQHGIDL
FT                   TE"
FT   CDS_pept        complement(85996..87480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06233"
FT                   /product="ISBmu7a transposase"
FT                   /note="OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06233"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48022"
FT                   /db_xref="GOA:A0A0H3KYW7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KYW7"
FT                   /protein_id="BAG48022.1"
FT                   /translation="MRLYMKYRLKEGPPQAAARAGFSAATGYRIEEDPRLPSQKKAPRG
FT                   RRRADPLAAIFDTEIVPLLQSAPGIRPIAVLDEMLRRHPDLPGNVRRTLERRIRDWRAL
FT                   HGEEHDVMFRQVHQPGQLGLSDFTEMDSLGVTVAGVTLDHRLYHFRLACSGFEHAHVIL
FT                   GGESYVALAEGLQNAIWALGGAPREHRSDSLSAAFRNLDADARKDLTTRYDALCAHYGM
FT                   QPTRNNRGVAHENGSIESPHGHLKSAVRDALLLRGSHDFDDLGSYRRFIDEIVGRINAR
FT                   NGKRIEVERALLQPLPVQRTCDYEETRVYVTTTCGFVLRKVFYTVPSRLIGHHLRVRLY
FT                   DDRLELFLGGTALMTLQRGRAGPNGKHGHVINYRHVIHALRRKPMALLNLVYRDQVFPR
FT                   EAYRLSFDRLLEQLPERQACRTMVELLSLAHEHNCEAQLAEALQQCLDDGQLPDLDALC
FT                   SRFEAKPTSSMPEVNIQLAALSDYEALLDMATEVAA"
FT   repeat_region   complement(87709..87714)
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(88102..88359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06234"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48023"
FT                   /db_xref="GOA:A0A0H3KZZ0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZZ0"
FT                   /protein_id="BAG48023.1"
FT                   /translation="MLVLQALGVAVMLIVSFQMAMLIWSSETSLSAAYMDSWRKTGTVL
FT                   AHLFQIQPGPSRRIGIIAFGLVGFYLAIAAAIEIVAPLGH"
FT   repeat_region   88400..88403
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   mobile_element  88404..89613
FT                   /mobile_element_type="insertion sequence: ISBmu2"
FT                   /note="IS5 family"
FT   repeat_region   88404..88419
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   CDS_pept        88490..89482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06235"
FT                   /product="ISBmu2 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06235"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48024"
FT                   /db_xref="GOA:A0A0H3KT61"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KT61"
FT                   /protein_id="BAG48024.1"
FT                   /translation="MKRQIGFAEAEIAGKKRVTRRQRFLEEMEKVVPWQRLLSAIEPHY
FT                   PKGTRGRPPIGLERMLRIYFVQQWYGLSDEGLEDALYDSITLRAFAGIDLAIENVPDAT
FT                   TLLKFRRLLIEHELTRKLFDEIGISLCERGLMMKEGTLVDATIIEAPPSTKNAGKSRDP
FT                   EMHQTKKGNEWHFGMKAHIGVDADSGLIHSVVGTAANVSDVSQAHALLHGHEEQVFADA
FT                   GYIGVDKREEMAGKAVKWHVAARRGKIKAMQEGALKDLVIALERTKAQIRSRVEHPFHI
FT                   VKNLFQHRKTRYKGLAKNTAQLFSLFALANLVIARNLLRSVHGSSPSCV"
FT   repeat_region   89598..89613
FT                   /rpt_type=INVERTED
FT                   /note="ISBmu2, terminal inverted repeat"
FT   repeat_region   89614..89617
FT                   /rpt_type=FLANKING
FT                   /note="target site duplication"
FT   CDS_pept        complement(90294..90719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06236"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRQ9"
FT                   /protein_id="BAG48025.1"
FT                   /translation="MASGNDSHFKLRRPCENCPFLKVGAIELAPGRLDGIVDALVKDDR
FT                   GTFHCHKTVHNERTGGEWDGDGNYVASGQESMCAGAMIYLEKLGCPTVGMRLGRVLGLY
FT                   DPDRLRPAFADVIDPRDRQRENRDDEIRKRRAEEGRD"
FT   CDS_pept        complement(90847..91092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06237"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWH5"
FT                   /protein_id="BAG48026.1"
FT                   /translation="MMNSKRANRMLADGEYEATCRERTIFSAAANGHSAVFPRARMVVK
FT                   NGCATFTRDGAEVWNCNARYAAAHFDVQRIPHRKTQ"
FT   CDS_pept        complement(91121..91390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06238"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSI2"
FT                   /protein_id="BAG48027.1"
FT                   /translation="MVGTERLPIELPAGWIAEDDSRGTVITAIDARGRPAGSVTVCTKA
FT                   RGYTLGVAKVRRARDAAEDVYKGLGWQVRLFSDAVCALSQTLEN"
FT   CDS_pept        complement(91807..92184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06239"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KZZ5"
FT                   /protein_id="BAG48028.1"
FT                   /translation="MRSRNNAAFIYRCNRCAQCYIAPRHASCRTRGRSHSILVGPMTEA
FT                   KRPRGRPPTREAKTATQRVNALDEALKASGGRILNRTRLSPEATAALAALSGHFGTDRA
FT                   AIEAALIDLSKRCAQRKKRLY"
FT   CDS_pept        92392..92724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06240"
FT                   /product="DNA-binding protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48029"
FT                   /db_xref="GOA:A0A0H3KS58"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS58"
FT                   /protein_id="BAG48029.1"
FT                   /translation="MNDMLTDIEALQAQLREVNARLAEVKRDEKRAALDAIREQVALYG
FT                   ISEEELLLAAGFRKPRKRRTSAKYYDPSTGKEWSGFGPRPKWLVGKNLDDYRIDRAPKP
FT                   WWPGES"
FT   CDS_pept        92859..93653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06241"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48030"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRR4"
FT                   /protein_id="BAG48030.1"
FT                   /translation="MCYSAKVEANYREYVRRYGADMDIESFRRLYFARAASGDIKIPKA
FT                   VDAALAAAGDDEISAAIFAYRTHRASELESELFKQRTRLAAAEKKLAAKVTKAASEDVR
FT                   IATDKIEAAMRGLEDLRRTDLQERDSRIFPGWYAPVLIELDGKRVIVPMRYRCRLPGWT
FT                   ERDERQKPGTYNARVDSLSTAWRKVFGFSHGLMLVDAFFENVKRDERNVVLRFDPTPRQ
FT                   HMQVACLWTRTEIPGSDDLWSFAAITDDPPPEVAAAGHDRCI"
FT   CDS_pept        93939..94664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06242"
FT                   /product="predicted divalent heavy-metal cations
FT                   transporter"
FT                   /note="COG0428: Predicted divalent heavy-metal cations
FT                   transporter, Mycobacterium tuberculosis CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06242"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48031"
FT                   /db_xref="GOA:A0A0H3KWH9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWH9"
FT                   /protein_id="BAG48031.1"
FT                   /translation="MTPTAKLALLTLPPVLAACFGALAAAWRAPGPKTSSVIQHFTGGI
FT                   VFAAAALELLPQDRAHALIPVVVGFVLGIALMLAISELSGSIETRFETARLPVSLIIIT
FT                   AIDLVVDGLVLGIAFSASDESGIILTVALTLEVLFLALSVSAALAAAGIGRLLSIVVPV
FT                   ALAALLSVAAVVGNAAFAGLPANIYAALLGLGTVALLYLVTEELLVEAHEVPESPFATA
FT                   SFFIGFIVFFLIEGSVKVG"
FT   CDS_pept        complement(94687..95190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06243"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSI7"
FT                   /protein_id="BAG48032.1"
FT                   /translation="MRNIVKGIVLAACLMSTAATAAGWPERALSHAPAHDVGSRANERM
FT                   LCEFAVVPAGAWTARFARGLCEVDNGWLTFVPADTGDDSAVAETRIMLGDVRTASHQSR
FT                   KLKEQLQLTTRDEVIALNVLADDGSRKSREHAIDLWTALRDEGVTPVNGTRIVDTYPTG
FT                   ATTW"
FT   CDS_pept        complement(95217..95492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06244"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48033"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L001"
FT                   /protein_id="BAG48033.1"
FT                   /translation="MNIPRPLIGIAAVALSIAAFSQAVAAQPKSRQEVFQELVRARHDG
FT                   VIPSPNHDYPASPAAVARNQEVHRSTVHRGEKMPMVDAHDNRFAVL"
FT   CDS_pept        95809..96969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06245"
FT                   /product="outer membrane porin"
FT                   /note="COG3203: Outer membrane protein (porin), Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06245"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48034"
FT                   /db_xref="GOA:A0A0H3KS63"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS63"
FT                   /protein_id="BAG48034.1"
FT                   /translation="MNNPVRLVMMSGALLTTAHAAHATEVMLYGLFDTSLTYVWNADAQ
FT                   GKNLVGLGNGNLLGNRFGVKGAEDLGGGLKAIFTLENGFNPNTGALGQGNRMFGRQAFV
FT                   GLESARWGTLTIGRQYDALADVAWPITGDFYFGSVYATPGDVDNYDTSSRTDNAVKYTS
FT                   PVVGGFQFVGMYALGGVAGKSGAGQTWSAGLSYSNGPFDAAGGYYYAANRSSLANGIRT
FT                   GWNGTSDGTFDGSLVNGGYISAKSIGIARGALRYTFAPFTVGIDYSNAQYKADATSAFR
FT                   GTQKYDTARGFFNYQTTASLLVGVGYSYTKARGDTSATYHQVSAGADYVLSKRTDLYAV
FT                   GAWQRANGEQRTLDGGTQPAQASIGSYGYGGTRTQGIINLGLRHRF"
FT   CDS_pept        complement(97169..97486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06246"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48035"
FT                   /db_xref="GOA:A0A0H3KRR7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRR7"
FT                   /protein_id="BAG48035.1"
FT                   /translation="MADAPAAFVPIATAASIAGGVVQTFIPDRKLPRPAIRLALIAALT
FT                   VPLYAGCVSTRSDTTAAARKAAPANLMPGEQVDYAGHRCGNPNMHVKTHPCLFPQSNSR
FT                   P"
FT   CDS_pept        97692..97976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06247"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48036"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWI4"
FT                   /protein_id="BAG48036.1"
FT                   /translation="MKTAKLAALFVTATLSLGMATQAAFAQTQTQGKSRTQVINELKQA
FT                   QHDGIVPINKTQYPPTAEVVARNKELHGISVHGGEKKPQTDNHDALAAK"
FT   CDS_pept        complement(98059..99465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="BMULJ_06248"
FT                   /product="two-component system heavy metal sensor histidine
FT                   kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /note="CusS protein"
FT                   /note="KEGG, K07644"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06248"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48037"
FT                   /db_xref="GOA:A0A0H3KSJ3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSJ3"
FT                   /protein_id="BAG48037.1"
FT                   /translation="MIARLLPRTLRGRLTALIILSTSVILASSGVALYEALSNRVETTA
FT                   AEQMAGISAALGAHLAEARTTADVARNTDIWIDQLHGHPNMDLAIFDAAGTRLVGTPGF
FT                   RPYAPLMLTNAGRVPVGIAPPGARHQYLLTTVPLAGAGAPVVRVAVQYDRSADVLLLRT
FT                   HAYTIVVIEVFGVVLAAAIAYGIAALGLSPLRRFAARAEQMSSSRLAHPLPELDTSGEL
FT                   KELEHAFNGMLARLNESFTRLSQFSSNLAHDMRTPLTNLQAAAQVVLSQPRSADEYRSV
FT                   IESSIDEYQRLSRMIEDMLFLARSEQAGTSIDVRRLNAAEEAERVAGYYEPLAEDEGVT
FT                   VKVDGHAWVDADLTLYQRALSNLLSNALTYAPRGSVVTIDCVEQGGATTIAVSDTGPGI
FT                   AAEHVGRIFERFYRVDPSRHNSASGTGLGLAIVRSIMDNHGGECGVDSEPGRRTTFWLR
FT                   FPRRPAAIST"
FT   CDS_pept        complement(99462..100145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusR"
FT                   /locus_tag="BMULJ_06249"
FT                   /product="two-component system copper resistance phosphate
FT                   regulon response regulator"
FT                   /note="COG0745: Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain, Ralstonia solanacearum"
FT                   /note="CusR protein"
FT                   /note="KEGG, K07665"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06249"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48038"
FT                   /db_xref="GOA:A0A0H3L006"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L006"
FT                   /protein_id="BAG48038.1"
FT                   /translation="MRILIVEDEPKTGAYLRKGLTEAGYVVDWVEDGITGQHQAETEEY
FT                   DLLVLDVMLPGQDGWTLLQNLRRSKSTPVLFLTARDDVGDRVKGLELGADDYLAKPFDF
FT                   VELTARIKSILRRGQPRDSNTLRAADLELDLTRRKATRQGDTILLTAKEFALLWLLMRR
FT                   EGEILPRATIASQVWDMNFNSDTNVVDSAIRRLRSKIDDAYEPKLIHTVRGMGYVLEAR
FT                   GGAAA"
FT   CDS_pept        complement(100145..103357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06250"
FT                   /product="HME family heavy-metal exporter"
FT                   /note="COG3696: Putative silver efflux pump, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K07239"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48039"
FT                   /db_xref="GOA:A0A0H3KS67"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS67"
FT                   /protein_id="BAG48039.1"
FT                   /translation="MFERLIRFAIAHRWLVMLAIAAVAALGVFSYQRLPIDAVPDITNV
FT                   QVQINTSAPGYSPLEAEQRITYPVETVMAGLPGLEQTRSISRYGLSQVTVIFKDGTDIY
FT                   FARQLVNERIQEAKDKLPAGIAPAMGPTSTGLGEIYLWTVEADANARKPDGTRYTATDL
FT                   RELQDWVVRPQLRNVRGVTEVNSIGGYVKEYRVAPNPAKLMSYGLTLADVVRALERNND
FT                   NVGAGYIEKRGEQYLVRVPGQARTVDDIANIVLTNVGGVPVRMKDVGVVDIGRELRTGA
FT                   ATSNGEEVVLGTVFMLMGENSRTVSKAVAAKMEDVNRTLPAGVKAIPVYDRTVLVEKAV
FT                   ATVKKNLLEGAVLVIAVLFLFLGNIRAALITALVIPLSMLMTFTGMVNAKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENCVRRLAHAQSAAGRPLTRDERFAEVFGASQEARRALIFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAITVVMALAAAMVLTVTFIPAAVALFIGERVEEKENR
FT                   LMGWARRAYEPVLAAFMTRPARVMIGAGAIVLVTLGLATRLGSEFIPSLNEGDLAVSAL
FT                   RIPGTSLSQSVEMQKSIEKTLKARFPEIERVFARTGTAEIAADPMPPNLSDGYIMLKPA
FT                   DTWPDPKKPRDQLVREIEEALAELPGNAYEFSQPIQLRFNELISGVRSDVAVKIFGDDM
FT                   AVLNQTGEQIAAALQKVPGASEVKVEQTTGLPVLTVNLDRDKLARYGVSVADLQDSVAA
FT                   AVGGQKAGTLFQGDRRFDIVVRLPDELRSDIEAIKRLPIALPAPAAGASAPLAAAPYVP
FT                   LAELATIDVAPGPNQISREDGKRRVVVSANVRGRDVGSFVADAREQLQQDVRVPAGYWV
FT                   SWGGQFEQLQSASERLKLVVPLALFMVFVLLFVMFNNVKDGLLVFTGIPFALSGGVVSL
FT                   WLRGIPLSITAAVGFIALSGVAVLNGLVMISFIRNLRDEGMPLDAAVHDGALTRLRPVL
FT                   MTALVASLGFLPMAFATGTGAEVQRPLATVVIGGILSSTALTLLVLPVLYRVSHAVSWR
FT                   AALRGGFGAGVLRRLGFFKGNA"
FT   CDS_pept        complement(103486..104961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="BMULJ_06251"
FT                   /product="heavy metal resistance protein"
FT                   /note="COG0845: Membrane-fusion protein, Pseudomonas
FT                   aeruginosa"
FT                   /note="CzcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06251"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48040"
FT                   /db_xref="GOA:A0A0H3KRS0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRS0"
FT                   /protein_id="BAG48040.1"
FT                   /translation="MSRSRIFVIAAAVLGGAGIVIGALAVTRGGSGASAPTAAETAQPT
FT                   DAAGVGARGGVVLKRGKLSVEIVMTEKPGDARLVVYPFVDDKPATQGVTVSGTLVRYDR
FT                   THEPLRFDAAGQKFVSAQSIAKPHVFDATIDVKSGNDAASFPFARADGAIALTDAQLAT
FT                   SRIALAKAGPAQIATPFQLPGEIKFNEDRTAHVVPRVAGIVEQVSVSLGQNVAKGQVLA
FT                   VIASTDLADRRSELLTAERRLSGARATYERERTLWQERISAEQDYQQAQVQLREAEIAV
FT                   QNARQKLAALNAPVGAGALNRYELRAPFAGTIVEKHATPGEAIAADASMFVISDLSTVW
FT                   AEMAVPAQRLNDVRVGRDATVSATAFESRSSGPIAYVGSLLGEQTRTAPARVVLPNPDR
FT                   VWRPGMFVNVSVDAGRQGVPLAVASDALQDVDGAPSVFVRSPKGFVAQAVETGRRDERA
FT                   TEVLKGLKPGQEYAASNSFVLKAELGKGSAEHE"
FT   CDS_pept        complement(104987..106294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="BMULJ_06252"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Ralstonia
FT                   solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06252"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48041"
FT                   /db_xref="GOA:A0A0H3KWI9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWI9"
FT                   /protein_id="BAG48041.1"
FT                   /translation="MLKPNLALAIVFAMAATAHAQPSLSPGPAPGAAAAPIGAPPSDAL
FT                   PASSLTLSDALAVAARNNPALRGARADVDASAGVLMQAGARPNPEVSFLQEGFSRAERT
FT                   STALINQTIELGGKRRARLDVASYGREAASASLDEQGAAVRADVIAAFYGLLAAQRQLQ
FT                   VTEESAAIAARSADLAGRRAQAGKVSPVEATKAQVAAAGVQIEVVTARGRVEVAREKLN
FT                   AVMGEARNDRLAVLGDLETVPPVEPLSALTAQLDDAPLARVARAEMLRSNAAISLERAR
FT                   RIPDVTVSAGVKRVTTGGVPNNQAVVGVSIPIPLFNTNKGALLEATHKAERANADLDRE
FT                   RTRLRLELTQAYANFEAAEQEAQRLKSDILPAARLALDAMWRGYELGKFSFLDVLDAQR
FT                   TLFQGQSQYVRALAGAHAARADIGRLVGTPLAAVAQ"
FT   CDS_pept        complement(106333..106689)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06253"
FT                   /note="truncated arsenical resistance protein"
FT   CDS_pept        complement(106696..106842)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06254"
FT                   /note="truncated arsenical resistance protein"
FT   CDS_pept        complement(107335..109920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06255"
FT                   /product="cation transport ATPase"
FT                   /note="COG2217: Cation transport ATPase, Caulobacter
FT                   vibrioides"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06255"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48042"
FT                   /db_xref="GOA:A0A0H3KSJ7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSJ7"
FT                   /protein_id="BAG48042.1"
FT                   /translation="MSDIQKLRLDLPLVLPDIYGAEDRCVSRLQDKLADRPGIEGAHIT
FT                   GAAEGEPQLCVHYDPAVISLSRLRELIRSEGLAVAGRFAHIVGRVNAPMHVRATRRVAE
FT                   QLRSLGGIIEADVSPSGVVRIEYDRSLTDESDLTQRLTLLDISVNWATPAVQPTTAVRS
FT                   CKASADSGTAGHKAAANDHRALQRANHTCGKDEGGEHSHRHGGLFGEKTELIFACLSGV
FT                   FLMAGWLVGRRGTGLEWLSTHCYVVSYFFGGYYTIQEAIENLRAKRFEIDTLMLVAAAG
FT                   AAALGSWGEGALLLFLFSLGHSLEHYAMGRARRAIEALTKLAPDTATVRRDSGTEVVPL
FT                   EKLEVGDVVVVKPNERLPADGVVVVGTSSVNQAPVTGESVPVDKRPVEDGRITIGRFEG
FT                   VAAESRVFAGTINGAGAMDIMVARKADQSTMARVIKMVTEAEAQRSPTQQFTEKFERIF
FT                   VPSVLVLVGLLLCAGVVIDEPFSHTFYRAMAVLVAASPCALAISVPSAVLSGVARAARS
FT                   GVLVKGGGPLENLGTLTSIAFDKTGTLTEGKPKLTEVVPAQGVPEHELLAVALAVEEHS
FT                   DHPLAAAIVNGAKERLRDKTDLPQAVDVKSITGRGVRAQLGGETVHIGKPILFRELSDS
FT                   TVPDDIDEANKKLIADGHTTMIIRKGARFLGVIGVMDTPRPVAGRVMGELRKLGIERLI
FT                   MISGDSQKVAEAVAQTVGLTEAQGDLMPEQKVEEIKKLRTEHGKVAMVGDGVNDGPAMA
FT                   NATVGIAMGAAGSDVALETADVALMADDLAQLPFAVGLSRSTSRVIKQNLWMSLGVVAV
FT                   LIPATVLGLNIGTAVIFHEGSTLLVVANALRLLAYKPFDKSATAAEPAT"
FT   CDS_pept        110520..110855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06256"
FT                   /product="ArsR family transcriptional regulator"
FT                   /note="COG0640: Predicted transcriptional regulators,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06256"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48043"
FT                   /db_xref="GOA:A0A0H3L012"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L012"
FT                   /protein_id="BAG48043.1"
FT                   /translation="METNQTIAALAALAHESRLAVFRALVQAGPEGMPAGQIATLLDVP
FT                   PSSLSFHLKELAHAQLVTSRQEGRFVFYCANFATMNGLLAYLTENCCGGNPCSPAGACS
FT                   PVKEQHS"
FT   CDS_pept        110852..111331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06257"
FT                   /product="hypothetical protein"
FT                   /note="COG0346: Lactoylglutathione lyase and related
FT                   lyases, Mycobacterium tuberculosis CDC1551"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06257"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48044"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS71"
FT                   /protein_id="BAG48044.1"
FT                   /translation="MKRFHVHISVPDLVDSIRFYSALFAAEPTVVKSDYAKWMLDDPRV
FT                   DFAISQRGAAPGLDHLGVQVENDAELAEMHTRLNGAALPVDEQIGTACCYARSDKYWTV
FT                   DPQGIAWETYQTLGDVPTFGESRNASAAESNADASACCSPARGKPIGVPVKSSCC"
FT   CDS_pept        111341..111835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="BMULJ_06258"
FT                   /product="protein-tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="COG0394: Protein-tyrosine-phosphatase, Mesorhizobium
FT                   loti"
FT                   /note="KEGG, K01104"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06258"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48045"
FT                   /db_xref="GOA:A0A0H3KRS5"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRS5"
FT                   /protein_id="BAG48045.1"
FT                   /translation="MSDKPYNVLFICTGNSARSILSEGLMNRLGEGRFVAYSAGSHPKG
FT                   EVNPFALRELARWQLPTEGYRSKSWDEFAAPGAPALDFVFTVCDKATGEVCPIWPGQPI
FT                   TAHWGVPDPADVEGSDEQKQQAMHDAALTLKRRIDLLLSLPLAKLDNVALQKSLTEIGQ
FT                   K"
FT   CDS_pept        111853..112347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC2"
FT                   /locus_tag="BMULJ_06259"
FT                   /product="arsenate reductase"
FT                   /note="COG0394: Protein-tyrosine-phosphatase, Ralstonia
FT                   solanacearum"
FT                   /note="KEGG, K03741"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06259"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48046"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWJ4"
FT                   /protein_id="BAG48046.1"
FT                   /translation="MTTNVLILCTHNSARSVLSEGMLNHWAAKLGKDVRAYSAGSAPSG
FT                   RLNPFALEALTTAGVDVSGYRSKSWDEFVGDGAPEMRVVITVCDSAAAETCPYWPGSPV
FT                   KVHWGYADPSNALGGDEGKRLAFELTRQAIGYRMLQLLALPLDRMSNAELQTALTEISQ
FT                   N"
FT   CDS_pept        112411..113484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06260"
FT                   /product="ACR3 family arsenite transporter"
FT                   /note="COG0798: Arsenite efflux pump ACR3 and related
FT                   permeases, Agrobacterium tumefaciens strain C58"
FT                   /note="KEGG, K03325"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48047"
FT                   /db_xref="GOA:A0A0H3KSK2"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSK2"
FT                   /protein_id="BAG48047.1"
FT                   /translation="MNTSNVAPPGKAVAKPSINFFERYLTVWVALCIVAGITLGQVLPG
FT                   LFQQIGRMEYAQINLPVGLLIWVMIIPMLVKVDFGALHEVRQHVKGIGVTLVVNWLVKP
FT                   FSMAFLGWLFIRHLFAPMLPTDQLDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLFTLS
FT                   QVALNDSIMVIAFAPLVGLLLGMSAITVPWATLLTSVVLYIVIPVIIAQILRKRLLANG
FT                   QAAFDAAMARIGPWSIAALLATLVLLFAFQGEAILKQPLVIALLAVPILIQVFFNSALA
FT                   YWLNRAVGEKHNIACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLIEVPVML
FT                   LVVRIVNQSKGWYECRT"
FT   CDS_pept        113486..114718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06261"
FT                   /product="permease of the major facilitator superfamily"
FT                   /note="COG0477: Permeases of the major facilitator
FT                   superfamily, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06261"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48048"
FT                   /db_xref="GOA:A0A0H3L016"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L016"
FT                   /protein_id="BAG48048.1"
FT                   /translation="MSTHAPRPHAWLTPSLGLTQIVGWGSMFYAYGVLMQPMQDELGLS
FT                   KPVVVGAYSVALLISGLLSTSAGSIIDRVGGRALMAGGSLLAALMLVCLSRVNNVVGLY
FT                   LVWAGIGVAMSATLYQPAFTVITQIFGNDYRRAITHLTLFGGFASTVFWPLTQTLLQHV
FT                   GWRDTWQLYAGANLAICVPVHVALPSRSHAPHGVTPTQTEQPAANLGAVLRDPAFYLVT
FT                   AAVTLNALVFAAMSLHMIAVLQAHGISAANAAWVGALVGPMQVLGRVLETTIGKRASTR
FT                   QVGMAAMALLPLSLVLLFASGTWLPVYVVFAALYGIGNGVMTIVRGALPAELYGRTAYG
FT                   AISGAMATPVQIAIAAGPFVASLLYVAGNGYPGTLLALAGIGATGAILFRYAILHLRHH
FT                   AVPLSKQGIST"
FT   CDS_pept        114715..115137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC1"
FT                   /locus_tag="BMULJ_06262"
FT                   /product="arsenate reductase"
FT                   /note="COG1393: Arsenate reductase and related proteins,
FT                   glutaredoxin family, Mesorhizobium loti"
FT                   /note="KEGG, K00537"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06262"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48049"
FT                   /db_xref="GOA:A0A0H3KS75"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS75"
FT                   /protein_id="BAG48049.1"
FT                   /translation="MSNITIYHNPDCGTSRNALALIRNSGEEPVVIEYLRTPPSRETLV
FT                   KLLADAGLTVRELLREKGTPYAELGLGDPKWTDEQLLDFIGQHPILMNRPIVVTPIGTK
FT                   LCRPSEAVLDILPNPQTGPFTKEDGEVVIDAEGKRV"
FT   CDS_pept        115130..115852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06263"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /note="COG0431: Predicted flavoprotein, Sinorhizobium
FT                   meliloti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06263"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48050"
FT                   /db_xref="GOA:A0A0H3KRT2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRT2"
FT                   /protein_id="BAG48050.1"
FT                   /translation="MSEQLNDMPQLDATLFRVPDAAQLRPATPSTHPPRLLLLYGSLRE
FT                   RSFSRLLVEEAEHLLTAMGAEVRVFNPSGLPLPDDAPESHPKVVELRELVIWSEGMVWC
FT                   SPERHGAMTGIMKSQIDWIPLSVGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRVLGRWM
FT                   RMLTIPNQSSVAKAFAEFDEAGRMKPSPYYDRVVDVMEELVKFTLLTRDIGPYLVDRYS
FT                   ERKESAEELSKRVNQRSI"
FT   CDS_pept        115874..116302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06264"
FT                   /product="putative N-acetylglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06264"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48051"
FT                   /db_xref="GOA:A0A0H3KWJ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWJ9"
FT                   /protein_id="BAG48051.1"
FT                   /translation="MEIRPATVDDLASIETLLRQCGLPVVGVSDHLRNFVVATEGSMMC
FT                   GCGGLEHYGDAALVRSIAVAERARDSGPGQRIVSRLVAECHALQVRSLVLLTTTAEHYF
FT                   TRLGFVRVARGDVMPLVLASSQFQGVCPGSAVSMLRVL"
FT   CDS_pept        complement(116392..116787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06265"
FT                   /product="hypothetical protein"
FT                   /note="COG3544: Uncharacterized protein conserved in
FT                   bacteria, Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06265"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48052"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSK7"
FT                   /protein_id="BAG48052.1"
FT                   /translation="MQTRISIPWFVINVIATLGLMIGTTSAQQATSMPDMNMGQSTKAN
FT                   SASVQAFKGADQRMMRRMQGQTYTGDADKDFVSHMIPHHQGAIDMAAAELKYGKDPEMR
FT                   RLARSIVKAQKEEITKMKRWQAKYGSQ"
FT   CDS_pept        complement(116939..118333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="BMULJ_06266"
FT                   /product="two-component system heavy metal sensor histidine
FT                   kinase"
FT                   /note="COG0642: Signal transduction histidine kinase,
FT                   Ralstonia solanacearum"
FT                   /note="CusS protein"
FT                   /note="KEGG, K07644"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06266"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48053"
FT                   /db_xref="GOA:A0A0H3L022"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L022"
FT                   /protein_id="BAG48053.1"
FT                   /translation="MTGKAAPYSLLTRLTVAFAVVAGLAFALTGAYLYRSLSIELQRRD
FT                   DIEIGGKLSQFLQLAHASGSVQAIRATPAVFHEVLLSHPGVYLGIYDGQNNSLIEHTAA
FT                   PGVTLKSIASSDRPPRIPYTCDPTGIGPSRCVFARDRLPSGEDVRIALVRTATDRQSLL
FT                   KSYRVDIWLAVAVGAILLGGLGYAIARRGLRPVESLGRQTSIIEAHNLSERLDIRGGPM
FT                   ELRELASSVNRMLDRLERAFVRLSQFSSDLAHDMRTPLANVISSSQVTLSRPRTSDEYE
FT                   ALIDSNIEECERLQRMIENMLFLARTENAHLHLKVSDLDTEMELQRLASYYQSIADEKG
FT                   VNFVVVGDAHVVADATLFRRAVSNLISNALDHAFAGTAIKLASSRSLQYVVVEVTNHGR
FT                   PIAPEHLDRIFERFYRVDASRHGSSKNAGLGLAIVKSIMELHRGQVQVSSNDVSTTFHL
FT                   QFPRER"
FT   CDS_pept        complement(118330..119001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06267"
FT                   /product="OmpR family two-component system response
FT                   regulator"
FT                   /note="COG0745: Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain, Ralstonia solanacearum"
FT                   /note="KEGG, K02483"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06267"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48054"
FT                   /db_xref="GOA:A0A0H3KS84"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS84"
FT                   /protein_id="BAG48054.1"
FT                   /translation="MRILIVEDEPKMASYLRKGLTEASYTVDVAENGKIGLFLALHENF
FT                   DLVVLDVMLPELDGFEVLKRLRAEKQTPVLMLTAREAIEDKVAGLELGADDYLHKPFAY
FT                   AEFLARIRSLLRRAPRSIRDILLVADMEIDLLKRRVRRGDNRIDLTAQEFALLQLLAER
FT                   EGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKVDNAYDKKLIHTIRGMGYVLEDR
FT                   S"
FT   CDS_pept        119292..119693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06268"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06268"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRT5"
FT                   /protein_id="BAG48055.1"
FT                   /translation="MSYWRKLFVVVLLALSLPVQSFAAISMNCVASHAEASETPIVHAG
FT                   QSMSGHHRDMHGAALAADDHHTYHHGGGHHAHSCSTCAACCFGTGLPAVPSVVVSSDVT
FT                   RVTTSIPPSAGVVSFLTDGIERPPRHTLV"
FT   CDS_pept        119781..120098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06269"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06269"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWK3"
FT                   /protein_id="BAG48056.1"
FT                   /translation="MRLISAALLGAAASLPTLVHATTTIPDPTDAAASVPAISAPSAFN
FT                   GYRPYNDADNPTWQQLNQAVQEKPAKGGMTHGGAMGHGGAMNKPAGDHQSNHSQHGEPA
FT                   K"
FT   CDS_pept        120095..121591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06270"
FT                   /product="RND efflux system outer membrane lipoprotein"
FT                   /note="COG1538: Outer membrane protein, Agrobacterium
FT                   tumefaciens strain C58"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48057"
FT                   /db_xref="GOA:A0A0H3KSL2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSL2"
FT                   /protein_id="BAG48057.1"
FT                   /translation="MMKRLVSTRMGAGVSIMVFLAGCTTFSKDGGFGTVSSTATERLGK
FT                   DAVIVKTDADRDAVAKRTQELLAKPLSMDDAVQVALLNNRGLQASYAELGLSEADLVQA
FT                   GRLPNPGFTFSRTRAGNGDLSIGRTFSANVLSILTLPFAAHIEGRRFEQTKLETADTML
FT                   KLAAEARRAYVNAVAAEQAAKYAEQVKDSADAGAELASRMRQAGNFSKLDYAREQAFYA
FT                   DSVAQAAKARQQAVSAREKLTRTMGVWGTGTQYTLPERLPDLPKDRPELKDLERFAMQN
FT                   RLDIQAAKLQTQGVASSLGLSKATRFINAIDVGYQNNYETDKGHEHGYEISIEIPIFDF
FT                   GSAKVARAEAIYMQSANRLAQTAIDARSEVREAYSAYVNSYDVAKHYRDEVVPIRKTIS
FT                   DELLLRYNGMLASVFELLADSREQVGAVNSYIDALKDYWLAETDLQQALGGRLPRAGAE
FT                   QTEQTPPGPNSAPQSAPRPAARPEPASTAQPAHETHSEGK"
FT   CDS_pept        121593..122888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06271"
FT                   /product="L-ascorbate oxidase"
FT                   /EC_number="1.10.3.3"
FT                   /note="COG2132: Putative multicopper oxidases,
FT                   Sinorhizobium meliloti"
FT                   /note="KEGG, K00423"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06271"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48058"
FT                   /db_xref="GOA:A0A0H3L028"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L028"
FT                   /protein_id="BAG48058.1"
FT                   /translation="MVSRRQFLSGSGAAILGAAMVSKAGAASLPEAPTMAKATMQPPLV
FT                   PPNGRPYTPVATLNGWTLPWRMKNGWKEFHLTAEPVVREMAPGMKANLWGYNGQSPGPT
FT                   IEAVEGDKVRIFVTNKLPEHTTIHWHGMLLPNGMDGVGGLTQPHIPPGKTFVYEFQLEK
FT                   HGTFMYHPHADEMVQMAMGMMGMFIVHPKDRSVMPVDRDFVFLLSAYDIDPGSFTPRVN
FT                   EMTDFNMWTFNSRVFPGIDPLPIRAGDRVRIRFGNLTMTNHPIHLHGYHFEVAGTDGGW
FT                   IPPAARWPEVTADVAVGQMRAIEFTADRPGDWAFHCHKSHHTMNAMGHSVPNMIGVPQK
FT                   DLAKRINKLVPDYMAMGSTGGAMGEMEMPLPDNTLPMMTGTGPFGPLEMGGMFTVAKVR
FT                   QGLGRNDYRDPGWFKHPKGTVAYEYTGELPDS"
FT   CDS_pept        122954..123301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06272"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06272"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48059"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS88"
FT                   /protein_id="BAG48059.1"
FT                   /translation="MKKALFSIAIGCALAFSASTYAAGDMGNMDMSGGTKQSTDAKSSM
FT                   SHGEIKKVDTTAGKLTIKHGPLENLGMEAMTMVFKAKDPAMLSQVKVGDKIDFVAEEVN
FT                   GALTVVKLQKQ"
FT   CDS_pept        123363..123737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcoC"
FT                   /locus_tag="BMULJ_06273"
FT                   /product="Cu resistance protein CopC"
FT                   /note="KEGG, K07156"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06273"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48060"
FT                   /db_xref="GOA:A0A0H3KRU2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRU2"
FT                   /protein_id="BAG48060.1"
FT                   /translation="MKILTLRHFAGLAVASAVAFAPIAALAHGKLESATPASGSTVDVA
FT                   PDALRLTFNEDLESTFSSVKIADATGAPVTKEKAKIDASNPRVMTLVVPKLASGAYTVQ
FT                   WAVMTSDAHKTKGTYTFKVK"
FT   CDS_pept        123737..124678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcoD"
FT                   /locus_tag="BMULJ_06274"
FT                   /product="Cu resistance protein CopD"
FT                   /note="KEGG, K07245"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06274"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48061"
FT                   /db_xref="GOA:A0A0H3KWK9"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWK9"
FT                   /protein_id="BAG48061.1"
FT                   /translation="MNDGFLGILRLIAVAIQNVGFAVIVGALLSSQWLARGDSTWQADV
FT                   GRRLVLTVRMASTLALLASVLSFWAHCALMSESTLLEAGPAVWSMLVGTGFGHAWLVAA
FT                   VFMVCVVVLALLRSGSDGSFPTGIWLALAAVALARSNGGHPVDSGLFSLPVWVDWLHLL
FT                   AISAWVGLVLVTTYVVMPRLLDAPGSERQTSASFVQSLSDTSTYALVILFSTGAYNGWR
FT                   GVSTPANLWTSTYGQILLLKFVLVLVAAALGGHNRFFEMPTLMSTLKNPAQEVPTVPLR
FT                   RFSTVLHVESLILLGVLMVAAVLVSSPLPGTT"
FT   CDS_pept        125046..125267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06275"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48062"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSL7"
FT                   /protein_id="BAG48062.1"
FT                   /translation="MVSNESVAAPATAQIENTVSRGKTREQVQQELIQAYHDGLLPTSK
FT                   HDYPPSEATIARNKELHQLSEPKWAAQH"
FT   CDS_pept        complement(125645..125974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06276"
FT                   /product="hypothetical protein"
FT                   /note="COG1145: Ferredoxin, Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06276"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48063"
FT                   /db_xref="InterPro:IPR005560"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L034"
FT                   /protein_id="BAG48063.1"
FT                   /translation="MAHQQYQTCISACDACATACDHCAAACLEETQVGQLIDCIKLDLD
FT                   CATLCRLASAAMARGSKQVKAVCSSCATLCDACATECEKHQHAHCKECAQVCRRCAQEC
FT                   RTMAQ"
FT   CDS_pept        126145..126513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06277"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS92"
FT                   /protein_id="BAG48064.1"
FT                   /translation="MKLLRTFILSLLCAVLPISGLAASGLTGECPMQQTMSMGADASMS
FT                   GDMPGCDLMKSSSVDKAKAKSVFCKVTAQCQFGSLYHPAAKTDISRPAAVGTPVIFHYV
FT                   QSLPVRDPNGLWRPPRLV"
FT   CDS_pept        126604..127896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06278"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06278"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48065"
FT                   /db_xref="GOA:A0A0H3KRU7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRU7"
FT                   /protein_id="BAG48065.1"
FT                   /translation="MLFIFGTPLRRRVPWRAHALVSALFLAGVVHAQQAPMTLDAALQS
FT                   ATDRSASMQAAQASVRASSEAAVKAGQLPDPMLKAGIDNLPINGPQRFTVGQDFMTMRR
FT                   IGIEQEWVSGDKRRLRSALADRMVGRERAGYLVQLANVRQQTATAWLNAVYAKQALALQ
FT                   QALLDHMHHELAATKASYRGAKAGASDVVQAQAMLAQTQDQVLKAQQTYQTALIGLSRW
FT                   TAAPVSEVTGEPPAPESFVSSLPPDELRLSQPTLVAAADDISVAEADTAVANSERSPNW
FT                   TWEVAYQQRGGAYSNMVSIGVTIPLPLNRKNRQNRDVAEKAELATKARLMYEDALRQVQ
FT                   ADIRTQSATLASGRERIANLSQSLLPAADQRVQLANAAYRAGSGSLADTFAARRAQLEA
FT                   ELQVLDLKREVSQTWAQLEYQVVPSTMAAAQ"
FT   CDS_pept        127908..129437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="BMULJ_06279"
FT                   /product="copper efflux system membrane protein"
FT                   /note="COG0845: Membrane-fusion protein, Ralstonia
FT                   solanacearum"
FT                   /note="CusB protein"
FT                   /note="KEGG, K07798"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06279"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48066"
FT                   /db_xref="GOA:A0A0H3KWL3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWL3"
FT                   /protein_id="BAG48066.1"
FT                   /translation="MTQKPLVRAVLTVFAGAALLAAGYFAGTRHAATPAAAASTVTASS
FT                   GEKIDPKTGRKVLYWHDPMVPNQHFDKPGKSPFMNMQLEPVYADDGGGSSGIKIDPGLQ
FT                   QNLGIRYATVRRQETTGGFDAVGTTQFDESRSDVVQSRVTGYIDRLYASAPMQRIAKGA
FT                   PIASLFVPDWLAPQEEYLALKRGGMDASLLEASRARMRAMSIPDGIIASLDRTGRAQTH
FT                   VVLTSPEAGVVSELNVRDGAMVAPGQTLAKIAGLSKLWLIVEIPEALALSVQPGMTVDA
FT                   TFAGDPAQHFAGRIREILPGISTTSRTLQARLEIDNASLKLTPGMLMRVRVAGQKAVSR
FT                   LLVPSEAVITTGKRSVVIVKNGDGRLQPATVTVGNDIGSETEVLSGLNDGDTVVASGQF
FT                   LIDSEASLKSVLPRLEGGSGASATAPASAPVATAQTYETTGKVEKVTAADITFSHQPVP
FT                   ALGWGAMTMAFNKPAPSAFPDIKAGQMVHFVFKQSDEGYQLTKVEPVGGAQ"
FT   CDS_pept        129434..132640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="BMULJ_06280"
FT                   /product="copper efflux system membrane protein"
FT                   /note="COG3696: Putative silver efflux pump, Ralstonia
FT                   solanacearum"
FT                   /note="CusA protein"
FT                   /note="KEGG, K07787"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48067"
FT                   /db_xref="GOA:A0A0H3KSM3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSM3"
FT                   /protein_id="BAG48067.1"
FT                   /translation="MIARLIRWSIHNRFLVLLATVLVTGWGLYSVAETPLDALPDLSDT
FT                   QVIIKASYPGKAPQVIEDQVTYPLTTTLLGVPGAKTIRAYSSFGDAFVYVLFDDKTDQY
FT                   WARSRVLEYLNQVQSRLPQGATVSLGPDATGVGWVYEYALVDRSGRHDLGQLRALNDWF
FT                   LKFELKAVPDVSEVASIGGMVRQYQVVLDPDKLRAYGITQAAVADALGKANQESGGSVV
FT                   EMAESEYMVRSSGYLRSLDDFRHVVLRTNDAGTPVLLGDVARIQIGPEMRRGIAELNGQ
FT                   GEVAGGVIVMRSGKNALKTIDAVKAKLADLKRSLPPGVEVVTTYDRSQLIERAVDNLKD
FT                   KLIEEFIIVGLVCAVFLFHLRSAFVAILSLPLGVLAAFIVMRYQGVNANLMSLGGIAIA
FT                   IGAMIDAAIVMIENAHKHLEAFDHEHPDTRMTAAQRWELIATSAAEVGPALFFSLLIIT
FT                   LSFIPVFSLEGQEGKLFSPLAFTKTYTIAAAAGLSVTLVPVLMGYLIRGRIPHENANPI
FT                   NRVLIRLYRPLLEATLRRPWTAIGLAAVALVLTIVPISRLGGEFMPPLDEGDLLYMPTA
FT                   LPGISAQKASELLQQTDRLIKTVPEVETVFGKSGRADTATDPAPLEMFETTIQFKPRSQ
FT                   WRPGMTPEKLVDELDRTVKVPGLSNVWVPPIRNRLDMLSTGIKTPVGVKISGPDLTQID
FT                   RIATQVETAVKGVPGVTSALAERLNGGRYIDVDIDRLAAARYGLSVADIQSVVSSAVGG
FT                   ENVGEVIAGRERFPINIRYPREIRDSLEKLRQLPVVTDRGAQIQLGDVAHITIADGPPM
FT                   IRSENARLSGYVYVDIRNTDLQSAVKAMQKVVAEQVQLPPGYSIAWSGQFEYLERAAAK
FT                   LRTVVPVTLVVIFVLLFLTFNSAADALLLMSTVPFALVGGFWLIWMLGHAVSVATSVGF
FT                   IALAGVAAEFGVVMLLYLKGALNRRLEDGEPLTEALLFDAIREGAVLRVRPKAMTVAVV
FT                   LAGLIPIMVGHGAGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAWFLLQRRRARQAPAAS
FT                   FPQAVPSGTNVPVNQTGEVQ"
FT   CDS_pept        132637..132987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06281"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06281"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48068"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L039"
FT                   /protein_id="BAG48068.1"
FT                   /translation="MKKLIVVSAALAAAFVTPAFAGNDMAGMDMSTKASAMKASSNNAL
FT                   TDAEVKKVDTATGMVTLKHGALENVGMPPMTMAFKAKDAAMVKQIKEGDKVKVRVEEVN
FT                   GTLTIVKLEKRS"
FT   CDS_pept        133063..134934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="BMULJ_06282"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="COG4232: Thiol:disulfide interchange protein,
FT                   Ralstonia solanacearum"
FT                   /note="DsbD protein"
FT                   /note="KEGG, K04084"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06282"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48069"
FT                   /db_xref="GOA:A0A0H3KS95"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KS95"
FT                   /protein_id="BAG48069.1"
FT                   /translation="MRTTSSNTYRYVYRTADALSRMLRFVLVLVFGLVSFAAYAVNESE
FT                   LLAPEQAFPLTVSLASHKEVVLDFKTKPGYYLYRDRFSFAVSGAPVKPVAMPPSETKND
FT                   PTFGVVQVYHQPVRILLPLSAAVTSSATLTVTSQGCADVGVCYPPQTRRFRIAADGGVT
FT                   PAALVGSAKGADFPVAEKDRQATVLGLPLRPANGIGIAEMLGFLLAGLLMAGTVCMYPL
FT                   IPIVTAVIDGTRERLPVWRGFSLSLAYVQGLAITYAAAGTVAAVIGIPLVALTQKPWLL
FT                   ATFGMLMLAFALGMFGVFRLQLPTGWQTRFAGWSKRLPGGRVGPVFVMGMLSALIVGPC
FT                   STPALAGALLYIANSRDISGGALALYLMGIGIGIPLLLVGTFGTRLLPKSGHWMVAVQN
FT                   TLGVMLLAAALWFVYSLLPAWLLMSLIALLLTACGTMLRAIDPLPADATGIARVGKALG
FT                   VLLLVAGIAEFVGVASGNFDILTPLGGLTRTSTSAGGGTSAATQFDTITSNAKLDEALK
FT                   AARGQPVMVDFYADWCITCKELERFTFTDARVMNEFTHWKLLRIDVTKNTEADTAMLRR
FT                   FGLFGPPALIFFDKTGRPQPDAQLIGFIGADTFLAHLKRLQSGDVAQ"
FT   CDS_pept        134986..135348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06283"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRV0"
FT                   /protein_id="BAG48070.1"
FT                   /translation="MKFWVKLVACFLIAWLPMLGYPAQAALCPEMSSMPAVQHHMKAAS
FT                   AIEATGCTSGTKPLGTSDRPSACHAGMGSAVCGMLAIPMSHRVGIVVSTADYRAITPFL
FT                   AEQFIPELPAPPPRSL"
FT   CDS_pept        135456..135755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06284"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWL7"
FT                   /protein_id="BAG48071.1"
FT                   /translation="MEIYMNASHARMAVLSTLLVAASAVSFAATGSASGTSAQDREHGH
FT                   GSMMMGGMMGGCPMMGGSAGLDSKTAMRMHAEMMRAMSDIMMKYSDQAGAAPSK"
FT   CDS_pept        135808..136035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06285"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06285"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48072"
FT                   /db_xref="GOA:A0A0H3KSM9"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSM9"
FT                   /protein_id="BAG48072.1"
FT                   /translation="MKCNWKTMVAVGSALVAVIALGYWAFPPLRGPLATLAVIASGFIC
FT                   PLSMIFMMRGMQSHADGSGVDTRLTDKAEH"
FT   CDS_pept        136297..136854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06286"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48073"
FT                   /db_xref="GOA:A0A0H3L044"
FT                   /db_xref="InterPro:IPR025673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L044"
FT                   /protein_id="BAG48073.1"
FT                   /translation="MKRYKRHQSGSAANERSGRVVKVKLNLLSLLALILAVSTALVWGP
FT                   SLVHWAFGPKSAAVTLENTVQQVPGWRVGMLRPDGLRIISSGVSDASHVLNPVQFPDIA
FT                   VRHAYWVATQIPATLNKLYCWCGCENRGEHRSNLQCFEDKMAVSCPVCQGTAEIAYQMT
FT                   QAGVRDAAKIQAAVDAKWAPKG"
FT   CDS_pept        136891..137199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06287"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06287"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48074"
FT                   /db_xref="GOA:A0A0H3KSA0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSA0"
FT                   /protein_id="BAG48074.1"
FT                   /translation="MELKCVVAVLRPEVLTALEQRLGALHIHGMTVTKAKGFGAHPNFF
FT                   GNDWTTEHIRIEVFTVAESVDALVEEITTVANEQSGGDGVVAVVPVERFLRVRSATP"
FT   CDS_pept        complement(137266..137703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06288"
FT                   /product="TetR family transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06288"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48075"
FT                   /db_xref="GOA:A0A0H3KRV3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRV3"
FT                   /protein_id="BAG48075.1"
FT                   /translation="MSSRAGTSPDDTRPGSAPRRRSRGKTREALQLAILRVKTRGLKLS
FT                   ISSVAAEAGVSAGLIHNTYPDIAEEIRTQVGRGIRQQRDATVAEVKKVREQLKTVRAER
FT                   DAALADVATLASINETLRQEIATLQAVASGKIHVLPPVRDV"
FT   CDS_pept        complement(137700..139592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06289"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48076"
FT                   /db_xref="GOA:A0A0H3KWM0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWM0"
FT                   /protein_id="BAG48076.1"
FT                   /translation="MPATSLPAPRALRAFELLAAQPISLVGIPPAERDAIVVTAVADAA
FT                   GHEHPVSRFGDRVWDLAPEIEAKNRKGSALKIVWPDDVPKALIDDAKAALYCAQRRGPH
FT                   GRKWSGSSIADIGRSGVLALRYLAQLGLADFSQVRALHLSDHIADLRRTLKPVSVRGRL
FT                   QIVDLVWTFHTEVLHPLLEHPWAGLALWDACGGNEDNRMPSGRTGTTPVIPRSVQRILF
FT                   AYCEASLAQADELFQARDAGGLGAPKRPAMTSIRNAVLYLLQISSGMRNSESTGVTSGC
FT                   WRTEQRNGVTYHWVRTREVKTTGGTEVDFLVPPEAIRALEILQRYAQPLQARLVGEARW
FT                   LEDLMAQGPDLTGHLCNGMKMAEAAHRLNHVREIGRHLVLGLNVKASDHLGTGSRVEVL
FT                   SSASCGYQLKQLAAAAGTEWNLANHQCRRTFAYNVANSRLGRMGLVFLKWQLKHASMSW
FT                   TQLYAASPHQDHALYREFEEEMADARLGLLESWAHSDALLSGGAGKKIMQTRTRAARDL
FT                   KQLLRQTAESIELRSTGHAWCISGTRGCHGQGVYDPSMCAGCSQAIIDQGQASAWQMIH
FT                   LDNLRLAAITDCGPAVADKARRVVERSTQVLRDLGCALPTDDRARAYTAALEGA"
FT   CDS_pept        complement(139649..141550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSN4"
FT                   /protein_id="BAG48077.1"
FT                   /translation="MVRKKNYNVSENRAAPVGVISASLERPKPGADDACIDMVALLGLE
FT                   ARFPQRIKTLDLRDWLGRGIDDWVCSSGFCLKAMLLSGARATASVTTYFGQLPYLFEYL
FT                   AGSSQTPLPQRPKLPSDLSPMHVQHFIGWLQKRAQAEGWRPSSTRNTYRGVKAVLAEMF
FT                   AQGFIEGEPSRFFRRGALPWSSEDSLQTSLSDAEQERLAKAIKSDLVDVHHGRLQLKQS
FT                   AVQGLRLLLVAHRQGLNPTPLLEMCRDALAPGFLPGTILIRTAKHRSKKIRSNVGRSAL
FT                   GRHASNQPNEQADEQNLCFDLSEGAVLQQAIASTRELVGEAPSAFKTRIWLYRAEASAG
FT                   STKRGNITCLDSKSLNRAIEGVIERRSLLGDGGLPLRVNLSRLRKSRFDRALRTADGDI
FT                   AITANLMGNTPRVAGVNYPSMNEARKADAASFMNGDYTVLMRAEAQAPRGNEIRPVQVE
FT                   PFKVGKGSISAPPSPTPVSACSDSISGEHAPNDGRSHCDRYVMCLFCSSFAIVGTVDEL
FT                   WRLFSFQMFAQAELDYLDEALGPERTTDGLLEDLRDRYRVVIPYIDDFTQRQFARSRVA
FT                   QARAKTVSGLHPYWQHQMTMSRRARHRASAPDLRVDGSHGDTAIPRIRGTQQAGPRA"
FT   CDS_pept        complement(141559..142743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06291"
FT                   /product="tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06291"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48078"
FT                   /db_xref="GOA:A0A0H3L049"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L049"
FT                   /protein_id="BAG48078.1"
FT                   /translation="MRYVRATDEFVFAGRPRPGFPLILDDSMEPAQPFHDYLLYRLLES
FT                   GKALDQKTWEAYGRRLWDFARFLQANEWCWDDPFMSVGQSVVSVYRDWQAQDLKLDPAT
FT                   INARLELVTAMYRWAHERGRIDRLPFTCSDVAVYGIEHDLTHITGGRKRSSRPAVLLNE
FT                   WNKEPAFLTADQLKIVRQSIRSAAQRLLFDLMARVGLRSVEARTFPLSYVVDPRTQKAW
FT                   KPGTFIDVRLDPRDMEIKFNKSRVVHVPYSLMEDMYAYTTFERNGLADAADRKELILTI
FT                   HGQRYSKESAVKVYTDLSNTVGFRVRPLMLRHSYAIHTLLLLRSRPEIPMEPLMYVRDR
FT                   LGHASVQTTMVYLQQIERLLGAEALAMMDEFDRLYGVGKALATAPHASTVDPRH"
FT   CDS_pept        143201..143917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06292"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48079"
FT                   /db_xref="InterPro:IPR017166"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSA6"
FT                   /protein_id="BAG48079.1"
FT                   /translation="MQAALAHPETIHPALWRASQLARSSSRGVDTGHAELTAELPGGGW
FT                   PAGALVDLLTQQAGIGELRLLAPVLARSSGRPIMLIQPLHGLQPLALSYWGVDSSSFVL
FT                   LPAPRTADALWAAEQVLRAGTCAAVLLWQSNVRADALRRLNLAAQTGSALFFLFRPAAA
FT                   ARDASPAPLRLALAPKRDGIEITFVKRRGPARDTPLFVPLSPSPILLNRHASLDRRASA
FT                   APQPRNVPATLAGAIA"
FT   CDS_pept        143838..145316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06293"
FT                   /product="nucleotidyltransferase/DNA polymerase"
FT                   /note="COG0389: Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair, Ralstonia solanacearum"
FT                   /note="involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06293"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48080"
FT                   /db_xref="GOA:A0A0H3KRV6"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRV6"
FT                   /protein_id="BAG48080.1"
FT                   /translation="MQVWIGVHLPHLNLETFRPRSPAPSPDDARGLVVLESGRVVALDR
FT                   AARALGIVVGMRRAGVLSLAPDAQIRERDVVRERELVLGVAYALLQFTPNVVDADEAVV
FT                   LLDVTASLRLFHGIRALRRRVRDVVASFGVSAAISVASTGPAAWMVARGLRGGLALSAR
FT                   SLRRALARVPLVVAPDARRYATWFDELGCETLADLQRLPRAGLKKRCGTQLLDWLDQVA
FT                   GTAPAAYDWLDMPPSFDTRVELMDRVEHAEALLFVARRLILQLTGWLTAKQLDVAAFAL
FT                   LLEHERGRDAIAPTEIEISLGAPTRFEEHLTRLVKERLGHVELAGPVIAVRLVARRVQE
FT                   AAAPSDSLFPEPGGTPQDHARLLELLTARLGAENVLVPAPIADYRPEPAARWVPMRDAP
FT                   KAAPLPADLPRPAWLLAKPVPLLTRQHRPFYGTPLRMVSPGERIEGGWQDGQTVTRDYF
FT                   VAEDDNGICYWIFKERPTASDESDSRYFLHGLFG"
FT   CDS_pept        145323..148472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06294"
FT                   /product="DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0587: DNA polymerase III, alpha subunit,
FT                   Ralstonia solanacearum"
FT                   /note="KEGG, K00961"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06294"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48081"
FT                   /db_xref="GOA:A0A0H3KWM4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWM4"
FT                   /protein_id="BAG48081.1"
FT                   /translation="MSAASYGALPAYAELQVASDFSFLHGASRAEEYVARAAQLGYSAI
FT                   AITDECSLAGVVRAHVEAKAAGLPLIIGSHFRLTAADGAPAIAFSALAMNRDGYGNLCE
FT                   LVSLGRMRGKKGSYRLAPRDLEQPDAPFTHLRGLPDCIAILSPDFPANEQRLDAQVEWF
FT                   ARVFGDRAWVALTLHARAMDDIHRGVVERVAARHGVPVVATSWPLMHVRSRKPLQDVLT
FT                   SIRLGRPVSECGYELAPNAERHLRSRLRLANLYPAGALEETVRVARRCTFSLDDLKYEY
FT                   PDEVVPAGYDVATYLREQTYIGAQRRFPAGIPVDVQAQIEHELQLIAELNYEAYFLTVY
FT                   DIVQFARQNGILCQGRGSAANSAVCYCLGMTEVDPSRQSMLFERFMSKERNEPPDIDVD
FT                   FEHQRREEVMQYIYRKYGRDRAALTAAVSTYRPRSALREAGKALGVDPAIVDRVAKSHH
FT                   WFDSRADLLQRFAEAGLDPEAPLNQQWAAFAAQLLGYPRHLSQHSGGFVISRGKLTRLV
FT                   PVENAAMEDRTIIQWDKDDIEALGILKIDVLALGMLSMVRRALDMISEKRGETFELQDI
FT                   PAEDKATYDMLCDGDSMGVFQVESRAQMSMLPRLRPQCFYDLVIEVAIVRPGPVQGGMV
FT                   HPYLRRRQGLEPVTFPSDGMEKALKRTLGVPIFQEQVMQVAMLAAGFSAGEADQLRRAM
FT                   AAWKRKGGLEPYHDRLVSGMLERGYDREFAEAIFAQIKGFGEYGFPESHAASFALLVYS
FT                   SAWLRRHEPAVFLASLLNSQPMGFYTPSQLLQDARRRGVEVLPVDVNVSTWDSVIEGPT
FT                   TSAPVRLGFSLLRGMRADVAGRIELARAVRPFVDVADLARRAQLDRHDLQVLARANALR
FT                   SLAGGNRRAALWLAAAAIPDRDLLRGTERDDAVPALPQASEGKEIVTDYRAMGFTLGRH
FT                   PLALLRDRLTLDRLQSAEQLATLRSGQLARACGLVTVRQRPGTANGVLFMTLEDETGQV
FT                   NVILWPGLLEKFRKEALGAALLAVYGVWQAEGKVRHLIASKLVDRSELLGSLPTTAREF
FT                   C"
FT   CDS_pept        complement(148510..148836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06295"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSP0"
FT                   /protein_id="BAG48082.1"
FT                   /translation="MARTLRLVSFSLPGTFPKELVPTPLARFVACCEPGLTKERLMECA
FT                   RARGWSPTWKQLPDWTREGQEAFGFAVTVDGMGVPLVAWMRRTVAVKRSPKGPECDPRQ
FT                   MSLF"
FT   CDS_pept        complement(148901..150025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="BMULJ_06296"
FT                   /product="replication initiation protein"
FT                   /note="COG5534: Plasmid replication initiator protein,
FT                   Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06296"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48083"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L053"
FT                   /protein_id="BAG48083.1"
FT                   /translation="MSTVNSENSYSLRGAGAAQLPMGARPPLARSQGAEQSENSADGDD
FT                   VVRLDEGEFDPEQLELFFGEQLDLSWKPREDLHSLEFPLFSLQKGKDTRVRVYRNGEQI
FT                   VRIIPSGVGAANIFDKDLLVYAATLICKAADSDIPVSRRIRFKVRDFLKYTRRSTGGAS
FT                   YERIVDSCRRLKGTIIETNFDTTRPGANEAGIHETLRGYGLIQEYSVITYTANRKGALE
FT                   VELVLSSWTYDLLLSRRILTLHPGYFDLGQGLERRLYDLAKKHCGDKLWFKIGLEKLYG
FT                   KSGSAQALKYFRRDLIAAMKADKLPEFHIALDDDKAMVVFFRCDRDNRRQDEQLTASIH
FT                   RELLAKKLSKWYYALRRWDSDARDVGQLELIAGT"
FT   CDS_pept        complement(150048..150458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06297"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48084"
FT                   /db_xref="GOA:A0A0H3KSB2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR032428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSB2"
FT                   /protein_id="BAG48084.1"
FT                   /translation="MATFRLSAKHFSALDSAMRKHAREFGTRPFDEATRDIARAVIVDG
FT                   RPAADVASEFGVSRQRVSQLVKRYYESLTNSELRSAEVIVWLKQEFEVPSPLVEPLARF
FT                   LAKAQRSKDTNKVQSAVSALIKHLGTQTSKLE"
FT   CDS_pept        complement(150521..151879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06298"
FT                   /product="putative plasmid segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06298"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48085"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRW0"
FT                   /protein_id="BAG48085.1"
FT                   /translation="MQQATSGKFASISALTRAASAASRVAEIEQATGAVTRFIAVNKVR
FT                   IKPQVRDDFADVQAFAERLRAIGHVHTPILVRAISDSDEYELIAGERRIRGSLLNDWPE
FT                   IQAKIFPAGTSDLAIRMYQVSENIDRKQLSVRETAIGLATDVELYGREQAASIWAAPSG
FT                   KERSASWVSKHLRFLRYGPTTRALFDEDMFDDVEAANKMADIEACSAATAHEIATDMRA
FT                   GKKFGRLTLDARLNLLKQVAAPSVKDAVGEAAAMARSSAPAEAPGSTASQSIDDGQQPS
FT                   PGPVFEGQAAHGAEHDADVPNMADARLAPSPAASPEGLRQVPKAKRLHAAAADPSETSV
FT                   WRVEEIYEIGTGSVERVRRLHADLSAAGVRAEDIEWRLWVCFVDLAASALAGMPTETAG
FT                   KIINRFNDEINSSGPLELLNRLHPCRRPGVLPDDFGYDTDREIHPLAPNDWSL"
FT   CDS_pept        complement(151894..152727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="BMULJ_06299"
FT                   /product="partitioning protein"
FT                   /note="COG1192: ATPases involved in chromosome
FT                   partitioning, Xylella fastidiosa 9a5c"
FT                   /note="ParA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06299"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48086"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWM8"
FT                   /protein_id="BAG48086.1"
FT                   /translation="MKKISIVNGKGGTGKTTIVRHLVYTAIERGIRVLVVDLDPQGNLT
FT                   RSMLYRKLTAKSGPSVMGAALTWEHLGLPDVTENSSAHLLYQGKRDVNPMRIVDGAAMI
FT                   GATPELEDVMTWPLESAAKARESLDALADQFDLCVIDTAPTMSNLVLGGMICADYVVIP
FT                   TDLGIDSMSGLLSTSEKLELVKREWNPDLELVGVLLNKVNLRRADDQSMRTTVRNAFDD
FT                   AVLEHELRDRAGVRLTSFHPVWARRRGESDRLAAKEMHAVCDSILERIGLSVSNA"
FT   CDS_pept        complement(152738..153121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSP5"
FT                   /protein_id="BAG48087.1"
FT                   /translation="MSSTVQSRIYRLLVDLIPELGVSASRTRFAPPRVPGDMAVHCTID
FT                   DGVDGHLEIEIAQDIAGDHRRSQSRICFDVDLMRGTACVTQLEQGGYFSVASGRVNVYA
FT                   ANWLAVFHTLGRSFQPIEALACA"
FT   CDS_pept        153685..154251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06301"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06301"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48088"
FT                   /db_xref="GOA:A0A0H3L059"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L059"
FT                   /protein_id="BAG48088.1"
FT                   /translation="MPRSIPITSERYRRLRVQLATMRIRAGLTQTELAKRLHIDQSNLS
FT                   KIERGERYVDFLTYVDWCRACGVSPATSMRKFLEQDDSPRRPADTSIPKSARSQPTKHG
FT                   PRRDQQHSPHRVPPVKVVSSISQQEFLRFAKATLGMTWDQLAAAAEINARALKTYRMPD
FT                   TSKDFRPLPMLARAAIEKLLDGHSA"
FT   CDS_pept        complement(155195..156367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06302"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06302"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSB6"
FT                   /protein_id="BAG48089.1"
FT                   /translation="MCPDETQNADSLTELRRRRRRTAVLEHQAESTVRTYAPLTRPARP
FT                   ERGGHRAVYPVRDCSNSALIEIAVGNFRDALNAEPNNTASTRQIKTRPMFPNELWLRKA
FT                   IEIVQKNPSPDRIPVTGDERLKQRNYFYAGLDGIEGEGDVLIVGLSRSGVLGRPWHDGR
FT                   YQPDAVDIPMARAVQAKPTFVYYLRRFEFIERDPFRFWLKVRTRHYSRVARRKERREGR
FT                   FNRRQLERKERMDVLQAIVRLSMDQDGRTIDAVMIATLLYQRGWIRHPAADEVLQRIRA
FT                   LVRVLVAEGLVEVVQQNTAYRMLPNAVRVLDQYLTEERRHADSQALQRKVMILGGVAAV
FT                   ASAVQAVVNVKQEWFDKPTGETPAFHATNENATATARPASVAIAPTRGAQ"
FT   CDS_pept        complement(156739..159051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06303"
FT                   /product="tyrosine recombinase"
FT                   /note="COG0582: Integrase, Ralstonia solanacearum"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06303"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48090"
FT                   /db_xref="GOA:A0A0H3KRW4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022169"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRW4"
FT                   /protein_id="BAG48090.1"
FT                   /translation="MRASPARATLRLTPGHFALYRAYLEGLDEATLHAHYGVPGTDVRV
FT                   TRRTIATLRDTLTIAARRARDVDAAHLLRLKPGSLPRDAHAGAAAGREVPTLEEFRAEV
FT                   DPDAFYSERELVALYIETYPPASSPALDSKTARNRRLRDRQDAALARMEASLVEAPRPD
FT                   HTLDGWFDSRVVARLAAAGITTFAELLALMRTRRQRWYRAIPRLGAIGAQRITDFIAQH
FT                   PDTLGYLSPLAVTPRRHFAPGHPALQPLPGAAADVAPLEALRVPAALDGSAGLNRAPVP
FT                   AHQAELNTDLQAVHAWIATRGARSEATRRAYRREAERLLLWAIVAKGKPLSSLNTMDCA
FT                   EYLDVFLRDPQPAARWIGRSRVERFDPAWRPFVGPLSERSRDTARRILNAMGEWLVAQQ
FT                   YLRVNPFAGLPAAPSVPIDATGRSLTRAQWQYVLQTVLRPTSAFDGGDSQLANRSANQA
FT                   ANARDAFLLLFAYVTGLRRAEIAAATTGALTRTALDGALDDAWSLKVMGKGRRARTVPM
FT                   PRRLIDALRAQLRARPIPLTLETAPADTPLIANLVTGEALHPDVVGRLYKGIFARAADQ
FT                   LAATYPNAAADLRRASTHWLRHTFANHGLDAGADIRDMQELLGHASLGTTTLYTKADAV
FT                   RQFQSVEALFNAALDRADPPAAMGVPVASPPARADTGAAAQLVAVHVKLRVEPKRPGGR
FT                   GRARVLERVEREVLAGFGRTPIRDGVTVLQVPFDNQDAFDRRVDDLLVQIAMTAEQHRC
FT                   ASESEAWAEVAGERWTW"
FT   CDS_pept        complement(159781..160089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06304"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06304"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWN3"
FT                   /protein_id="BAG48091.1"
FT                   /translation="MALTTTYVRARFLAFAQQRWIADQHAAQDTNKFSALFAGHPAHLQ
FT                   FETDGAWRLSYLGFRSERIFHPADAQCAAPAFMRDVLARMAALIEGAPRRSATGGHA"
FT   CDS_pept        complement(160397..161317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06305"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48092"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSQ0"
FT                   /protein_id="BAG48092.1"
FT                   /translation="MSESRQRGTYAQRVEQAKARKQAELDRHRAAALVGVAAPEFFEPR
FT                   FADGRPADPATVVVSMFRRTEDGQAMEIVGTGFFVAPGVLITAAHVAQVAFESDPHGYP
FT                   RLWCVHVLDGGQYQRRPVVHAVTHAVTDIALCVLAPSVHRVTGAPLPNPILRLSARDPV
FT                   IGEHVFTFALPDAVFEAQQGGRNARLDLHSHYYDGHIVEHYPVMRDRVLLPFPSFETSM
FT                   HLHGGASGGPVFDDSGAVVGINVSSQEPDTDCSYIAKVRDAFDLSLPCEVDGGQVVQLT
FT                   LRELAARGFSCLQADSPAAPAGGVA"
FT   CDS_pept        complement(161465..162001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06306"
FT                   /product="unique hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06306"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3L064"
FT                   /protein_id="BAG48093.1"
FT                   /translation="MLLHRSDGSVELSPSGEPRLPDVTLVERPGANERAPTFLATVRAT
FT                   GLYELAARKDGFATAEDALAWATAFEFAKRRSGSVTWYALAADASHWHAVIGTTVAEIV
FT                   GYELGGRATYAVKRRMKLGKQAVEFAITDLSYGDEPKSIVSFEQASAIALTMPDYVMEL
FT                   MRVAADVAPPSGLGE"
FT   CDS_pept        complement(162769..163176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06307"
FT                   /product="PilT protein-like protein"
FT                   /note="COG1487: Predicted nucleic acid-binding protein,
FT                   contains PIN domain, Sinorhizobium meliloti"
FT                   /note="KEGG, K07062"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06307"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48094"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSC2"
FT                   /protein_id="BAG48094.1"
FT                   /translation="MSLYLLDTNILSNVIRDPRGACASRIGETRPEQVCTSIVVAAELR
FT                   YGVCKRGSSALAQRVEQLLASLTVLPLQSDADQCYGRLRADLERQGQLIGANDMLIAAH
FT                   AMAVDAVLVTDNTAEFTRVTGLAVENWLRPA"
FT   CDS_pept        complement(163173..163415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06308"
FT                   /product="SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06308"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48095"
FT                   /db_xref="GOA:A0A0H3KRW6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KRW6"
FT                   /protein_id="BAG48095.1"
FT                   /translation="MPTHDTRHARLFRNGRSQAVRIPREFELPVSEVTIHREGRRLIIE
FT                   PVEAPSLRELFAQWAPLDETFPDIENLPAEPVDIE"
FT   CDS_pept        complement(163517..164548)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BMULJ_06309"
FT                   /note="inactivated ATP dependent DNA ligase"
FT   CDS_pept        165042..165713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA5"
FT                   /locus_tag="BMULJ_06310"
FT                   /product="chromosome partitioning protein"
FT                   /note="ParA5 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48096"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KWN9"
FT                   /protein_id="BAG48096.1"
FT                   /translation="MVITIGAEKGGVAKTRLATHIAALAASEGVDVVLLDTDKQGSAMS
FT                   WSRIRNEEGVTPSIPVLALPANPARELANLANKYTLVVVDIGAQNYRTMLECALLSDLV
FT                   LVPCGPDQQEVESTLNVFATLKDMGPRHESGEIPAYVVLTRVSPIEGSKATAELRSYFK
FT                   SEDIRLFDSQIPQREAWRATGKTGRAVHELKGRDRSKKAIEEMEAVYREIIKRINGGEE
FT                   E"
FT   CDS_pept        165713..166678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB5"
FT                   /locus_tag="BMULJ_06311"
FT                   /product="ParB family partition protein"
FT                   /note="ParB5 protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMULJ_06311"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48097"
FT                   /db_xref="GOA:A0A0H3KSQ5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3KSQ5"
FT                   /protein_id="BAG48097.1"
FT                   /translation="MATFRKKAVDIERVAAVEDAASSAPIVGDPRLAPTMPSVSQRESG
FT                   AVGSSQDPRKYEVGHVYEIPIGKIRSNSVNPRAIYTASAVSEMAESLLARGQGQAAIGY
FT                   VNDDAEIVLIDGERRLRGARTAGLSTLRIEIRPKPGSERELYEEARAANVERKDQSPLD
FT                   DAIKWKELIARKIYPTQAALAKALNLGEDHVSRTLSLAQLPNKLVQAAAEHPELLSLKM
FT                   LNAIREFWEVKGDDETLELISEAAKNGLGYRDVAARRKAAAKGPVRRPRSTREQLSFRG
FT                   AKGEFKSFEEDGRIELKLKGLAPDVAAEISEKILALFPKE"
XX
SQ   Sequence 167422 BP; 32227 A; 52046 C; 50641 G; 32508 T; 0 other;
     atggcaaatt ccatcgtcga ccacgtgaaa gcgattgcgg cccgcgctag cagcgcgggc        60
     gctgaaacgc aatctcatcc gacacagatt ccgctgtggc cgccgaacgt tcgtggtatg       120
     ccaaacgcgc tagcgcgctc ggctctgttc aacgtcaaca agtcgaatgc gccgcgtagc       180
     aggatggaga aagcgctgat tgcaagtgtt gatggggtgg aaataacgtt cagtggggaa       240
     gagcttagac aggacgatgc ggacgtcttt ctagaagtgc ttcacttggc tagagacacg       300
     cagctgaacg agaaggtgga attcacgggc tacagcgtac tgaagtctct cgggtggggc       360
     acgtctgtga aatgttacga ccgactcgtg acgacgctgg aacgactgca ggcagggcag       420
     gtgaaagtgc gtttctccgg caacaaaaag gggttcgtcg gctcgttaat ccggaagttc       480
     ctgtggaaag agggcactga aacgggaact gacgggaaga cgaggtgggt ggcgtacgta       540
     gaacccgaga tcgtggcgct tttctccgat gacgattaca cgcgactcgc gcgcgagcaa       600
     cgccaacggt tgcgatatga attgtcgaaa tggctgcaca cctactacca cacgcatgca       660
     gtgccttacg cgcattccgt tcgtttcctt catcgtcagt gtggttcgca gaccaaagag       720
     ttgtttcact ttcgcgcgaa cttgaaaaag gcgcttgatg aacttgtaaa ggaaggcttc       780
     ctggtgagct ggacgatcga caagaacgat ttggtccatg ttgttcgcgc gtcggctcgc       840
     ggggcaattg ccgcgtaaag aacagcgctg ttagctcgtt ccacaagcgc ctttgaaggt       900
     tcgaatgccc ctcggtgggc cggccgtttt gttggagact tcagggtgtg ggaggcgcgg       960
     cggggcaaac gagggcggat atcggtttcg ttgaccgtta gttgcacaat tcgtgtggag      1020
     tccccaagca gaccgacata aacgggcttg taaacgcctt cgcctctcga tatactcgat      1080
     aagcgcctga gacagcaggc gtcgggtttg gcgacccgtc taatcaaagc gcacaagacc      1140
     gcgcccgcgg tcttttttgt gccgaaggcc tttgcgcgcc ggtttctatg ggcgggccaa      1200
     ggcggggaga ccttcgagtc tgccggtttc tttgatttcc ggttcgccaa ccctgccttg      1260
     tgcccgctca ccccatttgg cgatggggcg cggggaaaat cgcaaatcaa agaggccaat      1320
     ccgtgaagaa catctcgcct gaatccgggc aggcattgcc ccgtcgtctc ccgtaccctt      1380
     catcaagact cttcggattg ctgctcgcgg tgctatcgac cggcacatcc ctctggatat      1440
     ccgtcgtcgc cggagaggaa cgcgggggat cttcgattga gcgaggagtg tgggcagcaa      1500
     tcgggctagt tctgctcgtc gcagcgcacc ttatccctgc ggtgacgcgc ggtacggccg      1560
     ctcgtattcg gttgccggcg ttgctcctct gggcggtgtg catggttatc acagggtacg      1620
     gccacgcaac ctttttcttg gctgctcagc gccatgctgg cgacgtaaga gcgaccacgg      1680
     ttcatcgcag cagccaacta gcagaaattc ggcagcctga cggccgcagc ctagccgcaa      1740
     tcgctcgtga tcaagcacac gtgaggcagc agctcgcggt ggcacgctat atgaggtgct      1800
     tgaatcgatg cgagcaacag accattcggc gtgagacgct tgcagcacaa ctagctgcgt      1860
     tggatgtcga agctggggaa gcgcgtcggc gcgaagaagc cgccgaccat atccgctcta      1920
     cgatcgaacg tcagcaagcg cgcgaagagc aggcccgaat cgacccagtt acggctcaag      1980
     ccgcacaatt agtgaacgct tctcgcgaaa caatcgacct aatggtcgcg ctggtccatg      2040
     gcgcggtgct cgagtgcgtg gcgtgcctcg gctggttact cgcgctccat ccggggcggc      2100
     gttatgctga gagccacttg cagactttgg ccgcactcaa cgccggcgtt accggccgga      2160
     gtaacgtcgg gggcacggat tcgctatttc ctcaacagaa actgcacaca acagccgagc      2220
     aagggaaggc cactgtcacg ccgcgacgct ccatcggtgc ggccgggaat gtttcgccga      2280
     gggaagcgtt atcgcggcag attgtggact cggatttctt ccgcttaagt catgcgattg      2340
     cagaagggcg acttcgtccg accgtcaagg acattcgtgg tttcctgaga tgctcgcaag      2400
     ataaggcgat gcgaatgaga cgacgtcttc ttgcagtgat cgagggaggg cccagcattc      2460
     cgccgtccgc agccgcgcgc gtacgtgcgg agcaacgtcc tcgtctcgta cactccagtc      2520
     ccgaccagcc atgggcggcg tagggtaccg cgcaggtatg tgcgtcgcgt ttagaccggc      2580
     gccatcggct attggacgac atgggaaaaa atgcgccgcc cagtctacga ggcaggtgat      2640
     gcttcaaaaa tcctaaaagc agtttccggg caatcggccc gccacctacg gagatccaaa      2700
     ttgatactta aaagatccaa gaatcttgtc gacattaagg cctcccggta tggccttcgt      2760
     cgtgcaatcg ccttcttcat tatctggtcg atcgcatgcg acttgatctt cactcgcaca      2820
     ctagggtggt cgacagcagc caccccttat aatctcgccc gcgccggcgt agtgctggcg      2880
     ataggcgttg ccttcgctat gatcgttggg cgtcgcgcag aaacccgttt caaggcgaaa      2940
     caggctccca cgctgtagta tccgaccgcg gccgtggcag agtgccgcgg ccaatttgca      3000
     cgaaccaacc atagcactat ggccgccctg gaaattatcg agagtctcgc gaagggaatc      3060
     gatccgcgca ccggtgaaat actgtctgag catgggccgt ttaatgatcc gtcagtcatt      3120
     cgagcgctct tcgaagctgc gaatgcactc cgcacggcgg gcgcgacgtc tgagcgaaac      3180
     gtagtcggta agcccaagcc gacgaacgcc gggcgcgcat ggccactgga ggaagacgtc      3240
     cggctgctgg cggatttcga cgctggtgtc actccgcagg aactcgcgcg gaagcacggt      3300
     cgctcaacag gtgcaataaa gtcgcgcctc gtgaagcacg ggcgaattga gcgatagaga      3360
     cgccacggtg acggttcgac tagcaagtct tcagggcgtg ttcaccttcc gcttttcaag      3420
     gaaacgggca tgaacgccgt ttccctcgac cttgtagggg catgtctacc tctggcgctc      3480
     gcgatcggat atctaccgcg actggtcagg tcgctagacg cttggacctg gatgttgctc      3540
     gtcgggtccc tcggcatttc tgcgaccttc tccttctgcg acagcaaagc tgtgcacgtc      3600
     gtgcccggta tttacctcct gtgcttcgta acatggttgc gtcgcggccg cggtcaatgt      3660
     cggcgggttc ctgctgcggg cattttcagc gccacgatga tcacgatctt tcccggtgac      3720
     ttgtatggcg ctctcacttg ccacgccatc ggtatcgccc gaatcggcgg tggagggcat      3780
     cttgacgcat tgctcttgac gcccttactg ctgtcgacga tgcacgcggc cgtctactac      3840
     ttctgtgagt tggacgaaca ccgtcgagtc cccgtgggaa gcttcctgcg gcgccagttc      3900
     tcgttattcg agtattccgt tcgaagtcgc tgaccgatag cgtacaaact tcgtaggcaa      3960
     cccgcatcaa ttcgcggcac ccgatttgcg gcattctagc cacgcccaat actgatcgaa      4020
     attctaatcg agggacgcga ccgctcaagt tatggcacgc gtgaccgtaa tctacagaag      4080
     gcggcagacc gattgccgcc acgcctaggg gcgagacgtc ggcaccaaat cctggctgcg      4140
     tcgaccagtt gcccctacga aaggttgagc gaaatagact cacaagaaca tcagtcacga      4200
     ggacatttgg acatggccgc cacccgctgg acgaacggaa acacaacgca aaacgctcag      4260
     ggactcatcg acgcaatcaa cgatccgaat atcgtcaccg tcacgctatt tgcgagccca      4320
     acttcaaagg atccatcctt ctctgatagc gacggcccgg acacgaactt gccgctgctt      4380
     tccgccttga cgcattcgaa ttcgggaaat acgacggtct tcgacggcgt tttcctgacc      4440
     gcggcccgcc agtctcgata tttcgaagta agagatgtac tcgacgccgc gattgcgagc      4500
     gggaaagtgt acttcggcgc ctctcgagcg ccgttcacgt cggcgttgac accattggat      4560
     gcgacacggt ctctaagcgc agtcgcaccc gtggaaaagt tgaccagctc aagccgtccg      4620
     cgttttttcc ggctgctctc gggcgtcacc gaagcaaccc tcgctgccct gtaagcttct      4680
     ggcccgtaat gacctgtcgg acgagtgcca agcgatgctg gtatgcggct ttcggactct      4740
     tcttgatgga agcggccgga cttctaacga tcgcgccttc gtggaagggc ggaacgttgg      4800
     aaggcgagat caacgcgctt gccttcttgg tcgccggggc ggccacgact ttcctcttgc      4860
     tggcccgcac gcgccccggc agctcgcacg tgacccaagg cctgaggtat ctcttcgcac      4920
     ttatgggcgg cagcgcggcg aactttctac tcacgtggac cgcttgggct tccgggtttg      4980
     ccgtctccaa tgggacgatc aaacggggaa tcatgggtga gaactactgg ctcggtccta      5040
     cgatgctcgc atatgcgacg attttgtggc tagcgtaccg tgcagctctg caccgtgagc      5100
     gcgctttcaa cgacgggccc gtcaatcgaa tgtgatttgg acatacggga aactgggccg      5160
     aacttcccat ctcaatcttg ataccccaaa attcaaaaca tcaaaatcgc tgttttgata      5220
     taatgagatc acggtcagcg gtacgtaaaa gccctgggag caaggccccc ggggctatgt      5280
     cgccggccgt ctgaccatct ggagcactcg ccccaggcaa ccgacaacga agaaccacaa      5340
     cgaggaacca aaagaatgaa gcgcaacgag accactccct gcagcaccac atcgatcaag      5400
     cgtttgaccc tcgccattgt cgcagcgtcg atgctgtcca cactcgcagc atgcggtggt      5460
     ggcggcggcg atagcggggc ggccgccggc accccttcca acaattcgca gacgaacgcg      5520
     aaactgcagg tggtcgcttt tggcgacgag ctctccgacg tcggcaccta ctctccgaag      5580
     atccttctcg gcttcggcgg aggcaagtac accacgaatc ccggcgatgt atgggctcag      5640
     aaggtggccg cctcgtacgg cgggaccctg agccccgcat atcaaggtgg gttcgggcta      5700
     ccgttggcgg ccgcaaacgg cctaggctac gcccaaggcg gcgctcgtgt ccaagaatcg      5760
     atcggtatcg ggcatgccgc cgaggggacg ccggacgctg actatgctca agcgacgacg      5820
     acgcccgtga cgcaacagct tcagaactat ctccaggccc atcaaagctt caacagtggc      5880
     cagctcgtcc tgatcaacgg cggtatgaac gatattctgg cgttggctcc cgccttgcaa      5940
     tcggcggtcg caaccgatgt cgccggaggc atggatccgg caatcgccgt ccagaaggaa      6000
     ggcggggcgg ttctagcgcc gatcgcacag gcacttgcaa gcacggtgca gcagatcgtt      6060
     gcggctggcg cgacccgtgt cgtgctggtg aatgtcccgg accttggcca aaccccttac      6120
     gccgtccgat ccggtgcggc cgcgcaacag ctgctcagtg ggttgagcac gatctacaac      6180
     acgttcctcg cgcagtccgt ccaatcgcta ggcattcccg caagcaagct gatcgccgtc      6240
     gaccttgcag gatggcagga tggcgtcctt gcgagctaca aatcgaacgg gttcgcggtc      6300
     ggcaacaccg gaacagcatg caatatcgat gcgatgatcg gcaacgcggc gaaagcgggc      6360
     gtcgcaaatc cgcaggcctt tggttcagca ctgttctgtt ccccgcaaac ctacgtcacg      6420
     gaaggagccg atcaatcgta catgtacgct gacctattca atccgtcatc gcacctgcac      6480
     gccctgttcg ccgaccaggt gcagcagcag ctgaaggcga gcggcatgac gaattgattc      6540
     gatgaaaggc acggtcgatg cgcgggccaa atgctccgca tcggccatca cccggcttct      6600
     cggcaggaaa atctgcgcaa cagctcccca gcacgctgac atctctgaac tccccacttg      6660
     ggcgtcgacg cctctagaac gtcggtcccc ctcgctcgaa cgggactaca cggccctcgc      6720
     tagtgcaacg cgaagtacgc tgatgcgctg attccaacga tcgcaagcag cggccaagat      6780
     cttccagcta gccgcaaatc ggtaggcgac ggccaagctc caacaagaag ctgggcgagt      6840
     ccaaaccaga tcgcgatatc cgacgcctct aacgtggcca aggtacgtgt ccgccacaac      6900
     gccgacgccg cggcgatcgg caagcttagg agtggcgcga gcgccgccgg cgccgcgttc      6960
     caccaacgca cattttcgaa ggcgaccatc ccataaacgt ataccccatt gggtgaccga      7020
     tgcggaaata tagagagcct cgttgggcga gcccacacga ggtggccaac gacaaagtgc      7080
     aataattcgt gcgcaatcgt cgccggcaag caaagtgcag cgaagagggc gccgctccgc      7140
     gcgaatttca gaagtagggc agcccctgcg atcggcggca gcagataaag catggcggcg      7200
     cacagatgcg ttgaatacag gacactcgag tgggccactt tggcgaatgg ggatggaacg      7260
     attgcagatg gagtgacgaa gcaacgagcc tttcgcatgc gaaaggctct ggatgtctta      7320
     ggctgcttcg gatacagtgc ggacgcttgg aggcggtaga acgggcatcg cgttaccgga      7380
     ttcccactgc agatggttca tcctctcatc cgctaacaac tccgcaagcg cgaccttgta      7440
     agcctcggac gcatttccgg gcaccatgta gacagcggta tgcttcccct cggtgtcgtt      7500
     aaggaccact gaggccagcg gacgggtgga tggcaagtta tagcgaaggc ccttcacgaa      7560
     tcgacgtcgg tccgagacca gtgtttcaag gaagctcttc tcctcgactg tcgagaacgg      7620
     aatccactgt tcgttcacgg tcatcagcgc catctcctcg agctccgcga ctcccgcaac      7680
     gtcgacactg aaggtggcaa tcatgacgag atgaatgtca ggatacgcgt tccagaggct      7740
     tttctcggcc tcaaacacct ttaagcgctt gttcaggtcg gcgctcatca tgaaaaagaa      7800
     ccccggcgca tgtttgagct cgattttgtg tccgtaccgc gctgcagtaa ctgccttgat      7860
     ctcaccgatc gcgataaaca gcctctgtcc accgcgcccc ggcttgtgtg ccgccgcgag      7920
     caacgctctg cgccgctgct cgatctcgtg tttccgatcg acgtagaacg gctccggcac      7980
     gtacaacgtg gacggcaaat gcatcccctt cgtgaacttc ccctgcgctg cgcgtaacag      8040
     gtacttatgg acggtggccc agctacgccg gccttccatg cccggatgcc aatgggtaag      8100
     acgcgcctca tcccaaaggt aatgaagaag ggaccgtatc gtgagcttag atgtttcgcc      8160
     cttgacgcta tcttgctcgg aatcggtcgg tgtaggcggt gcccggccgg cgatcttgtt      8220
     caatgcgaaa tccaaccgaa gactcgtcgt tccgtcgtcg acgtcctcct tgatcgcgtg      8280
     gcccatgacc tcaccgagcc cgctgagctg cgccggtgcc tcgtatgacg ggcagttctt      8340
     ctcggccgaa tgtagcggcc cagagtccgg cattctcttg atcagatact gcccatgaac      8400
     cttcgagacg tacatcggga tgccgggctt cggatcaaca caaaggcaga gcggacgaat      8460
     cgccgagccg tgaattctcg cgagtgcacc ttgcaaaccg gggtcatctt ctgagtaagt      8520
     tttcccgtct atctcaaagc gaaccatatc ttccccgtac ttcaactgcc gcgccgaacg      8580
     ggcagttgcc tctcgatcag gtgtcggcta tgccgcgcgc tttctcattg acgccaggct      8640
     gtttgatttc ttttgcccgc tcagtggtgc gcgccaactc gttgggctga aaattgagtt      8700
     gcacattttg tccctggtag acgttcccac tgagctcgtc cttgctgaat cgcaccgcgt      8760
     cggtccggct ggtttgcacc aggacctgct tgtctgagac atcgatcacc ttgccctgga      8820
     cgacaacgtc cggtccaagg ctcgtcgatt cggtaatccg taagcccggc ggaacgtgag      8880
     taatgtgact gcgcgacggg ggcgcggtca gaagagtttg tccgccactt ctctccgcgc      8940
     cggctcgctc tcgtgcattt ccttgatccc agtcatggcc cgcgcgatcc agtccgacgc      9000
     gatcgcgcgg tgcgagtccg agagcttgtc gataggcgtc ttcgtcaatt cgtccgaact      9060
     cgcgctggtc ttcgacgcgt tgctggagtc gtctttggat gtgttcatag ttaccttccg      9120
     atttcaatac ttcgatgttc tcgaaaccct gcagctgaac ggggttcgcg cggtctctga      9180
     catcaaccac gtcgagaagt aggttagggc cgaaaacgct attgagctgc tcaagcgatt      9240
     cggggaggcg accgacgatg ttggcgatcg tcgcgatgct tgatccccgc ccctcctcgt      9300
     agaaacgctg gagcgtgttg tcgagcgcgt tttcgacccg cgcatgtacc acaatgatat      9360
     gcgcccggta accagcatca agcacctgct gaattttggc gcgacttgtc tcgaagttgg      9420
     acatctggcc ctcaaacacc atcaccgcgt cgcgcggcaa ctcgccagat ttcagcacca      9480
     tcgaggtctt cccggcgccg ggggacccag tcaagaaata gactgtatct cgaccgctga      9540
     cacgtggtcc tgcaaggttc tcagtgaaaa gtgtcgcggg gcggcgtaaa ggagccgggg      9600
     atgggcggcg taatggcgcc agcagaaccg ggggtaaaac gcggattcga acggtttcaa      9660
     ggttgcggtt ttttgccgtt tttggcaact gcattttgag ggggatctgg catcggtttc      9720
     ggggtgcggt aactgtcgcc ctcgaggacg agccggtagg cgccgtggcg tagtcggtcg      9780
     agtgtggcgg tgccgaggat gcggttgtcg gggaacgcgg cgccccattc accgaagtcg      9840
     agattcgacg tcaggatggt cgccgcgtgc tcgtagcggg ccgcgacgag atcgtggaag      9900
     tcctcgtcct gcggggtacg tagcggtttg agcgcgaagt catcgacgat cagcagcggc      9960
     acccgggcgt actgctggaa cttgcggtca taggcgccgg tggcgcgcgc ggcgttcaat     10020
     cgcttgagca gctcggtctg cgagatgaac agcacatcgc ggccttggcg ggcggcgcag     10080
     tggcccagcg cctgggccaa gtgatctcgt accgactgtc aacgcatgtt cgcggcttcg     10140
     gagcagggct ctacgccggt tcgggcatag gctggttgcg gcgagactgg cggacctcga     10200
     gcggcacttt gaattgcgca gcaacgatac gtttgccctc ttggacggaa atcgagttac     10260
     cttcctgatc tcgaagcacg tacggctcgc cggtcttcaa cacgcgatag atccggttga     10320
     tcaagcgcgt cgcaactgcg cagatggctt gcttgtggtg atgccctttg ttcaccataa     10380
     gacgccagta cacggcggca agatctggat cgatctttcg tgcaacgtcc gcagcgatgt     10440
     acagcgcccg cttgacgcga tcactaccac tctttgtcag cctttgaccg ggcttctcta     10500
     taccaccgga cgaacttctg gtaggaaaca taccgcagaa tccgcgtatg tgatcttcgt     10560
     tacggaagcg tttcgcgtag ccgagtacgc cgatgagcag cggagccaag gtcgccccta     10620
     tgccaggaat agatcgaagc gcatcggacg gatgcacccg ctgatagatc tgctccactt     10680
     cacgctcgat cgcgcggacg tggcgatccc acagtcgcaa atgttcgact tcttgcgcca     10740
     cctcgaattg caaagcggtg aaatcgacgc tatcgccgtg gagctcaatg gtctcttcgg     10800
     ccgctgcctt aagtttctcg accagcgaat cgatgaaggg gccgctcttg ggatgattcc     10860
     ctgaggcgtg ttgtgacagg aatcgggcga gcacatcgcg tcgcatggct acgaccttgc     10920
     gcggatccaa cagctcgccg agaattgcta gcgtgagttg cgtgaccgta tcgggcaaca     10980
     caggctcaag cgccgggcac gcccagcgga tgaggtcaag aacgcggcgc cgcgcggaac     11040
     acactagctc ctgatagcgg tgacgctgtt tggtcagtcg ttgtagtgaa tgttgctcgg     11100
     gccctggcac atgaactggg tcgaggccac ggccaccaaa gccgggtatt gcgcccaata     11160
     catgtgcatc ggccgcgtcg gtcttggcat gctcgctgag gtatttgcgt aacgccttca     11220
     cgcgctgacc cttgacccga atgactttga ttccggcacg ctgcagccag ttggccaccg     11280
     gaaaccatgc catgccggtt ggctccatca cggctgtgat cggcgtatcg gcgccgacgc     11340
     cgctcttgat ggctgacacg aaacgcctga ggtcggttga cgtcaaacgg aagcggatcg     11400
     gtttgccaat tgcacgtcca tcatcgaaga tctgcgcgac ctgaactgca cttattgcca     11460
     gatcgatgcc gacggtccgg tgacgcacgg gtgcattgct gatagaagcc atgagttatt     11520
     gttctcctta tcaacgaatc agagggctcg tcgctgggca gcactgccag gtgtttcatt     11580
     cgtggccgct tgaaactcgc agattcatgc gccaccatct cgttactctt gcctgcgcca     11640
     gcccgaaccc cgcaaccatg ggcttcacat cgtcgggacg aactttgcgg gctctcccac     11700
     gttcttaagg tcgccgggtc cggtgcccgc aggcaagagt accagcgagc gagcgggcgg     11760
     agttgaacgg cgagtcagaa gcgacagaag ctcggcctca tactcttgcc cctcggcgta     11820
     cgtcctgcac cccgattcag acaagaagct atcgaattcg acggtgcgaa ggtcgacccg     11880
     cgatcacttc gtcgaggcgc cctgaagccc tatcatcgac ttgcccctcg gcgtcaaccc     11940
     cgcactgcta tagatacctg gcttttgccg gtgccggttg gaccggcgat caggatcgcg     12000
     accttctcgt cgagataccg gcctgtcgcg agatcatgaa cgtgtgagcg gttcaacgta     12060
     ggcagccggt cgaagtcgaa cgtctcgagc gtcttgccca tcgcgaagcc ggcgcgcagc     12120
     agacgggtgc cgagcttctt gtgttcgcga cgggcaacct cgtcgtgcag cagcatggca     12180
     aggaactcgg tataggcgag ctgcccgtcg atcgcctgac ggttgcgctg ctcaagcgag     12240
     tcgaggatgc cggacaggcg cagctgtttg aggatggaat tcaattcggg actcgggttc     12300
     atggtgtcag tggatcagca gggattggag atcacggccg aagcggccgc cgttctggta     12360
     agcgccagtc ggggccgacg cgggacgcgg caccggttcg ctgtccaggc ctttgtcgag     12420
     gatgcccttg atggtgctgt acttcgcgct gctgaacgcg agcgcacgct cgcaggctgc     12480
     ttccagcctc tgatcgccga ctttctgtcg cagccggatg atcccctgcg cgccgcgcag     12540
     gttgacgagc accttgtcgt tgaacagcgc gaggatcacg ccgtggcacg acggcccgat     12600
     ctccttcgcg cgcgccagac accactgcgg atcgtgctcg agccaggcct gcgcttcggg     12660
     cggctggtga tctcgcaccg tgtggcgacc gccggcccgc tgccgcggat gggttgcgac     12720
     gagttcatgc cgatggaaca gctggatgac cgtatcggtc gccttcagcc agagcgactt     12780
     gccgacgagc gtgaacggtg cagagtacag cgcgtgcttg tagacgacgt ggccgtcgcg     12840
     atggaccgcc acctccttcc agaccgacag taccggcggc acgtccggca atgcagcgag     12900
     caacgggcgc tcgacgccga agcgcgtcag cggccgttcg tggacggtgc cgtggatacg     12960
     agtgccggcc tgctgcatca cccattcgcg cagttgccgg ttggcgtcgg ccagatcccg     13020
     gaactcgcgc agcggcacga aggacttctt gacgtatttg acgcccgatt cgacgacgcc     13080
     cttcttctgg ggatcgtgcg gcggacaggc gtcgatccgg aatccatatc cctcggcaag     13140
     cgcggcgtac gagcgttgca ccgccggctc gtatcgacac gcccggatga tcgcgcactt     13200
     cgcgttatcg atgatgaccc ggtcgggaca gccgccgaac cattcgaagg cgcgccggtg     13260
     gctggcgagc cacgtctcga cggtctggtc cagcacgatc tcggcatact ggtggcgcga     13320
     ccagcacaac gtcatcacga agatccacgt ccggaccgca atgccctcga ccgtcagcac     13380
     gggtcccgcg ccgaagtcga cctgcgcggc gtcggccggt gcgaagtcga ggatcgttgt     13440
     ggtggccacg ctgcgctcgg cagccagatg gcgcagcatg cgcttcacgg cacaatagct     13500
     gccggcgtag ccatgattgc gttgaagggc ggcatggatc gtggtgccct gaacgccggc     13560
     ggcaagccat tcgcggacct gttcgcgata tggctcaacc gtcgacacac aggtgtgcgg     13620
     caggtgcggc gtgcgcccga agacacccgc gatcgtagcg tcgtccggca gcggctgcac     13680
     cggatccagc caactacgcg cttcagcctc gcggcgcacg gtcgtcagct tcttgcgccc     13740
     catcaaaccg ccgcgcgcga tgtcgcggtc agaatcgcct tgccgcatgc ggacaaggac     13800
     ttggcggtat tcaaacaatt cgaacctcct gttggccatg gacgctccgt tcaaaaagaa     13860
     cggagcgtac cgactcggaa agttcgaacc gcgttctcgc cctgatgctg ctggcgccta     13920
     tgcgccgccc ctaacgtggc gccattacgc cgcccttgga ctggcgccta tgtgccgccc     13980
     ctcaagtggc gcccttatgc cgaccccgca ttggctccat agcgccgccc cgtgacaaaa     14040
     agagccgacg ataggaccgc cgccgaattg tggaccggat tattgtagcg attccgggct     14100
     tctcgcgaag cactgaagtc cggaaacgtc tccttgaaca ggtcagctgc aacataccgt     14160
     ccctcgaatg acctcgcgtc cgccttgtac gcgtcgaaga actttcccgg atccttcttc     14220
     accgcctcaa tcgcgttgtc ctgcacacgc ctgcgatccg gctcctcgaa atttacgtac     14280
     cggatatctt ctagtttcat tggttacccc ggtttactgt tgttcgcatc accatgttgc     14340
     tctcggcaac atcacttcgg tcggcaacct gggcgacgac tattgggtcc gtccacgcac     14400
     gttgcgagat tgacttgtcg cgcgaagacc caccgttaac gcgatggttt cgcggttgcc     14460
     gtcgtgcaac ggcgatagat gcatcacgtc gggaattaaa ttatactcac ctcgcggcct     14520
     gatacaagtt tataacccga ccaggccgga acggggaaac catgaggatc gaccactgca     14580
     aatccgtcct ctcgagatac cgaacaccga gcctgctcgg tgtcgtcgcg gctctccaga     14640
     ttttggattg gcacagtacg ctgaccgctc cgcacacgcg cggcgaaaca aacaggttga     14700
     tcaactggct cgtccagtgg gtcagcttcg agtcggccgt gtccaccttc aagctgcttt     14760
     gcctagccat gcttctgtat ggcttcctgt tctggcgcaa gcacaagggt ctctatgaaa     14820
     ccgagttcgc ccttgcgctt ggtgtcgtcg ccgtcgtgta tggcggggtt gtattcaaca     14880
     actacgttgc ataatctcac ttttgatgtt ttgatcacgg ccgttgccca gcccgtttcg     14940
     ccgcgcgaag ctcgccagcg atcaggggtc gagaagggga gtcgtcaagc cgctttgaca     15000
     ccgttcggta tcatttcggc attaacgact ggagtagggc atgaaagcta ttgttgagca     15060
     ggacctgaag gaagcagcga tcgcagggac gatcaaggat ttcatcatcg aggaagtgga     15120
     aggcgggttc attctcctca ccatctttgc ccggtcgaac gtcgaacacg ttctctatac     15180
     gcagcgcaag cgcgcgagaa cctgggtgaa cgtgaactcg ctgctcgaat ttatcgtgca     15240
     gtacaaacct gagttgcccg aggtccgtgt tcgcctcatc cggcgctcaa acaattgaaa     15300
     gaggacccat gcaccgtctt gcaaaacttg ctatcagcat gatctgcgcc agcattgcca     15360
     ccctcgcaca tgctggcttc ccggaagagc tcaccaagcg gtttccggcc gctcaaggtg     15420
     caaagatcga acgggccttc cccggctttt ggtcagtcgc gaaggggagc gacgtcttct     15480
     ttgtgcgaga cgatctttcg atactcattt ccggcgaggt cgtcgacctc aaccaacatc     15540
     gctccctcac gcagtccgtc cgagacgcca atcctccgcg tatcgacgtg gctcagctga     15600
     acctgaaaga tgcaattaag ttcggtaacg gttctcgccg tctcttcatc ttctccgatc     15660
     cggactgccc ttactgccga aagctcgaag gtacgctgac caagcttcaa gacgtcacca     15720
     tcttcatttt tccgtttccg ctcgccggcc atgagaatgc tgcggaaata gccgaaggga     15780
     tctggtgcca aaaggatcgg gcggctgcgt ggcgagccta ccaagacttg acgctgacca     15840
     ctcgtgagcc cgagctcctg tcggcgtggc aagactatct ccgccagcac aatcagccag     15900
     cgcggccgac gtgtgccaac ccaatcgcgc gaaacctcga gttcggacgc cagtggaaca     15960
     tcgcggggac gccggcgctt gtcttcgagg acggaacgct gattcccggc ctcgtgcccg     16020
     cagcgcggat cgaggcacag cttgcaaaat cccattccaa cttggcggcg tcgaaataag     16080
     atgacggaaa aatttctcgc ttggcttgcg gtacacggcc gacataccac cattcacgtt     16140
     gctgtagtcg cgctgctcgg gaccgcggcg ttcatcattc tcactgccag tgatctaggg     16200
     ccgatgggcc cgctcgtgat tgcactggcc ttttacatgg tagtcgccgc tgtaacggcc     16260
     gaggtcgccc tcggcattac ggtcgtagga cgatcgctcg ctcggcgggc tctgcggcgc     16320
     gcaaaatgac cttccgattt gcgaccattg ctttagtagt cctactcgcc tgcagcaacg     16380
     cgagctcggc cgatttgaat gcgtgcttcg aaaatgctgc ccgcaagcgg cacatcagcg     16440
     tcgacctgct ccgagcgatc ggtcatgtcg aatcccgatt ccgaccttgg gtgaccaacg     16500
     ctcaatccgg cgcaatcggc gtgatgcaga tcatgccggt ccatctcaaa tggctcagaa     16560
     aatacggtat cgagcgagag gacctgtacg acggatgcac aaatatcaac gtcggcgcct     16620
     tcgtcctcgc cgacatgatc cggatgttcg gcccgacgtg gcgtgccgtt ggtgcctatg     16680
     gcgctggaat tgcggcgaat aaggaacagg cacgcaagga gtacgccacc cttgttcaag     16740
     cgtcgctcga acagctcaag cgtagcggct cgcccgccct tcctcctgtc agggcgcagc     16800
     tgatcacgac gcccgcggct ccctctcgac caaagatggt ggtggactaa tgaaccgcat     16860
     cccgaaattg ctcatcgggc tcgcagcctc gctgcaactc tccatttcct atgccgagga     16920
     cctcggcaca aaggcacaaa cctatccgct tgatcgcgac gcggctgagc agatcaagga     16980
     cattttccgg agaaagcagc aatcaggcga actcgatgca ttctggaaga actatcgcga     17040
     tcgcacgatt gagagcatca agaacccgcc gtccctcggt atagccacaa gctacggcgt     17100
     gcgcaccgag ctgcgcgaac tgcgtttcca gattccgcaa gactatcgcg atcacaccgg     17160
     gaaggtcatc gttcggcgcg ggactgtcgt agagcccctc aaggtcatgc cgctgacgaa     17220
     cggacttctg ttcatcgatg ggaccgacgc tcgtcaggtc gagtatgcga tcaggcgcag     17280
     tcagtccgag cgcttaaaga tcgtattgac cgcgggctct ccgtatgcgc ttcgcgtgaa     17340
     gtacgcgaaa gtgccgtggc atggggggac gggtgttccc ttttacttcg atcaacgccg     17400
     aatgatcatc agcacgctgt ccaagctgta caacatccag atcaacagtg tgccggcggc     17460
     aattttccaa caaggcgaca ggctcgccgt ccagtttggt atggagggcg caaattgaaa     17520
     agcttcatgc gtctttgggc ttcggtcgtc ttggcacttt gcctctctgg taacgcaaac     17580
     gcccaagcac tttgcaatgg cagcttcccg aaccttatca cggacgtctg ctacgactgc     17640
     attttcccga tctcgattat gggcgggttc atcaacatgg gcgtgtcagg cgacgactac     17700
     gacacgggcg caagccactt tccagtttgc gtctgcgcaa acaacttggc agtgggcacc     17760
     ccagtctcgt tctgggagcc acggtatatg gtcgacacca cgaccaaacc cggttgcatg     17820
     ccgttgctcg gtggcataga tatcaagacc ccgtacaacg cagctgagta tggcgcggag     17880
     aacgttacca acgcggcaat cagcgggaag cgaaaagcgg ccttcatgca ggtgaatgaa     17940
     tacgtgaacc cgatcatgtc agcactcggc gtggtcgtga acaatccgtg cctggacaac     18000
     cgttcgttcg acgtcccttt cctcagctgg gccgacccga catggaacga cgatgcactt     18060
     tcgctgatgc ttaccccata cgcatatccc tttgccggga ttccgagcat cgcggccgag     18120
     ttgccggacg caatctccgc gacgttcggg ttcccgatgg agattctttt ctgggtggcc     18180
     ggagcgtggg ggccgatgta cccactgaac ggcaatgtcg cgatcgccaa caccccggag     18240
     caggtatcgc acctgatgat cgcgcgcctc tttgccaagc tccacgctgc cggagctgcg     18300
     caagccaccg cgggaaacga cgcccttcaa tcgtgtggcg cgctgggggt ccctcagctc     18360
     gtgatggaca agcgtcagta caagacgaac cgtgtctttc cgtttcccga caacaaatgc     18420
     acgccgatcg ggcggccgct cgctttccaa gagataggcg ccgcacgccc gcaagacaag     18480
     gattacggat acatcatctt ccagcgcaaa gactgctgcg cgacgaagac cattcagtaa     18540
     cggagaacgt catgaatcgc ttgatcgtcg cgcttgcact cttcgccgca gcaccagtcc     18600
     acggcgaacc ctcgctcagt gaaacgatcg ctgcgccgtg gaacacatat atcttcgttt     18660
     cgagccgaat gccgcttcaa tcgatcatcc aggtcacgcg cgaagcgagt cgagctcacg     18720
     ccgtcatagt gctcacgggt tttgcaggtg aggagccgac acttaccagc acgcagcgat     18780
     acgcagctga cattaatcgg gcttgctgca cgacgcagcc cgcgcgctgg atcgtcgatc     18840
     ccgtgctcac gcgtcggtac ggcgtaaccg cggccccgtc attcgtaatt gcacacggag     18900
     cgagcgaaaa ccccggcgaa ttctccaaag tcgctggcga catgagcctt tcgcaggcgc     18960
     tcaagttttt cgcgcagaac tcgagattgc cttccgcgcg cgactatgcg tcgaagttgt     19020
     actacgcgac ctacggcacg aaatattaat tgtgatcctc tcggctagtg attaaaattt     19080
     aggtatgaag acacctgttc tcatcctcgc acttgcctct ctcgtcgcat cttcggcata     19140
     cgcggtcccc tccaccaacg gcgtcgcatt cgacgtccat gggccctacg tcgatggcgg     19200
     tgcaatcgtc gagtcgccgc aaggggggag ctacgtctac tcgaatcagc ttcccgatga     19260
     cgggcgacgc ccgcagcgct tcatgcttgg aaaagcaccg cgccagaact acgacttatt     19320
     cagcgagaag gaggaagcag ccctttggaa tacacgggag tcaatgttgg ctgccgagcg     19380
     cacgcggctc gcgcggcata gccggcacac ggcaagtcgc gggaaggcgc gatccgggtc     19440
     gattctgaac tggccgaagg tcatcgtggt tggcgagaaa acgtgtgttc cgacaaccgc     19500
     attcgcgact tctgctgact ggcagaagca tcttgtctgc tgggataagg ggagtcgcca     19560
     tgtcgattaa gttccgaatc ccgagatacg gcggggcagg gcccgccctg tttggcgtgc     19620
     agttcaagga tacctacatc ctgattctct ccctacttat cgcagcagta gccggaaagt     19680
     tctacggaac ccccgcgtac ctgggaattc cgttcgcggg gtaccacatc aacaagaagt     19740
     acatcgagtg gtgcaacgaa cggctagaag gctttgcccg cgtggccctg tttcgactcg     19800
     gtttgaaagg ctacggccga ttcaaatctc agaagacgct atatatcggc gacgcaaccg     19860
     tgatcaaccc acgcaatagg cacctcatcg agtcgattct tgatcccagt tcaaaggaaa     19920
     aaggaaagtt ggaatgaatc gcacagcaag agataaatcg atcgccgaat acaagcagct     19980
     gaaccgatat ctctcgatcg ggatcggctg cttgggcatt gcagtcctgc tgctgtcttt     20040
     gcgggtgatc ttccagaacg tcatcgtcca aatgcaggtt ccgggaatgc cagatggcgc     20100
     gaagatcgag cgcaacggga tggatgtcgg tgcaatgcaa gcgtatgcgt tcgcagtgac     20160
     taatgctctc gcatcggtca atccgagtaa cggcgaatcc acgaaacgct tcgttcagcc     20220
     atttctctca cctgcggcgt acacgaaagt cagtttggca atcgaccaga agatcgagac     20280
     gctgaagtcg cagcgcgagc tgggaagcta ttactttgtt ctgaagcgct tcgatgccga     20340
     cgagaaactt gggcgcgtgt tcgtccaagg tgacgtccat accgtcaacg cagccaagga     20400
     taccggggag ccatgggtct tcgaataccc ggtccgcttt ggcaattatc gaatgacgat     20460
     ggacgacgtc atcgcctacc ccggcgacaa ggctcatacc tccgaatgga tcaaagctca     20520
     acagaagaag tgaagccgat gaaaacccgc tacctttccg cccttatggc ggtctatttc     20580
     ggatcgacac tgtccactgt tgcgtttgcc caaggcgcat cagcgtccgt ggactttggc     20640
     gttgctacgc cgccggctat tgaatccgcg gcgacgacga cgacgacgac gaagacgaag     20700
     ccgaagctcc atggccacgt gaaacggacc cgtgatcccc tgaaggttga tgcgtcaatc     20760
     gcagttaaga acacaccgca gaaggaaatc gttcttcctg gcgttttgac ggtacccggc     20820
     gagggcattg gcgtgcccga cccgtccaat gtccagaagg tctcctggac caacacaggc     20880
     aacaaaacgg tatacctgag cgcagacgag ccgaaccgga ttctgctgcc gttcaagaat     20940
     gcgtacattg tccacacgag tgacgttcaa gtcgacaagc gtgagcaaag caataacgtg     21000
     tacgtctact ggacgaacgc tccttcgcaa gctcgccacc tgtatatcga gccgcccgac     21060
     ggggggtcag cgctcggtct cgctatcgtc ccgaagaaga tccccgcgca aacaattctc     21120
     gtgaccgacg ataccggcat tgtatcgggg cgacgcccca agtcgtcgcc aggcagtgag     21180
     tacacatccc atattcagga cttgatggcg gcgatcgctt tgggaaaggc gccggatggc     21240
     ttctcacagg ttgacatcca gttgcctccc atagcaatga acggcctctc cgccaccgtt     21300
     gacacccggt acagcagcca agagggcgat ctctacgtct atacggttcg aaatccaacg     21360
     cagagcaggg ccgtgttgcg cgaggaggaa ttcgacggcc ctgaggtcat cgcggtatcg     21420
     atttacccga aaccggtact tcttcctgga gagaagaccc gcgtgatcgt gatggcgcgt     21480
     aagcgcgagg agcagtaatg gcgatgcaat ttaagtggct tgaagatcgc aagcaggaat     21540
     ggcgggatat ggagcctaag ttccgctacc tgctggtcac tgtcgccgtc acggggaccg     21600
     ccttcatcct gtaccagcac ttcacacgag cacccaaagc ggacaccgcg ggcgctgttg     21660
     cacaaggagt ggtcgctccc gcggccggct tgccgcctca accggcgcag ccggcgcccg     21720
     cgccccaagg gtttgccggc accgtcggca ttttgccgac gtcgaaccgg aaccagggcc     21780
     tcgaggactt ggcggcacag gtcggctcgc tccagcagca ggttgtcact ctgacaaagg     21840
     cggtttccga cggcaaggct ggcggcgcac cagacgcatc gaagctgacg acgacatgga     21900
     cgccggcaag cgcgccttcg gcatcgacgc ccacgccgtc cgacggttcg aataacagtc     21960
     cgctgggcaa ggatctccct gacgctgtga actttgatca accgggaaat cgtccgtcca     22020
     gcgcatcggg cagtatcgca gggaccgcgg cggccgaccc cgcggccttc gccgccgctc     22080
     gaccggcaga gccgccggcg ccggcgcgcc cgaccttagt cgtggacaag ccagcaccgt     22140
     cgactgcaag tgccggaaac cccaaaccgg acccgacttt cccgatctat tcgggcatcg     22200
     aggcagtcat gctctccggc ttcaacgcgc gccagggcgg gtcgaacggt ggtccagccg     22260
     gcgccgtcac gaaggcgatc gacgtcggcg caccgttcgt gtcccgagtg aagggggcga     22320
     cgatcatgcc gaactcgtgg aagtcttccg acctcgagaa ctgcttcatc ggcggctcgg     22380
     ctactgccgt cctgtccgcc gagcgcgcgt acgttatctc cgacaagatc agctgcgtct     22440
     tcaagaacgg ggaaatctat gaaggtgaca ttgtcgcgta cggactggac gtcgacggca     22500
     acctaggtct cgccggaaag gtcgtgaata agcagggctc catgctgatg caagccgcgc     22560
     tgacgggcat ggccgccggc ctcgggtcgg cactcgctcc gacggctgtc tctagctaca     22620
     acagcaacgt gagcgccggc tcgactggcg cctataccta cccgagtccc agctttctgc     22680
     tcggcacctc ggttggtacc ggtgtgaata aggccgcaac ggagctctcg cagttttacc     22740
     tgaacttcgc caaggaaacg ttcccggtca tcgaagtaac cgcgggtact cgagtcacct     22800
     ggattctcaa gcaagcgctc accctgaagc gcaagacgcc ccccaaggac caacgatgaa     22860
     tcgctcctca agaaatctcg gcatgatgat tttgccggcc atcgctgttt cgctcgccgc     22920
     ttgctcgtcc gcattcaatc cgatcgggag caatacgtac gactgcaatc gaaagcagga     22980
     tccgacgagc atctattgcc atagtttccg cgcggttgaa gcttcgacca atggtcgact     23040
     gcctgatagc cgcttcgata ccgagctgaa atttagcgag tacgacaagg caactgacat     23100
     cgccccgccg aatcgtcgcg acttgaccgc tcccccgcta ctgactgccg gcggacaacc     23160
     ggtccagctt ggctcgggtg gagcggcgtc ccagcctgcg ccggccgatg cgacgcctct     23220
     gcacgcagag atgcccgtcc gtatgggtcc ggtaatccag cggacctgga tcaagcgttt     23280
     cgtcgacgag aacgacatgt ggacgagcga cctcaccgtg ctcaaggaaa tcgcgccatc     23340
     tcgatggaca ggattcgacg gtggcaaccc cgcacgggcg gccggtggcg tctatccgca     23400
     caaggttgcc gacacgcctc aagacccgtc tgctggcgcg gtcgcctcgg cgcaaagcgc     23460
     gcctccggct gctgccccgc cgacgaccaa cgatttcatc caacccggcg gacccgcgcc     23520
     gggcggtgaa aaccccgctg gcatcccgat gccaatgtca atgccacagt aaacgaggaa     23580
     accaatgaaa cagaaagcag ctgcaaccct gaccgccacg ccgacctggt cgccgaaggc     23640
     ggcaatggtg atggccgtcg ggatgggcat catgctcatc tcgatcggcg cccttaatgg     23700
     cggaaccgcg ctgaccggta gcgcatggga ttcgatccag accacgatca aggagatgct     23760
     gagcagcacg tatgtgatgt tcgccattct gctgactttc ctcgtgacta tctggcagct     23820
     cgcgcacggg cagggctatc gcaacctcgc ggttgtcctc ggcatccttg caacggcgtt     23880
     gatcggcccg agcatcgtcc agacggtcgc aacagctaac gggcctgcac cggcatccag     23940
     caacaccgcg cccgactacg gactcgcgca ctaaacaacc gtccccgtcg aggatcgggg     24000
     cgcgccgaac gcgcgcccca tccgtttcaa gtcgaaagag agttcatctt gaccgccacc     24060
     accctcaaag tccgacgatc accggcgagc gatattctca acatcgagac ctacacgtcg     24120
     gatagcaacc tcgtgatctc gaaggcgcca ggcgccgaac ggccgctaat cggcgccgtc     24180
     tacaggatga gtccgctcgc tggaggcggt ggcgaattca gcacagtcgt tcaaaacgtg     24240
     ttcaaggccg tgcccgacca gtcggtgatc caggttactc tggtaatcca ccctgaccac     24300
     gacgcgccgg atacctattt gaagggcaaa ttgtatggcg gccctgtcgt gcaagacctg     24360
     atcaagcggc aggcggacct ctatcgccgc ggactcgcga gtggcgagct acctgatctc     24420
     cctggcatca ataagcggac ggtctacgtt tcgctcgcag tgccgcatcg gaaagccgac     24480
     gacgaggctg tcgaaaaatc cgccagcttg caacaagagt tcttcacgaa catgcgcggg     24540
     tgcggcttcc atgacgtcgt gcagctcaat attaatcaac tggtcggcgt gtataggcag     24600
     atcaccaata tttatgagcc ggccaccgtt ccggagctcg accctacgct cgatctgcgg     24660
     tatcaggtat ttggcccgga tcagactttc gatttccggg atccccacgt aggcgagatc     24720
     aacgggaaca cgtactgcac caccgtcacg gttaaaaagt accccgagcg tccgttccac     24780
     gggatcatga acctgttgag cggtgcaccg ttcaactcgg gcagcgtgcg cgagggggga     24840
     ggccagcgga tcgaggggcc gtgcatcatc acgaccacgg tgcgagtcgc gaatcagcgc     24900
     cgcgaatgga cgcgtgtcga gagcgcaatc cgctcgcgtc gacagcatca gccccttccc     24960
     atcaagctcg gcgtcgagga cacgccacgc gtgctcgccg atctcgagga gattaaacgg     25020
     caatgcgcag aagacggcac gaagttcgtc tatgtttcga cgaacgcgtt cctcttcggc     25080
     cgcgaccgcg acgaggcggt ccgcgctggc gcatccgtca aaggcacgct ggacaaactc     25140
     ggtttcgacg ggcgggatgt ggtcgctacc ggcttggtac gactcgccca gaccctaccc     25200
     ctgaactttt ccaacacgat cgccgacgac ctcgctggcg aagcgacgat ggccagctcc     25260
     gaggtcgggt gtttgcttcc cgtctacggc gactatctcg gaaacgtcaa ctccgacttt     25320
     ccgctgacgg ggatggccta cccaacgcgt cgcgggacga tgcactactt cgatccgtat     25380
     gtcagcaact ccaacttcaa cggtgttatg gccgctgaat cgggtgtagg caagtcgttc     25440
     agtctccaag ccaagataac cgcggagctc gccgagggcg acaacattgt tctattcgac     25500
     aacggccgca gcagcctgaa gttctgcgca ctcatcgggg gagaatataa cgaattcggt     25560
     ggcgctaaag cttggcggcc atcgctgcag ccgttctcca acctgacaga cgaggaattc     25620
     gacgagcagc aagagaccat cacatcgctc cacatgctga tggcctacga tgaggaaaag     25680
     cccgatcccg gcgcaagaat tgcattaagc gaagccgtca aggctgcatg ggggcagcgc     25740
     ggcaaggatg ccgaagtttc gacgacgatc gcctgtctgc aggcaatcgt cgaatccgct     25800
     gcagagaacc agattcagaa ccaagtccac gtcgccgcgg ccaacctcat ccctcggctc     25860
     aaggctttcg ttgactcgcc gacccggggc ccgtatttcc gcggtccgag cacactcgac     25920
     ccgaaagcgc agttcaccgt tttcgaactc gccggactcg gcgacgacaa ccacctcaag     25980
     cgagtcgtcc tgttctgctg cgtcaacatc ctgctttccc gcatcaagaa gttcaaggga     26040
     cgaaagcgca tctatgtcga cgaggcccaa gacctttttt cgatcgattc ggccgctgac     26100
     gcgttcgaag gcctctacct caaggggcga aaaaacggtg tctcggtctg ggtcatcgtc     26160
     caatcgctct tgaagcttgc cagcttcaaa gcgggctcgg tcatcctcag gcagtcggca     26220
     tggaagatga tcatggcgca gaagaaggac gagatcgacg ccgtcatcga tcagaaggta     26280
     atgaccgcgt tcgcggacga cccgtatttt caaaagctca tcaagagtgt cgagtcgaaa     26340
     aagaacttct ggagcgaaat tctcatcatg agcgacaaga cgtacgaggt agtacgtctc     26400
     tacgtcgata agtttacggc aacgctattc agctcggagg gagccgcgcg cgatgacgtg     26460
     ctgcagatga tggaggaggg ggtagggcct ctcgaggccg tccggaaggt gatgggggac     26520
     aagaaagcgc gccggcgcga atggatgagc gaatttctag acatgtgcaa aaacatcgac     26580
     ggcctgacct tcaatgagat cgttagagag ctcaaggaga tcgcaaaatg aaagggatcc     26640
     ttagtggtgg gcgtgtaccg tactcggtgg tgtgcctgct atcgttctcg gtgtatgcga     26700
     tcggttacca ggctggacac catgcggcaa agccaccggt tcgtgtcgcg atcgcggaga     26760
     agggcgctgt cgttctagag gctgctctca atcatccgtc cgctacgccg gcgcagatga     26820
     aggcacttat cacggatccg attaactccg ttttgcgcca atacctcgcg caaggtttcg     26880
     tcgtcgtgga caccagccga aacgaccagg gtgaaatgac cgtcactgcg ctaccggccg     26940
     acacggtgga catcaccaac gaactgcgca aagcggcaca gctccctctt cagaagtcag     27000
     ctgcctccga agtcgcggta agcgcgccca ccgtttcgac gagtgccgag ggagcaaaac     27060
     aatgacgacc gtaagcgaaa tcgatgtgga aactccacgt cccggcgagc gcggcaagtt     27120
     cgccgcgttt tttttcgcca tcctcgtgct ggtgctcttc ttctggattc aacccccaat     27180
     cacgttcggc ttcgacccgc agagcgaacg ctgtctgccg gacctgcacc tcgcaatgat     27240
     ggttcacaga cagccgggcg aagtgcaccg cggcgatctg ctcttctggc gaccggacgg     27300
     cgcactcgct ggcttcaagg aacagtacat ccttaagatg gttgctggca cacccggcga     27360
     tcacctcacg attcgcgcgg gaagagtctt catcaacgga aagcaggtcg tgcagggctt     27420
     ccctctcgcc gcgtcctacg gtcgcgacca acgagcgttt gagcgagacg aagttgttcc     27480
     acccaatgcc tacttcatgg tcggagtgca tccgaactca aacgactcgc ggtactgggg     27540
     ctatctcgat gcgcgtaagg tgtcaggcta tgcataccgc ctgttttgac atcgcgcgcg     27600
     gtcggcgcat tgcccaatgg atcgcgctcg ccctgctgcc agtctcgatc cacgtcgtcg     27660
     cggcgccagc gactgactcg ccacggggtg acgcatacgg cgatgctttc ctcaactatc     27720
     agccttacgt cacaccagct gcgcccgtcc aagcctccgc acccgcgtct aagccgccca     27780
     cacaaacggc gccagcgcca gctacagtag ccgagacggg cccccaaaaa gtcgacgtag     27840
     tctttcttcg aaaggtttac ccggtgctag aagagcgggc gatcaatgac cccaccgacg     27900
     ccaatatctc ggcgtacatg tatacgaagc gcattattct cgacaaggct caacgattct     27960
     ctcagagcgt tgcgcgtgtg cttaggcagg acccgttact cgacgaaaac aaccgggttc     28020
     cgtatgcctc gaccggagcg ctatctgtac gcaacgccga ctatcaagct caacaaaagg     28080
     ccgtggaaga gctcgcccgc atcggcgggc ttgtcgcctt cgtcgacagt acatgccggt     28140
     tctgcgcaat gcagatccct gtcctcgaca tgctcaaacg cgcgcacaag atcgagtatc     28200
     tggtggtgtc gcttgacggt gctcgcccta agggatttaa cggcccgctc atctcagata     28260
     acggtctgtt tcgaaaactc gggctgaaac taacgccctc catcgtcttc gttccccggc     28320
     ctcgcgcata tgtcggggcc gacgatccta accgttatct ggtggtgtcc caagggttct     28380
     atgcgatgga cgaactcgtt aaacagatcg cgtacgctgg tcacgatacg aagctgttaa     28440
     gcgcggaggt aatgcgcgat ctcaacgtct gggaccgtgg cgtaacgact acacaggacc     28500
     tcaacaagct gaggctcgat ccgaacaagc caggctcgtt ccgcgagatc cttcagccgt     28560
     acctcttgaa gcaataccag aactaaggag gcgcccgtgc gcgtgaaaaa atttctgttg     28620
     attgtggcga tggtcgtcgt gccgcatctc gcattcgccg gcattctggc tgacctcggt     28680
     tctatggtga tggcgaacag taccgcgcca ggagccatga ccacgaagga tcgtgttggc     28740
     gtctttatgg gcgcattcac gatgcgttcg ccgatcaaag cagtcaatct cgtcacattc     28800
     gatcctccgc gaatcgacgc cggctgcggc ggtatcgacc tctacggtgg atccttcagt     28860
     ttcatcaaca gtcagcagct aattcagatt ttccggcagg tagccgccga cgcggccggg     28920
     ctcgcgttca aagcggcgat caagtcaatc tccccctcgc tcgacgcgtt gatcaccgag     28980
     tttcagacgc tgctgcaaaa tctgaacaac cttgcgaaga actcctgcca gatggcgcac     29040
     ctcattgttg atccgatcga caacgctctt tccaacgcgg tgaacggcga tggcaataca     29100
     ggtggaacca actcgaatat gttcacagat gtgatgggcg gtctcaagag ctacctctcc     29160
     gacgccaact cgtacttcaa gaatcagtct gcgaacaatc cgaagagcgg gaaccctctg     29220
     gtgaagaagg tagtcgcgtc cggcgcgtcg tcgatcatgg gactcgccgg cttaccgaac     29280
     gtcgacggga gcagcgataa cccatccgat ccgaacagtc tgaacaacat ggtgctttac     29340
     gcactgcttg gctacaacat cgatgccgcg ccgtgtaaca gccttaatca ggcggggcag     29400
     ggcatccagt cgtcacgtcc cgccaacaac accattggcc aagtgacgtg ttcggggccg     29460
     gccgtgatga ccctcgacga cttggtgaag ggtggcggaa ccgggtcgct tcgccccgat     29520
     gtacctctgc agctttatcg ctgcgcgaac cccaacggga gtgtttttgg gggcgttgat     29580
     aaccaaatct gtacgcagat gcaggtcatc tccttcaatt acgttggcat cgagggatgg     29640
     gttaactcaa tgctgttcgg ctcggttgac ccggcgctct ccgtggcggg aaactcgatc     29700
     gtcggtcaaa tcaatagcgt gaattcgacc accttctccg ctcagcaggt cgccttcatg     29760
     aagcaagcag gcgttccgct cgcggggctc ctatccaaga cgtcgaacac cgcgacccgc     29820
     gtcgctatcg cgcagcggct ggctccccat atcgtcgact gcgtggcggc tcgaatcggt     29880
     gaggtcctct acaagggcgc aaacctcatc caaacgacac ctgggtatga cctcaccgac     29940
     gatcagaagg accgtatcaa gacgcttcga accgactatc tcgccaagca gaacgcctgc     30000
     aataacagcg atgcacttct ccggatcatc actgagatca acgaagggac gcgcttcgtg     30060
     aataccaaca tcaagtaaac cggggaaact gatggctatt ccaactctca caatctattc     30120
     cgcgactgcg gacccaacca ccctgcgtgc catcctggac agcgtcgcaa tggtatgcaa     30180
     gaacaaccta atggtttggg gttttgccgt gatggtggcg ctatggcgcc tgagcgcgtc     30240
     gaccgctgct gccgcgctgc ggtcggcatc gggacaggga ggggcagttc ttggaaatgg     30300
     tgcgttgagc gcggcgatgc cctttatcct ggccacggtg cttacaaacc cgatgttgaa     30360
     aagcacggtt cagatcgagt caacggtcaa cgggagcctt actgaagtcg acaatgtgcc     30420
     gcttgcgatc tcgatcatcc cggtcgctgg cagcgttcta tcaatggacc tgaacgacac     30480
     cgtttcgaca gcgttccagc gtgcgagcgc ggagtatccg acgatctccg ccagtgccaa     30540
     cggctttctc aatcctctaa aagcgcttct cagcgcccgt acggcgacat cgcgacttag     30600
     cgggattgac tccgaggtga aaaccgttct cgcgtcatgc ctcggccctg attctggtgt     30660
     caactactcg aacattcaac gcctcgtcat gaacgcggga aacacggggg caaccagcgc     30720
     acagtcgatc cccgtcaatg ggataaatcc gacagcgatc ggcgcgcttc tttaccaggc     30780
     ttcgctgaac agtacaggaa aggtcaacga catcggccta gattcgacca acattttgtc     30840
     atgctctgac gcagcgtatc gcgtggcgga cgacatcacg aacgctctga attcgctcga     30900
     gttcccacgt gtcgttcaag gggcggtgaa cggcctcgac tcaccgcgtc caggcgcgga     30960
     ctacagtttt aactcgcttg cctcgcagta ctacgcagtt tcccgggcga atactcttgg     31020
     cggtgtgttc gccggcggga ccggtcaggc gaatgcagag ttcatgaatc tactgttttc     31080
     cgagatggtt caaggggatt taagttgcct tcgtgcaggc ggcgacacct taattcagtg     31140
     ccaagcttcg gtactacaag cggctgaggt cgagcgcaat aaccttcaag cggcggccag     31200
     cgagattcct gccatgcggt acgccggcgc ctttggtaac tacctcatcg cggtcatcat     31260
     cggcctcggg cccgtcatca tcatgttcat gatgttcgct ggtatcgagg ccggcaagtc     31320
     ggtgaagacg gccgcacaca tcatcgtgtg gccgctgttg gtcaataacg tcggcgccga     31380
     gatcgtcaac gggattattt cgatcgacat cgcgaactat ctccaggcac tgcgccaagg     31440
     tgggtggctt tcacaggcca ctacgtacac cgcatacaag gagctgagcc tgcagattgg     31500
     cgtcggctct cacatcatgt cgagtctgcc ggtcttgatg agcatcatct tcggcctggg     31560
     cgaatcgtcg gctatgacaa ccgtcgccac taacatcgca ccacgatcca aggaaacgac     31620
     tgacaacgtc gcgccggcgc cgcaagcgac ccgcccgatg ttcgagggcg gcccggtagg     31680
     aacaatcagc cagatgggac atggtgcggg caagctttcg atgactggta gcgtcgacgc     31740
     ggtctcgacg agcatgaact tcgggaacat ggcacgcgac gcgagccgat cgctcacaca     31800
     gtcggaggta cgcagccaca atctcagcgc aggagagtcc aacctcgccg aatttcgccg     31860
     cgcgttctcg acgggcgatt tcagccgtct caacattgac cgtcaggttg ggcaaacgct     31920
     cgcggagaac tttaacaacg agattcgaag cggcaaagag caacatgccg gaaacgcggt     31980
     gaccggtaca cgcagcaact caaatcgaac gactatcgga gcgggcggca gcgtgagcgc     32040
     gagcctgaag agcggcttta gcgccggtct cggggcacat gccgacacaa gcacttcagc     32100
     ggacgacgcg ctgcaacgca acgataaccg tggccagtcg gacaactatt ccgactcggt     32160
     agcgcttagc agggcactgg caaagactat ggctcagtat tccaatacca gcgccggtag     32220
     tcagtcgacg tctgagctgt ctcgcgcgct gtcgacacag cgcagctatc agcaaactct     32280
     gtcggaagtt caatccgtga gcgacgcggc aacacaaggt gtccgggaga gctcgggctt     32340
     cgttagcatg agcggaaaaa tcggctctga ggaaatcgcg tggcaacagc gagcgaaccc     32400
     cgaatatgcc gctttccaga tgactcaagg gcgccgcttc gaagagaatg gcgcgacgag     32460
     gccgtacctc caaactgctg cggcagacgc ggcgtccggc gcgacgggcc gtctcgtcgg     32520
     cgatcgagcc gggcaagcgg cgattaatcg gcatcgggca gcagtgatgc tcgcgcaaga     32580
     ccagaacgcc cgtcccgaag atcgaatcgc ggccgcgcgc tatctggctg atgaagctcg     32640
     agctatgcag catatgaagt tcgatccaac gaatcctgca ccgatgaacc tcgaaattgg     32700
     atcgccgcgt gatggcactg gcgttagcag tagcgagatc gcaccctttg cgcgtcgcca     32760
     tttgccgccg cccacagcac cggcagcgcg aatcgcgtcc accacttccg cgtcgcccgg     32820
     cgacgacggc gcccatgagg gggccattca tcctcgtggt ggccgcgttg gaaccgtgcc     32880
     ggcctatcgg gggcccggcg cttccaaccc ggtcgcggaa tcccaactgc cgcaagcaaa     32940
     cacgtccgcg cgggctgttc aaccaggttc gaacgaccat cacgcagtac gggccgaaat     33000
     gccactatct cgggcgcgcg agtccaaaga tctcggcggt gtcactggcc gccggtcgac     33060
     tgccgccgac accggcgctg ccgtcgcttc cggtcgccag ccgtccggta ccgcggccga     33120
     ccactccacc tccgcgccac agataccccc ccatactccc aacgggcccg ttcattcgcc     33180
     acgggtcgct ccgcctccag tccccgaaca actgccggca tttggcggcg atttcgaacg     33240
     acagatgcgc gacgaactgg ctagccgaag ggatcgagtt agcgcttcgg tccagtctgg     33300
     cgacactcag gcggccaacg ccgggctcga cgcgaagggg catggcacgg cgattcgcgc     33360
     ggccgcgaac gtcgtggaca atgtcgcgga catcggtcgc acggctggcg ccggctccag     33420
     aaccggtctg gctccgccgg taaatcccca aaagggtcga ccgtcaactc cgagcgctaa     33480
     cccggattta acgcctggaa aaagagggaa ttgaaggtta tcaaagaggg gtcgcgcaag     33540
     ttcaagcggc ctcttccatt ctgtggtagt ctcgttgaac atctacaaaa agagcagggg     33600
     tgcagaatgg cattcttgaa acgtgcggcg gtcaagctcc tggcacttct aaagcgagtt     33660
     tccgctgacg acgattttcg tgaagattat gtcgcgcgcg cccgcaggaa ttccgcaggc     33720
     ggcgatccgc ataatggatt cggcatcggc agccgcggtc cgaataacga ttggggaatg     33780
     aatagccgtt ccggctggtg aatcccaagt tccgttgtga cgttcgctgt aaaagggggg     33840
     tggtttcgca tgcgaaacca cccccttcga tttttggccg cctaccagtc gaaattcttc     33900
     atgtcgggaa tggcgggcac ctcggcttcg gtaacctttc gtaacgcgtt gcggaccgtg     33960
     gcaggcttca cgtcgtacag gtcggcgatg gagtcgatgg tcatgcccga gtcaaagagc     34020
     cgcacccagg tctcgatttt tttctcttgc gcatctttca gagtgacgcc gagcgcctta     34080
     cggaaagacg catggacgct tcggtggcca cgctttttcg cctccgtata ggagaaatct     34140
     cgcttgcggt acaggctatt caggatagac tcggccttca cctcatacat ttcggcaacc     34200
     gtttctagag cgacgcctga ctcgaggagc ctgatccagg tgtcgtaacg tgcctcaacc     34260
     actcgggacg ccggaatccc aagagacgtg cggtaaaggt acacttgcat gtgctttacg     34320
     ccgagctttt tcgctatcaa cgtgtcagga acgcccctgc tcagaccctt agatattagt     34380
     tttttctgtt cgtccgtcag cataagcaca gtcttcgagt gtcgccgcgt ggcgggagga     34440
     tcgctagatt acaaccacat aacagttggt tcggcaagtt ttgccgatca ttctccaccg     34500
     aaactgtaca tggcgggcgc ttctcaataa aggcgtaaac ccggaccctt gacggccacc     34560
     atggggacgt ccaaggtcaa acatcctcgc ccgttcgcgc gaacccagca tggtaccgcg     34620
     ccgcgtgtgt caaagggtta ataagtgtta ataaatgtaa tctggcccat gccgccggcg     34680
     gatgcccggt cggcacttca cttcgccatc gaaatcaacc cgttcaccaa ctggctgaac     34740
     agtgctgcgt cgccagacgt aaactcaggc gttacgatat aggtgcccgc gacggaaacc     34800
     gcgggagtgt ttgtgattcc aagcagcttt tgccgaacga gtgcggcgcg cagctcgcgt     34860
     tcgagttcag tggcgtgatc tgcgacgagg cgggggacgg gaactggcac atgcgcagca     34920
     tgaccaatcc gctcgatgcc cgcccaattc gacgttgata ttcctcgttc ttgagcgcca     34980
     ataaatgacg cctccatgaa gttccttaga taggttgggt agtatttttg aaccgcgata     35040
     aagctcaacg caaactggat gccgtctgct ttatttacca acggagtaaa tttgaaaatc     35100
     ttttgacgcg gaagagtggc ttccaaatta ttgaaaaatt ggaagtaatt ccgggagaac     35160
     tggcaacttg gagagaagaa gacgcgaacc gtttcttctt ccccctctac cggtttgact     35220
     tggaggtagg gtttcagctg ttccattccc gcgggtacct gagcgatggc cggcagcggg     35280
     ccgcagagcc aaaggccgac agcaagggag agaagaggtg ttttgcacca ggcgatcgat     35340
     gtcatgcgac ttctccatag gccgtttcac gcgacgacac gaggaatgct tctagcggtt     35400
     tgtcaccgcc ggcgtccgcc gcgcggtggt agtcatcgat cgcacatgcg acctcgacga     35460
     gatcaaggcc aaactccttg gcgagccgga ggcggctgca cggatagcct ttcgcatcgc     35520
     tgctgccttc caggcccgcg atgcagtcgc gcaggagagt ttgctggctt tgcacggcac     35580
     ggacacctcc aaccgcaagg ggctcgtact ggtcctgttc gcaggctgcg cgataaatcg     35640
     ctgtcacgtc gacccgcttt gcgcgtagca attgtttgac ctctggggta gtgacgatca     35700
     cctcgacaat cgccaccttt cctacgtgct tcgagggcac cacctctctg attgaatcgc     35760
     cgagatcaat cccgttcgct tcaagccaca actgctcgtc gcgggtgagc gcgcgcacga     35820
     ccgactcccc cgcgtaccga tcaatccgcc gtagggagat gacggccttc aacgtttccg     35880
     cgagacgata cgcgtcgcga gccttatctt tcgtcaaatc cagagcgcgc gtataggtct     35940
     cggcgctgtt gttggtgtgc agtgttgaaa gcacgatgtg gccggtctgc gcggcctgca     36000
     acgcgatttc catcgtttcg gaatctcgaa tttccccgac catgatcacg tctggatcgg     36060
     agcggagaat agaccggagt gctcgagcaa acgttatgtt cccgctgacc tgtcgttgcc     36120
     gaatcggacc atttccacgc aaagcaatct ctacgggatt ttcgatcgtc tcgatggcgc     36180
     gagtttcatc gttcagcacc gacaaaattg cattaagcag cgtcgtcttt ccggaccccg     36240
     tcggcccagt caccaagatc aggccacttg gcttactgat cgctcgcatg atcgttcgat     36300
     agactgaata cgacagccca agctcatgca gctcaggggc gcgctgggcg tcaagcagtc     36360
     ggcatatgaa tgcgaagccg ttgaacgtct tcgtgtactc gacgcgaaca tccaccgcat     36420
     acgtcggtgc atcctcaaac ggcctcaatc catgggcttt cgcgaagtcc aatggcagct     36480
     cgatctcgaa ccgagttgat gcgatctcgg gggtcgacgc gccttgcggc gttccagaga     36540
     gttgaagaag ctttgtctcc caatgccggc cttcctgctt cggatagcgg aaccgaaaat     36600
     tcctgaagcc ctccggcgtt cggatgtgca aatagatctc gatagagcca cgtcgatcgc     36660
     gaccggacac gtgcacgtca gtcgactgag tagtaatcgc ccagacgaac acctgccgga     36720
     ttgccaattc aacagaggcg ttctcgttgc ccccctctcg caccatcatg atggcgcggc     36780
     gttcatcatc cgttagttcg tccagccctt cgacgacggg taagcacgca tggacatcct     36840
     gcatctccaa ttccccgcaa gtggcttcca gcacgcgcct cgttgcaact tggcgagccc     36900
     cagaaatata aatttgggta cacttccgaa ctgattataa tttaggtgac acgcgctctc     36960
     aacatagcaa tgcacatcaa cacagtccga gtccgacgct tcgctctgag tcttctagtc     37020
     agcactgcgc tgacaggagt gatggttgcg tacgcgcagg aaaacggaat agagcccggt     37080
     gcagtcaaag ggctcgcgga atcgacgttc agctcgccag ttttcgcaga cctcgtcaac     37140
     ggctaccgca cccaaaacgg atctatcgtg aagagtgtga cggccgacgt tgtcgatcgt     37200
     gcgaaggcac ttcttccaaa ggcgaatcaa ctcggtgaac gtctacgatt tggcgaccac     37260
     aacgtcgtga gtaacgacgg cgagacggtg gtcatgtgga tgattgaagc ggccaacgcg     37320
     accggcgaaa agcgcaaagc gctcttggca aagctcgccg agctcagtgc gcgtggcgtc     37380
     cccgaagcca tgacctttca ggggttcgcc tcggagtacg ggctcttcgg ttttccaaag     37440
     gatcttggtc gagcacttag tctatacagg tcagccgccg cgtcgaaata tcagccggcc     37500
     atctataacc tcgcgattgc ggctggatac ggaaaactgc agcgacccga cctcgcatct     37560
     gcgctcatgt atgcgggtca ggcagcggcg atcgcagccg atgcatcata tagagtgtgc     37620
     gggtttgcgt ccttcctaag ctacaggcaa ggcgaccgtg tgcgcgcgct ccaatacgcg     37680
     acctcatgtt ggtcagacct cgctggcctt tcccgggccc gctacgacgc gcgagcatcg     37740
     ctctccgagc gagtgactct tctacgaaat tcaattagca ccggtatcga tgacggctat     37800
     gcgctcctcg agcaagtgac ccgtgacgcc ggagcagaac ctcaatacct cgcctgtaag     37860
     tacgagcttg tcaacaaata tcgccgcccg accggaggtc gcaacctacg cgacgatgcg     37920
     gttctttgct atcggcgata tacgccaacg gggactcagc gcgaagcttc gatccgattc     37980
     aacaccgtag tcccgggcat catcggtttt gtcccgaccg aaatcgcagc ccttgagaag     38040
     ttgcgtgcat caaacaaatt tcactacggt tggagtgttc cgtatctccc gttccggcaa     38100
     caggatgtgg accttttcgc accatacgtc tcccacgcca agcagtaaag gaccgccagc     38160
     atgcgcaagc tcgccattac agccatcttg agccttcttt ccgcatcctt gtcagctaca     38220
     acgctgtccg gtggtccgca aagcgtgttc atgatcgcgc tggaaaatgg aactgcaacc     38280
     gcgccgctcg acagcaacgg gcagtactcg gttgcgattt cggctattcg cgagaggacc     38340
     ggcgacaacg gtccggttgt agtactcgcg aggcgaattg cgtcgttcaa agaacaaccg     38400
     agatgcggac gtgtcgcatt catcgtcgcg cagccgtcgt cccacaccgc gtggaccgat     38460
     atgggagggg agctcaacat ctgcgacgac ggtaacccac ccctgcgtat ctgtgccgcc     38520
     gaacctagca agctcgttct acctgactcg gcatgcgccg acggctcgac gccggtcgat     38580
     acacctgagg tcgcggacgc gatcaaatcc gccacggctg cagggggaat ggatccgcgc     38640
     gaggcggctc gccgggtccg ggcggccgcg atgcctgccg gcggcgccga aacggagcgc     38700
     ctcaaatgaa ggtattcatc gtcgcgctcg ccttcgcgtt cgctagcacc gcgctcgctc     38760
     agaatgcttc ggatgtcaac aacggacgaa cattcgccaa ctcgatcgcc cccacatccc     38820
     agacccagat cgtgaatccg gccggcgtga acgcgagcgc ttgggctggg caaaccaaca     38880
     tgccgactag tgtcccatcg ggctttgccg cattttcaaa cccgaacaca agctcggctg     38940
     cgctgatggc cgcgcgaggt agtagcctca ccgctctcgg caaccaagct caaattgatt     39000
     gcgcggcctt cgtgccaggt aacgacccat accagaatca gtattgtgct gcagttaact     39060
     tcctgaacaa tcagtgcatg cagccgacta caggtcaaaa gtcggttctg ggcaaaaccg     39120
     gacagacaat ctcgagcaac gcaaactgtg cgggaacgtt cggcgccggg caatcccagt     39180
     tcggctacgg agaccaggtg acgattgatg accccatgtt caaggtgatc cttggcctcg     39240
     gggatagcgc gcgagacgcg ctctcaacga tttgcacgcc gaaaaccgtc gtcacgcaac     39300
     cggcgcagta cgaaaacaac acgtgtgtcg tctctatcga caaagaagag aacggctgct     39360
     cgcaatactt gaatgcgacc atcacgaatt caatcagcca agcgctctct gtcgaaagct     39420
     gcccggacgg catgacactc caaggcggaa tgtgcctcca ccaggtcacc tacacgccgt     39480
     ggatctcgtg tcctgcgggc tacattcaga gcggcgcaaa tcgcgaccag tgcgtgcaaa     39540
     tttcgaatct tcaaggtaca ccgtattgcc ctggcggctt cgggacaggc cataccgata     39600
     acggaacgat ggtgtgcgtg tccatgtcgt cttatccgga tccgccgcca aacgtcctca     39660
     acaacatgcc tttgattgat cgtggcttgt gtattggagg cagctgctac aacccgtcct     39720
     atttgccgct ccagtcctgt cccgatggct ataccttcga cggcactcaa tgcacgaaga     39780
     ccaccacggt cggcgcgacc tacagctgcc cgaacggagg ggcactgcag ggtcagactt     39840
     gcgtgactaa tgactcggct aaccctacgg tgacatacag ttgcccgccg gggcaaaccc     39900
     tgaatgggtc gaactgcgtc aaacaagtgg tcaagacgag ttggaccgat acctgcaccg     39960
     cgtatgagca gagcgccggc gtcgctctgc ctaccccggc gaactgagga accaccgatg     40020
     ctgattaccc gtattcgacg cctcttcact tcgctggtcg tcacggtgct ttcccttccc     40080
     ctgccgacaa cggcacaaac ctatggcccc ggcgcatgtt cccccgtccc agggtcgcag     40140
     acttgcatcg acacgacgcc gtgcaaaacg tcaggcactg gtcagcaaat ttgcctttcc     40200
     actgcgacgc cgcccgcagg cgcactgcag gtcccttata gctgctggca gtactcctac     40260
     agttacgctt gcaccggcac caccgtcgac acctgcggtc agtaccgcag caactcagcc     40320
     tgcggcgtgg tcggtagcgt ttgcaatgat acgatcgccg aaactgggca gtgcgacgaa     40380
     tggacgtata cctaccgttg tcaaaccaag gccgagcaga ctggccaaca gatgaattgc     40440
     tcgaacggtc tgtttgacaa cagcggcttt ccgacgccgc cgaacaacaa caactcgttc     40500
     ctgacgggag caatcgggct cgaactgctc ggtgaggcac agaagtacac cgacggcaat     40560
     agcatcttcg ccggggtcga ggaaagctgc agaaagggtt acgaaggaat ccagaattgc     40620
     tgcaagagta cccctggcgc gcaatcgaac aacatggtaa tgacagcggc catcggcgca     40680
     gctggttcgg tcgccaagta tgccggcgag aagctgattg atctcgcgtc gccatacgtg     40740
     ttcgacgcga tgtatacgaa cggaattttc tccgaggcgc tgacgcagaa cttcacgaca     40800
     gcattctctc ttgatgcggc caatggcggc ggaacactcg gtactcaact cgcttctggc     40860
     ggcatacagt tcggcgtata tggtttcacg gtcgggttcg gaacgatgac cccagggctt     40920
     ttcggcgcga acatgcaact ggcttccttc ggctccaacg gatacctcgc gtttaaccca     40980
     tatgtcttcg ctgcgatggt tgcaattcag gtcatccaag gcctatcgaa gtgctcgcag     41040
     ggcgagcagc tcctggcgct tcataagggt gccggtctaa gcacgttcat caaagaggag     41100
     tgtgccaaga aggcgctggg tgcctgcgtt caatacgtcg acacctattg ttccttcaac     41160
     tcgcaactcg ctcagatcat caacattcaa gggaagacgc aactgggcct tccgcttgag     41220
     ggttgcagtg gcctgactcc ggaccagatc agcaagatcg atttcaagaa gattgacttc     41280
     agtgcattct cgagccagat gatggatcaa gctatgaaag gcctcccgaa aaatatcacc     41340
     gggaattaca caccgatcat gcagaacact ccgagcggat cttcccaaaa gggcggctct     41400
     gccgttcttc cgacttactg atataccaac aacgagacca ggaccttcat gaaagccaaa     41460
     gtatttgtga aacgagcgat cttcactgtc ggaatcatca cgctgcttgc gtcgctcggc     41520
     gcagctgcaa tcggttacaa gctgaacgtc aatttgagca aacggaacgc ggagcaggcg     41580
     cgagaaatta gcgcactgaa ggaggacgta cggaagctag gcgagcgtct gtctaccagc     41640
     gacgccgagc tcaaagggct tcggaaccag ggggacgcca accaagcgga actcaataaa     41700
     ctcaaagaca acgttgatgc attcgctacc caagcagctg cgtgcgagac cttgcgccgc     41760
     tcggtgaagg gaggtgcata gcgtgccgcg cactgacacg ttcatcgcga cgatcgccgt     41820
     tgcagcgtcc tcggcgatcg gcagcgcaat ggcctgcgca tcgcctgtcg agttcgatac     41880
     agcatccgcg cacgtcatcg tcgcgcgtcc gatcgacagt tggtctggcg actcatcggc     41940
     gcagaagcac tccctcgagt cgctccgcga gcgcaaggtc tcctacgacg tgatattgga     42000
     tggcacccgc tatcgcggca gtccgctcat tctgcagggc ataagcgaca acccgataac     42060
     tcgcggcgta gaggcaaccc tcgccgagga acggatcacg cttgtgcgga acgcgcccta     42120
     cctcttccac gtcctcgacg tggctacctt cgcggccgac gcatacccga ccttcgcacg     42180
     agctcaggcc gagtactaca ggcgattcgt agaaagagcg ggggacccac gtaccctggc     42240
     aacgcggtac aacatcaaag ggatgatcgg caatgccctc tctattggag cactgttctt     42300
     accgaccggt agcttgggcg ttgcaaatgg cgctcaggtg atgatgaatt ctggtctcgc     42360
     agaagacatc ggcaagcttc cgcgcggttc gcgcgcggcg ctggtcccag tacgtttgcc     42420
     ggacctcgat ccggcggcat atcgacaaat cgatgtgcgg cgagtcgaat tcaaacccga     42480
     cacccccgga gaaattgtta tcgcatacaa gggggaaaaa accccagagg ccgaggctga     42540
     agccttggtc cgtgcaatag cgattgtcgc gggtgctcaa accaccgctg atgccgtcga     42600
     atcggcgcgg cgggccgatt ttcaagagcg cgtctcgatt tgggacgcat gtgttaatga     42660
     aggcaagtgc caaaatggag gccaacaatg actgactcga ccaagcaaca aaagcccgta     42720
     cccaaggttc tgcggaagaa tggactcctg acctgggtcg cattcgtggc aatcctcttg     42780
     gtcctcgcca actcgttctg gaagcatttc ggctaacgct gatagcccgg tctgcagctc     42840
     gcgggccggg cgcgcctcat gcaggaaccg tgtcgacgag gatcgacgcc cgacgagagg     42900
     gcattcggcg aggcgctcag tctgcaattg gtgctgcggc atgtcgatgc atggacagga     42960
     cagataacgc gatggcaagt gacgctcata agcggttggt aacgctcggc gaacgatggc     43020
     ttaagcggga aggtttttca gtcgttgcga ccgagctggt cacaagcggc acgcgcgagc     43080
     aagccgatgt gattggtttt cgatcgaact gctctgcggt gatcgaagcg aaggcgacgc     43140
     gatcggactt tttggccgac gcgcggaagc cacatcgcat aagtggcggg ttgggcgtgt     43200
     atcgattcta cctttgcccg ccggacgtca tcagagtatc cgaattgccg gtgcgatggg     43260
     ggctgttgta tgcggaccgc cgtggcgtcc gcgaagtcct tcggccgaca ggcaacggat     43320
     ggccatcgtt tcgatcgacg atcggcgatt ggcccgcgtt tcaacacgaa ccagacctag     43380
     aagcagagcg cggcgtcctc ttttctattg cgcgccgacg ctcactttcc cgttctgacg     43440
     aattgtacga acggaagttg caggacgcga cacgtcgcgc agaccggctc gcacgcgaga     43500
     acgccgctct ggcggagaac atacggcggc tggaactcgc gctctatctg gctgagcgcg     43560
     gcctcaatgc cggtgtcccg gacgcgcacg aattaaaatc cgcgatacga cggaaggtgg     43620
     catagcgttg tgggccggct aagttatagc ctcgttgagc accaactgaa tgaatcggag     43680
     acgcaagtta acgcctctga cgcacgaagg tcgcgtccgc gcgagggacg gcttgccgat     43740
     cggattgatc gaagatcgct agagattgca tagctcggaa agcggtacgc cgcattgggg     43800
     gtatagatga cacgagtaac gtggaagcaa acggtgcgag gcgcggaaat ccgcctggtc     43860
     agtaagatca aagccatcga ggggtggcgt aacttgtgga tgacaccgtt ctacgcatgg     43920
     ctgcgccgca gtgtgctgca caaagaggaa gcttggatcg ttgcagagtg caaactcgaa     43980
     gcgctgcgta tgcgccacga tcgcatcgta cggcgctatt cgcactttta gtaagtttga     44040
     gtgagggaaa taatgacgat ccgcgtgatc gaaattccgt tcgtccaact cggtgccgac     44100
     aggccggagt cgcagaccaa tgcagcgatc gatgcgctga attctgcgat cgcgcgtgac     44160
     ggccttgagg tcctgtcggt cgagacggtt acggttccgc ggttcttgtg gcttggaacc     44220
     aaggtggtcg gtatccgcgc atggtgtcgg acacaatagc gcattcctat cgaaaacacc     44280
     gataaattag tttatgtaaa atggggccct aactattgtt ctgccgctcg ccttcgttct     44340
     cgccactccg ggcacgcaga cgtctcggga cgtcaatttc tgacacaaac agatctgcaa     44400
     agtggcgggc acccaactct catattgcaa tgaaatgacg ccgctcacta tccaagctct     44460
     cgtcactgtc gccgcaacgc tcatcgtcct ggttatcggg gtgatcgggg taaagaaagc     44520
     cgatccgctc atggtacttg gtgcggtgtt cctcgcaatc ccaacggtag gtcttggcta     44580
     cggggtctgc cttcgagcgc tcgctgccct tattggatag gtcgcgatat gcaccgattc     44640
     gagggtcgac tcgcttgccg cccaagggta cgcgaggacc gacccagcaa ttcagccttt     44700
     cgcggtcgat gcgagggtgg cgtggaccgc ggggttcgtt cgccgactgg gtcgcgaaag     44760
     cagcgccgat ggcggtggag tttccggcac caaacgtaac ggccgggcgc aaatgtcggt     44820
     cggaccgctt cagtatcggg tactggcgct ctgccgagtt gggcatgggc ttctttttgg     44880
     cgactgactt caacgagatc gacgatcgcc tcaacgttgt aacgcccatg ctcttccaca     44940
     gcgccgcccc catttcagtt cacattgcga cacaaagctt cacggttcgg cgccgcccgg     45000
     cgtacggcaa gagagagcgc gttgctggct cgatccaaat tgtcagaatc cgtaaaacgt     45060
     ttgcgcgaga cttccgtaac ctctcgtttt cccctaaatt agcgatgcct caggccgtcg     45120
     gcctggccgg cagaacctga gacgaaggaa gaacaatgag tttcgctccg aatggcggtc     45180
     ttccgaccgg cctcggtggc agcccacttg gggctttgac gccgatcagc agcgccctgg     45240
     gcggcctcgg cggctcgctc gcctccggcg tcggcggcca gctgggcccg ctggcgggct     45300
     tggccgggca cgtcgacacc ctgcagcgcg cgacgcagct cgcgcagacc ggcttttctt     45360
     tgatggagaa gacgccgggg gcgatcgccg cggcactgaa caacgcgacc ggcaccgcgc     45420
     gcctgacgca actgaaccgc tacgcgacga tcgatacgcc gctcggcccc gacgtgctgc     45480
     tcctcagcgc cgcgatcatc gatgaacacg tcaatcgcct gccggaaatc cacctcgacc     45540
     tgctgtcgca ccagcacgat ctcacgccgg atcaactgat cggccagcag gtcaagctca     45600
     agctcgacca caacgcgcga cagtccacgc tcgagcgcat tgtcgcggcc ggcgcgaccg     45660
     acaacgaacg ctacttcgac ggctacgtgt ccgcgttcga ccgcgtcagc caccccggcc     45720
     gcgtgaccca gtaccagatg acggtggtgc cgtggttctg gttcctgacg cgctcgaccg     45780
     actgccgaat tttccagcac aagactgcgc aggacatcct gaacgagatc ttcctggaac     45840
     acggctttta cgacttcgtg ttcgacattc gcaccgagca aaagccgctc gagtacatcg     45900
     tgatgtacca ggagtcctat ttcaatttct gcacgcgctt gatggagcag gaaggcttga     45960
     tctggacgca ccgctacgag aaggacaagc acttcctggt catcggtgac acgaacttgc     46020
     tgtttcgacc gatcgacggg ctcgcgaccg taccgtatgc agccagccaa tcaagtgagt     46080
     tcaacgggat tgaccagttg tacgagggcc gtcgcttcgg ggtcggcaag gtcacatacc     46140
     aggatttcaa tcaccagaat ccgtcgtcgc cgctgatgcg agtcgaagcg agcccggaga     46200
     acttgaagca cgcgcggctc gactcgaccg agcgcttcga gcatcagtcg ctgtacgacc     46260
     acggtgacga cggcaatcga tatgctcgtc tggccatgca agccgaggaa gcgcaggcgc     46320
     accgctatgc gggcggtggc tatgcgtggc ggatgacaac cgccgggtgc gtgacggtca     46380
     ccggtcaccc agtgccggcg aacaaccagg aatacgtaat cctgcacgtg cgccacgaag     46440
     tcgtgaacga ctacacgcag cacgaaacga aactccccta tcgcaacagc ttcgcgctgc     46500
     tgccgaagaa aatttcgtac cgggcgccgc gtatcacccc caagccggtg atccacggca     46560
     cgcattcggc caaggtggtt ggcccgaaag gcgaggagat tcacaccaac ggcagctgcg     46620
     tgaaactgca cttcccctgg gatcggcgcg gcaaacagga cggctcggac tcgatgtggg     46680
     tgcgggtgtc gcaaccatgg gcgggcgatg gctggggcgc ggcagcgatt ccgcggatac     46740
     accaggaagt gctggtcgcc ttcaatcagg gggacccgga taatccggta gtcgtgggcc     46800
     gcgtatacaa cggcgagcaa agcaatccgt accacggcgc cggcggtcaa actatgggga     46860
     tcaagagtca gacgcacaag ggcgcgggct cgaacgagtt gcgtttctcc gacgtgaacg     46920
     gccaggaaga gttcttcatg cacgcgcaga gggacatgaa taccgtggtc gagaacagcg     46980
     agacgcacaa ggtgctcggg ccgctgcgca ccgtcctgat cgcaaccggc agcgaagaaa     47040
     agcagattcc gcagggcaac ctgaccgaga cgatcgccga gaagcgcagc accacagcca     47100
     ctaccgtcga agtgacgacg ccggcgaagg acggtggcgg cggcacgcag gtctacatgg     47160
     ccgagcgcgg catcttgctg aaggtccagg acagctcgat ctcccttgca ccggagggca     47220
     tccgcctcga gcacaagggc tccgtgatcc tgatgaccga cgacggcgtg atggtcaacg     47280
     gcaagcgcat cgacctcaac aagtaatcga acacgcacga ctataacctg ccatgcacta     47340
     cgctatccac gaagggacct tcgacttgcc ggacgcggcg ctcgaccgca ccgtcaacat     47400
     gctaattctt ccgatcggga cgggtggctt gagcctggtc gtgtcgcgcg gccgattgcg     47460
     cgacgcggag tcaatcgacg ccttcgtcga tcgggaatgg ggactggcgt cgcgcactgc     47520
     caaggacctc actctgcaga cccgacggcc ggtgacagta ggacggaacg agtgcccggg     47580
     cgtccagaca gaatccacgc acgaacagga cggtcgcacg tttcatcaac accagacggc     47640
     gtttcagctc gacgccggtg gccatgtgat cgtcatgacg ttgaccagcg cggcgccgct     47700
     gaccgacgaa cagcgtgcgc tcgcgaaccg gatgctcgag agtttcgagc cgcgccctca     47760
     cgaccccgcg gcgccctcgc tcgtttccga tagccaccgc ccatgagtca gcccgccgcg     47820
     cgcaaggacg acccgttcac ccacactacc ctgatgggtg acctgattgg catggggggc     47880
     tcgctgctag ccggcatggg catcggctgg ttgctgactg agggcgccct gcttgctgcg     47940
     gccgccgtgc tcgaagtcgg cacggccggc ctggctacgc cgctggtgct cgcgattggc     48000
     gtgggcgttg ccgccaccat gcaggcctcg gggctgaacg acaagatcga cgaggccgcg     48060
     aaggggctcg gcaatgcgat ttcaccgccg caagaaaaag gccacatcaa gagcggctcc     48120
     ccggacgtgt tcatcaacgg cgaacacgct gcgcgtgcgg cggacggcgc cgacatggat     48180
     accgtcgaat gtcaggacca tcctggcccg cagatgatcg cgcagggttc ggagagcgtc     48240
     tacatcaacg atctgcccgc cgcacgtgtt gacgacaaga ccacctgcga cggcacgatc     48300
     tccaaaggat cgcccaacgt gttcgtgggt ggcggcacga aaacggtacg cgacatcagc     48360
     gcggcgcggc cgtgggttgc ctggctcggt atggcaatcg gcattgcgct cgcgctgtgc     48420
     gggcgcggaa atatgaagtg gggcaacctg aagggcaaac tgccgtgcct cgggatcggc     48480
     ctgttggccg gtctcggcgg caccctcctc ggcagtctga tgagaggcca cccggtcaac     48540
     gtcatcaccg gcggcaagat cctggacggt gctgacgaca ccgacttcga actgccgggc     48600
     ccgctgccga tcgtctggcg gcgcttctac agcagtcacg acgatcgtgc ggacagcctg     48660
     ttcggaccgg gatggagtgt gccgatcagc gtagagctgc agcttgtgcg cgaacgcggc     48720
     gaagtcgtgt cgatcacgta ctgggacgaa caaggtcgcg acatcgtgta cccggccgtg     48780
     tcgcccggtg aaagctacta cagcgtgccg gagggcatgt atctgatctg cactgcaggc     48840
     ggccactacg tggtcgaaac cgtcgacggt ctctatcgcg acttcgggcg tgcgcggacg     48900
     attgcggaca ccgagacgct aaagctgcgg cgccttgagg atcgcaacgg caactggatc     48960
     gaagtgacgc acgaaacggc cggcgacgtc atccgaccgg cccggttgca cgacagtgct     49020
     gggcgcctgt tgacgctagc ctacgacaat gcacacccgc agcggatcgc cgctgtcgag     49080
     ctgacgctcg gcgtcgacgg cgaacaatct gagacgctgg tgcgctacgc gtataccgac     49140
     gccggcgagt tggccgccgt aaccgaccgc agcgggcata ccggccggaa gttcgtatac     49200
     gagcacggcc tgatggtcca gcatacgctg cgcggcggct tgaagtgctt ctatgcctgg     49260
     cagggtacag gccgcgacgc gcgcgtggtg cgccactgga ccgacgacgg cgaagcctac     49320
     acgttcgatg cggatctgac ccagcgcgaa gtgacgatca ccgaccaact cgggcgcatc     49380
     acgcggtgga cgtggaacga ggatcggcag ccgactcatc acgtagatgc ggaaggccac     49440
     gtgtggctgc tcgagtggaa cgcgatgcgc caattaatta gcgcgaccga cccagccggc     49500
     catgtgacgc gcttcgaata cgacgaacgt ggtcgccaga ccgcgcgcat cgacgcgctc     49560
     ggccagactg cgcgcaccga gtggaacggt ttttatgacc tgccggtagc agaaatcgac     49620
     ccgaccaatg cacgctggat ctaccgttac gacgcgcgcg gcaacctgac gatgacgcgc     49680
     gatccagcgg gcttcgccac cgagtatcac cgcgacgagc gcggcctcgt gcacacgatt     49740
     cgcgacgcgc gcggcggcta caaatttctc gcatggaatg cgcgcgcgca gctgacctcc     49800
     tatactgact gttcgggcaa gaccactcgt ttcgagtacg acgcgcgcgg tgcactcgca     49860
     cgcgtgaccg atgccgccgg ccatgccacc gtgtacgaag ccgatgcgat gggtcgcgtg     49920
     acggcaatag cgaccgccga cggcgcacgc cagacgtttc attacgacga cgccggccgg     49980
     ctagtcgaag tcgtcgcccc taaccagcga cgtacacgct acgaactgaa tccgcgcggc     50040
     ctgctgctgt cgcgaaccga tgcagcggat cgtgtcgtgc gcttcggcta cgacaatgcg     50100
     ttccggctcg caagcctgac caacgagaac cgcgaaacct atcgcttccg ctacgatcgc     50160
     cgcgacctac tgatcgagga agtcgggctc gacggcaacg tgcgcgcgta cgaatacgat     50220
     atgcgcgggc tgggcatcgc gctgcgcgag ggaaagcgcc agaccatatt tgaacgagat     50280
     gcgatcggtc agctcgtcgc caagcaagcc gcacgcgagc gctgtgaata ccgttacgac     50340
     aaggcgggtc ggatcgcagc gggcgaactg tacgcgctca cgggtcgcaa accgtcgctg     50400
     aagaatcgcg ttaccctaaa atacggctcg cgcggcgagg tgctcgagga gtacacgccg     50460
     accggatggc tggcgcacac ctacgacgag ctcggcaatc gcgtcagcac caccgtctcg     50520
     gggcaacaga ccatcgattg gttgcattac ggctccggac acgtgcacca gatccgcgtc     50580
     gacggcgccg cgatcgccga catcgagcgc gacgatctgc atcgggaggt gctgcgcacg     50640
     cagggcaaac tgaccagcca gttcggctac gacgccgttg gtcgccgcgc gcgagcggcg     50700
     gcgcagcgcg gcgcatcggc ggaagtactg ctcgcaaagc agtggcaata tgacgcggcg     50760
     ggcgacgtcg tccagaagcg tgatcagcgc tacggtacga cgagctacag gtacgacccg     50820
     accggccgca ttgagcaggc gacggggcca ggcctaccgt ccgaggtgtt ccgctgggat     50880
     gccgccgcga atctggtatc gagtgaccac ccgggtggat acgtcgaata caaccggctc     50940
     aggatgttcg acgacaagcg cttcgagtat gacgcgtacg ggcggctcgc gcgcaagctc     51000
     agcggccacg gccccgccag agagcagacg ttcgaatacg acgactggaa tcagctgaag     51060
     accgtcgtga cgaaggaccg gctcggcgtg tcgaccacgc acttcgaata cgacgcgttc     51120
     ggtcgccgca tccgcaagct caacggcagc tactcgagca cggatttcct gtgggacggc     51180
     atgcggctcg tgcaggagac gtatcacgac cggtgcggcg aagaggcgct gacgtatctg     51240
     tacgaagcaa atagctacgc cccgctcgca cggatcgatc acgctgcgcc ggcggccaac     51300
     gacgcggagg ctcgagatgc tgtctattat ttccataacg acgtgtctgg attgccggag     51360
     gaactgaccg acgctgacgg cgagctggtc tggcaggccc gctacaaggt gtggggcaac     51420
     gcagttcagg aggagtggat cgcgcgtgcg ccgcagcaac ctgcggctgc atggggggaa     51480
     gtgcaaacgg cggcgacacc gggccacgtg ccgcggccgc agaacctccg cttccagggc     51540
     cagtatttag accgcgagac cgggctgcac tacaacacgt tccgcttcta cgatcccgat     51600
     atcggacggt tcatcaaccc cgacccgatt ggtctgaacg gcggccacaa cttataccgc     51660
     tacacaccta atccgatcac ctggatcgat ccatggggat gggcaggatg tacgctgacc     51720
     aaagccaaat cgaaggacta tgattacact ctgcggttga agcgatccga atatccccag     51780
     acgttcgggc atatctctga tgctatcggc aatggacacg cggatatcgt gaccgttcag     51840
     agaggcagcg cgaagctgaa tcggaagctc agtctggccg gcataaagac caaggccggc     51900
     atggaccgag acgagtggcc gatggcgatg ttcaaggaag gtggtgatgg cgcaagcgtg     51960
     agatatattg acccaagcga taaccgcggt gccggatcaa gcatcggcaa cgcgttgtct     52020
     gatttgccag acggaacaag agtaaaggta gaaattttcg atgagtgaca atctcagcca     52080
     aacggttgat ctccttattt cccatagtca gattctggtg cggtctcgac cctatgacga     52140
     aggtttgagc caatggggaa cgggaaacat tgatcagggc gcggtcttgc atgccgacta     52200
     cctcattttt gacccgcttc cggacgatgc cttcggcgca aaggtctacc tgcaagtgct     52260
     ggacaagttc gagatggacg agcgggccgc tcggtgcatc gttgctccct ttcatattac     52320
     ggatcgtaac gcgctcgaag tcgcttccgc gaccgaaaaa ttcaaaatct cgctgcaact     52380
     accgcttaat gcttacgacg tgtattacga ggtttgcgaa ggcgacgaag ttttctacaa     52440
     atttacgttt gtctcagaag ccaagcatca tcaagcaaaa tatttgcgag atgatccctg     52500
     gggtgggaaa aaagacatgc ctcttgtttc tgggaagttc gatagatagt tcgccttatc     52560
     ggtgtctgcg atatgagcag agctgatcgt tctgacgcag ccaaattgga cgccagcctc     52620
     cgctttcggt tggctgaagc attgagtaaa agtgcgctcg ccgacgatcc gcgttatgag     52680
     cgcttgcctg ctttcgtccg cttccgcgcg acaggcgcgg ccaaagcgtg ggaagcgtgg     52740
     cgccgggtcg tcgaacaggg gccgaacaac gtatcggaga tgctgcgcac acgctcgatc     52800
     gttgcactgg tcaaccagtt tgacgagctt gcaaaacggc tgcttccata cggcaccccg     52860
     gaaatgatgc cggacgaggc cggaacagtt gcagcgcata gtgcgatctg gcaggcgttc     52920
     gacctccgga acgggttgat tttcgaaccc actccgcccc tgcatcgcct gctcgacgac     52980
     tcgtacattt ctgacgatgt gccgatcggc gccgtcgagt ttcccgccga cacactgtgc     53040
     atcattccgg agccctcgtc ttggggtcaa ggggagcgta gtgacgccac agtctttttc     53100
     aggaacgggc agaccttggg ctgtgccacc tggatcatgc gccttcacga cggccagcga     53160
     gacgcgacga ttgacgttgt cgagctgccg ttggacaagc cggatcggac catcggcgcg     53220
     ttgctcgacg aggtttgcgg atcgtcgaaa acctatcaaa cgctccgcgc gtatctgcgc     53280
     gaatcaatcg actatgcgga tttcggcgat ggtgatcaat cgtttcggcg aacgtgatca     53340
     gtctggaagg tggtgttgcg cggtcaatgg attatagcga cggtgatcac gatcaggcgt     53400
     cagcggactc ggatttcgtt ttctttctca tcgaatcgcc cttgaccgga agcttgtggg     53460
     cctgatgcac gagccgatcg agaatcgcat cggcgagcgt ggggtcctgc agccacgcgt     53520
     gccagtgttc gagcggcaac tggctggtga tcacagtcga gcgcgtaccg acacgatcat     53580
     caagtacctc aagcagatca ttgcgcgccg cctggtcgag atcctgcaag ccccaatcgt     53640
     cgaggatcag cacatcaatc ttcgcgagtt gcgcaagccg acgtgtgaag ctgccgtcgc     53700
     cgtgcgcgat tttcagctct tcgaacagcc gcgcgacgcg cacatagaac acggagaagc     53760
     cctgccggca cgcctgctgg ccgaacgcgc aagcgagcca cgtcttgccc gcgccggtgg     53820
     ggccggtcag gatcaggttc tgagcattgc gcacccagtc gcagccggcg agcgtggcga     53880
     cgatgcgctg gtccagccca cgggtttgcc ggtattcaat gtcttcgacg caggcctgtg     53940
     ggttcttgag cttcgcggcg cgcagcaaac gttcgagtcg tcgcgtatca cgccaggcca     54000
     gctcgcgatc tacgagcatg cccacgcgtt cctcgaatga caggctggtg cttgccgtga     54060
     gcgttgactg ctcctcgaac gcgcgagcca tgccgtccag tttgagcgcc tttagctggg     54120
     taagggtgtg ctgcatcaac atcgtgacct ccttcgggtc agtggtagta gtcggggccg     54180
     cgcacgttct cgtgctcggg cgagcgccat tcggcgggcg tggtcgggag cgagggctgc     54240
     aggtcaagtc ccgcttccag gattgacagc acggagcgac gcgtgggcga gccgatcttc     54300
     aatgcacgct ggcatgcggc ctcgaggcgg tgtttgccgt acttgcgcgc gagcgagaga     54360
     agaccgagac aggcgcgata gcccatctcg gggtgaggtt tgttggtcag cagatgccgc     54420
     acgacagcct cggcgccggg gccgacggat gcgccccagt tgagcaggcg cccaggcgtc     54480
     cattccatgt gcgcgcgatg cgcagccggc atgtgttcgg cgatggtcgt gtgtttgcct     54540
     ttgaggcgcg agcgagcgtg cgcagcgaca cgcttgccgc catgcaggat ctctacgccg     54600
     tggcgtgtga tacgcgccca gacctcctgc cgtgcgaggc tatgcgggac gctgtaatag     54660
     tggccgccga catcgacgtg gtaatcgatg ttcacacggc acttctggaa ggtggcgatc     54720
     tcgtagcgac gcacgggcaa cgggcgcagg acgggttggt ccagccgttc gaaccattca     54780
     cgccggttgc cttcgagccg cttgaacggg cgctggttta ggtcggcgat cagttctgca     54840
     atcgccttgt tgagttcagc cagactgtag aagcgatagt ggcgcagtcg ggccagcacc     54900
     cagcgctcga cgatctgcac gccgacttcg accttggcct tgtcctgcgg tttgcgcgga     54960
     cgcgccggca gcatcgcggt gccgtagtgg ttcacgaagt cctgcgtggt cgtgccgagt     55020
     ccgggttcgt aacggtcggg tcgcgcgatc agcgccttcg ggttgtcggg cacgagcagc     55080
     tcgggcacgc cgccaatgaa ctctagcgca tcgcacaggc tgccgatcca gtccgccatc     55140
     gtctcggtgc gcgtcgcgca cgcgaacgtg tagttggatg cgccgagcac ggcaacgaac     55200
     acgtgcgcct cgaactcgac gccgccatcg ctcgccagga ccggcacggt gggacccgcg     55260
     aagtccgcga acagcttctc gccggcgcgg tgctgctgac gcatcgagcg cttgatcgac     55320
     ttcgcccaat ccttgtactt ctggcagaac tgcgtgtagc ggtacgtccg ctggccgggg     55380
     ttcgcttcag cgtattcttc ccacagcagt tgcagcgtca cgcccttgcg gcgcagctcg     55440
     cgatgcaatg ccgtgtagtc gggctcgatg cgtcgcgtcg tcgtcgccgc ggcattggtt     55500
     gccgcaggcc tcaggcgcgc gtccagttcg tcgtcggaca ttgcttcggc tgccgcccaa     55560
     tcgagtcccg cctggctggc ttgggccgcg aacttcgaga cggcaccgac gctgatgccg     55620
     atagcccggc tgatctgccg atgcgtcagg ccacacgccc actttagtcg caggacttcc     55680
     ttcaatttgc gcatgctcat ccgaggtgtc ggcatcggca cttctcccgc aaaaaaggga     55740
     gcaggctaac gccgtcggtg aatacatgcg caacgccacc gccagactca aacccggatt     55800
     acgttccggt tacgtgatca cccgtttcgg tcccgtgatc gctcattccg gcatcgtgat     55860
     cacgcgtttc ggaaacctgt gatcagcgat cacgatcaac cgaaacgggt gatcacgatc     55920
     attcggaatc catgatcacg atccgccgaa atgcgtgatc acgttcgccg gaatacgcaa     55980
     tcgactacgc ggtcaagatg ctcctgtatc tcaaagcccg cgacgcaaac gtggtccatg     56040
     agcgccccta ctccgatgca ccgcgatcgt tccctgggct aggtcagcga aagcggaacg     56100
     agcgcctagc cgaaatcgac atgctctacg atcggcacct tatcgggcct gcgattcttg     56160
     atgtcgactc agcaggcagt gtgccgacgg aagcttcggt ccacgaagta cgcggtcact     56220
     ggcgccgccc gcatttccgg atgcaaccgc acggtccgca ggcatcgctg cgcaagctgg     56280
     tcttcattgg cccgacgatc gtgcggcccg atcgccttgg tcttttgtga ttgctgctga     56340
     ggtagtgtca cgagcgagca cgatggaaag cagaaagtgt ccgctgcgac gcacctgtcg     56400
     accggcttga ctagagagat gtagttgccg ctgcggacta aaaagttgcg gacgctgtcg     56460
     ctcgaacccg gagatgagca tcaccgctaa tggccggttg caccggccgc cagattaaaa     56520
     gcctaacaag tttccagggt cgggtgaacg ctccaaggtt cgctcggttt ccaccgaacg     56580
     agtcggtgct acctcaatac tccgagtagc accgtgcttc gccccttggt cagcactctg     56640
     atcaagggaa gactcagccc gttcaaactc gactgctgtt gtcttgccca cttccctacc     56700
     ggcgttgcga agtagcgtat ccaaatccga ggtgatgatc tcggtgttgt ctttcgctcg     56760
     cgacgcagca acatacgcgg cctcacgatt gaacacgcgc gcaccgatct tgctgaccgc     56820
     cacaatttcc cggtggttcg tggccccttg ctccttgtac gacgtgtgag cgtacgcatg     56880
     atccacaaac cgcaggtcgt cgttctttag gtccgactcc tttccatctc gataccatcg     56940
     aatcttggca ccaaggctgt cgatcgcgac aataacgcct tgcgtgccat tgtctagccg     57000
     attcaactcc tgacctggaa ggcgtatgat cgccctggtt tcgactcggt cacctacggc     57060
     gaaaacgcgc gactcttgaa tcgccgggga aaagtagtct tggcgttgag ggttaatctc     57120
     caccgacttt cctttggcat tcagcgcata gatccggttc ttctggacgt catacccagt     57180
     cactgtgagc acgtcgcctt tttcaacgcc gatttcgcgg tagctctttc gatagatgag     57240
     cgcatctacc cgatttcgag acagcattga tgcgtagcgt tgctcggcgc cggtcatctt     57300
     cgggtcgtca aggtgtggct tttcgaagtg cgggccgctg atgatcccta catcggtcaa     57360
     agcctgatga acagcggcgt ttatcaattt ccggtcgctg ttggtgatcg cgaccacacc     57420
     gaccttcggc gcatcgacac cctttgccgt caattcctgg aggttctcca ggtacctctc     57480
     cgctacagtt tttgcaaggt ctgattccgc tacacgcagg gtgtcgagac gcgcgatcgc     57540
     ctgtgcgtag ttccccgcct tcatgtccgc gagggcttgg cgtgtttgcg cggtagcgtc     57600
     ccgaaaacgc cgcgtctcct cgagaattga cacgttcatc cctgcgatct gcgcttgttc     57660
     gaacgcccga ccggctgcaa cactgccgtg ctgcttcacg tcgccttgca ggacggtccg     57720
     cgcgccgatt tcgcgcgcga atcgtaggag tttctccgtg tcgtccacgc cggtcaagga     57780
     cgattcatcc atcacgatca gagtcttctt tccgtcaacg ttcccgtacc gccgaaggtt     57840
     ttcgagcttt gcctgcgtcc gagcgtattc cgcatcgagt tccgttgcgg acccttgccg     57900
     ctcaaggtaa agcgtgttcc gcgccgcgac agcctctgct gttccgatct gttcgaatgt     57960
     catgagtcga cggccgaggg acgccgcaac gttagccgct gcagcacgca ccgtctccct     58020
     agcctgttcg ccgagcgtta cagggtgtcc ctgttcagtt ccggccgctt ctctgtgacg     58080
     cgccgcgatt tccgataacg ctgccccgat cgcattgcga aggttctccg gcgaccggaa     58140
     gacttcaccc cgctgatgat caaacgtgta cctgtgggtg ccgtagtcaa tatcttcgct     58200
     ctttaccgcc aacgtccgag cctcgattcg ctgatcgtcg aggccccgga gcgtcgcccg     58260
     ttccgagatc gacttccgta ggtcttgaag ccgaagctcg accgcccgga tggcactgtc     58320
     tcgtttcgcg aaataccctg caacggtatc gctttggatg ccgctcgaag cctcgagctc     58380
     cttcgcggcc gctgcggagg tcgccacgcc aattacctcc caccccatcg cttgagcgac     58440
     gtccttcacc atcgctaacg ccgccgtctt gcctgtcccg gcctcgccct gaatgccctg     58500
     aatcgaatct tcatgcatca ggacattgcg agccgcctgt atctgttccc cggagagctt     58560
     aaactgctct ccaatttcgg ctgtcttctt cgcttcgaat gccgcgaccg cggcgtcgaa     58620
     ttggtcttcc gcatcgagca caacgtttcc ctgacctcgg ccggcgagaa tgtgctccgc     58680
     aagcttaagc tcgttatcga tcgccttgtg ggtcgtgtat tggatctggc cgcccaccgt     58740
     gatgccgcga tcgaccagca tatggttacg cacatgctga tcgatcgccc actcgatctc     58800
     agaaatgctg ccgcgactga acttcaacgc cgtgacctcg agatcaacga gtgtgaaagc     58860
     ctgctcccgt tcggtcaaat gttcgatcgc ccaggagact gcccgcagag cgttcgctcg     58920
     agcatcgttc gaaacgctaa ctgctgcgcc ccgacttggc ccggaatcct gccccatcgc     58980
     cgccccgtgc tccaccgttc gctctacacc gcgtcgcgga acttgccgat cagcgaacgc     59040
     ctcccgcgcg cgttctacga tcgaggccac gtccaaattt gcttctttcg ccgtctcctc     59100
     ccacaccgac tgcagaatct cccgggggtg ctcctgcttg gctgctcggc tgtcgagttt     59160
     ggctaccctg cgtgcatcaa agctagcttc gcccggatct atgccatgct tcaaaagcgc     59220
     ctcgcggacc tggaccgcgc gggtactgaa tgtgtcgacg tgatcgcgtg aaaagccctt     59280
     cagctcgaaa tcgatgccgt tctccgcata cacaagttgg taaccaagat gtcgcagggc     59340
     agccgcgagc tccgctttgt aaatgatgtc gccgcgcgcc cgtagcgtgt acaacaggtc     59400
     gttggtaagg ctgcgccacg aatggcgtgc cccatcgtaa acagcggata cgatcacgtt     59460
     gtggttatga agctgcggct cgttctcccg gttagtttcg tgcagcaccg tcgcatacag     59520
     caagttgccg gccacttccg gccggtttct tcccttttcg tctttcacgc gaatcagaga     59580
     agcatgcttc tcaaaccatt ccatcgtccg cgcattcgct gcaaggtgcg ccgcgatcac     59640
     acggtcgtcc ttcccaacca atgccgcgat cgacacgctt ttcggcggcg caatcgtgaa     59700
     gtcgataccc gcccggcgct tgtccccctt actgttgttc gccagattct ggatcttgcc     59760
     agtgtccgga tgcggcatcc gcccgcttag gaattgaatg aactcctctt tcgtaactgc     59820
     cttccccctg ataccgagaa aatcggcacc gcgtccctgc cagtgagccg tcgctttctc     59880
     gtttacatag tagttgtcag ccttcttccc cgcgtctttg ttaaaagact tgtcgtgata     59940
     tctcgcagca tcggcgacgc tacgaatcgg ttccttcgaa atcaccctca caccccactg     60000
     aagtcgaaga atgctgtcgc agtgaatccc gtttcccctg cttgcagcgg gatgacaagg     60060
     cgtaccggtt cgctttcaag gcggtcgcga tgtgcgtatt ctgtcgctcg ataaagcagc     60120
     gtgcgaacgg tgcgacttcc tgatcgcaag tacacgcgaa ttgctgggta gagcatcgtg     60180
     ggtttgctgc tcgccagttg caattcgacg gttgctgtct tcccgttatg cgcaagcacg     60240
     cggagatccg ataccgtgac tgtggtcacc tggtggtcct cgggtagata acggatcgct     60300
     cgaatttcag cgatttccgc agctgataga actcgcgttg cgccgtcctg gcgccctatc     60360
     caatccgcag cgatgcccca cagttgagag gaaaacaacc agcttacgat gacggcgccc     60420
     gcggctacca tcagcagcca ttttcgaaat agcgacttca tcagaacaac ccctcatttt     60480
     cttgcgagac cggctctcga ccgtcgctat gttcatcgcc acgcccgacg tcggctgtcg     60540
     gaagcatcac ttcgccagtg tctagatcgg tgacgatcca ctttccctgc gtcgttacgg     60600
     ccgccgtcgg actggttgcc gctgccgctg ccgctgcagc agcttgggcc ttcattgctt     60660
     ccgcctcggc ccggacgctt tctatcgcat cttgaccatc cgcggcggat atcttgaacc     60720
     gcggatcgcg tggcgggtcc ggctgcctct cgcggaatcg caaggttcgt ggccacggtc     60780
     gataccatcg aggtagccag tggcggtagt tcaccaatgc cggcggaaag tcaccggcaa     60840
     cctgaacgta tgccatgcag tttttcagca acccaatctt cgatggcatg accacccact     60900
     tttcgcgctc gtcctggcta agctgccccc cgtcacgcca atcggtcacg gcgatcgcct     60960
     gtcccgccct gactacggct gtctcactct tccccaagcg ccgcgccatt cgctcctgca     61020
     tgttcggttc attgagacgg agcgtaacag tggtgttgaa gcagttcatt agcgtttcgg     61080
     cgcggtccgc acccatggac gtattgaact gcttgtctgc ttgaatgcca gcggcgacgc     61140
     aaaccccgta cttccgcaac tccgcttgcc gggcgtccag cttgatgtca ccaaggacat     61200
     gcgtttcatc aagaaaaaac caatagcggt cctcgtgacg aatttcccgg cgcgcggcaa     61260
     tcgtctgaaa tgccatcgtg atcaagaggc gaaatagcgg tgcgaacatc gcatacgtgt     61320
     cctcggtgcc gatgaggaaa agtcgcgtgt cgtcgtcctt ttcgtagaac tcgcggagcg     61380
     tccaagtgcc gtcctgaacc gcggcgattc cgttcaagta gatggcgatt gaactgatca     61440
     ccccttgacg ctgccccttg gagtcgccgc cgactgccga gctcgcaaca gaattcttga     61500
     tcaagagctc aagctcgtcc tccggcatgg aaaggatggc ctcggaaatc aggcgggtat     61560
     agaccgcccc gcgttgacgc aagcgtaagg ccatcaccga aaatagcact cgcgctgcgt     61620
     cctcaaagaa tgcgctcgca ccatgcacga cccccgcctt aggcggcaag aatgcgtgtg     61680
     caagcgtgtc cgaatcgtag gtgttctcca tctccatgaa catcgaccaa gggaccgagc     61740
     caagcagggc gggattaaag aacaggtctt ttccgggacg gtagtacgct cgaaagtatt     61800
     cgccggcatg atcgtaaatt accgactttc ggccgcgcgc gaacacctgg cccataagat     61860
     cgtgaatacc caacgatttg cctgttcctt gcgccccgac aaacataatg ccctgcatcg     61920
     gcgcagatcg aggaagggcc acgtcaagga cggtatacgg ccccgcctcc tcgcggcgta     61980
     cagctttcga cagctcttca gccgagacga cgtccaacgc tccgtcgacg cgcttgttct     62040
     cacgagcccg ccgaccgagc cgcgcaaggg accgccaaac cgcgtaatag ccggccgcac     62100
     caagtccgac gctgacccac gcgacatatc ggaatgccgt gactggccga gcaaggtcgg     62160
     gtacaacgtt cctaaactga gggggagtta accactgggc gagctcgccg tcggatttga     62220
     cgacggtgag gatctttttc tccccaacac catcgcgaat ccgccagcgt cgcggtacct     62280
     cctgatcgac gacgtgggac aagatattgg ccttaacgag gtcgacatca tgagcagtaa     62340
     gcgtgttcat ccaccagacg ctcggcagaa ccatcgccgg caacgccccg acaaaaaatg     62400
     ccatcgaggc agcatggaca gtcagcttga cccgagtcat gaaaagcgcg cgtcccgcgc     62460
     cggcatcgga gattaccttt tcggtcatgc cgcctccgct atgacctgaa cgccgcagtc     62520
     gtcaacgcgg acaagttgaa aatcgagtac ttccgtcggc aacagcatgg ccagctcctc     62580
     agaccgcgca ccgaaattgt cgcgccatct cctatcaggc attctcagaa aatcggccgc     62640
     tcggatagct ccgtcacgtc ccacaaaaat catgtcgatc gcagtaacgg ttggcccccc     62700
     cgcgagttgg tattcgaact gaaacgcaca ctcgctacgg gacggactca cgtaggtcga     62760
     acacgtgacg cggtatttgc ctggccgcaa atgcaccggc tcgtttatag aggcaaactt     62820
     aatcggcagc agcatcgggg ccccctaccc tgaagacacc ttcatcaaac gcgcgactga     62880
     tccgctcgcc ttccctcacc gaagcggtga tatggccttt cacctgttcc ctcattggcg     62940
     ccggtataga cgtcgccata ccgggtggaa ttgaagccgc ggcaacggcc ccggccgaga     63000
     gggctgccgt ctttaccaac agcgtatgca gctccgcgta ctggccccgg agggcctcaa     63060
     gttgatccag caacacttca tgccgtctgt cgtagttcgc taaagcgtca cgatgaagaa     63120
     gcttcgcgta cgcgttaggg gttagctttc tcttcctggc ctcttcctcc agcatctcga     63180
     attccttcca gtccacgcgg aagtggacag atttcagagt cacggtttgg tctctccgca     63240
     aaaacttggt tttgatatcg ggtggtgcaa tctgcaccac ttactaaccc aatgattctg     63300
     ttgctgattc tagacagaaa tttacatcag tggaagtagt gattataatt gtggtgcgca     63360
     aaaaagcgcg ataaatcatc tgcttgcgat ggttttgacg tctgcacggt acgtgcgtca     63420
     tgtctgtgct tttgtggagg ggcggctttg actttcccgc gatcggatag atggcggaca     63480
     acggcatgcg ccacgacaac aggacgatgc cgggaattgc ttttgaggcg tgagaaagcg     63540
     gggattctcg ggcgcacgca gccggcatcg tccggtccat catcactatt cgaggagtcc     63600
     aatgaaccag gaaaaatcag gaactcacaa gccgcgcggc cgccgaccgg cagcgtctct     63660
     tgaggagagg atcgccgagg ccgaaaggct cgtggcgagt ctgaaagagc agaagaagct     63720
     tgaagagcgt cagaacttgg agaggaaccg taaggcgatt ctcgacctgt tcaaaagcga     63780
     aggcgtcgat acgattccga tcgaaaagtg gaaggcggcg atgccggagc tgaagacggt     63840
     cctcggcgtt ggtcgcggtg cgaccgacgt cgggagcggt gtaagcgaag ccaaaggcgc     63900
     ggaacaggcg gcatagcgtt ttccacaaat ccacggcagc gaacggacgg cagcgattcg     63960
     tttggatcgc aagagccgtc cgccgcgcga gatatccaca acgtcgtttg ttgtgggtat     64020
     ctcattcggc gcgggctgcg gtggggcttg ttgggaaacg cgctgcactg ggccacgggc     64080
     ggctgcggtg cgaccggcgg tcgaaagcga tcgcggcgcg gatgcgccgc gagagcgccg     64140
     gccgacgtcg tcaatccgac gtcagggagt gtaggcggcg cagccgtcga aactcactca     64200
     aaaatcacct tatcccgatc ggagacgagc gggatctgga tagcagcttc cgacaaccgc     64260
     gctgtccccg agaatcgttg atttttcgtg atcggtactc tcgcgaaagg ctggggcttc     64320
     tcgcgagcgg gtcacagggt gaccggctcg cgacggcgcg agcatgtgca ttgcgcagca     64380
     atgcaatgcg gagcggatac ccgtacggta gatctgacga gtggcgcgct agcgccagga     64440
     gacggatcgg acgattcaat ttggagcaag gaattgcgcc aaatctggat agcagcgcta     64500
     ggggcccgaa actgcccacc ctagctcgcc gaggtgcgac tttcgcaggc gaaagtcgag     64560
     atttcaattc ggtgcgccct gctacccgca agccttcgat tcgaagcatt cgcaacgcac     64620
     ggcgagccgt ccatcgtcaa atttcttcac ttcggcgggc gtcggcgcgc cgggtgtttc     64680
     taccttggtc atagtaactc cgggctgttg tggcccgccg cagcgggccg gattggcaca     64740
     ctcagccgtg caccgggcag gggttgccgc tatcgttctg gcagtcgggg cactgcgaaa     64800
     ccgcgtcgca ttcttcggcc atctgctgcc cccactccca ctcggcgacc agttccggca     64860
     cgtccgcaaa catcgtcggc acgctgtaga cccctgcctg atagtcgtaa tacccctcgg     64920
     cctgcgcgtc gtacagcgag gcgatcacca aatccgattg agggtcgaca atcgctttga     64980
     tctttgcaag cgcgtagttc actcgaacat ccaagccacg catttttatc tcctgtatca     65040
     cgtgtgggtt ccgtctctta agtgatcgat agcccgggct gaccggggcg aaccttccgg     65100
     ggcgttacag tggcatcggc gaccaagcgc cgggggcgtg gcggtacagc gtgacgcgct     65160
     tgcgctggcc gttcaccacc gtctccacgc ggaccgcgcg aacatcgtct tcctcgcggc     65220
     gccaccggtg cagtacacgg atttccgcgt tcaggtcaca gcccagaaag aaagcggcga     65280
     tgcggcgaag aagattcgat ttcatggttg ctccgtgcgg tttaagggtt tcaggctgac     65340
     cgggacccta gattccgagt cccttcgtag ggtttgtttt agcccgaccg gcagctgctt     65400
     ctgtgctgcc gccagtcccc tgagttcgtc gtcccggcga caaaggagcc cgtagccgcg     65460
     cccggacaag ggcgtgcccg gaggccgcat gcggagcgca gccgcaggcg agcaccgaac     65520
     gggcgaggac acggcgaagc gaacccttgg ccgggcgcgg cgaagggcta ctgtcgcgaa     65580
     aagggacggc ggactcaggg gactggcgac ggcgtgtccg cgcgagaggg caaaaacgcc     65640
     gcgcggcgag cgcccttcat gcggccgcag gccgcatcac ttcaggggtg aatgtccgaa     65700
     agggccgaag gcccttttcg gctcccgcgc aagcgggcat atcgctaatc atgccgcttg     65760
     gcggcactag atggcggcgc tgcttcgtct acagcgaagc gaagaaaaag gccctttcgg     65820
     gccttacgtc agaaaccggt ctgctcccaa tgcgcgcgta ttagaaggta ctcccgcagc     65880
     ccggtgcaac gtccgtcaac gatgcctcca cggcgcactc tcacccaccc gtgtcccatg     65940
     atcgaaagca gccctccggt gcactggtgg atggcgacaa tgcagagttc gacggtattt     66000
     gcgctgtccg ctgtcttcat acctcggtgc ctccgatcca ctccttaccg ataaagacat     66060
     ctgcgccgaa ggcgtcgatc acacactcgc acgcacgcgg actgccgagc agaccgacaa     66120
     gccgctctat cgtccacgca ccgtctgcgg gcacttcgag caatactgag cctccgaggt     66180
     cgcggagaat tagcggcggg accgcatccg tgctttcggc gctcacggtc agcagactgt     66240
     ccttggcggg aacgattttt acaccgcagc gagtcggata aatcacctga ttctcctagt     66300
     aacctagcca gtcgagcact tccttaccct catactccgg gcgatcgcca acctcggcga     66360
     gaaaggcaga aaagccgcct tcgacatcgt ggcgtccaat ttcggcctcg gcttcagcac     66420
     gcgttactgt catatcgcat gcgtcttcgt aggtgtatgc ggtcattcca atctccatca     66480
     gtaaagctgc tgggtcgttc gcctgatcca gttcctcgcg acagctccat atgcgttcag     66540
     agcgagtcgc catgcaggcg cattcagggc gaacagcaga tagcggtgcg cagtcgggtc     66600
     gatgcctcca gtacgtccga tattcataag cgcgtgcgca gcgacgagcg gcggaacgtc     66660
     gctttcagca tattcggcgt cgaactgctc ctgtgtcatc cactgtgtta cgacgcgtcc     66720
     acgttcgacc gcaagtacct gcgtcgtggc gcgcgtctgg tggctgtagc cgaaggacaa     66780
     gcggatcgcc gggttctcgt tagcgtccag gtacaccgag ctgcgcgtag tcggacgcgc     66840
     cgggtcggtt ccggtgagct ggcattcggg cgcgtccggt tcacggttga agggctcaac     66900
     ggttggaatg atatgcgcct ttgtccggac acggttaccc gtttcggcgt gtgcatagtg     66960
     gacgaattcc agcgtatagg aacgtccggc gcggtcgatg tcggcgtagt gctcgcgggt     67020
     gatggtgcat ggaatttgca tgatggtctc tcaattctcg cgggcgtcga gcgcgccctg     67080
     cagcgcgacg gcctggaatg cgttcaggcc ggcggcgtcg atgaacgttt cgcggttgaa     67140
     aatcatcacc gcgtaaacgt tggcaagctc gcgcgcctcg gcgcaaagcg tggggcattc     67200
     gttcgtgcct tccggggccg gtgacgtgcg cgccagatat tgattgcgca ctcgatctgc     67260
     tcaatagtgg ttagcgacat ggctcagccc ctttcttccg aatttttgat atccagtggt     67320
     ttcacgtcgc gccttcaaaa tccgatctgg ctccagtgag tcaccatctg cttgtattca     67380
     ccgcgcttcg cccgaagcca acgaagcatt cgcgcgactg cggctcgcct ccgcgcgact     67440
     tgtcggagcg catgcggacc gccgcaacag agatcctcct cttcatcgcg ttgactggtt     67500
     gcctcattaa gatagcctgc tgcgatcgct cgaagcgccg cgtttccccg tgcatgaatc     67560
     gcaaccaagt cgaactcttt ccaaggatcc tccacctgaa aggcacgggc gtactccgct     67620
     aggagcgccc cgacgaaact ccacttacct ctacgcaagt acttgcaagc caagtcgtat     67680
     gcagacggtc gatggctggc tatgccaatc gcttgctcga gctcgaggta cagcatgtgc     67740
     aatccaggat attgaaatcg atctggaacg gcccttttcc tgccatacgg tttgaactgg     67800
     aagctgaggg catccaccgc gtcgtggttc tcgatatgcg tcatgggcga ctcctattca     67860
     tcgttaggtt ggacggcccc gatcgctcag ggcacgcttc gagttacctt ttagagtggc     67920
     atcggcgacc aagcgccggg ggcgtggcgg tacagcgtga cgcgcttgcg ctggccgttc     67980
     accaccgtct ccacgcggac cgcgcgaaca tcgtcttcct cgcggcgcca ccggtgcagt     68040
     acacggattt ccgcgttcag gtcacagccc agaaagaaag cggcgatgcg gcgaagaaga     68100
     ttcgatttca tggttgctcc gtgcggttta agggtttcag gctgaccggg accctagatt     68160
     ccgagtcccc tcgtagggtt tgtttctgcc cgaccggcag ctgcttctgt gctgccgcca     68220
     gtcccctgag ttcgtcgtcc cggcgacaaa ggagcccgta gccgcggccg gacaagggcg     68280
     tgcccggagg ccgcatgcgg agcgcagccg caggcgagca ccgaacgggc gaggacacgg     68340
     cgaagcgaac ccttggccgg gcgcggcgaa gggctactgt cgcggaaagg gacggcgaac     68400
     tcagggggct ggcgaagggc gctgcacacc gcgcgagggc agaaacgccg cgcggcgagc     68460
     gcccacaagc ggccgtaggc cgcttcactt caggcgttcg ggagaaaggg gctcagcccc     68520
     tttcgtccgg cgaagccggg ccacggacac gtgtggtccg accacatgag atcaggggcg     68580
     atttcgcctt gggtccattg cagcgctacg gtgcgaattg ccgcgtttcc accgcaggcg     68640
     cctcgagatc gcttggcgag ctggagtgca cctagcgcac ttgatcgagc ggtcggcatt     68700
     gcgccagcct tgaccgaaag tgctgctcga aggcttccgc caataccggg tcattccatg     68760
     cgatcaccac gttctcgctg ttcgattttg cgcccgccgc ggtgtagttg atgcttccag     68820
     tctggacgct ccggtggtcc agtatcattg ccttgtcgtg cattaagcga tatcggtcca     68880
     cgacgcatat ggcagcaccg gcgcgcgcga gatagtcgag cccgcggcgg atgtagccat     68940
     ctcgatcgtt cgcgatgctt tcgccatagt caacggcgat tgcaacgggg acccccgctc     69000
     gtgccttcgc tgccagcgcc tcgattagcg gccgatacgt cattacgtac gccaggacgt     69060
     gaatggaacg atgcgccgaa cccacgccgt acaagacgag atccatcccc ttaccgtccg     69120
     gagaaaaagc atatgaggtc acacgaccct cgggggctgc ggtcgtgagc accgttgcga     69180
     cgctcgcgac tggcgaggca aatgccgcca acgcgatcgc aagctcggca atacatccgg     69240
     cgatcactgc gggggctgtc catgacagca gctttagtgt catgtccgcg cgctccccga     69300
     agtaaccggc cggagccgtg cgaccggggg aaactgattc gccgggatga cgcgtccaac     69360
     gctcacgtgt gtctggcagc gatcggcctg cgtcgtcacg taaacccacg tcgccggatc     69420
     gagcgaaaac cgcgaggtga cgatgccccc ctcggcgatc gccagttgat tcgcaagatg     69480
     ctcagtcgac gggagctccg accaatctcc gatcgcgtgc cgaatgacga actccatctc     69540
     acggcgatca agtgacgcga gcaccgctcg agcggctgtc gacattttga tgctaccggt     69600
     ctcaacgatt gggtgaagag gaagcgcctg cgccacctca ccgcgaccac tgactagata     69660
     acaatgccat tccggcagga ggtctccaac gagggcgcgg gcttgcagct gctgactgct     69720
     atcgagctcg aaaaaataac ggattgtggg cataggtcac cgttcagtgg cgttggtcga     69780
     tacaagttcc cttggcagca tcaccctgac ctgctcccgc acggccgcca aaccttcggc     69840
     gcttgcgagg tcattgaaat cggtcggacg cccgacgagg gagttgaata caggcacgat     69900
     cgcctggcat ctgaggatcc gtgctgcttc ggcggctgag tcgacacctc tgttggacgt     69960
     cgtggaccgg acatgctttc cgtcgctccc cgtgatcaca tcaacggtca cagaacgagc     70020
     aaccccgcag cggcattcca ccgcaagccg gtactttccg tgtgcgctcg catgccattg     70080
     cccgtccgcg atcgcatcga cgattctcac ggttcgagtc gcgtcccggg gtcccgcgtt     70140
     gaccttgaaa gagcattcgg tctcaggcgc cacgctacct agttcggcaa tccgcgtgac     70200
     ggctgtctca agaaaaaact ggtcgttgtc ggcgcaaacg agcttcggtt gccgccgcgg     70260
     caggacgtgc acgaggtctt tcgcaaccgc aacgaggttg cctgcgtcga agcacacaac     70320
     caccggtagg cccgtcgctt cgtaaatcga cgctcccgtt gcgtaccctt ccgagagcag     70380
     caccgccggc gcgcttacga ggtcagcgac acgtcgcgcg ccgatcaggt gaaaggcacc     70440
     ggtctttcgc gctcccttcg tgaatagctt gcttccgtcg ggaccgagcg cctggacagt     70500
     tcgcagccgg tcttgaatat cccgtccggg agcgatcaag tattcgtcgg atgtcgactt     70560
     gaagtgctcc aggttcagca gggtaatcat gtccataccc cggccgctcg caatccggag     70620
     accgtgcgcg gctacccctt tgcgggccaa atacgggtgc gcgtcacatt cgacttccgg     70680
     cagggtcacg agcaccttta atgccctcgc cgctatctcg cgctgctcct cgatcacctt     70740
     tgcagcgcgc gccgcacggc gatcgctatc ggccgcctcg agtgcggcgc gttgctcgcg     70800
     tgtcaggcgt cccttctgaa agcgccacgg gccagatgcc cccttaaaat ttcggatgta     70860
     accccgccac tccccaccaa cacgctcgag cttgtagctt ccgctgttgc gtggtccggc     70920
     cggcgtttcg actttggccg tatgccaggc tccatccgca cgtacggtgt cggggataag     70980
     cccaaaggta cgcatcgcga ggctgaagtc cgcgatcgct tcctctgggt caatgccggc     71040
     attcgcaagc acggtctcat cgacgatcca ctcggcaaaa ggcgtccgat ccatcgacgc     71100
     gtcgatccag caaaggcgcc gatcgtaatc gagatgcgcc ccgagagacc gagccttcgg     71160
     aatgtctctg gggggtaccg caaggtaaat tcgctgcgct tgcgatgcgt tggacttgat     71220
     gtttccttgc tgccgtgacg attttccctg cggaactgag gcgagaaagc gctcaacggc     71280
     cctggcctgc ccactagtcg aacgttttgc catggttgtg ctgtacatga gacacctcct     71340
     ttctcagagg cggatcgcgt cgagcggcag gcagccgacc acaacggtca gcgccgctgc     71400
     atgaaattct ttgcttatcc cctgccccga aaccttcccg ttgcgtacca tcgcgttctc     71460
     cgttggtttt gagccgaccg gaacccaaga ttctgagtcc cggcgtaccg gccgagtcga     71520
     cgcagcgcta cccgcagctg ctgccgccgt tcccctgagt tcctcgtccc gcgaactagt     71580
     caggtgaggt gacccgtcgg tcaagggggc aagcgagggg ataggggcgg gcagtcgcgt     71640
     agcgacaaca cggccccgag cgccttgacc gacgggccgc cgaacctacg gtcgcgcgca     71700
     aggacgagga caaagggggg gacggagctg cagggcagga ataccggagg ctcggcgccg     71760
     cgcggcgagc gcccatcgcg cgaagcgcga cgcgacagcg cgtccggatg gacgaagagc     71820
     gaagcgaaaa aaaagccccg ctggtgcggg gcaaaacatg ctgcttccga gggcacggca     71880
     cgagcaaacc gcagcatgct aagagcagga aagagcgaag gtgagccttt ccgggagcgc     71940
     agcgagcggc cggcgaggcg ctggcagccc cgcccgaagg gcgcggggcg agactccgca     72000
     ggaggctcga cgcttaggcc gcgcatcgcg cggacgtagc gcaacatagc cggtctttgc     72060
     ggagcaaaga cgccccaagt gaattcttcg catacctcct caattcggtt acgtaagcca     72120
     agagtggcgt tcaatttgca actcgccgct tccgtttcaa aataagaaac cgtacaccta     72180
     ggcacacgaa caggccgccc agcaacagca cacacatcgc cgcgtatcca actagcaccc     72240
     ttttgacgag ataccaatcg cgagctgcag cggtacagcc cacaacctcg cggaaatccg     72300
     tcagatcctc cagtgagggc accacccaac caactaaaga agcaaagtgc ggagcgagta     72360
     tccatagcag tgcaccagca gtcgcgattg cgacgatata cgcgaagaat gcgatcgccc     72420
     gacgccgaaa agaccacgat gtatctggct gctcgagagc cagttggatg tggtatcggt     72480
     cggcgagctt aacgctcgcg aattcttcct ctatcgaacg acgcacgtcc ggcaccacca     72540
     caccatccga ttctgaggaa cgactcgatg aatcccaggc tcgcgatgga tatatggtcg     72600
     ccccggtcgc cgtgcgtagt gcgtcgcgaa ggcgaccggc actgcgcacg gcgacgtgtt     72660
     ccggggtgac gtgctcattc tgattggtct ctctcacgca ttaatttcgt cccgctggcg     72720
     ggacggtgga taaattttaa tcacctttgc acatgattgc aattgatatg tatggagcgg     72780
     ttcacgcccg agggaggggg atccaagggg gaaccgggtc ggggttcccc cttggtcggc     72840
     gtccgccgat atcccgctcg gcgcacggcc cggacgattt agcgccgcca ggcgcgttga     72900
     ggaaggcgcc gtgcgacgct ggatggcgcg aggtagtgca caaaaaaaaa ccccgtcacc     72960
     gacggggcaa atttgcgact gctcagagat atcgttgaat taagccgccg gccggcttcc     73020
     agcgagcacg ttcggcgtcg gcgtcgcaaa cggccacggg aatcgcgccg attgagtgac     73080
     tcggcctccc gcaaattccg tcggcgcgac gtcggctggc ttcacgccgg tctcagcacc     73140
     gtccggacta tccgagaccg tgtcaggttg cgccggttca tcacccagca cttcctcgtg     73200
     ggctccgaga ttgtccgccg tcgcgagctc gccgtccgca tcctcctgct cattaccgtc     73260
     atcgccgaaa taggttcgcg cggtacggac ttcggcagca gccatgaatt cgggaagcca     73320
     gttcttgtcg gcaagcagtt tttccgcttc ctgcgccgcc tctgccttct tcattttccc     73380
     caacctcgcc ccatgctcct tcgaaatgac gtcactcacg atcgcaacga ttcgatcctt     73440
     cgagacatga ttaaggtacg actcgcaggt gggcttccag tacttcgtga ggtcaagttc     73500
     cagagcgccg gcgagcgcat tgatagcatt cggttcttcc gtgcggctca caccattcag     73560
     actcagagcc gtgcaaacgg cgagaatgtt caggactacc gcttgcggct gttcgagcaa     73620
     ccatccgaac agttcgttcg ggtttttcgg aatcatgcga gtgaccgcca gcaccgaccg     73680
     tgcaagctgg tcgtactggg gcaactcctt gatgccgggc acagctcgat ccgcgctgta     73740
     catcggctgc tgttccttga tctgcacagc actgaggtcg ctatagtgct catagacgaa     73800
     ctccagcaac agtcggtgtg cgacagcgac gagcgcaacg ccggggttcg caacaagcgc     73860
     ggtttgaacc gctgccgtgc ggtgcgacgt cagattgagc agcagtttct ccgaatgcag     73920
     ccccttaacc ttcttggtca ggctacgcgg gaccgactga cctgcctctt ccatcatcgc     73980
     acgcgcttgc gcccgattct cgcgacgcac caagccgcgc acgatttcaa gtgctccgtc     74040
     gtagccgacc gtgacgatcg ccccgctcac tttcatctgc tccgaggtga actctccgtc     74100
     gcggtcgtcc atttcctgca tgatcgcgta aagctgattg cactcgccgt ccagcttttc     74160
     ccggtcctcg tcgctgaggt acgcagcatc gcccacttcg gcatcgtagc ttgcctcgat     74220
     tttctcgctg agttcgtcgg cccgcatttg agcttcttcg tattttgcct tttcgtcgct     74280
     agtgagcgga accggagtgg aataaagttg cgtaaactgg ttgcggtcgt catagtcgaa     74340
     ggtcggtcgg gcttcaaccc aattccagcc ttcggccttg atcgattcga ccgtgcaggc     74400
     gattttctca tcgaacaatc gagccagcag ctcacgattg acgatgaaac cgtcatcttg     74460
     ctccgcgaac aggtcgcgct ccacctctcc cccggctgct tcgtatgcgg cgacagtcac     74520
     gaatcgcacc atccggtccc cgaacgacag tttctcgcct ttcagcacat tgcgcagtgc     74580
     gttagggctc tggttccagt gtccctttgc accgaaccac gccgcttcct gtcgctcgtg     74640
     gttgtcggtg atggcaagcg ccttgatctg ttcgaggctg atgacgtccg cagcaaacag     74700
     ttcaaagagc ttcggggaaa cgttcgcgag cttcaatcga ccggcgacga ccttcggact     74760
     gacattgaag actgccgcaa tgaactcagg gcttcggccc tcgtctgcaa gcgccttgta     74820
     ggcagcgaat tggtctgcag ggtgcggggg tacgtgcaag tcattttctg acgcactagc     74880
     aaggatcgcc tgcgcctccg aaatctcgat gcaacgcact tcatcgtcca tcgacatgta     74940
     gccgcgctcg acgttgaaca ggaacgcttg acggcgcgtt tcccccgcgt cgacgcccca     75000
     ctcctgcgcc ttcttcgccc tctgcggcat tttatgcaca acgaggttct gtagttgacc     75060
     gacagcaagc atgttgtctg cgattgccac aatggtcgct tgatcgcgct tcttcttacg     75120
     ctggttatac ggcgaagcga ccagccgttt caacggaatc atcacttccc gttgccctgc     75180
     gcgaagcatg ttcggcatgt cggcgggcag tgcatcggcg ttcacgttgg cgtcttgtgc     75240
     aatcacggtt ttcatagcat tcctcaaaat taacattgaa gttgtgacgg gaccgccggg     75300
     ccccaagatt ctgagtcccg gcgtaagccg ttctgtcgag tcggcgggcc gcgctccgca     75360
     gctgccgccg ttcccctgag ttcgtcgtcc cgcgacgatc ggagcgagga ccagtgcatc     75420
     gtcaaggggt gacgcgcggg tcggtgcggg agggagcgca gcgactgaca cggtcccgcg     75480
     cgcccttgac gttgcgctgg ccgcagctac agtcgcggag gtggacggcg aacgaggggg     75540
     acggagatga aggcagcacc ggtaccacga cgagccagaa cgccccgcgc ggcgagcgcg     75600
     ctatccgagc ggcgcgacgt caggagcgcc gagaggctgg agggatggcc cgcgccgggg     75660
     caagtccgcg ggacgcggcg cagccccaag agcggaagtg tttggtctcc gggccgccgc     75720
     gtgcgcggct tgcgtgtcgg ccggtagtgc cggccggcgc gcaaggtgcg gcggcccggc     75780
     tggcttccgg gcccaggtcc accgtcagtg cagcgtcggt aggtccgcgc cttcttccgt     75840
     tcccacgccc cacgagaatt cggccaatac gtatggggcg agcgtcgcgc tcgcccaacg     75900
     atagttacgc gctttgctca gtgcgatctc ggttctgcac gtgtttcgtg atcgcgcgtc     75960
     gcgcgctaac taatgtcctg cggcgctcta gatcgaaacc tccatcattc cgcatgatct     76020
     gtgtttggac tgtctcaact ccccgctcga tcgagacatg gatgaaatgc cccttgtagc     76080
     caatggtgtg aaacatatca gaccacctca gagacaggga aaccggcttc agtgagctca     76140
     cggcgcgcat cgtcatccca ggtcgtcggc gactcggact cacagcgata cgcgtaggcg     76200
     attgccgctt cgcgtgcgtc ggccgacaga ccgccggtta ctttgaccac gacctcccag     76260
     tatgtcccga agtcgtgggc gctgctcttg atgaacaggc tggcaccgtc ggggggttcg     76320
     cccaaggtgc gcctgatttg gttgatgaag gccgtgcatt cggctcggct acgctccagg     76380
     tagcgcatgt cgcccacttg cgcacatgcc tcatcacatg gcgctggtcc aatctcaatc     76440
     gtttccacca tcgtacagct ctcctaaaaa atatagactg accgggcccc aagattctga     76500
     gtcccggcgt gaaaggttct ggcgagtcgg cgggccgcgc ttcgcagctg ccgccgttcc     76560
     cctgagttcg tcgtcccgcg acgcctcgag cgacgagccg gcgacgcgtc aaggagtcaa     76620
     gcgcggggtg ggcgcgggag ggagcgcagt gaccgacacg gaccccgcgc gccttgacgc     76680
     ggcagaggcc gacgctacgg tcgcggggaa tggacgacga acgaggggga cgggggtgcg     76740
     gacagtgctt gctccgtgac gagccggaac gcccgcgcgg cgagcgcgct atccgagccg     76800
     gcgcgacgcg aggagcgccg cgaggctgga gggatggccc gcgccggggc aagtccgcgg     76860
     cacgcggcgc agccccaaga gcggaagtgt ccggattccg ggccgccgcg tgcgcagctt     76920
     acgtgccggc cggcagcgcc ggccggcgcg gaaggcgctg cccggcggcc cgcatgtcac     76980
     cggcgatccc ggtcgaggac tcggatcgcc gtccctgcca attgcggtcc gatggcggtc     77040
     ccatggagtg cggtcgagcg agttgaagct catgaagatg acggctaccc gtccccctgc     77100
     tgcccgcttc ggcgggcctg ggtagtgcgc gcaggagttc gacacacgcg gtgggcatcc     77160
     atagatccat cgaacgccgc gggtggatcg ctcactcggc gtccgaagtc aacaatggcg     77220
     cggtcaacgt tcgacacgaa gaattcaaca gcaattgcct gaacagtcgg agcaagcacg     77280
     cccgcgttcg ggtaaagccg gtcgagcgtc gccatttggc ggaggaccag tctgctaatg     77340
     tctttccacg ttctgtgggg agcacgttgc cacgcgtata aggcgtcagt aacgatcgtg     77400
     ttgaggatga tgcgaatttg tgcgttccga acgcggttcg atgtggcaag cggccactct     77460
     cgcggcaacg tcacggaata caagttggat tccttcatga tggattgcgt gacgcggaca     77520
     ccggattgag tgcccgcgtc cgatcagttt tttcagttta gaggtccgcc catgcaacgt     77580
     cggctttcgt ttccacttcg ccgccgaaca tatgctcgac ctgataccgc acgcgcgcac     77640
     gtgcaccgtc gatcacaagc gttccgcgac caaagtagcg gcccagcaga gctcgttgtt     77700
     cttccgcccg gagcttgccg cgccacttac cgttgcagtt cccgatgcga tttacgagga     77760
     ataggcgcag tttcgctgcc tgttcgtgct ggttcggcgg cggcgtcagc acaagcacgc     77820
     cgtcccggtc aatcggcgcg aggtttgtgt ctcggtaggt gcgcttgtat tgggttgggc     77880
     cgatagccag cccccaatcg accgtatgct gaatccgttg ccgtgcctct gatgaagagc     77940
     gggcaaccac cgaatcgtat gcgcggccgg cgcgcgactt ccggatattg aagaacggga     78000
     cacccggtcg cgattcgaat cgttcgacgt cgatttgata gtggccatgc ttgccaccac     78060
     cctcccatcg ctcaactagt tgcgcagtca tgctgcctcc acacgacggc cgaacagcat     78120
     cagtgcgact gcttcgaggc gtgctgctgt atcgataagg acgccatcgt cgtcggcaag     78180
     cacggtgatg tagctggatt cgccgcgtgg acgaccagcc gcatctcgcg caacgtgtac     78240
     tacactgacg ccggccgcct gcagcccgcg ccgggcatat tccgcaaagg tgtctgcctc     78300
     gccgtgctcc ctttcaaccc ttcgcatacg ctgctgaatg cgttcgatct tgcggacggc     78360
     agcgcgcaat tcgcccaatt ccggggtgag actgttcaac acgacgcgat ggccgaatgc     78420
     cactgcatgg tcgcgactga cgaaggcgcg aagctcaatc gtccccgaat actcgtaccc     78480
     caccgcactg accaccgcgc gttgaatctc aacgacgagt tcagtaacgt tgtggtcccg     78540
     ttcgacgtac agcatggcat gcagttgggg tttcgttgcg cgtcgtgtca ttgcatagct     78600
     ccgtggatgt ttgctgaccg ggccccaaga ttcggagccc ttcgtagggg tttcctttcg     78660
     gcggacgctg attgggtcgc agcgttgccg ccgttcccct gagttcatcg ccctgcgact     78720
     ccggaagttc gaggaggcgt cgcgtcaagg aggcaagggc gggggcggtg cgggacgaag     78780
     cgcagcgaag gacacggccc cgcacgcctt gacgcgaggc tgacgaggac tacggtcgca     78840
     gaactgggcg atgacgggga acggtgcgta acgcgtgacc tgcgatcgcg cgaaaggccc     78900
     gcgcgggtag cgcctgttcg cgcagcgaag cggagcgact ggaatgggcg gcaagcgccg     78960
     ggcgaagccc tggagcgttc agtttgtttc ccggtccgtg gcgagtttcc tcgccacgga     79020
     tccggctcga tgccgacagc tttaccgctg aaaggcctga tattgggcag caacgaccac     79080
     ttaggtcgcg cgtgtggcgc tatggtcgcc cccgatcccc cgacgcgtac tccgaaatcg     79140
     agggggcgac cgcgcaaacc gccctcctct cgcgctttcg acgctattgg cgcctggtcc     79200
     cgcatcggcc cgatgcgacg agccgcagcg agtgcgagta ccctgcaatg gcaaaaaacc     79260
     ccacagctcc gaccgcgcgc acttacgggc gaccgtcgct gccgccatct cggtgttgtt     79320
     tgactgaagg tgctgggcac ggaccttgag aattccagca ctcgtttgct caaagcacga     79380
     acggcaggtc tgcttgcgca ctggaggtcg ttgccttgtg tgcccatgca gtgcgcgccg     79440
     gcgacggcaa cgccgcaaaa cgcaccgcgc ggcgaagcag atcagcaacg gcatagtcga     79500
     gcgttagtcc aagccgatct ttgaaatctg tacgacgcgc gatctcgtcg tgttctcgtt     79560
     gctgtgctcg tgacaatgtc agcgtgccat agtttaggta ccaacggtac ccagccgtga     79620
     tgcctccagg gaagaatccg gcatcatgca tttcgaccag gcgctcgaat tcgaagtcca     79680
     ggatcatctc ggccgattcc tcgtcgactt cgaaccgctt accggtcggc acctcccaag     79740
     tggttcgccc gcccttgaga tggtgaactt tccgagcaca tggagagtct tcagtcaaag     79800
     cctcgaacag cggatctcgg aaccctgtcc actgatccgc ggtgtcgtcc cagtgctctc     79860
     cgacatgcag aaacataggc tccggcattg gctgcggcgc gaccggcata acgtccggaa     79920
     catcgtatcg aacgccgttg cagtagatgt cacgatagtc agcccatatc gcgaagggtg     79980
     gtgccaggcc ttgaagcgat tgcatagcat cgacggcaat catcatcgtc aagggcaacg     80040
     tttgaaattt gggccgcgat ccagtgcgct ttgcgcggac cagctcgtct cggtcgatcg     80100
     tcatcatgta ccgcacaagc tctcgcacag tggccgcgtt gaatgtgtcc ggctctatgc     80160
     agatgtagcc ttctttaatg gtacgaccga cccaatttcg gcgggaccag tcataccgaa     80220
     tcgcacggat gaacttgttg aggcggttca gtccactcgc atacgcgtag cgatcctcat     80280
     caaatttgat catctcttcg agcgatcggt cttccgcctg ttggcacgtc caacatcctg     80340
     tccgcgcgtc gcagtgcccc ctgcgcttcc gttttccggc cgacgcctct tcgaatgaga     80400
     ggtctgagac gatcgcgcag ctgctgttgc ctgcgtgcgc atagattcgc gaggtttctc     80460
     ggaagtccgt gtaggtagac cgaagacctg acgttacttc gccgatgtac tcccagacgt     80520
     cctcagtctc ccagtcagcg atcacacaca gcgtgaggtc accctcgtcg ttgcgcacgg     80580
     gtgtatcggc acgatcgcca cgggcttgca tgccggcctt ccgcttcgcg ctttcggcaa     80640
     acctcgatcc gaggcatacg accggctcag catacccctg ctgcttcgca gcgcgcgcga     80700
     gttgatttcg gaacactctg gaaggctcga tcttcaagct cactgagcag tccgagttcg     80760
     tacctgcata gcttgggagc gctcgaccgc tgagaatcgt gacctgccaa gaggtggcca     80820
     gtgacggcgc gaccgtttgc acgtggaccc tgacgttgtg ccgctttccg tacgcgtgca     80880
     ttttcgccaa ctcccgctgg gcgtgcgcta cgatctcagg cgactcgacc ccggtgtcag     80940
     cggtaacgac gtagacgacc gcctcgcctc cttctgccgc gtgtcgacgg gcggcttcga     81000
     gagtcagcgc cgctacgacg ccactgtcct taccggcgct gaactggcag atcgcgatac     81060
     ggcgctcgtg aaatagccgc cgcaaggccg cgacggcacg ctctactcgc tgatcaagcg     81120
     tcggccgttg ttgaagatga ggaaacaaat cgatcgtttg catggctgct ctatccgcat     81180
     gttgggtggc gccgggccca tagattccga gtcccggcgt aagccgttct gtcgagtcgg     81240
     cggggccgct gctgcgcctg ccgccgttcc cctgagttcg tcgtcccgcg acgatcggag     81300
     cgaggaccgg agcaacgtca agggcgacgc gcggggcggt gcgggatgga gcgcagcgac     81360
     tgacacggcc ccgcgcgcct tgatggtgcg caggccgcag ctacagtcgc ggagatggac     81420
     gacgaatgag ggggaagaag gagtcagggc gtgacgtcgc gcgagacaga acgccgcgcg     81480
     gcgagcgccc tttcacgcgg caagcgccag cggcgccgcg tgacacaatt tcggcctttt     81540
     agtgcgcagg acggtagaac agcgcactcg tcagataccg tcgcgcggta cgggtggggc     81600
     tggcgcaccg gtccacccgt accgcgcgac ggctggttcc taacgcggat ccgcggctag     81660
     aagcgtccgg cgatcttcgg ttcaattacg gcgaagagcg ctgccgactg ctcggcgtcg     81720
     agtccgctgg taagcgcgta gtcgatgcaa cgcaaagcga cacgcttcgc ttccgcttcg     81780
     agcgcacaaa cgtcaaagag gctgcagatc atgtcggggt gcacgataga cgcgagtacg     81840
     tcgagtagcg actcattgcg actatcaatg ctggcgtcta ggacagccaa ggcgtcaacg     81900
     aagggttgtg gaagcgttcg gatcatggct gaaaaaaagc cggacaagcc gcggccgcgt     81960
     acatcaaacc accgcgcgtg gtggttcttg accgacagaa aatattaatt cttatcactt     82020
     aatgaaatga cgatactttt aaacgtatat tgcaaacgga gccattgtac ggttaaatta     82080
     accggccctg acgatcaggg cgtctctagc agttctcttt cccaaaggca gtcaaaggcc     82140
     cgcgcaagcg ggcctttggc tttgtgcagc gggcatggcc aaaagttaag cacgtcgggc     82200
     ggcccttgtt gcccgcgtcc gcgccgcacg ttagatccga cgcgttcgtc gggaccgctt     82260
     ccactaaacc gctatcgatc gctgggcgcc ccgcacgctc ataggtgcgc cttgccgggg     82320
     cgttgcgccc tgttggtatg gtcagtttcg cgagcgaacg cttatccgcg cgctgaccgg     82380
     ttgcccagcg ccctcggcgc ctcaacccct ttcggactct tccggaccgc gccaagagcc     82440
     tctacgcgct tccatgggag cctttttcag accgcgagcc ccctccttgc agagcatggg     82500
     gtagacggtg gttgcgcgag ggcgcgtctc ggcaatgggc gagcacacga gcgcgttgat     82560
     caccggggtg gcgggccacc ccggtgatct tttacgcgca cttgggggcc ggcgtgccat     82620
     aggcacgtcg gcgccttagt gcctgccgcg cgaaaggggt gacttgaggg gggtgtttcg     82680
     tatccatgcc ccgtaggggc cacgatattg cagttcgggg gggggggccg ggtgggtggg     82740
     gccggcttta gccggcgaac ccggccgggg gggctctttg gagccccccc tcactgaggg     82800
     tggcgccgtt ccattccgga gttaaaacca agttaaaaaa ttcggttaac cgcgcgcgcg     82860
     tttacgcatt tgctgaacgc cggtgcacaa gggacatggg ctgatgaggt ggtccgttcg     82920
     acgcgcgacc ggtggtgcga aagacgatct ctgcgggact gatagacgcg cacggtggcg     82980
     ccatagacgc acagcatccg gacttatcca cagattcggt tccggtggtc caatagacgc     83040
     ccgcaaaaaa tacagcgaac acatggcact cgcctgccgc gccggctggt cctactgcag     83100
     aaacccttac tgcgtaagct attgaaagaa catgaccttc aactccggtg gtgcgataga     83160
     cgtcccgaac ggtggtgcga tcgacacttc aggagcgaca aagcctcgcg acagagtggt     83220
     gcaatagacg ccggattatg gtggcgtgat agacacgacg cctcgtcacc tcgccgggaa     83280
     cgtgtcggtt agcgtgaggt ggcgcgatag acgtatcagc cgacgcaaca atcgatcggt     83340
     acagtatcca tgcgagccgt atgaattctc ccgccggata ctcggtctcg atgctgatac     83400
     acgagcgcgg tttggcagtg gcggcctgcc cgttggagtc cggttgatta agttgccgca     83460
     cgcgttgcga tctcaattac ggtcgcgatg gagacgctag ccaggccgaa cgcgccggtc     83520
     ccttcactca gatccgaacc ctacggaagc tggaaaaaag cgggtggagg ttctcgtatc     83580
     agtgagggtt ctgtgcgtcg aagcagtcct caacccaagc ccaccgaccg ttagcaagcc     83640
     cgcaccattc ttgcccttct ccggtccatc ggttgattcg aaccgtacct tcacgatcgt     83700
     attggtaccg aagcatgatg gcagcaatca gcaccgcgaa ggcaatcgcg aatgcaagcc     83760
     agctaagtcc tttgtctgcg ttcatcttcg cgacctcgtt catggaccgc tttccgttgt     83820
     tatagaccaa gagcgcgaca ggcgtctgcc cacgcccacg attcgcgttg gccataaccg     83880
     acaggcttgc gcgagttagg cttcagtttg acgacatatc gcacgcgccc tccggcgaac     83940
     gtgccgactt cgcgcactac cactgcgtcc ggatgtttcg ctctcaggcg ctgttttgcc     84000
     gtcatcgctt ttcctatcgc acttcgcggc acatcgcgtg ccccctcgat ctggccgacc     84060
     cgttacttcg gtgagtgcgc cagcacgacc gacccagccg cgtatcccgg ctcagcgttg     84120
     aggttccgca acggcacgat gagggagacg cgtgaaacga cagcatcctc gcatgtcttt     84180
     tccgtgatgg tgatttgcca accaatcgac ggctgaagtg taccaacgta cttgcaatgc     84240
     gcagcgtcac tcaggcggat tatccgagga tttgcgtctt gcaagctcgt ctccagcatc     84300
     aaaggaactt gctggcccgc tgccgcgctt gttgcaagcg tcgccagtgt cacagtcagc     84360
     gacagcttct tcatcgcgtt caccgttaca ggtcgtattt cgcgcgcaat tcaacaatcc     84420
     gctctaagcg cgcgtgatgc gccgcgcgag cttctgccga aacgtccgcg agattcacct     84480
     ttccgcaggc gaccgacgtt tcccattgag tcgtttcctc aacaaggttg acgagctccc     84540
     gcatttcgcg cttcatcatg tcgaacacca tccctttccc ctgttcctag ccgttagtga     84600
     ggccgtgagc acccacgccg cgcatgagcc gttgcgcaat aagacgcacg atcgcgatcg     84660
     cctctccgtc gtcggacgcg agttcaccaa gaagcatggc ccgcgcaaca gcatcgcact     84720
     gcgccgggac tgacgcttgg gtgagaacaa ccgcgctctc gtaggcctca gtgccgagca     84780
     gcttctgaac tgctcggtca aaatcacttc gcttgacgtc ctgtggcgcg acaatctgga     84840
     tgagagacgc gcgacaatca gcttgagaat gtcgcggcag gaatgatgat gccgatgttg     84900
     attgacgctg gcaagcgttt actgattgac gcgcggtttt gattgacgct ggcgagcggg     84960
     tgtcgcgcga caatcaagct gaagccacga gtcgttgagg attgctgtgt aatggtgacg     85020
     ccgcaggtat tctggctgcg cgacaatcag gatgagaatg tggtcgcgtg gaaggtgatg     85080
     ccggggttga ttgacgccgg ctagctttgc ctgcgagccg cgcgtcaatc aggatgagaa     85140
     cagcgggtca ttcggtgagg tcgatgccgt gctgatcctc ctgtgtcggt ggcacgccaa     85200
     cgttcttcgg tgtcgctcta ctggccgggc gtcccggtcc ctgctgcttg cgctgcaggg     85260
     cagtacggcg acggtagctt tcgacgttca gctcaaagat ggtcgagtga tggaccagcc     85320
     ggtcgacggc ggccaccgtc atggcccggt cggggaagac cttgtcccat tcgccgaacg     85380
     gttgatttgc tgttatgcaa agagaacggc gctcatatct ggcgctgatg agctcgaaca     85440
     ggaccgacgt ctcggcctga tccttgctga cataggcgaa atcgtcgagg acgaccaaat     85500
     cgaagcgatc cagccggttg atggcggatt ccagagcgag ctcgcggcgc gcgacctgca     85560
     accgctgcac gaggtcggtg gtacgcgcaa acaggacctt ccagcccttc tccagcaggc     85620
     tcagtccaat ggccgacgac aagtgcgact tgccaccccc actcggtccc agaagaatca     85680
     ggttggtgcc gttacgcaac cagccatcgc cagcgcaaag cgccgagacg tgcgcgcggg     85740
     acaccatcgg caccgcgtcg aaatcgaagt tctccagcgt cttgcccggc agcagctttg     85800
     cgtccttgag gtgacgttcg acccggcgtc gatcgcgctc ggcgatctcg tgttcagcca     85860
     gcgccatcag caggcgtgct gccggccagc cttccgcgtc ggatcgctcg gcaaaactgg     85920
     accagatctg cttgatggcg ggcagccgca aatcgttgag caacagcgac aggcgggtga     85980
     cgtcgatgtc gagactcatg ctgccacctc cgttgccatg tcaagcaggg cttcgtagtc     86040
     gctcagcgcg gcgagctgga tgttcacctc cggcatgctg ctcgtcggct tcgcttcgaa     86100
     gcgcgaacat agtgcgtcga gatcgggtaa ctgtccatcg tccaggcact gctgcagcgc     86160
     ctcggccagt tgggcttcgc agttgtgctc gtgggccagg ctgagcagtt caaccatggt     86220
     cctgcatgcc tggcgctccg ggagctgttc gagcaggcga tcgaagctca ggcgataggc     86280
     ctcgcgcgga aagacctgat cgcggtagac caggttgagc agcgccatgg gcttgcggcg     86340
     cagcgcgtgg atgacgtgcc ggtagttgat gacgtggccg tgcttgccat tgggacccgc     86400
     gcggccgcgc tgcagtgtca tcagggccgt gccgcccagg aacagttcca gccggtcgtc     86460
     gtacagccgt acgcgcaggt gatggccgat caggcgtgac gggacggtat agaacacctt     86520
     gcgcaggacg aaaccgcagg tggtcgtgac gtacacgcgc gtttcctcgt agtcgcacgt     86580
     acgctggacc ggaagcggct gaagcagtgc ccgctcgacc tcaatgcgtt tgccattacg     86640
     cgcgttgatt cgaccgacga tctcgtcgat gaagcggcga taggaaccga gatcgtcgaa     86700
     gtcgtgactg ccgcgcagaa gcaacgcatc acgcactgcg ctcttgaggt ggccatgagg     86760
     gctctcgatg gagccgttct cgtgggcgac gccacggttg ttgcgtgtgg gctgcatgcc     86820
     gtagtgggcg cacagcgcat cgtaacgcgt ggtcagatcc ttgcgcgcgt cggcatcgag     86880
     attgcggaac gccgccgaca ggctgtcgct gcggtgctcg cgcggcgcgc ccccgagtgc     86940
     ccagatagcg ttctgcagcc cttcggcgag cgcgacatag ctctcgccgc cgagaatgac     87000
     gtgagcgtgc tcaaagcccg agcaggccag ccggaagtga tagaggcggt ggtccagcgt     87060
     gacacccgcc acggtgacgc ccaggctgtc catctctgtg aagtcggaca agcctagctg     87120
     accgggctgg tgtacctgac ggaacatgac gtcatgctcc tcaccatgga gtgcgcgcca     87180
     gtcgcgaata cggcgctcca gtgtgcggcg cacgttgccc gggaggtcgg gatggcgccg     87240
     aagcatctcg tccagtacgg ctatcggccg gatgccggga gcggactgga gcagtggcac     87300
     gatctcggtg tcaaagatcg cggccagggg atcggcccgg cgacgcccgc gcggggcctt     87360
     cttctgcgat ggcaatcgcg gatcctcttc gatgcgatag cccgtagcgg cgctgaaccc     87420
     agcgcgcgca gccgcttggg gcggcccctc cttgagtctg tacttcatgt agagcctcat     87480
     ctgatggtcg ttgatgtgtc ggccgggcaa ctcagcctcc cttcgctaca tggaagagct     87540
     gttcataccc gatttaccgc gaccaccgac aaggcacccc ggcagcgggg cggactcctc     87600
     ggcgcggcgt tgcggcagcg gttccgggct acgccctcca ccgctgccgc aacgcccgta     87660
     ctctcatcct gattgacgcg ctgctctcat cttgtttgac gcgcggcaac gtccatcatc     87720
     acgccttttc tcagttctca gccgctctgt ttttgatgtg cctgagctgc ttcgaggctg     87780
     tcgaagttac cgcggtgatc gcgaccttgc caaagcatga aacgagacac accggaaacg     87840
     acgtatcttc cgatcgtcca cccgctagcg tgtgaccagc cgtagggcga ttcttgcttc     87900
     cactctgctt ctgcgactac ctcggacatc gttctgtttt cctacagttc gtgattcgcg     87960
     gggcacatca gcgcggagtc gcgctcgctg ctcgcgatag ccttccatgt gagcaattgt     88020
     tcaatcgagt tgctcgatct ctgccttttc cgacccgcgc attcctgtat cagcgcttcg     88080
     gtcattttgt tttctgctag gtcagtggcc gagcggcgcg acgatttcaa ttgccgctgc     88140
     gatcgcgagg tagaagccga cgagaccgaa tgcgatgatc ccgatccgcc gactgggacc     88200
     tggctgaatc tggaaaaggt gagccaacac cgttccagtt ttccgccaac tgtccatata     88260
     cgccgcactc agcgacgtct ccgacgacca gatgagcatc gccatctgga aactgacgat     88320
     caacattacg gctaccccaa gcgcttgcag taccaacaaa atttgcctct cttcttcgat     88380
     gccggcgtgc cggcgttttc tagggaaacg ctgatttatt cggctcggcg gtcatcgcag     88440
     acgtagccga ggacgtttag aagacagctc acggaacgga cccacgacga tgaagaggca     88500
     gatcggcttc gcggaagcgg aaattgcagg caagaagcga gtgacgaggc gccaacgctt     88560
     cctggaagag atggagaagg tcgttccgtg gcagcgcttg ctgtcggcca tcgaaccgca     88620
     ctatccgaag ggcacgcgag gtcgcccgcc gattggcctt gagcggatgc tgcgaatcta     88680
     cttcgtgcaa cagtggtacg gactgtcgga cgaaggactg gaagacgcgc tgtatgacag     88740
     catcacgctg cgagccttcg ccggcatcga tctggcgatc gagaacgtgc ctgatgcaac     88800
     cacgctgttg aagttccggc gcctgctgat cgaacacgaa ctgacacgga agttgttcga     88860
     cgagattggc atctcgctgt gcgagcgtgg gctgatgatg aaggaaggca cgctggttga     88920
     cgcgacgatc attgaagcgc cgccgtcgac caagaatgcc gggaagagcc gtgacccgga     88980
     aatgcatcaa acgaagaagg gcaacgaatg gcactttggc atgaaagccc acattggcgt     89040
     cgacgccgac tcgggcctga ttcacagtgt ggttggcacg gcggccaacg tgtcggatgt     89100
     atcgcaagct catgccctgc tgcacgggca tgaagagcag gtgttcgccg acgcgggcta     89160
     cattggcgtc gacaagcgcg aggaaatggc gggcaaggcc gtgaagtggc acgtcgctgc     89220
     caggcgggga aagatcaagg cgatgcaaga aggagcgctg aaggacctgg tgatcgcgct     89280
     cgagcgaacc aaggcgcaga tccgttcgcg ggttgagcat ccgtttcata tcgtcaagaa     89340
     tctgtttcag catcgcaaga cccgatacaa gggcttggcc aagaacaccg cgcaactgtt     89400
     cagcctgttc gctctggcga atctggtgat tgcgcgaaat ctgttgcgat cggtccatgg     89460
     gagcagtccg tcatgcgtat gaaaaatgcg agcaggggag gctcgcttac gcgccaaatt     89520
     cactgaattg agcgccgatt cgcttcgtca tccagaaaat ttgaagccat ctcgcctgca     89580
     acttcggaag ttggtccatt gatcagcgtt tccctaggtg ccggctgctc cggccgttcg     89640
     cgcgctcaac gacaggacca agccagcggc tccgggcctt cccgttcagt gttccgagga     89700
     gttgtcgctg ggcgcgttgc ataatcgatc accccaggtg ctcgatctgc caccggtagg     89760
     tatccaactc tgtatctaat ttctgcgcca tctcaatctt ttccttgtga ccttcgagcc     89820
     agcattgact agtttccgca ctcctatcgg ctcgacgcgc tgacggcgac tcatcagtgg     89880
     cgggtagcca ctagcaacag gatcacaacg gtgccggacg cgatcgccgc gaaggtgctg     89940
     gccggatggg ggaggtgctg tgcaatctca aggccgaaag acagacagcc cataccgaga     90000
     gtagccaggg ccaccaaagt tgcgagcatt cgcatttttt gtttcctctt tgtcagcctg     90060
     agcgctacgc ttcgaacgaa atcagttacg cgtgtgtgcc cgttccaccg ttttccttca     90120
     tgtcggcagc gccggctttt gccggtcaat cgtagcgtct gatcggagca agaccgcgtt     90180
     gctcgcgaag cgcatcttct gcccgctcca tcgacgccaa gcggtactgt gctgacgaac     90240
     agtccggagg gtccagcgcc catacgtgcg gctcccgcgt acgtgccaga gactcaatct     90300
     cggccttcct cggctcgtcg ttttcggatt tcatcatcgc gattttcacg ttgtctgtcc     90360
     ctcggatcaa tcacgtcggc gaaagccggc cgcaagcgat ccgggtcata gagtccaagt     90420
     acccgaccca gacgcatccc tactgtcggg cagccgagct tttccaggta gatcatcgcg     90480
     cccgcacaca tgctctcctg gccgctggcc acatagttgc catcgccatc ccactccccg     90540
     ccagttcgct cgttatgcac ggtcttgtgg cagtgaaacg tgcctcgatc gtccttcacc     90600
     aaggcgtcca cgataccgtc gaggcggcca ggcgcgagct cgatagcccc gaccttgaga     90660
     aacgggcagt tctcacatgg gcgacgcagc ttgaagtgcg agtcatttcc agacgccatt     90720
     acgttttccg ttgcgtagat gctgcgcgcg ttcgcgccgt taccgtcggt aatacatggg     90780
     tcgcaggcct gcctccaaag ctccaaattc cactgcgaaa ccgtgcgacc gtccaaagct     90840
     tttcgttcat tgcgttttcc ggtgcggtat ccgctgaacg tcgaagtggg ctgctgcgta     90900
     acgcgcgttg cagttccaaa cttccgcgcc gtcgcgggtg aatgtcgcgc aaccattctt     90960
     cacgaccatc cttgcgcgcg gaaacacagc actgtggcca ttcgcggctg ccgagaatat     91020
     tgtgcgctcg cggcacgttg cctcgtattc accgtcggca agcattcggt tggctcgttt     91080
     gctgttcatc atgttgacct tgctcagtat ttttccttgc tcagttttcg agcgtctgac     91140
     tcaatgcaca aacagcatcg ctaaaaagcc taacctgcca accgagcccc ttatacacat     91200
     cttcggcggc gtctcgcgct cgtcgtacct tcgccactcc caaggtgtaa cctcgtgcct     91260
     tcgtgcagac cgtcaccgag cctgccggtc gtccgcgtgc gtcgattgcg gtgattacgg     91320
     tccctcggga atcgtcttct gcaatccatc ctgcaggtag ctcgatcggc aatctttcag     91380
     ttcccaccat agtttctccg gttttccggc tcacaaattt tcactttgcg ttgtcgtgcg     91440
     gacactgctt ctgattgtgg tcagccggtt tcccccgaac ggtcgctgcg cacaatgtgg     91500
     tgcacgactc gtctggtcaa cttttcgctt cccgtcctct atcgcgccgt tgccttcagc     91560
     ggcattcctg tgcgcctacg acgcaatacg gtttcgccga cggcgcttgc tagtgcaatc     91620
     gctaggctgg cgcacgtcgc cgcgaaccac gcgggcacat cgagcggaaa cgaccaaagc     91680
     acgccgacgc agaagaccga tccgccaaga gcgaggatcg ttgtgtattt caggactgag     91740
     atcgcgcggt cgaggttcat tgtcttcctt cccgggttat cggtaagcgt gcgtcgatca     91800
     tgaaggtcaa tatagcctct tttttcgttg cgcgcaacgc ttactaagat cgatcaatgc     91860
     tgcttcgatc gcggctctgt ccgtcccaaa atgcccggac agcgcagcca gcgcggctgt     91920
     tgcctcgggc gacaggcggg tgcgattcaa gatccgcccc cccgacgcct ttagtgcctc     91980
     atctaaggcg ttgacgcgct gagtagcagt cttcgcttcg cgggtcggcg gacggcctct     92040
     ggggcgcttt gcttcagtca ttggtcccac caaaatagaa tgagagcggc ctcgtgtgcg     92100
     gcatgaggca tgtcttggtg caatataaca ttgcgcgcaa cggttgcatc gatagatgaa     92160
     cgcagcgttg tttctgctgc gcatctatgc tcgtaatgcc tccacttcga agactgttac     92220
     gaggaagtcc gtctgacgcc cggtatgggc gttcgtaccc cggaaatacg cgattcctcg     92280
     gaaaaccggc gcagcgatcc ggtcgacgct tgccaactgc atcgcgcgat attcgccgcc     92340
     gtttcagtgc ccgctgttct cggctaccat cctgcggttt tccaacagac gatgaacgac     92400
     atgttgacgg atatcgaggc tcttcaggcc caattgcgtg aagtgaacgc ccgactcgcg     92460
     gaggtgaagc gcgacgagaa gcgtgccgca ctggacgcca ttcgcgagca ggtcgcgcta     92520
     tacggcatct ccgaggagga gcttttgctg gctgcaggct ttcgtaagcc gcgtaagcgc     92580
     cgcacttcgg cgaaatacta cgacccgtcg acgggtaagg aatggtccgg attcggccct     92640
     cgtccgaaat ggctggtcgg gaagaacctc gacgactatc ggatagatcg cgccccgaag     92700
     ccgtggtggc ccggcgagtc gtaatacgcg gcgccacgtc aaacgtcaca ctgtccagac     92760
     cgattctctc gtgcggtggg acgctcagcg tccggtgttt atcgtgatcc gcgacttgct     92820
     gtaacctgcc tttatgccgc agctgactgg agacgtcgat gtgctattcc gccaaggtcg     92880
     aagctaacta ccgcgaatac gtgcgccgct acggcgccga catggacatc gagtcattca     92940
     ggcgcctgta ttttgcgcgt gcagcgtccg gcgacatcaa gatcccgaaa gcggtcgacg     93000
     cggcgcttgc agcagctgga gacgacgaga tttcggccgc gatcttcgcg tatcgcactc     93060
     accgtgccag cgagcttgaa tccgagctct ttaagcagcg gacacggctt gcggccgcgg     93120
     agaaaaagct ggcggcgaag gtcaccaagg ccgccagcga ggacgttcga atcgccaccg     93180
     acaagatcga agcggcgatg cgcggcctcg aggatcttcg tcggaccgac ctgcaggagc     93240
     gcgattcccg aattttccct ggttggtatg cgcccgtgtt gattgagctc gatgggaagc     93300
     gcgtgattgt tccgatgcgc tatcggtgcc gactgcctgg atggacggag cgcgatgaga     93360
     ggcaaaagcc cggcacctac aatgcgcgcg tcgattcgtt gtcgacggcg tggcgcaagg     93420
     tgttcgggtt ctcgcatggg ctaatgctgg tcgacgcatt cttcgagaac gtgaagcgcg     93480
     acgagcggaa cgtcgtgctg cgctttgatc cgacgccccg gcagcacatg caggtcgctt     93540
     gcttgtggac gcgcaccgaa atccctggct cggacgatct ctggtcgttt gcggcgatca     93600
     ctgacgatcc gccgccggaa gtcgccgcgg ccggacacga ccgatgcatc tgaatactat     93660
     tagccgttag acgatcgtaa ctcgttgatt gaatgtggat tttgacaacg aatagtttgc     93720
     cgcgcgccgg ccacgttaat acgattcaat aatcgtcagc tatcctccga ctgagtttcc     93780
     agccattgtc aaatgccacg atcctgaagt cccttccggg tattcgatcc ctaattcgcc     93840
     gttggacgag ttcgctgccg cttccggcat gacggaatcg tgtatcgcta cctggcttca     93900
     gccctacccg cctgccacac gccaaccgct tggactccat gacaccgact gcaaagctcg     93960
     ccttgctcac gttaccgccc gtgctggcgg cctgtttcgg cgccctcgcg gccgcttggc     94020
     gagcgccggg cccgaaaacg tcgagcgtga tccagcattt cacgggcggc atcgtgttcg     94080
     cggccgccgc gcttgaactg ctgccccaag accgtgcgca tgcgttgatt ccggtcgtcg     94140
     tcggtttcgt gctcgggatc gcactgatgc tcgcgatcag cgagctatcc ggatcgatcg     94200
     aaacgcgctt cgagacagcg cggctgccgg tgagcctgat catcatcacc gcgatcgacc     94260
     tcgtcgttga cggcctggtg ctcggcattg ccttttccgc gagcgacgaa agcggcatca     94320
     tcctgaccgt cgcactgacg ctcgaggtgt tgttcctcgc cctttcggtc agcgcggcgc     94380
     tggccgcggc tggcatcggc cgcttgctgt cgatcgtcgt tccggtcgcg ctcgcggccc     94440
     tgctgagcgt cgcggccgtt gtcggcaatg cggcgttcgc cgggctgccg gcgaatatct     94500
     atgcagcgct gctggggctg ggcaccgtcg ctctgttgta cctcgtcact gaggaactgc     94560
     tggtcgaagc gcacgaagtg cccgaatcgc cgttcgcgac ggcttcgttc ttcatcggct     94620
     tcatcgtgtt cttcctgatc gaaggatcgg tgaaagtcgg atgaaccggg cgtaacggcg     94680
     cggcggttac caggtcgtcg cgccagtcgg ataggtatcg acgatccgcg tgccgttgac     94740
     cggcgtgaca ccctcgtcgc gtaacgcggt ccagagatcg attgcatgtt cgcgcgactt     94800
     gcggctgccg tcgtcggcca gcacgttcag cgcgatcact tcgtcgcgtg tggtcagctg     94860
     cagttgctcc ttcagcttgc gtgactgatg cgacgcggtg cgaacgtcgc cgagcatgat     94920
     ccgcgtctcc gcgaccgccg aatcgtctcc ggtatcggcc ggcacgaacg tcaaccagcc     94980
     gttgtcgact tcgcatagcc cgcgcgcaaa cctcgcggtc cacgcgccgg ctggcacgac     95040
     cgcgaattcg caaagcatcc gctcgttcgc gcggctgccg acgtcgtggg ccggcgcgtg     95100
     cgacagcgca cgttccggcc agcctgccgc cgtcgcggcc gtcgacatca ggcacgccgc     95160
     cagcacgatt cctttcacga tatttcgcat cgcccctcct tttcttgaat caacgatcaa     95220
     agcaccgcga agcggttgtc gtgcgcgtcg accatcggca tcttctcgcc acgatgaacg     95280
     gtcgagcgat gaacctcctg atttcgcgcg acggcggccg gactcgccgg atagtcgtga     95340
     ttcgggctcg ggatcacgcc gtcgtggcgc gcacgcacga gttcctgaaa cacttcctgg     95400
     cggctcttcg gctgcgcggc cacggcctgc gagaaggcgg caatcgacag cgcgacggcg     95460
     gcaatgccga tcagcggacg cggaatgttc atggggtggg ctccttactg gaattccgtg     95520
     acaggagccg tcactttgat cccgcggcgg tgcggatgcg tgaccgcttc atgacgcttt     95580
     cgtcaccgtc cgcgcatctt gtacatcgca gtacgaatcg aaatcaccgc atgtttccgc     95640
     acgcatgaca ccgcgatgac atttttctca tttgtccatc acctccacga tccgaacgct     95700
     ttccagaatc gccaccgcaa tcgcgatatt ccggcccgtc gcgacacaag ttcggcgccg     95760
     gcatcgaacg atgcacgaaa cgatcacctt caacttcagg aacacaccat gaataatccg     95820
     gttcgactcg tcatgatgtc gggagcgctg ctgacgaccg cgcatgctgc gcatgccacg     95880
     gaagtgatgc tctacggctt gttcgatact tcgcttacgt atgtgtggaa tgccgatgcg     95940
     caaggcaaga acctcgtcgg cctcggtaac gggaacctgc tcggcaaccg cttcggcgtg     96000
     aaaggcgcgg aggatctcgg cggcgggctg aaggcgatct tcacgctgga aaacggcttc     96060
     aacccaaaca ccggcgcgct cgggcaaggc aaccggatgt tcggccggca ggcgttcgtc     96120
     gggctggaaa gcgcgcgctg ggggacgctg acgatcggcc gccagtacga tgcgctcgcc     96180
     gatgtcgcat ggccgatcac cggcgatttc tacttcggca gcgtgtacgc gacgcccggc     96240
     gacgtcgata actacgacac gtcgtcgcgc accgacaacg cggtgaagta cacgtcaccc     96300
     gtggtcggcg gcttccagtt cgtcggcatg tacgcgcttg gcggcgtagc cggcaagagc     96360
     ggcgccgggc aaacctggtc ggccggcctg tcgtacagca acggcccgtt cgacgcggca     96420
     ggcggctact actacgcggc caaccgttca tcgctcgcca atggcatccg gaccgggtgg     96480
     aacggcacat cggacggcac attcgacggg tcgctcgtca acggtggcta tatctccgcg     96540
     aaatcgatcg gcatcgcgcg cggtgcgttg cgctacacct tcgcgccgtt cacggtcggc     96600
     atcgactaca gcaatgcgca gtacaaggcc gatgcgacgt cggcctttcg cggcacgcag     96660
     aagtacgaca ccgcgcgcgg attcttcaac tatcagacaa cagccagcct gctcgtcggc     96720
     gtcggttaca gctacacgaa ggcgcgcggc gatacgagcg cgacctacca tcaggtgtcc     96780
     gccggcgccg actacgtgct gtcaaagcgc accgatctct atgcagtcgg cgcgtggcag     96840
     cgcgcgaatg gcgaacagcg cacgctcgac ggcggcacgc agccagcgca agcgtcgatc     96900
     ggttcctacg gctacggtgg tacgcgcacg cagggcatca tcaatctcgg attgcgccac     96960
     cggttctgaa tcacggcgat caaccatgcg ggccgtgtga cgaaaatttc atgttccgat     97020
     caacttcgcg atgtgtcgtg gcgctacgat cggaacggtg gcgggccctg cccgctccca     97080
     tccacgcagc gggtcgctgc cacacggcac gatcacgcat tgggcccgga ctcatcgagt     97140
     accgggcttt tttttgggcg ttcgacgatc acggcctgga attagactgc gggaacaggc     97200
     atggatgcgt cttaacatgc atgttcggat taccgcagcg atgcccggcg tagtctacct     97260
     gctcgcccgg catcagattg gccggtgccg ccttgcgggc ggcggcagtg gtatcggaac     97320
     gagtcgatac gcagcccgcg tacaacggga cggtcagggc tgcgatcaag gcgaggcgaa     97380
     tggcgggacg aggcaatttc cggtccggaa tgaaggtctg aacgacgccg cccgcgatcg     97440
     atgcggctgt cgcgatcggc acgaatgccg ccggcgcatc ggccaacggc gggcttcatg     97500
     ttccgcttcc cgctcatcgc atccgtgacg cgaacatgac gattgcgtca tatcgaccga     97560
     gtccgtccag tacatcccgc acctcgcaat ctgacgcatt tttcatctcg ctatcacgat     97620
     cacgcacggc tgctttcgca tactgggtcc atggttcgcc acccggcggc cctgatcaag     97680
     gagagcactc gatgaaaacg gcaaaactcg cagcactgtt cgtcaccgcc acgctgtcgc     97740
     tcggcatggc cacgcaggcc gcgttcgccc aaacgcaaac gcagggcaag tcccgcacgc     97800
     aggtgatcaa cgaactgaag caggcacagc acgacggcat cgtgccgatc aacaagacgc     97860
     agtacccgcc gaccgccgag gtcgtcgcgc gcaacaagga actgcacggg atttcggtcc     97920
     atggcggcga gaagaagccg cagaccgaca accacgacgc cctcgccgcg aagtaatgaa     97980
     ccgcagccac accgccgccg gcgacgcgcc gcgcgaggcc gccttgcggc gaacgcgcgg     98040
     gagtgtccgc ccgcgctgtc aggtgctgat ggcggccggc cgtcgcggaa agcgcagcca     98100
     gaaggtcgtg cggcggcccg gctcgctgtc gacgccgcat tcgccgccgt gattgtccat     98160
     gatagaccgg acgatcgcga ggccgagccc cgtgcccgac gccgaattgt ggcgcgacgg     98220
     atcgacgcga taaaaacgct cgaaaatccg cccgacgtgc tccgccgcga tgccgggccc     98280
     cgtatccgac acggcgatcg tcgtcgcacc gccctgctcg acgcaatcga tcgtcacgac     98340
     gctgccgcgc ggcgcatagg tcagcgcatt cgacagcagg ttgctcaacg cgcgctggta     98400
     cagcgtcagg tccgcatcga cccatgcgtg gccgtcgacc ttcacggtca cgccttcatc     98460
     ttccgccagc ggctcgtagt agccggccac ccgctccgcc tcctccgccg cattcaggcg     98520
     ccgcacatcg atcgacgtgc cggcctgttc cgaacgcgcg agaaacagca tgtcctcgat     98580
     catccgcgac agccgctggt attcgtcgat gcttgactcg atcacgctcc ggtattcgtc     98640
     cgcgctgcgc ggttgcgaca gcacaacctg cgcggccgcc tgcaggttcg tcagcggcgt     98700
     gcgcatgtcg tgcgcgagat tcgacgagaa ctggctcagc cgcgtgaacg attcgttcag     98760
     ccgcgcgagc atgccgttga acgcatgctc gagctccttc agctcgccgg acgtatcgag     98820
     ttccggcagc ggatgcgcga gccggctcga cgacatctgc tccgcgcgcg ccgcgaaccg     98880
     ccgcagcggg ctcagcccga gcgcggcgat gccgtatgcg atcgcggccg caagcaccac     98940
     gccgaacacc tcgatcacga cgatcgtata ggcatgcgtg cgcagcagca gcacgtcggc     99000
     gctgcgatcg tactgcacgg cgacgcgcac caccggcgca cccgcgccgg cgagcggcac     99060
     ggtcgtcagc agatactggt gtcttgcgcc gggcggggcg atgccgaccg gcacgcgccc     99120
     ggcgttcgtc aacatcagcg gcgcgtacgg acggaagccg ggcgtgccga cgaggcgcgt     99180
     accggcggca tcgaagatcg cgagatccat gttcggatga ccgtgcaact ggtcgatcca     99240
     gatatcggtg ttgcgcgcga cgtcggccgt cgtgcgcgcc tcggccaggt gtgcgcccaa     99300
     tgcggcggaa ataccggcca tctgctcggc tgccgtcgtt tcgacacggt tgctcagcgc     99360
     ttcgtacaat gcgacgccgc tcgacgcgag gatcaccgac gtcgacagga tgatcagcgc     99420
     ggtcagccgg ccgcgcagcg ttcgcggcag caggcgcgcg atcatgcggc cgcgccgccg     99480
     cgcgcttcga gcacgtagcc catgccgcgc accgtgtgga tcagcttcgg ttcgtacgcg     99540
     tcgtcgatct tcgagcgcag ccggcggatc gccgaatcga cgacgttcgt gtcgctgttg     99600
     aagttcatgt cccatacctg cgacgcgatc gtcgcgcgcg gcaggatctc cccttcgcgg     99660
     cgcatcagca gccacagcag cgcgaactcc ttcgcggtca gcaggatcgt gtcgccctgc     99720
     cgcgtggcct tgcggcgggt caggtccagt tcgagatcgg ccgcgcgcag cgtgttcgaa     99780
     tcgcgcggct ggccgcgccg caggatcgac ttgatgcgcg cggtcagctc gacgaagtcg     99840
     aacggcttcg cgagatagtc gtccgcgccg agctcgagcc ccttcacgcg atcgccgacg     99900
     tcgtcacggg cagtgaggaa cagcacgggc gtcgatttgc tgcgccgcag gttctgcagc     99960
     agcgtccagc cgtcctgccc gggcagcatc acgtcgagca cgagcaggtc gtactcctcc    100020
     gtttcggcct ggtgctggcc cgtgatgccg tcctcgaccc agtcgacaac gtagccggcc    100080
     tcggtcaggc ccttgcgcag atacgcgccc gtcttcggtt catcctcgac aatcagaatt    100140
     cgcatcacgc attacccttg aaaaaaccca gccggcgcag cacgcccgcg ccgaagccgc    100200
     cgcgcaacgc cgcgcgccac gacaccgcat ggctgacccg gtacagcacc ggcagcacca    100260
     gcagcgtcag cgccgtggac gacaggatac cgccgatcac gaccgtcgcg agcgggcgct    100320
     gcacctcggc gccggtgccg gtcgcgaacg ccatcggcag gaagccgagc gacgcgacca    100380
     gcgcggtcat cagcacgggc cgcagccgcg tgagcgcgcc gtcgtgcacc gcggcgtcga    100440
     gcggcatgcc ttcgtcgcgc aggttgcgga tgaacgagat catcacgaga ccgttgagca    100500
     cggccacgcc ggacagcgca atgaagccga ccgccgccgt gatcgacagc ggaatcccgc    100560
     gcagccacag cgacacgacg ccgccgctca gcgcgaacgg aatgccggta aacaccagca    100620
     gcccgtcctt cacgttgttg aacatcacga acagcagcac gaataccatg aacagcgcga    100680
     gcggcacgac gagcttcagg cgctcgctcg cactttgcaa ctgctcgaac tgcccgcccc    100740
     acgacaccca gtagccggcc ggcacgcgca cgtcctgctg caactgctcg cgcgcatcgg    100800
     cgacgaacga gccgacgtcg cggccgcgca cgttcgcgct gacgaccacc cgccgcttgc    100860
     cgtcctcgcg gctgatctgg ttcgggccgg gcgccacgtc gatcgtcgcg agctccgcga    100920
     gcggcacgta cggcgccgcc gcgagcggcg cgctggcgcc ggcggccggc gcgggcagcg    100980
     cgatcggcag ccgcttgatc gcctcgatgt cggagcgcag ttcgtcgggc agccgcacga    101040
     cgatgtcgaa gcggcggtcg ccctggaaca gcgtgccggc cttctgcccg ccgacggccg    101100
     cggccaccga gtcctgcagg tcggccacgc tcacgccgta gcgcgcgagc ttgtcgcggt    101160
     cgaggttgac ggtcagcacc ggcaggcccg tggtctgctc gaccttgacc tccgacgcgc    101220
     ccggcacctt ctgcaacgcg gccgcgatct gctcgccggt ctggttcagc acggccatgt    101280
     cgtcgccgaa gatcttcacg gcgacatcgc tgcgcacgcc cgaaatcagt tcgttgaagc    101340
     gcagctggat cggctgcgag aactcgtacg cgttgccagg cagctcggcg agcgcttcct    101400
     cgatctcgcg cacgagctgg tcacgcggct tcttcgggtc gggccacgtg tcggcgggct    101460
     tcagcatgat gtagccgtcc gacaggttcg gcggcatcgg gtcggccgcg atctcggccg    101520
     tgccggtgcg cgcgaacacg cgctcgatct cgggaaagcg cgccttcagc gtcttctcga    101580
     tcgacttctg catctcgacc gattgcgaca ggctcgtgcc gggaatccgc agcgcggaca    101640
     cggccagatc gccctcgttc aggctcggaa tgaactcgct gccgagccgc gtcgcgagcc    101700
     cgagcgtgac cagcacgatc gcgcccgccc cgatcatcac gcgcgccggg cgcgtcatga    101760
     acgcggcgag caccggttcg tacgcacgcc gcgcccagcc catcaaccgg ttctccttct    101820
     cctcgacccg ctcgccgatg aacaacgcga cggccgcggg aatgaacgtg acggtcagca    101880
     ccatcgcggc ggcgagcgcc atcacgacgg tgatcgccat cggatggaac atcttgcctt    101940
     cgacgccggt cagcgcaaag atcggcaggt acacgaccat gatgatcagt tgcccgaaga    102000
     tcagcgcgcg gcgcgcttcc tgcgatgcgc cgaacacttc ggcaaagcgc tcgtcgcgcg    102060
     tgagcggccg gccggctgcc gactgcgcat gcgcaagccg ccgcacgcag ttctcgacga    102120
     tcaccaccgc gccgtcgacg atgatcccga agtcgagcgc gccgaggctc atcaggttcg    102180
     cgctcacctt cgcgttgacc atgccggtga aggtcatcag catcgacagc ggaatcacga    102240
     gcgcggtgat cagcgccgcg cggatgttgc cgaggaacag gaacagcacg gcgatcacga    102300
     gcaccgcgcc ttcgagcagg ttcttcttca cggtggcgac ggccttctcg accagcaccg    102360
     tgcggtcgta caccggaatc gccttcacgc cggccggcag cgtgcggttc acgtcctcca    102420
     tcttcgcggc gacggccttc gacaccgtcc ggctgttctc gcccatcagc atgaagaccg    102480
     tgccgagcac gacttcctcg ccgttcgacg tcgcggcgcc ggtgcgcagt tcgcggccga    102540
     tgtcgaccac gccgacgtcc ttcatccgca ccggcacgcc gccgacgttg gtcagcacga    102600
     tgttcgcgat gtcgtcgacg gtgcgcgcct ggcccggcac gcgcaccaga tactgctcgc    102660
     cgcgcttttc gatgtagccg gcgccgacgt tgtcgttgtt gcgctcgagt gcgcgcacga    102720
     cgtcggcaag cgtcagcccg tacgacatca gcttcgccgg attcggcgcg acgcggtatt    102780
     ccttcacgta gccgccgatc gagttgacct cggtcacgcc gcgcacgttg cgcagttgcg    102840
     gtcgcacgac ccagtcctgc agctcgcgca ggtcggtcgc cgtatagcgc gtgccgtcgg    102900
     gcttgcgcgc gttggcgtcg gcctcgacgg tccacaggta gatctcgccg aggccggtcg    102960
     acgtcggccc catcgcgggc gcgatgccgg ccggcagctt gtccttcgct tcctggatgc    103020
     gctcgttgac gagctgccgc gcgaagtaga tgtcggtgcc gtccttgaag atcacggtga    103080
     cctgcgacag cccgtagcgc gagatcgagc gcgtctgctc cagccccggc agcccggcca    103140
     tcacggtctc gaccggatag gtgatgcgct gctcggcctc cagcggcgag tagccgggcg    103200
     cggacgtgtt gatctgcacc tgcacgttcg tgatgtcggg caccgcgtcg atcggcagcc    103260
     gctggtagct gaatacgccg agcgcagcca cggccgcgat cgccagcatc accagccagc    103320
     gatgcgcaat tgcaaagcgg atcaggcgct caaacatgtc gggattcctt gaaacggggc    103380
     acggtcggcc gcaccggacg ggccgcgcgg ccggtcaccc ggccgaccgg aaagcaggcc    103440
     gcatagcggg ccgccagtcg cgccacggcg cacgcgtatt gctgctcatt catgttccgc    103500
     gctccccttg ccgagctccg ccttcagcac gaagctgttc gacgccgcgt attcctggcc    103560
     gggcttgagc cccttgagca cctcggtcgc ccgttcgtcg cgccgccccg tttcgacggc    103620
     ctgcgcgacg aagcccttcg gcgagcgcac gaacaccgac ggcgcaccgt cgacgtcctg    103680
     caacgcgtcg ctcgcgaccg cgagcggcac gccctgcctg ccggcgtcga ccgacacgtt    103740
     gacgaacatt cccgggcgcc acacgcgatc cgggttcggc agcacgacgc gcgccggcgc    103800
     ggtgcgcgtc tgctcgccga gcagcgaccc cacgtacgcg atcgggccgc tcgaacgcga    103860
     ttcaaacgcg gtcgcgctca ccgtggcatc gcgaccgacg cgcacgtcgt tgagccgctg    103920
     cgcgggcacc gccatctcgg cccacacggt cgacaggtca gagatcacga acatgctcgc    103980
     gtcggcggca atcgcctcgc cgggcgtcgc atgcttctcg acgatcgtgc ccgcgaatgg    104040
     cgcgcgcagt tcataacggt tcagcgcgcc cgcgccgacc ggcgcattca gcgcggcgag    104100
     cttctgccgc gcgttctgca cggcgatctc ggcctcgcgc aactgcacct gcgcctgctg    104160
     gtaatcctgc tcggcagaaa tacgctcctg ccacagcgtg cgttcgcgtt cgtaggttgc    104220
     gcgcgcaccc gacagccggc gctcggccgt cagcagctcg ctgcggcggt cggccagatc    104280
     ggtgctcgcg atcacggcga gcacctgccc tttcgcgacg ttctggccga gcgacaccga    104340
     cacctgctcg acgatgccgg ccacgcgcgg cacgacgtgc gcggtgcgat cctcgttgaa    104400
     cttgatttca ccgggaagct ggaacggcgt cgcgatctgc gcggggccgg ctttcgcgag    104460
     cgcgatcctc gacgtcgcca gttgtgcgtc ggtcagcgcg atcgcaccgt cggcgcgcgc    104520
     gaacgggaac gacgcggcgt cgttgccgga cttcacgtcg atcgtcgcat cgaacacgtg    104580
     cggcttcgca atcgactgcg cggacacgaa cttttggccg gccgcgtcga atcgcaacgg    104640
     ttcgtgcgtg cgatcgtagc gcaccagcgt gccggacacg gtcacgccct gggtcgccgg    104700
     cttgtcgtcg acgaacggat agacgacgag ccgcgcgtcg ccgggctttt ccgtcatcac    104760
     gatctcgacc gacagcttgc cgcgcttgag cacgacaccg ccgcgcgcgc cgacgccggc    104820
     ggcgtcggtc ggctgcgcgg tttcggcggc ggtcggcgcc gacgcgccgc tgccgccccg    104880
     cgtgacggcg agcgcgccaa tcacgatccc tgcgccgccg agcacggccg ccgcaataac    104940
     gaagattctg ctgcgtgaca tgatgatcct ccagtaagag gcgcgcttat tgcgcgacgg    105000
     ccgcgagcgg cgtgccgacg agccggccga tatcggcgcg ggccgcatgg gcgccggcga    105060
     gcgcacggac gtattgcgac tggccctgga acagcgtgcg ctgcgcgtcg agcacgtcga    105120
     ggaagctgaa cttcccgagt tcgtagccac gccacatcgc gtcgagcgcg aggcgcgcgg    105180
     ccggcaggat gtcggacttc agccgctgcg cttcctgctc ggccgcctcg aaattcgcgt    105240
     atgcctgcgt caactccagc cgcaggcggg tgcgttcgcg atcgagatcg gcgttcgcgc    105300
     gctcggcctt gtgcgtcgcc tcgagcagcg cgcccttgtt cgtgttgaac agcggaatcg    105360
     ggatcgacac gccgaccacc gcctggttgt tcggcacgcc gccggtggtc acgcgcttca    105420
     cgccggcgct gaccgtcacg tccggaatgc gccgcgcgcg ttcgagcgat atggccgcgt    105480
     tcgagcgcag catctcggcg cgcgcgaccc gcgcgagcgg cgcatcgtcg agttgcgcgg    105540
     tcagcgcgga caacggctcg accggcggca cggtttccag gtcgccgagc accgcaagcc    105600
     ggtcgttgcg cgcctcgccc atcaccgcgt tcagtttctc gcgcgcgacc tcgacacggc    105660
     cgcgcgcggt cacgacttcg atctgcacgc cggccgccgc gacctgcgcc ttggtcgcct    105720
     cgaccggcga caccttgccg gcctgcgcgc gacgccccgc gagatccgcc gaacgcgcgg    105780
     cgatcgcggc cgattcttcg gtcacctgaa gctggcgctg cgcggcgagc agcccgtaga    105840
     acgcggcgat cacgtcggcg cgcacggcgg cgccctgctc gtcgagcgac gcgctggccg    105900
     cctcccggcc gtacgacgcg acgtcgagcc gtgcgcggcg cttgccgccc aactcgatgg    105960
     tctggttgat cagcgcggtg gacgtgcgtt cggcgcgact gaagccttcc tgcaggaacg    106020
     acacttcggg gttcggccgc gcgccggcct gcatcagcac gccggccgat gcatcgacat    106080
     ccgcgcgtgc gccgcgcagc gccggattgt tccgggccgc gaccgcgagc gcgtcggaca    106140
     acgtcaacga cgacgcagga agcgcatcgg acggcggtgc gccgatcggc gcggcggcgg    106200
     cacccggggc cggccccggc gacagcgatg gctgcgcatg agccgtcgcg gccatcgcga    106260
     acacgatggc cagggcgagg ttgggtttga gcatgttggt cctgcggtaa cggtttgtga    106320
     ccgatgctac gatcacgccg cagcgcgaac atgacacggt gatgacgttt ccgtcatctt    106380
     gggagagtca agaaagcact tcggaaaccc acggctgggg taaaggttgt gtgaaagtct    106440
     cgctgcccat cgatcatcag atctttctct ggtacgcgcg cggcgccagt tcctcggccc    106500
     tttcctagcg ctcgctgtat cggtcgacca gatttgggcc gtcgtctcgg gtagagtgaa    106560
     cttgactggc tcctccataa cgtcaacgag ccgatcgtaa tgggccgacg gcttcgtccg    106620
     ccctgcttcg tcgaattccg cgaacgcctt ggccgacgac gactggttcg ggatcatcag    106680
     catgcgcatc cagcctcaga gcatgcgcat ccggtttaca gcgttgaacg actgagatcc    106740
     gccgcccacc tgcatcaccg cgagcgtctt gccctgcttc ggccgcaccg cgccgaccga    106800
     cgaaggaatc cagtcgatcc gtgatttcat gatgccggtc attgcgccgt gccgttccgg    106860
     cgagcactac actatgcctt ccgctcacgt caccaccccg cgcaacccgg ccaccttcgg    106920
     gtggctctcg ggtgcaaaat cggacgaagg ccgcccactt ggattgaaca cgcgtacccg    106980
     gcaccaatcg ctgtgaacgg cggcgcagct tcctcgaccg gcaagcagct gaacaagcgt    107040
     tcatgcaggg agccgtgcag aagcacgagc cggggcggat gggtcgacgg tggcgtcggc    107100
     cgcgccttcc ggcacgagga tcagcgtggt gtcgaactga ggcgggtcgt ccaattgttc    107160
     agacgcgctt gccctccgca tcggttacga ctccgccgcc ttccttggtg cacggacctc    107220
     tctgcgggta ggcaatcgtc ggtcaggtca ccggtaccgt ccgcggtctg cattaactac    107280
     cctggctcac tgtcttcgga aggcatggcg gtcccccctc ccattgtttt aacgttacgt    107340
     ggcaggctca gctgccgtgg cactcttgtc gaaaggcttg taggccagca accgcagcgc    107400
     gttggcaacc acgagcaagg tagacccctc atggaagatg accgccgtac cgatgttcag    107460
     ccctagcacg gttgccggaa tcagcaccgc cacgacgcca agactcatcc acaggttctg    107520
     cttgatgacg cggctcgtac ttctcgacag gcccacagcg aacggcaatt gcgccagatc    107580
     gtcggccatc agtgccacgt cggcggtctc caacgcaaca tcggagcctg cggcacccat    107640
     cgcgatgccc acggtcgcgt tagccatggc gggtccatca ttgacgccgt ctcccaccat    107700
     cgccaccttg ccgtgctcgg tgcgcagttt cttgatctcc tcgaccttct gctcgggcat    107760
     aaggtctcct tgggcctcgg tcaggccaac ggtttgcgca acggcctcgg ccaccttctg    107820
     gctgtcgccg gaaatcataa ttagccgctc gatgccgagt ttcctgagtt cgcccatgac    107880
     tcggccagcg acggggcgcg gcgtgtccat gacgccgatc acgcccagga agcgcgctcc    107940
     cttgcggatg atcatcgtcg tatgtccgtc ggcgatgagt ttcttgttgg cctcgtcgat    108000
     gtcatcaggg acggttgaat cagacagctc cctgaacaga atcggcttgc cgatgtggac    108060
     agtctcgccc cctaactgag cccggacacc gcgcccggtg atgcttttga catccacagc    108120
     ctgcggcaga tcggtcttgt ctcgcagccg ttccttcgcc ccgttgacaa tcgccgcggc    108180
     gagcgggtgg tcgctgtgtt cttccaccgc cagcgccact gccagcagtt cgtgctcagg    108240
     cacgccttga gctgggacca cctcggtgag cttcggcttc ccctcggtca gcgtgccggt    108300
     cttgtcaaag gcaattgagg ttagcgtgcc caggttctcc aaaggcccac cacccttgac    108360
     cagcacaccg ctccgcgcgg cgcgcgctac gccgctgaga actgcactgg gcactgagat    108420
     tgcgagcgcg caggggctgg cagccaccaa cacggccatc gccctgtaga aggtgtggga    108480
     gaatggctca tcgataacaa caccagcgca cagcagcaga ccgaccaaca ccagcactga    108540
     tggcacgaag atgcgctcga acttctcggt gaactgctgt gtcggcgagc gctgggcctc    108600
     cgcctcagtg accatcttga tgacgcgcgc catcgtcgac tgatcggcct ttcgggcgac    108660
     catgatatcc atggcgcccg cgccgttgat cgtgccggcg aagacgcggc tctcagccgc    108720
     tacgccctcg aagcgcccga ttgtgattcg gccatcctcg acggggcgct tgtcgactgg    108780
     aacactctcg cccgtgaccg gtgcctgatt gacgctggaa gtgccaacga ccacaacacc    108840
     gtccgcaggc agccgctcgt tgggcttcac gacgacgacg tcgcctactt ccagcttctc    108900
     cagtggcaca acctccgtcc cggaatcgcg ccgcaccgtg gccgtgtcag gtgcaagctt    108960
     ggttaaggcc tcgatggcac gccgggccct acccatggcg tagtgctcga gcgaatgccc    109020
     aaggctgaag aggaacagca acaaagcgcc ttctccccag gagcccagag ccgcggcacc    109080
     cgcagccgct acgagcatga gcgtgtcgat ctcgaaacgc ttggcacgca ggttctcgat    109140
     ggcttcttgg atggtgtagt agccgccgaa gaagtacgaa accacgtagc agtgggtgga    109200
     cagccattca agaccggtgc cgcgtcgccc cacgagccat ccagccatca ggaagactcc    109260
     ggacaagcaa gcaaagatca gctcggtctt ttcgccgaac aacccgccgt gtcgatggct    109320
     gtgctcgccg ccctcgtctt tcccgcaagt gtggttggct cgctgcagcg cacggtggtc    109380
     attggcagcc gccttatgcc ctgccgtgcc ggaatctgcg gatgccttgc aagagcggac    109440
     cgccgtggtc ggctgaacag ccggcgttgc ccaattcaca gagatatcga gtaaggtcag    109500
     gcgctgcgtg agatcggact cgtcagtgag ggaacggtcg tattcgatgc ggacaacgcc    109560
     gcttggcgat acgtcggcct caatgatccc accgagtgag cgcagctgct cagcaacacg    109620
     cctggtggca cgcacatgca tcggcgcatt cactcgtccc acaatgtgcg cgaagcggcc    109680
     cgccacagcg agcccttcag accgaatcag ctcacgcagc ctgcttagtg agatcacggc    109740
     ggggtcgtag tgcacacaca actgcggctc tccttcagcc gcgccagtga tatgagcccc    109800
     ttcaatgcca ggcctgtccg ccagcttgtc ttgcaggcgg ctcacgcagc ggtcttcggc    109860
     gccatatatg tccggcagaa ccaacggcag atccagccgc agcttctgga tgtcgctcat    109920
     gaacggctcc attttcatac aaatggccag ccggcccgga aggttcaccg gccaccaggg    109980
     tgctccatca gcaagagagt ctatcagtcc gttccaatcg ccggcaaata gcgccggctg    110040
     cgctgcccga agcagatgct ccgagctgag atcaggatac caatcaatca gataggggcc    110100
     gacgtcgcgc gggtcaggac gtgaaattcg ccaacttcca ttacgtccag tctcttccgg    110160
     tccgtgaccc gaacgggtta tggcgccccc cgcgtctcgt ctaatccctc gctgacaggt    110220
     tgaaggtcgg ccgggataag cacttatgcg aaggttcgca tattcacgaa tcccggcgga    110280
     ccctctacta actgttacac gatggtaagt cgttgttttg gtatgcactt ccactacgaa    110340
     cagtttgccg ctcgccaaca tcggagcgct ctaatttttg ccgtaggtgc ccgcatcgct    110400
     cgagtttgcg cccgacaagg ggccgcggtt cgacactatc aaatccaggc attccaatgc    110460
     agggccgaaa tatcgaccga tttctttcct gctttcgata tttcgactac tattgaaaca    110520
     tggaaacaaa ccaaaccatt gccgccctcg cggcactcgc ccacgaatcc cggctcgccg    110580
     tctttcgtgc actcgtgcaa gcggggccgg agggcatgcc ggccgggcag atcgccacgc    110640
     tgctggacgt gccgccgtcg tcgctttcct ttcatctgaa ggaactggcg catgcacaac    110700
     tcgtcaccag ccgccaggaa ggccgcttcg tcttctactg cgcgaacttc gccacgatga    110760
     acggcctgtt ggcttacctc acggagaact gctgcggcgg caatccctgc tcgcctgcgg    110820
     gcgcgtgttc cccggtcaag gagcaacact catgaagcgc ttccatgtgc acatcagcgt    110880
     gccggatctc gttgacagca tccgtttcta ttcggcgctg ttcgccgctg agccgaccgt    110940
     cgtcaagagc gactacgcga aatggatgct cgacgatcct cgcgtcgact tcgcgatctc    111000
     gcagcgcggc gcggcgcccg gtctagatca tcttggcgtg caggtcgaaa acgatgccga    111060
     gctggcggag atgcatacgc gcttgaacgg cgccgcgctg ccggtcgacg agcaaatcgg    111120
     tacggcgtgc tgctacgccc gctccgacaa gtactggacg gtcgacccgc aaggcatcgc    111180
     atgggaaacg taccagacgc tcggcgacgt ccccaccttc ggcgaatccc gtaacgcgtc    111240
     ggcggctgaa tcgaatgccg acgcttctgc ttgctgttcc cctgcacgcg gcaagccgat    111300
     cggcgtgccg gtgaaatcgt cctgctgctg aggtccaacc atgagcgaca agccctacaa    111360
     cgtgctgttc atctgtaccg gcaattccgc ccgatcgatc ctgtccgagg gactgatgaa    111420
     ccgccttggc gagggccgct tcgtggcgta ctcggcgggc agtcatccga aaggcgaggt    111480
     gaatccgttc gcgctgcgcg agctggcgcg ttggcaattg ccgaccgaag gctaccggag    111540
     caagagctgg gacgaattcg cggcacccgg cgcaccggcg ctcgatttcg tcttcaccgt    111600
     gtgcgacaag gccaccggcg aggtgtgccc gatctggccc ggtcaaccga tcaccgcaca    111660
     ttggggtgtg cctgacccgg ccgacgtcga gggctccgac gaacagaaac agcaggccat    111720
     gcacgacgcc gcgctgacgt tgaagcgtcg tatcgacctg ctgctgtcat tgccgctcgc    111780
     caaactcgac aacgtcgcac tgcaaaagtc cctgaccgag atcgggcaaa agtaactttg    111840
     gatcgtcaac ccatgaccac gaacgtactg atcctctgca cccacaactc ggcgcgcagc    111900
     gtgctgtccg aagggatgct caatcattgg gccgcgaagc tcggcaagga cgtccgcgca    111960
     tacagcgccg gcagtgcgcc gagcggtcgc ctcaatccgt tcgcgctgga agcgctgacg    112020
     accgctggcg tcgacgtgag cggctaccgc agcaagagct gggacgagtt cgtcggcgat    112080
     ggtgcgccgg agatgcgcgt cgtcattacg gtgtgcgaca gcgcggccgc cgagacgtgc    112140
     ccgtactggc ccggcagccc cgtcaaagtg cattggggct acgccgatcc gtcgaacgcg    112200
     ttgggcggcg acgaaggcaa gcgactcgcc ttcgaactca cgcgccaggc gatcggctat    112260
     cgcatgctgc agttgttggc gctgccgctt gatcgcatga gcaatgccga actccagacg    112320
     gcgttgaccg agatctcgca aaactgacca ttcgcatggc ggtccgctga accgcgcggc    112380
     cgccgacgac ttcaagactg aaccctatcc atgaacacgt ccaatgtcgc cccgccgggc    112440
     aaggccgtcg caaagccttc catcaatttc ttcgaacgct acctcaccgt ctgggtggcg    112500
     ctgtgcatcg tcgccggcat cacgctcggc caggtgctgc ccggcctgtt ccagcagatc    112560
     gggcggatgg aatatgccca gatcaatctc ccggtcgggc tgctgatttg ggtgatgatc    112620
     atcccgatgc tggtcaaggt cgactttggc gcgctgcatg aagtgcgtca gcacgtcaaa    112680
     ggcatcggcg tcacgctcgt cgtcaactgg ctcgtcaagc cattttcgat ggcgtttctc    112740
     ggttggttgt tcatccgcca tctgttcgcg ccgatgctgc cgacggacca gctcgacagc    112800
     tacatcgccg gcctgatcct gttggccgca gcaccgtgta cggcgatggt gttcgtgtgg    112860
     agtcgactga cgggcggcga tccgctgttc acgttgtcgc aggtcgcgct gaacgacagc    112920
     atcatggtga tcgccttcgc gccactggtc ggcctgctgc tcggcatgtc cgcaatcacg    112980
     gtgccgtggg cgacgttgct tacgtccgtc gtgctctaca tcgttatccc ggtgatcatt    113040
     gcgcagatcc tgcgtaagcg gctgctcgcg aatggtcagg ctgcattcga tgccgcgatg    113100
     gcgaggatcg gcccttggtc gatcgcggcg ctgctggcca cgcttgtgct gctgttcgcg    113160
     ttccagggcg aagcgatcct gaagcagcct ctggtgatcg cgctgctcgc ggtgccgatc    113220
     ctgattcaag tgttcttcaa ctcggcgctc gcgtactggc tcaaccgcgc cgtaggcgag    113280
     aagcacaaca tcgcgtgccc gtcggcgctg atcggcgcat ccaacttctt cgagcttgcc    113340
     gtcgcggccg cgatcagcct gttcggtttc cattccggcg cggcactggc taccgtcgtc    113400
     ggcgtgctga tcgaggtgcc ggtcatgctg ttggtggtgc gcatcgtcaa ccagtcgaag    113460
     ggctggtacg agtgccggac ctgacatgtc cacgcatgca ccccgcccgc acgcatggct    113520
     gacgccgtcg ctcgggctga cgcagatcgt cggctggggt tccatgtttt acgcgtacgg    113580
     cgtcctgatg caaccgatgc aggacgagct gggtctgtcg aagccagtcg tcgtcggcgc    113640
     ctattcggtg gcgctgctga tctcggggct gttgtccacg tcggccggca gcatcatcga    113700
     ccgcgtcggc gggcgcgccc tgatggcggg cggatcgttg ctggcggcgc tgatgcttgt    113760
     ctgcttgtca cgggtgaata acgtggtcgg gctgtatctc gtgtgggccg gcatcggcgt    113820
     tgcgatgagc gcaactctct accagcctgc gttcaccgtc atcacgcaga tattcggtaa    113880
     cgactaccgc cgcgcgatca cgcacctgac cttgttcggc ggtttcgcca gcacggtgtt    113940
     ctggccgctg acgcaaacgc tgttgcagca cgtcggatgg cgcgacacat ggcagctcta    114000
     tgccggcgcg aatctggcga tctgcgtgcc cgtgcatgtc gcgctgccaa gtcgttcaca    114060
     cgcaccgcat ggcgtgacgc caacgcaaac ggaacagccg gccgctaacc ttggcgctgt    114120
     cctgcgcgac ccggccttct atctggtgac cgcggcggtc acgctcaatg cgctggtgtt    114180
     cgccgcgatg tcgctgcaca tgatcgcggt cttgcaggcg catggcattt ccgccgcgaa    114240
     cgcggcatgg gtgggggcgc tggttgggcc gatgcaggtt ctcggccgcg tgctggaaac    114300
     gacgatcggc aaacgcgcga gcacgcgcca ggtcggcatg gccgcgatgg cgttgctgcc    114360
     gctttcgctg gtcctgctct ttgcgtccgg gacgtggctg cccgtgtacg ttgttttcgc    114420
     ggcgctgtat ggcatcggca acggcgtcat gacgattgtc cgcggtgcat tgcctgcgga    114480
     actgtacggg cgaaccgcct atggcgcgat cagcggggcg atggcgacgc ccgtgcagat    114540
     tgccatcgcc gccggtccgt tcgttgcatc actcctgtat gtcgccggga acggctatcc    114600
     cggcacgcta ttggccctgg ccggcatcgg cgcgacaggt gcgatcctgt tccgctacgc    114660
     gatcttgcat ttgcgccatc acgctgtccc tctatcgaag caaggaatct cgacatgagc    114720
     aacatcacga tctatcacaa cccggattgc ggcacgtcgc gcaacgcgct ggccctgatc    114780
     cgcaacagcg gcgaggagcc tgtcgtcatc gagtatctca ggacgccccc gtcgcgggaa    114840
     acgctggtca agctgctggc cgatgccggc ctgaccgtac gcgagttact gcgggagaaa    114900
     ggcacgcctt atgcggaact cggtctgggc gatccgaagt ggaccgatga gcaactgctc    114960
     gacttcatcg ggcagcatcc gatcctgatg aaccggccga tcgtggttac gccgatcggc    115020
     acgaagctat gccggccgtc cgaagccgtg ctggatatcc tgccgaaccc gcagacgggg    115080
     cctttcacca aggaagatgg cgaagtcgtg atcgatgcgg agggcaagcg tgtctgagca    115140
     attgaacgac atgccgcagc tcgacgccac gctgttccgc gtgccggacg ccgctcaatt    115200
     gcggccggcg acaccgtcga cgcatccgcc tcgactcctg cttctgtacg gctcgctgcg    115260
     cgagcgttcg ttcagccgtc tgctggtcga ggaagccgag catttgctca cggcgatggg    115320
     ggccgaagtc cgtgtgttca atccgagcgg cttgccgctg cccgatgatg cgccggaaag    115380
     ccatccgaag gtggtcgagc tgcgcgagct ggtgatatgg tcggaaggca tggtgtggtg    115440
     ctcgccggaa cgacacggcg cgatgacggg gatcatgaaa tcgcagatcg actggattcc    115500
     gttgtcggtc ggcgcagtcc ggccgacgca gggcaagacg cttgcggtga tgcaagtcag    115560
     cggcggttcg cagtcgttca acgccgtgaa ccagatgcgc gtgctcggac gctggatgcg    115620
     catgctgacc atcccgaacc agtcgtcggt ggccaaggcg ttcgcggaat tcgacgaagc    115680
     gggtcggatg aaaccatcgc cctactacga tcgtgttgtc gatgtcatgg aagagctggt    115740
     caagttcact ctgctgaccc gagatatcgg cccgtatctg gtcgaccggt acagcgagcg    115800
     aaaggaaagc gccgaggaac tgtcgaagcg cgtgaaccag cgaagtatct agaatccggt    115860
     ccaaggagta aggatggaga tccgccccgc cactgtcgac gacctagcgt cgatcgaaac    115920
     gctgctgcgt caatgtggcc ttcccgtcgt tggcgtcagc gaccacttgc ggaacttcgt    115980
     agtcgcgacg gaaggttcaa tgatgtgcgg atgcggtggc cttgagcact atggtgacgc    116040
     cgcacttgtg cgctctattg cggtagctga acgtgcacgc gattctggtc cggggcaacg    116100
     tatcgtgtcg cggctcgtcg ccgagtgtca tgcgctacaa gttcggtcgc ttgtgctgct    116160
     caccacgacc gcggagcact atttcacccg tctagggttc gtgcgcgttg cgcgtggcga    116220
     cgtaatgccc ttggtgttgg cgtcgagcca attccaaggc gtatgtccgg gatcggccgt    116280
     ctcgatgttg cgagttctgt agccattgac gggagcacca agggatcggt ccgacaaggg    116340
     ggatctgctt gccttcgatg cgatttaccg gtggtcgccc ccggtcaaag attattggct    116400
     gccgtatttc gcttgccagc gcttcatctt cgtaatttct tccttttgtg ctttgacgat    116460
     gcttcgggca agccttctca tctcaggatc cttgccgtac ttcagttcgg ctgccgccat    116520
     atcgattgcg ccttgatggt gcggaatcat gtgggaaaca aaatctttgt cagcgtcgcc    116580
     ggtgtaggtc tgtccttgca tccttcgcat catcctctgg tctgcaccct tgaaggcttg    116640
     tacagacgcc gaattagctt tagtcgactg ccccatattc atgtctggca tggacgtggc    116700
     ttgctgagca ctcgttgtac cgatcatcag gccgagcgtt gcaattacgt tgatgacgaa    116760
     ccacgggatg gaaattcgcg tttgcatatt tacctcctga tgcataaaaa ttatgctttc    116820
     gggaaacgaa caatttttgc tggtcgaact ttttccactt tcgacactga ttcgaggctt    116880
     catgacggcg caatccacgc tcctgtgccg cgcactagta ccccttcgag gagaatcctc    116940
     atcgttcccg cgggaattgc aagtggaacg tcgtactgac gtcgttactc gaaacctgga    117000
     cttgtccccg gtgcagttcc atgatcgatt tcacgatcgc gagtcccagc ccggcattct    117060
     tcgaggatcc atgacgtgac gcgtcgacac ggtagaagcg ctcaaagatt cgatcaagat    117120
     gttccggcgc gataggccgt ccgtggttgg tcacttcaac gacgacgtat tgcagcgagc    117180
     gagacgaggc gagtttgatt gccgtgcctg cgaacgcatg gtccaaagcg ttggatatga    117240
     ggttgctcac cgctcgtcga aaaagcgttg catccgcgac cacatgcgcg tcgccgacga    117300
     cgacaaaatt gacccccttt tcgtccgcaa tgctctgata ataggacgcc agtcgttgca    117360
     gttccatctc agtatcaagg tccgatacct tcaggtgcag gtgtgcattc tctgtacgtg    117420
     caaggaacag catgttctcg atcatccgtt gcagacgttc gcattcttcg atgttcgaat    117480
     cgatcaacgc ctcatattcg tcgctcgttc tcggtcgcga caacgtgacc tgcgacgagc    117540
     tgatcacgtt ggcaagcggg gtgcgcatat cgtgggcgag gtcggaggag aactgagaaa    117600
     ggcgcacaaa cgcacgttca agtcgatcca gcattcgatt gaccgacgac gcgagttcgc    117660
     ggagctccat cggaccgccg cgaatgtcga gtcgctcgct caaattgtgc gcttcgataa    117720
     ttgacgtctg gcggcccaga ctttccactg gacgaaggcc tcgacgtgcg atcgcatagc    117780
     ccaagccacc gagcaatatc gcgccgacgg cgaccgccag ccagatgtcg acgcgatagc    117840
     ttttcagaag cgactgccgg tcggtcgcgg tccgtacaag ggcgatccgt acatcttcgc    117900
     ctgacggcag cctgtcgcgc gcgaaaacac agcgtgatgg cccgattccc gtcggatcgc    117960
     acgtgtatgg aatacgaggc ggacggtcgc tcgaggcgat cgacttcaac gtcacgcccg    118020
     gcgcggccgt gtgctcgatc agcgaattgt tttgcccgtc gtagatccca agatacacac    118080
     cgggatgcga gagcagtacc tcgtgaaata ccgcaggcgt tgcacgaatg gcctgtaccg    118140
     aaccgctggc gtgagccaac tgcagaaact ggctcagctt gccaccgatt tcgatgtcgt    118200
     cgcggcgctg cagttcaatc gacagggacc gatacaggta agctccagtc agcgcaaacg    118260
     ctagtcctgc gacgacagcg aaggcgacgg tcaaccgagt gagcagtgag taaggtgccg    118320
     ccttccccgt catgaacggt cctcgagcac gtatcccatg ccccggatgg tatggatcag    118380
     tttcttatcg tacgcgttgt cgactttggc gcgcaggcgc ttgatcgcgg catcgaccac    118440
     gttcgtatcg ctatcgaaat tcatatccca gatctgcgag gtaatgaaag tacgcgtcaa    118500
     aacctcgccc tctcgttcag ccaggagttg caacaatgcg aactcctgtg cggtcaggtc    118560
     gatgcgattg tcgccgcgac gcactcgccg cttgaggagg tcaatctcca tgtccgcaac    118620
     gagcagaatg tcccgaatgc tccgcggtgc gcgccgtagc aacgaacgga tgcgtgcgag    118680
     aaattccgcg taggcgaacg gtttgtgtag atagtcgtct gcaccaagtt caagcccagc    118740
     gaccttgtcc tcgattgctt cgcgggcggt cagcatcagc acgggtgtct gcttttccgc    118800
     gcggaggcgc ttcagcacct cgaacccgtc cagctccggg agcatgacgt cgagcacgac    118860
     gaggtcaaaa ttttcatgca gcgcgagaaa caatccgatt ttgccgttct cggcaacatc    118920
     gacggtatag ctcgcttccg tcagtccctt tcggagatat gacgccattt tcggttcgtc    118980
     ttcgactatc agtatccgca tgggagtgca gtaggactgt caacgggttc gacgcgggga    119040
     gcgctgcgct cagcatacgg ccgcgaaagc gcgcaaaaaa tgacggccgg atgacaattt    119100
     tttcatgaat ctccgagcgc cggaacagcg agagccgtcc accgccgctg gatgaaaaaa    119160
     tggtcatctt tcgaccacgc cgtcgtcacg catcggccgt taagctaaat accggctata    119220
     ccgcttgtgg ttacacccgg acacgttctc gatgttatcg tttcgaactg ctcgtgctag    119280
     actccgcacc catgtcatat tggcgcaaac tcttcgtcgt cgtgctgttg gcactgagcc    119340
     tgccggttca gtcgttcgcg gctatctcga tgaattgcgt cgcttcgcat gccgaagcca    119400
     gcgaaacgcc gatcgtgcat gccgggcagt ccatgtccgg gcatcatcgc gacatgcatg    119460
     gagcggcgct cgcggccgac gaccatcaca cttatcacca cggcggcggt catcacgcgc    119520
     attcatgttc gacatgcgca gcctgctgct tcggcacggg attacccgcg gttccctccg    119580
     tcgtcgtatc gtcggacgta acacgcgtca ccacctcgat tccgccttct gccggtgtcg    119640
     tgtctttcct gaccgacggc atcgagcgac ctcctcgcca caccctcgtc tgattctcca    119700
     ccgcgggtaa tgcccgcgat gtgccattcg tactgacggt cttgcgtgga cccgtcagat    119760
     gattcacgac gagaaaattt atgcgactga tttctgcggc gctgctcggc gcggcggctt    119820
     cattgccgac gctcgtgcac gccaccacaa cgattcccga cccgacggat gccgcggcct    119880
     cggtcccggc gatttcggcg ccgtcggcct tcaacggcta tcgcccctac aacgacgccg    119940
     acaacccgac ctggcaacaa ctcaatcaag cggtccagga gaagccggcc aagggcggca    120000
     tgacgcacgg cggcgcaatg ggccacggcg gcgccatgaa caagcccgct ggcgaccatc    120060
     agtcgaatca ttcgcagcat ggggagcccg ccaaatgatg aagcgactcg tttcaacgcg    120120
     catgggtgcg ggcgtttcca tcatggtgtt tctggctggc tgcaccacct tctcgaagga    120180
     cggtggattc ggtacggtgt cgtcgacggc tacggagcgg ctcggtaagg acgcggttat    120240
     cgtcaaaacc gatgccgatc gggatgcagt ggcgaagcga acgcaggaat tgctcgccaa    120300
     gccgctgtcg atggacgatg ccgtacaggt cgccctgctg aacaaccgag gactgcaggc    120360
     ctcgtatgcg gaattggggc tgtcggaagc cgatttggtc caggccgggc gactgccgaa    120420
     tccaggcttc accttcagcc gcacgcgagc gggcaacggc gacctgagca tcggccgcac    120480
     attctccgcg aacgtactca gtattctgac gctgcctttc gctgcccaca tcgagggccg    120540
     acgcttcgaa cagacgaagc tcgagactgc cgatacgatg ctgaagctcg ccgccgaggc    120600
     gcggcgggcg tacgtcaacg cggtggccgc ggagcaggct gccaagtacg cggaacaggt    120660
     aaaagattcg gccgacgcag gcgccgaact cgcttcacgc atgcggcagg ccggaaactt    120720
     cagcaaactc gattatgcgc gagagcaagc cttctacgcg gactcggtcg cccaggccgc    120780
     caaggcccgg cagcaagccg tatcggccag ggagaaactc acgcgcacga tgggcgtatg    120840
     gggcactggt acgcagtaca ccttgcctga gcgtttaccg gacttgccaa aggaccgccc    120900
     ggaactgaaa gatcttgagc ggtttgcgat gcagaaccgg ctcgacatcc aggcagcgaa    120960
     gctgcagacg caaggcgtcg catcgtcgtt gggcctcagc aaggcaacgc ggttcatcaa    121020
     cgcaatcgat gttggttacc aaaacaacta cgaaaccgac aagggtcacg agcacggcta    121080
     cgaaatcagt atcgagattc ccattttcga tttcggcagc gccaaggtcg cccgcgcgga    121140
     agccatctac atgcagtcgg cgaaccgcct tgcccaaacg gcgattgatg cacgatcgga    121200
     ggtccgcgag gcgtattccg cgtacgtgaa cagctacgac gtcgcgaaac actatcgcga    121260
     cgaggttgtg ccgattcgca agacgatttc tgacgaactt ctgctccgct acaacggcat    121320
     gctcgccagt gtcttcgaac tgctcgccga ctcgcgcgag caagtcggcg cggtgaacag    121380
     ctacatcgac gcgctgaagg actactggct cgccgaaacg gatctccagc aagcgctggg    121440
     cggacgttta ccgagggctg gggccgagca aaccgagcag acgcctccgg ggccgaattc    121500
     cgcaccgcag tccgccccga gaccggcagc ccggccggag cctgcctcga ccgcgcaacc    121560
     ggcgcatgaa acgcattcgg aaggtaaata acatggtgtc ccgtcgacaa tttctcagcg    121620
     gctcgggggc cgcaatcctc ggcgccgcga tggtcagcaa ggccggcgcg gcttcgttgc    121680
     cggaagcacc gaccatggca aaggcgacga tgcagccgcc gctcgtgcca cccaacggtc    121740
     ggccatacac accggtcgcg acgttgaacg gctggacgct gccgtggcgc atgaagaacg    121800
     gctggaagga gtttcacctg acagccgagc ccgtcgtgcg cgaaatggct cccgggatga    121860
     aggccaatct gtggggttat aacggtcagt cgcctggccc gacgatcgag gccgtcgaag    121920
     gcgacaaggt ccgcatcttc gtcaccaaca agctgccgga gcacaccacg atccactggc    121980
     acgggatgct gctaccgaac ggcatggacg gcgtcggcgg cttgacgcag ccgcacatcc    122040
     cgcccggcaa gacgttcgtc tacgagtttc agctcgagaa gcatggcacg ttcatgtatc    122100
     acccgcacgc ggacgagatg gttcagatgg cgatgggcat gatgggcatg tttatcgtgc    122160
     acccgaagga ccgcagcgtg atgccggtcg accgcgattt cgtgttcctg ctgtccgcct    122220
     atgatatcga cccgggcagc ttcacgccgc gtgtgaacga gatgaccgac ttcaacatgt    122280
     ggacgttcaa ctcacgcgta ttccctggca tcgatccgtt gccaattcgg gccggcgacc    122340
     gcgtgcgcat ccggttcggc aatctgacga tgacgaatca cccgattcac ctgcatggct    122400
     accacttcga agtggcgggt acggacggcg gctggatccc gccggccgct cgttggccgg    122460
     aggtgacggc cgacgtcgcc gtcggccaga tgcgcgcaat cgagttcacc gccgatcgtc    122520
     ctggcgactg ggcgttccat tgccacaagt cgcaccacac gatgaacgca atgggccata    122580
     gcgttccgaa catgatcggc gtgccgcaga aggacttggc caaacgcatc aacaagctcg    122640
     ttcccgacta catggccatg ggcagcaccg gtggcgcaat gggcgagatg gagatgccgc    122700
     tacccgacaa cacactgccg atgatgaccg gtacgggccc attcgggccg ttggagatgg    122760
     gcggcatgtt cacagtcgcc aaggtccggc aagggctcgg gcggaacgac tatcgcgacc    122820
     cgggctggtt caagcatccc aaaggcaccg tcgcatacga atacaccggt gaactgccgg    122880
     acagttgatt tacacaacaa ggtcggggca cgcccgaccg tcggtttcat cacctcaact    122940
     ctggagaagc acgatgaaga aagcactgtt ctcgattgca ataggctgcg ccctggcgtt    123000
     ctctgcgtcg acgtacgcgg caggcgacat gggcaacatg gacatgagcg gtggcacaaa    123060
     gcaaagtacc gacgcgaaga gcagcatgtc gcacggcgag atcaagaaag tcgacacgac    123120
     tgcaggcaag ctgaccatca agcacggtcc cctcgaaaac cttggcatgg aagcgatgac    123180
     gatggtgttc aaggccaagg atccggcgat gctgtcgcag gtgaaggtcg gcgacaagat    123240
     cgatttcgtc gccgaggaag tcaacggcgc actgacggtc gtcaagctgc agaagcagtg    123300
     acgacaatcg acggggacgc gcagccgcgg tccctgtctc attcttcgag acgagcaaca    123360
     atatgaagat tttgaccctc agacattttg ccggcctcgc cgtcgctagt gctgttgcgt    123420
     tcgcgcccat cgccgcgctc gcacacggca aactggaaag cgcaacgccg gcgtcgggca    123480
     gtaccgtcga cgtcgcgccg gacgcattgc gcctgacctt caatgaagac ctcgagtcga    123540
     ccttcagctc ggtgaaaatc gccgatgcta cgggtgcgcc ggtgacgaaa gaaaaggcga    123600
     agatcgatgc gtcgaatccg cgcgtcatga cgctcgtcgt accgaagctc gcgtcgggag    123660
     cgtatacggt tcagtgggcc gtcatgactt cggacgcgca caagaccaag ggtacgtaca    123720
     cgttcaaggt gaagtaatga acgacgggtt cctgggcatc ctgcgtctga tcgccgtagc    123780
     gatccagaac gttggcttcg ccgtcatcgt aggcgcgttg ctcagcagtc aatggctcgc    123840
     gcgcggtgac tccacgtggc aagccgacgt gggccgacgg ctcgtcctga cagtccggat    123900
     ggcgtccacg cttgctctgc tcgcgagcgt gttgtcgttc tgggcacatt gcgcgctgat    123960
     gagtgagtca acgttgcttg aggccgggcc cgcggtgtgg tcgatgctcg tgggaaccgg    124020
     ctttggacac gcgtggctgg tcgctgcagt tttcatggtt tgcgtggtcg tgctggcatt    124080
     gctgcgatcg ggtagcgatg ggagtttccc gaccggaatc tggcttgctt tggccgccgt    124140
     agcattggca cgcagcaatg gcggacatcc agtcgattcc ggactcttca gccttccggt    124200
     gtgggtcgat tggttgcatt tgctagccat cagcgcgtgg gtcgggctcg ttctcgtgac    124260
     gacctacgtc gtcatgccgc ggctgctcga tgcccctgga agcgaacggc agaccagtgc    124320
     atcattcgtg caatcgctgt ccgacacctc gacgtacgcg ttggtgattt tgttcagcac    124380
     tggcgcatac aacggctggc gaggcgtcag tacgccggcg aatttgtgga catcgacgta    124440
     tggacagatc ctactgctga agttcgtgct cgtgctggtc gccgccgcgc tgggcggaca    124500
     caatcgcttc tttgaaatgc cgacgctaat gtcgacgctg aagaaccctg ctcaagaagt    124560
     cccgaccgtg ccgcttcgac gattcagtac ggtgcttcac gtcgagtcac tgattttgct    124620
     tggtgtcttg atggtagcgg ccgtgctcgt atcgagcccg ttgccgggaa ccacataaat    124680
     tcgtcggtcc ctccgtccac gcaggtggtc tgtcactcat gtgcgagttg cgcgtgagcg    124740
     ggccatctct ttgcagcccg gccctccagc cgggctcttt tttcattccg cattgcgttt    124800
     ggtcgacgat tccagatgaa ggacgcgtga ccaaaagatc atattcatgt cacggctcga    124860
     tcagtggctg ctctccacaa tgactttcaa tggagtcgca tgtgcggttc catgcctcgc    124920
     aatggagaga aaacatgaaa cttcaaatcg tcgccgccct catagtggtc gcctgtgccg    124980
     ccacgtccgc gtctgcattc gctgatagcg ggcacggtta tcccgacgtt acgcgaaacg    125040
     gcagcgtggt atcgaacgaa agcgttgctg caccggcaac ggcgcaaatt gaaaacacgg    125100
     tatcgcgcgg caagacccga gagcaggttc aacaggaact tattcaggct tatcacgatg    125160
     gtttgctgcc aacgagcaag catgactatc cgcccagcga agcgactatc gcgcgcaaca    125220
     aggaactcca tcagttaagt gagccgaagt gggccgcaca gcattgaggc acgcaccgtt    125280
     gcggaaagcc aggcgttgct cagcctgaac gtacacgact ccggccatat tccatgtgga    125340
     acgtaggctc gccagaccag atagaggagt tcacgcgatg agaccgatac ccggcatatg    125400
     gatttatgtg acggcgatta ctacggtcct ggctcttgat ggatgtgcga gcgcgacggg    125460
     caatacggat gggaagacgc ggatgccgga ctcccgttcc gcaacgaccc gattaccgaa    125520
     gtcctatccg tgtcaaaatc tgcacgtgcg ttcggcgaat tgcccgccgc gctgacggca    125580
     acgtgtgcca cgcctcttgc gtgcgcgata tcaccgacgc cgggcgtggc acggagctga    125640
     ccgtctactg agccatcgtc cggcattcct gagcgcagcg tcgacaaact tgtgcgcatt    125700
     ctttgcaatg cgcatgttga tgtttctcgc attcggttgc gcacgcgtcg cacaaagtcg    125760
     cgcaactcga gcaaactgcc ttgacttgct tgctgcctcg cgccatcgct gcggaagcga    125820
     ggcggcacag cgtggcgcaa tccaggtcga gtttgatgca gtcaataagc tggccgactt    125880
     gggtctcttc aagacacgcg gccgcgcaat gatcgcaagc ggtcgcgcaa gcgtcgcagg    125940
     ccgagatgca tgtctggtat tgttgatgtg ccattttgac tctcctatcg tggactgccc    126000
     ggatcgggcc cgactcgtcg cgcaagcgtt gtacccacat tccggattag ccccacgcgg    126060
     ctccagtggc ggggacgttt cagcgttgaa acgtcagtac aattccgatg taatcaccgg    126120
     catcggcgga ctataatgct ggctatgaaa ttgctccgga ccttcatcct gtcgctgctc    126180
     tgcgcggtgc tgcccatcag cgggctggca gccagtggct tgaccggtga atgtccgatg    126240
     cagcaaacca tgtccatggg cgcggatgcc agcatgtccg gcgatatgcc gggctgcgat    126300
     ttgatgaagt cctcgtccgt cgataaagcc aaggccaaga gcgtgttctg caaagtgacc    126360
     gcccagtgtc agttcggcag cctctatcat ccagccgcca agaccgacat cagccgtccc    126420
     gctgcggtcg gtacgcccgt catcttccat tacgtccagt ctcttccggt ccgtgacccg    126480
     aacgggttat ggcgccctcc gcgtctcgtc taatccctcg ctgacaggtt caccgcagtt    126540
     gcggtgaggt tcgtcctatg ccggacgtgg aatccctatg ggatttcgca ttggggttag    126600
     aacatgctat tcattttcgg cacgccgctg cgtcggcgtg ttccttggcg tgcgcacgcg    126660
     cttgtttctg cgctattcct cgcgggtgtc gttcatgccc agcaggcacc gatgacgctt    126720
     gatgctgcgc tacagtcggc gaccgatcgc tccgcatcga tgcaggctgc gcaggcgtcc    126780
     gtccgcgcca gttccgaggc ggcagtcaaa gccggccaac ttccggaccc gatgctcaag    126840
     gcgggtatcg acaacctgcc gatcaacggt cctcagcgct tcaccgtcgg ccaggacttc    126900
     atgacgatgc ggcgcatcgg catcgagcag gaatgggtct ccggcgacaa gcggcggctg    126960
     cgctcggcgc tcgccgaccg aatggtcggg cgcgagcgcg ccggctacct cgtgcaactc    127020
     gcgaacgtgc ggcagcaaac cgccacggcc tggctgaacg ccgtgtacgc gaaacaggcg    127080
     ctcgccctgc aacaggcgct gctcgaccac atgcatcacg agctggctgc gacgaaggcg    127140
     tcatatcgcg gcgccaaggc cggcgcgtct gatgtggtgc aagcgcaggc gatgcttgcg    127200
     cagactcagg atcaggtgct caaggcgcaa cagacttatc aaacagcgct cattgggctg    127260
     tcgcgctgga cggccgctcc cgtttccgag gtgactggcg aaccgccggc gcccgagtcg    127320
     ttcgtatcgt cgctccctcc cgacgaactg cgcctgtcgc agccaacgct cgtggctgcc    127380
     gcggacgaca tttcggtcgc cgaagccgat acggcagtcg ccaacagcga gcgcagcccg    127440
     aactggactt gggaggtcgc atatcagcaa cgcggcggtg cgtactcgaa catggtgtcg    127500
     atcggcgtca ccattccgtt gccattgaat cggaaaaatc gccagaaccg cgacgtcgcg    127560
     gagaaagccg agctcgccac gaaggcgcgg ttgatgtacg aggacgcgct gcgacaggtt    127620
     caggccgaca ttcgcacgca atcggccacg ctggcgagcg gacgcgaacg catcgccaat    127680
     ttgagtcagt cattgctgcc cgctgcggac cagcgcgtgc aactcgccaa cgccgcctat    127740
     cgcgcgggaa gcggctcgct cgcggacacg ttcgcggctc gccgcgcgca gctcgaggcc    127800
     gaactgcagg tgctcgacct caagcgcgaa gtgtcccaga cctgggccca gctcgaatat    127860
     caagtggtgc cgtccacgat ggctgctgcg cagtgaagga gaacgatatg acccaaaaac    127920
     cactggtgcg cgcggtgctg actgtattcg ccggcgcggc cttgctcgca gctggctatt    127980
     ttgcgggcac acgccatgca gcaacgcccg cggccgcggc ctcgacggta acggcttcgt    128040
     caggcgaaaa gattgacccg aagaccggca ggaaggtgct gtactggcac gacccgatgg    128100
     tgccgaacca gcatttcgac aagcccggca agtcgccttt catgaacatg caactggagc    128160
     ctgtctatgc ggacgacggt ggcggctctt ccggcatcaa gatcgacccg ggcctccaac    128220
     agaacctcgg aattcgctat gcgaccgtgc gccggcagga aacgacgggg ggattcgacg    128280
     cggtcggcac aacgcaattc gacgagtcgc gctcggatgt cgtgcagtcg cgcgttacag    128340
     gctacatcga ccggttgtat gccagtgcgc cgatgcaacg catcgcgaaa ggtgcgccga    128400
     ttgcgtcgtt gttcgttccg gactggctcg cgccgcagga agaatatctt gcgctcaagc    128460
     gcggcggcat ggatgccagc ctcctcgaag cgtcgcgtgc gaggatgcgc gcgatgtcga    128520
     ttccggacgg catcatcgcg agcctcgacc gaaccgggag ggcccagaca cacgtcgtac    128580
     tgacgtcgcc cgaggctggc gtcgttagcg aactgaacgt ccgtgacggc gcgatggtcg    128640
     cgcccgggca gacgctcgcg aagattgccg gcctgtcgaa gctctggctc atcgtcgaga    128700
     ttcccgaggc gctcgcgctg agcgtacagc ccggcatgac ggtcgacgcg acgttcgccg    128760
     gtgatccggc acaacatttc gccgggcgca ttcgcgagat cctgccgggc atcagcacca    128820
     ccagccgcac gctgcaggcg cgcctcgaaa tcgacaacgc ctcgctcaag ctgacgccgg    128880
     gcatgctgat gcgcgtgcgc gttgccggtc agaaggctgt gtcgagactg ctggtgccgt    128940
     ccgaagcggt catcacgacc ggcaaacgct cggtcgtcat cgtgaagaac ggtgacgggc    129000
     gccttcagcc ggcgacagtg accgttggca atgacattgg cagcgaaacc gaggtgttga    129060
     gcggcctgaa cgatggcgac acggtcgtcg cttccggcca attcctgatc gattccgaag    129120
     cgagcctgaa gtccgtgttg ccgcggctgg aaggtggctc aggggcaagc gcaaccgcgc    129180
     cggcgtccgc gcctgtcgcc actgcgcaga cctatgagac caccggcaag gtcgagaaag    129240
     tgaccgccgc agacattacg ttctctcatc aacccgtgcc ggcgctcggt tggggtgcga    129300
     tgacgatggc gttcaacaag ccggcgccga gcgcattccc cgacatcaag gccggacaga    129360
     tggtgcactt cgtcttcaag cagtcggatg aaggctacca actgacgaag gtcgaaccgg    129420
     tcggaggcgc gcaatgattg cccggctcat ccgctggtcc atccacaacc gcttcctggt    129480
     gttgctcgcg accgtgctcg taacgggttg gggcctgtac tcggtcgccg agacaccgct    129540
     cgatgcactg cccgacctgt ccgacacgca ggtcatcatc aaagcgtcgt atccgggcaa    129600
     ggcgccgcag gtcatcgagg accaggtgac gtacccgctc acgacgacgc tgctcggcgt    129660
     gccgggggcg aagaccatcc gtgcgtactc gtcgttcggc gatgcgttcg tctatgtgct    129720
     gttcgacgac aagaccgacc agtattgggc acgttcgcgc gtgctcgagt acctgaatca    129780
     ggtgcaaagc cgcctgccgc aaggtgcgac ggtctcgctc ggtccggacg cgaccggcgt    129840
     gggctgggtg tacgagtatg cgctcgtcga caggagcgga cggcatgacc tcggtcagct    129900
     gcgcgcgctg aacgactggt tcctgaagtt cgagctgaaa gcagtgccgg atgtctccga    129960
     ggtcgccagc atcggcggca tggtgcgcca gtatcaggtc gtgctcgacc cggacaagct    130020
     gcgcgcgtac ggcatcacgc aggccgcggt ggccgatgcg cttggcaagg cgaatcagga    130080
     gtcgggcggc tcggtggtgg agatggccga gtccgagtac atggtgcgct cgtctggcta    130140
     cctgcgctcg ctcgacgatt tccggcatgt cgtattgcgg accaacgacg ccggcacgcc    130200
     ggtgctgctg ggcgacgtcg cacgcatcca gatcggcccc gagatgcgtc gcggcatcgc    130260
     ggagctgaac ggccagggcg aggtcgccgg cggcgtcatc gtgatgcgct cgggcaagaa    130320
     tgcgctgaag accatcgatg cggtcaaggc gaagctcgcc gacctgaagc gctcgctgcc    130380
     acccggcgtc gaagtggtca ccacctacga ccgatcgcaa ctcatcgaac gagcggtgga    130440
     caacctgaag gacaagctca tcgaggagtt catcatcgtc gggctcgtct gtgccgtgtt    130500
     cctgtttcac ctgcgcagcg cgttcgtcgc cattctgtcg ttgccgcttg gcgtgctggc    130560
     cgcgttcatt gtgatgcgct atcagggagt caacgcgaac ctgatgtcgc ttggcggcat    130620
     cgcgatcgcg atcggcgcaa tgatcgacgc ggccatcgtg atgatcgaga acgcgcacaa    130680
     acacctggaa gcgttcgatc atgagcatcc cgatacacgg atgaccgccg ctcaacgctg    130740
     ggagctcatc gcgacttcgg ccgccgaggt tgggccggca ttgtttttct cgctgctcat    130800
     catcacgctg tcgttcattc cggtgttctc gctcgaagga caggaaggca agctgttctc    130860
     gccgctggcg ttcacgaaga cctacacgat cgcggcggcg gccggcttgt cggtcacact    130920
     cgtgcccgtg ttgatgggct atctgatccg cgggcggatt ccgcacgaaa acgcgaaccc    130980
     gatcaaccgc gtgctgatac ggttgtatcg tccgttgctc gaggcgacgt tgcgtcggcc    131040
     gtggacagcc attggtctcg cggcggttgc cttggtgctc acgatcgttc cgatttcgcg    131100
     tctaggcggc gaattcatgc caccactcga cgagggcgat ctgttgtata tgccgaccgc    131160
     gctcccgggc atttcggccc agaaagcgag cgaactgctg cagcagaccg atcgcctgat    131220
     caagaccgtg cccgaggtcg agacggtatt cggcaagtct ggtcgcgcgg atacggccac    131280
     ggacccggcg ccactcgaga tgttcgagac caccattcag ttcaagccgc gtagccagtg    131340
     gcggccgggc atgacgccgg agaagctggt cgatgagctg gatcggacgg tcaaggtgcc    131400
     cggtctgtcg aacgtatggg tgccgccgat ccgcaatcgt ctcgacatgt tgtcgaccgg    131460
     catcaagacg ccggtgggtg tcaagatttc cgggccggac ctgacgcaaa tcgatcgtat    131520
     cgcgacccag gtcgaaacgg ccgtcaaagg tgtgcctggc gtgacgtcgg cactcgcgga    131580
     acggctgaac ggcggacgct atatcgacgt ggatatcgac cggcttgccg cggcccgcta    131640
     cggactgtcg gtggccgata tccagtcggt cgtgtcctcg gcggtgggcg gcgagaacgt    131700
     cggcgaggta attgcggggc gtgagcgttt ccccatcaac atccgttatc cacgcgaaat    131760
     tcgcgactcg ctcgagaaat tgcgacagtt gccggtcgtc actgaccgcg gcgcgcaaat    131820
     ccagctcggc gacgtcgcgc acatcacgat cgccgacggc ccaccgatga ttcgcagcga    131880
     aaacgcacgg ctctccggat atgtctatgt cgatatccgc aacaccgacc tgcagtccgc    131940
     cgtgaaggcg atgcagaagg ttgtggccga gcaggtccaa ttgccacccg gttattcgat    132000
     tgcgtggtcg ggccagttcg agtacctgga acgcgcggcg gccaagctgc gcacggtggt    132060
     ccccgtcacg ctcgtcgtca tcttcgtgct gctgttcctg accttcaact cggctgccga    132120
     tgcgctgctg ctgatgtcga ccgtaccgtt tgcgctggtc ggcgggttct ggctcatctg    132180
     gatgctcggc catgcggtgt cggttgcgac gtcagtcgga ttcatcgcgc tcgcgggcgt    132240
     cgctgccgaa ttcggcgtgg tgatgctgct gtacctgaaa ggcgcgctca atcgccggct    132300
     ggaggatggc gagccgctca ccgaggcgct gctgttcgat gcgatccgcg aaggcgccgt    132360
     gctgcgcgtg cggccgaagg ccatgacggt ggccgtcgtg ctcgcgggcc tcattcccat    132420
     catggtcgga catggcgccg ggtcggaggt catgcagcgg atcgccgcgc cgatggtcgg    132480
     cggcatggtg accgcaccac ttctgtccat gttcgtgatt cccgcagcgt ggttcctgtt    132540
     gcagcgccgt cgcgcgcgac aggcgcctgc tgccagtttc ccccaagcag taccttccgg    132600
     cacgaacgtg ccagtcaacc aaaccggaga agtccaatga agaagctcat cgttgtatct    132660
     gccgcactcg cagccgcttt cgtcacgccc gcatttgccg gcaacgacat ggctggcatg    132720
     gacatgtcga ccaaagcttc cgcgatgaag gcgtcgtcga acaacgcact caccgacgcg    132780
     gaggtcaaga aggtcgacac ggcgaccggc atggtcacgt tgaagcacgg cgcgctcgaa    132840
     aacgtcggca tgccgccgat gacgatggcg ttcaaagcga aggatgccgc gatggtcaag    132900
     cagattaagg aaggcgacaa ggtcaaggtg cgcgttgaag aagtcaacgg caccctgacc    132960
     atcgtgaaac tggaaaagcg ttcctgacga aaacattggt gcccggcgcg caggcgtctg    133020
     tccgcgcgcc ggtacgccaa aggggcggcc gaggagacca acatgcgcac gacatcctct    133080
     aacacgtatc ggtacgtcta tcgaacagcg gacgcgttga gtcgcatgct tcgcttcgtc    133140
     cttgtgctgg tgttcggact tgtatccttt gcggcatacg cagtcaacga atccgaattg    133200
     ctggcgcccg agcaggcatt tccgttgacc gtcagccttg cgagccataa ggaggtcgtg    133260
     ctcgacttca agacgaagcc cgggtattac ctgtatcgtg accgattcag ctttgcggtg    133320
     agcggcgcgc cggtaaaacc ggttgcgatg cctccctccg aaaccaagaa cgaccccacg    133380
     ttcggtgtcg tgcaggtcta tcaccagccg gtccgaattc ttcttccgct gtccgccgcc    133440
     gtcacgtcaa gcgccacgct gacggtgaca tcccagggat gtgcagacgt tggtgtctgt    133500
     tatccgcctc agactcgccg ctttcggatc gctgcggacg gtggggtgac gcctgccgcg    133560
     ctcgtgggga gcgcgaaggg ggcggacttc cctgtcgcag agaaagaccg gcaggccacc    133620
     gtactcggtc taccgctgcg gccggccaat ggtatcggca tcgccgaaat gcttggcttc    133680
     ctgttggcgg gtctgctgat ggcgggtacc gtgtgcatgt atccgctcat tccgatcgtc    133740
     acggcggtca ttgacggtac tcgcgagcgg ttgccggtat ggcgcgggtt ctcgctgtcg    133800
     ttggcctatg tgcaaggact ggcgatcacg tatgcggcag ccggaactgt cgcggccgtc    133860
     atcggcattc cgctcgtggc gctgacgcag aaaccctggt tgctggccac gttcggcatg    133920
     ctcatgctcg cgttcgcgct cggtatgttc ggcgtgttcc gattgcaact gccgacgggt    133980
     tggcagacgc ggtttgcggg atggagcaag cgcttgcccg gcggccgtgt tgggcccgtg    134040
     ttcgtgatgg gcatgttgtc cgcgctgatc gtagggccgt gttccacacc ggcgctggcc    134100
     ggcgcactgc tctacatcgc aaacagtcgt gacatctcag gcggtgcgct ggcgctgtat    134160
     ctgatgggta tcggaatcgg cattccattg ttgctcgtcg gtacgttcgg aacgcgcttg    134220
     ctgcccaagt cgggacactg gatggtcgcc gtccagaaca cgctgggggt catgctgttg    134280
     gccgccgcgc tgtggttcgt ttattcgctg ctgcccgcgt ggctgctgat gtcgctgatc    134340
     gcgttgctgc tcaccgcttg cgggacgatg ctgcgggcga tcgacccgtt accggcggat    134400
     gctacgggca tcgcgcgagt cggcaaagcg ctcggtgtgt tgctgctggt cgctggtatt    134460
     gccgagtttg ttggcgtcgc atcgggcaac ttcgacattt tgacgccgct gggcggattg    134520
     actcggacat cgacgtcggc gggcggcggc acaagtgcgg caacgcaatt cgacacgata    134580
     acctcgaacg cgaagctgga cgaggcgctc aaggcagcac gaggtcaacc tgtcatggtg    134640
     gacttctacg cggactggtg catcacctgc aaggaactcg aacgcttcac gttcacggat    134700
     gcgcgcgtga tgaacgagtt cacgcattgg aagttgctgc gcatcgacgt gacgaagaac    134760
     accgaggccg acacggccat gttgcggcgg ttcggtctgt tcggccctcc ggcgctgatc    134820
     ttcttcgaca agactggtcg gccacagccc gatgcgcaat tgatcggatt tattggcgcg    134880
     gacacgttcc tggcccatct gaagcggttg cagtcgggcg atgtggcgca atagcgcagc    134940
     tgccggcggt cgcagcggga ctgatcggcg cctatactgg aaatcatgaa attctgggtc    135000
     aaactcgttg cctgctttct gattgcgtgg ttgccaatgc tcggttaccc cgcacaggcg    135060
     gcgttgtgtc cagaaatgtc gtcgatgcca gcggtacagc atcacatgaa ggcagcaagt    135120
     gcgatcgaag cgaccggatg cacgtccggt acgaagcctc tcggtaccag cgatcgtcca    135180
     tctgcgtgcc acgcgggcat gggaagtgcc gtgtgcggga tgctggctat accgatgtcg    135240
     catcgcgtcg gcatcgtcgt ttctacggcc gactatcggg ccatcacgcc gttcctcgcc    135300
     gagcagttca ttcctgagct gccagcacca cccccgcgtt cgttgtaact ctcatccgtc    135360
     gacgcttgcc cagcggttcc gtaccgcggc ccgagttcgc tcgtggcccg cgtattcatc    135420
     cgggaagcgt cgcatgttcg attctttgaa tgcagatgga gatatacatg aacgcaagtc    135480
     atgcacgaat ggcggtcctt tccacactat tggttgcagc gagcgcagtg agcttcgctg    135540
     ccactggttc agcgtccggc acgtcggcgc aagatcgtga gcacggtcac ggctcgatga    135600
     tgatgggcgg catgatgggt ggttgcccga tgatgggggg gagcgccgga ctggactcga    135660
     agaccgcaat gcgaatgcac gccgagatga tgcgcgcgat gagcgacatc atgatgaagt    135720
     attccgacca ggcgggtgcg gcaccgtcaa agtgacgcaa gccagaccac atgactcgca    135780
     ttgaattccg cttgacaagg acttcacatg aaatgcaact ggaaaaccat ggtggctgtt    135840
     gggtccgcac tggtcgccgt catcgccctc gggtactggg catttcctcc gctcagaggc    135900
     ccgcttgcaa cgctcgccgt tatcgccagt gggtttatct gcccgctatc gatgattttc    135960
     atgatgcgcg gcatgcaatc tcacgctgac ggttccggtg tggacactcg cctgacggac    136020
     aaagccgaac actgagcccg ccgacttacg tcggtacatc gggccggagc gatggcattt    136080
     gccaccgctc cggtccgctt cacggagcgt atatgttcac tgggaaacca atcgtcaatt    136140
     tcatcattgg cctactcgcg gccatcggcc tgctagcggt gctgggcacg gccgcgatgt    136200
     gggggatgca tagcgggatg atgcacggca tgctgtcgtg tggaagcacg atgtatccgc    136260
     gttccggaac ctgagcggga gtttgggaga ttgaaaatga aacgatacaa acgacatcag    136320
     tctggcagcg ccgccaacga gcgctccggt cgtgtcgtca aggtgaagtt gaatctgctg    136380
     tctctgcttg ccctgattct cgcggtatcg acggcgttgg tttgggggcc ttcacttgtg    136440
     cattgggcct ttggtccaaa aagcgctgcg gtcacgctgg agaacacggt ccagcaggta    136500
     cccggctggc gagtcggaat gctgcgccca gatggactgc gcatcatttc atcgggcgta    136560
     tcggatgcct cgcatgtact gaacccggtg cagtttcccg acattgctgt gcggcacgcg    136620
     tactgggtcg cgacccagat ccccgcgacg ctcaacaagc tctactgctg gtgcggatgc    136680
     gagaaccgcg gcgagcatcg ttcgaacctt cagtgcttcg aggacaagat ggcggtgtcg    136740
     tgcccggttt gccaaggcac agccgaaatc gcttaccaga tgacgcaagc tggtgtccgg    136800
     gacgcagcga agattcaagc ggcagtcgat gcaaagtggg cgccgaaggg atagccgccg    136860
     ggcgtttcaa tttcgaagca ggaggatgtg atggaactga aatgcgttgt cgcagtgctg    136920
     cggcccgagg tgctcaccgc gctcgagcag cgattgggtg cgttgcacat ccatggaatg    136980
     acggtgacca aggcaaaggg attcggcgcg catcccaact tctttggcaa cgactggaca    137040
     acggaacaca tcaggatcga agtctttacg gtcgcagaga gcgtcgacgc gctggtcgag    137100
     gaaattacga cggtcgcgaa cgaacaatcg ggcggcgatg gcgtcgtggc cgtcgtaccg    137160
     gtagaacggt ttctccgagt gcggtcggcg actccgtaac accggtttgg cgattgtcgg    137220
     ttaccgggaa aatgcaatga gatcaaaggg atcccagcat acgacttaaa cgtccctcac    137280
     agggggcaga acatggatct ttccagaagc taccgcctgc agcgttgcaa tctcctgacg    137340
     cagtgtttca ttaatcgacg ccagcgtcgc gacatcagcc agtgcagcgt ctcgctccgc    137400
     gcggacggtc ttcagctgtt ctcttacctt cttgacctcc gcaaccgtgg cgtcgcgctg    137460
     ctgccgaatg ccgcggccga cttgagtgcg gatctcttcg gcgatgtcgg ggtacgtatt    137520
     gtgaatgagg ccggcgctta cgccagcctc cgccgcgacg gaggagatgc tcaatttcag    137580
     tcccctcgtc ttgacccgga ggatcgccag ctgtagcgct tcgcgcgtct tccctctgct    137640
     acggcgccgg ggcgccgacc cgggccgcgt atcgtcgggc gaggtgcctg cacggctgct    137700
     catgctccct ccagcgcggc agtgtacgcc cgggcccggt catcggtcgg cagcgcacag    137760
     ccgagatccc gcagcacctg cgtcgagcgc tccaccacgc gccgcgcctt atcggccact    137820
     gcgggaccgc agtcggtgat cgcagctagc cgcaggttgt ccaggtgaat catctgccag    137880
     gcagatgctt gcccctggtc gatgatggcc tgcgagcacc ccgcgcacat tgatgggtcg    137940
     tacaccccct ggccgtgaca tcctcgcgta ccactgatgc accacgcgtg tccggtgctg    138000
     cgcagttcga tcgactcggc ggtttgtctc aggagttgct tgaggtcgcg tgcggcacgc    138060
     gtgcgcgtct gcatgatctt cttgccggca cccccgctga gcagcgcatc ggaatgcgcc    138120
     caactttcca gcagccccag ccgcgcgtcg gccatttcct cctcgaactc gcgatatagg    138180
     gcgtgatcct ggtgcgggct ggcagcgtag agctgcgtcc acgacatcga cgcatgtttg    138240
     agttgccact tcaggaagac gaggcccatt cggcccaacc gcgagttcgc gacgttgtac    138300
     gcgaaggtgc ggcggcactg atggttggcc aggttccact ctgtcccggc ggccgcggcc    138360
     aattgcttca attggtaccc gcaggatgct gaactcagca cctcgacccg cgaaccggtt    138420
     cccagatgat ccgaggcttt cacgttcagt cctagaacca gatgccggcc gatctctcgc    138480
     acatggttca ggcggtgcgc ggcctcagcc attttcatgc cgttgcacag gtggccggtg    138540
     agatcggggc cctgcgccat caggtcttcg agccatcgcg cctcgccgac caaccgtgct    138600
     tggagcggtt gggcgtagcg ctgcaggatc tcaagcgcgc gaatagcctc cggcggcacc    138660
     agaaagtcga cctcggttcc gccggtcgtc ttgacttcgc gcgtgcgcac ccagtgatac    138720
     gtcacgccgt tgcgctgttc ggtacgccaa catccgctgg tcacgccggt gctctccgag    138780
     ttgcgcattc cggaggagat ctgcaagagg tataggaccg cattgcggat cgaagtcatt    138840
     gcggggcgct tgggcgcccc gagcccgccc gcgtctcgag cctgaaacag ctcgtccgcc    138900
     tgcgcaagac tggcctcgca gtaggcgaaa agtatgcgct gcaccgaccg cgggatcacg    138960
     ggggtcgtgc cggtccgccc tgacggcatc cgattatctt cattgccgcc acatgcatcc    139020
     caaagggcga gccccgccca cgggtgctcg agcaacgggt gcaggacttc cgtatggaac    139080
     gtccagacca ggtcgacaat ttgcagccga ccacgcaccg acacgggctt gagcgtacgc    139140
     cgcaaatccg cgatgtggtc agacaggtgc agagctcgta cctgactgaa gtcggccagc    139200
     cccaattgtg cgagatatct cagagccagg acgcccgagc ggccaatatc cgctatcgag    139260
     ctgccggacc actttcgccc gtgggggccg cgtcgctgag cacaatagag tgccgccttg    139320
     gcatcgtcga tcagtgcttt cggtacgtcg tccggccaaa cgatcttcag ggccgaaccc    139380
     ttgcggttct tcgcctcgat ctccggcgcg aggtcccaga cccgatcacc gaaacgactc    139440
     actggatgct cgtggcctgc ggcatcggcc acggcagtca ccacgatagc gtcacgttcg    139500
     gccggcggaa tgccgaccag gctgatcggc tgagccgcca gcaactcgaa ggcccgcagg    139560
     gcacgtgggg cgggcaagga tgtggccggc acggcgcgag ccccagatag cgtttggggc    139620
     gtgtcaagga tcgaggcaga ggtacttctc atgccctggg tcctgcctgc tgcgttccgc    139680
     gaatccgcgg tatcgccgta tcgccgtgcg agccatcaac gcgcagatcc ggcgctgacg    139740
     cacggtgtcg tgcgcggcgg ctcatggtca tctggtgctg ccagtaaggg tgcaagcccg    139800
     agacggtctt ggcgcgggcc tgcgcgaccc ggctgcgcgc gaattggcgt tgcgtgaagt    139860
     cgtcgatgta ggggatgacc acccggtatc ggtcgcgcag gtcctcaagc agtccgtcgg    139920
     tcgtgcgctc cggacccaag gcttcgtcaa ggtagtcgag ttcggcctgc gcgaacatct    139980
     gaaagctgaa caagcgccag agttcgtcca cggtgccgac gatcgcgaag ctcgagcaga    140040
     acaagcacat gacgtagcga tcgcagtggc tgcggccatc attcggcgca tgctcgccgc    140100
     tgatcgagtc cgagcatgcg gagacgggcg tcgggcttgg cggggcgctt atgctgcctt    140160
     tgccgacctt gaaaggttcc acttgcactg gccgaatctc attccccctc ggagcctgtg    140220
     cttcggcccg catcaaaacg gtatagtcgc cgttcatgaa gctcgctgca tcggccttgc    140280
     gcgcctcatt catcgacggg taattcactc cggcgaccct cggtgtgttg cccatcaggt    140340
     tggcggtgat ggctatgtcg ccgtcggcgg tacgcagagc acggtcgaag cggctcttac    140400
     gcaggcgact caggttgacg cgcaacggca ggccgccgtc tcccagtaga ctgcggcgtt    140460
     cgatgacgcc ttcgattgcc ctgttgaggg acttgctgtc gaggcacgtg atgttgcccc    140520
     tctttgtcga ccctgcactt gcttcagcgc gatacagcca gatccgtgtc ttgaacgcgg    140580
     atggcgcctc acccaccagt tcgcgggtgc ttgcgatggc ctgctgcaag actgcgccct    140640
     cggagaggtc gaagcaaagg ttctgctcgt cagcttgctc gttcggttga tttgatgcgt    140700
     gccgtccaag agcggagcgg ccaacattgg aacgaatctt cttgctgcgg tgctttgcag    140760
     tacgaattag gatcgtgcca ggcagaaatc ccggcgctaa ggcatcgcgg cacatttcga    140820
     gcaggggcgt cgggttgagc ccttgacggt gtgccaccaa caacagcctg agtccctgca    140880
     cggcactttg cttcagttgc aagcggccgt ggtgaacatc aacgaggtcg gacttgatcg    140940
     ccttggccag gcgctcttgc tccgcgtcac tcaggctagt ctgcaggctg tcttcgctgc    141000
     tccagggcaa cgcgccgcgc cggaagaagc gagaaggctc gccctcgatg aagccctgcg    141060
     cgaacatttc ggcgagtacg gccttgaccc ccctgtaggt attgcgcgtc gaactcggtc    141120
     gccagccttc agcctgagct cgcttctgca accatccgat gaaatgctgg acatgcatcg    141180
     gggaaaggtc cgacggcaac ttgggtcgct ggggcagcgg ggtttgcgaa ctgcccgcga    141240
     ggtactcgaa caggtaaggc agctgcccga agtacgtggt gacggaggct gtcgcgcgtg    141300
     cacccgagag cagcatcgcc ttgaggcaga agcccgatga gcatacccag tcgtcgatgc    141360
     ctcggcccag ccagtcacga aggtcgagcg tcttgattct ctgaggaaag cgtgcctcga    141420
     gccccaacag cgcgaccatg tcgatgcagg cgtcgtcggc gccgggcttc ggccgttcga    141480
     gtgatgccga tatgacaccg accggtgcgg cgcgattctc gctgacgttg tagttcttct    141540
     ttctgaccat ggcgtcgctc agtgtcgagg atcgactgtg gatgcatgcg gcgccgtggc    141600
     caatgctttg ccaaccccgt agagccggtc aaactcgtcc atcatcgcga gcgcctctgc    141660
     gcccagcagc cgctctatct gctgcaaata caccatggtg gtctggacac tcgcgtggcc    141720
     gaggcggtcg cggacgtaca tgagcggctc catcggtatc tcgggacggc tgcgaagcag    141780
     cagcagggta tgaatcgcgt agctgtggcg cagcatgagc gggcgcaccc ggaagcccac    141840
     cgtgttgctg agatcggtgt agaccttcac cgcggattcc ttgctgtagc gttgcccgtg    141900
     aatcgtcagg atcagttcct tgcggtctgc cgcgtcggca agaccgttgc gctcgaatgt    141960
     cgtatatgcg tacatgtcct ccatcaggct gtatggcacg tgcacaacgc gggacttgtt    142020
     gaacttgatc tccatgtccc gtgggtcgag gcgcacgtcg ataaaggtgc ctggcttcca    142080
     agccttttgg gtccgtggat caaccacgta cgacagcggg aaggtacgtg cctcgactga    142140
     gcgcaaaccc acccgcgcca tcaggtcgaa cagcagccgc tgcgctgcag agcgaatcga    142200
     ttgccgcacg atcttcagtt gatcggctgt caggaacgca ggttccttgt tccactcgtt    142260
     gagcagcact gccggacggc tcgacctctt ccgaccgccg gtgatatgag tcaggtcatg    142320
     ctcaatgccg tacactgcga cgtcggaaca ggtgaagggc aagcggtcga tccgcccgcg    142380
     ttcatgtgcc caccggtaca ttgccgtgac caattccaac cgggcgttga tggttgcggg    142440
     gtccagcttg aggtcttggg cctgccaatc gcggtaaaca ctgacgacgc tctgcccaac    142500
     cgacatgaat ggatcgtccc aacaccattc gttcgcttgt agaaatcgag cgaaatccca    142560
     tagccggcga ccgtacgcct cccacgtctt ttgatcaagc gcctttccgc tctcaagcaa    142620
     tcggtacagc aggtagtcat ggaacggttg cgccggctcc atcgaatcgt cgaggatcaa    142680
     ggggaatccc ggccgcgggc gtccggcgaa gacaaactca tcagtggcgc gtacgtacct    142740
     cacgcgctgg cctcgcgcaa catcttcgct gcttgcttga atggcacgcg ccattggcgc    142800
     atcacgaggt cgtcggcacc gtcagcaatc gcgcgcgccg cgaggcaatg cagccgccct    142860
     atttccggat catccatagg ttgccaaatc tcccccgaat tccatcccgc tactcgactt    142920
     caagaaattg aatagcagta cacaggacga tgtctgtcaa cccatttatt actaacaaaa    142980
     cgaggtattc gtaccgatgc atcgtgccga tcaaatcgtc gaacgtcgac gcatggctgg    143040
     cgccggatcc gtctcgccgc gcgcagctgc gcgagatcct cgccgatcgc gaacggccct    143100
     actacgagca ccaactggcg gcgtaattcg ggtagggatt ggagtcggca tggggaatgg    143160
     catatactgt ataaacatac agtgccagaa ccccacgacc atgcaagccg ctcttgccca    143220
     tcctgaaacc atccatcccg cgctctggcg tgccagccag ctggcgcgct cgagctcgcg    143280
     cggcgtcgac acggggcacg ctgagctgac cgccgagcta cccggcggcg gctggcccgc    143340
     gggcgcgctg gtcgatttgc tgacgcagca ggccggcatc ggcgagctcc ggctactcgc    143400
     gcctgtactg gcgcgctcga gcggccgacc gatcatgctg atccagccgc tgcacgggct    143460
     gcagccgctg gcgctgtcgt attggggtgt cgattcgtcc agcttcgtcc tgctgcctgc    143520
     cccgcgcacc gccgacgcac tgtgggccgc cgagcaggtg ctgcgcgccg gcacgtgcgc    143580
     ggctgtcctg ctgtggcagt caaacgtgcg cgcggacgcg ctgcggcgtc tgaacctggc    143640
     cgcgcaaacc ggatccgcac tgtttttcct gttccggccg gcggccgccg cacgcgacgc    143700
     gtcgccggcg ccattgcggc tcgcgctggc ccccaagcgc gacggcatcg agatcacgtt    143760
     cgtgaagcgc cgcggacccg cgcgcgatac gccgttgttc gtcccgttgt ccccttcgcc    143820
     gattttgttg aatcgccatg caagtctgga tcggcgtgca tctgccgcac ctcaacctcg    143880
     aaacgttccg gccacgctcg ccggcgccat cgcctgacga tgcgcgcggt ctcgtcgtgc    143940
     tcgagagcgg ccgtgtcgtg gcgctggacc gtgccgcgcg cgcgctcggc atcgtcgtcg    144000
     gcatgcggcg cgccggcgtg ctgtcgctcg cgcccgacgc acagatccgc gagcgcgacg    144060
     tcgtgcgaga acgcgaactc gtgctcggcg tcgcgtacgc gctgctgcag ttcacgccga    144120
     acgtcgtcga cgctgacgaa gcagtggtac tgctcgacgt gacggccagc ctgcgccttt    144180
     tccatggcat tcgcgcgctg cgccggcgcg tgcgcgacgt cgtcgcgtcg ttcggcgtct    144240
     ccgcggcaat ctccgtcgcg tcgacaggcc cggccgcatg gatggtcgcg cgcgggctgc    144300
     gcggcggcct cgcgctgtct gcccggtcat tgcgccgcgc gctcgcgcgc gtgccgctcg    144360
     tggtcgcccc tgatgcgcgg cggtacgcga cgtggttcga cgagctcggc tgcgaaacgc    144420
     tggcggacct gcagcgcctg ccccgcgccg ggctcaagaa gcgttgcggc acgcagctgc    144480
     tcgactggct cgaccaggtg gccggcactg cgccggcggc ctatgactgg ctcgacatgc    144540
     cgccgtcgtt cgacacgcgc gtcgagctga tggaccgcgt cgagcacgcc gaggcgctgt    144600
     tgtttgtcgc gcgccggctg atcctgcagc tgaccggttg gctcacggcg aagcagctgg    144660
     acgtcgcagc attcgcgctg ctgctcgagc acgagcgcgg acgcgacgcg attgcgccga    144720
     ccgagatcga gatttcgctg ggcgccccca cgcgcttcga agagcacctg acccggctcg    144780
     tcaaggagcg gcttggccat gtcgagctcg ccgggcccgt gatcgccgtg cggctcgtcg    144840
     cgcgacgcgt gcaggaagcg gccgcgccga gcgattcgtt gttcccggaa cccggcggca    144900
     cgccgcagga tcacgctcga ttgctggaac tgctcaccgc gcgcctcggc gcagagaatg    144960
     tgctggtccc ggctcccata gccgactacc gtccggagcc ggccgcccga tgggtgccga    145020
     tgcgcgacgc gccgaaggcg gcaccgctgc cggcggattt gccgcgcccc gcctggctgc    145080
     tcgccaagcc ggtgccgctg ctcacgcgcc aacaccggcc gttctacggt acaccgctgc    145140
     gcatggtgtc gcctggcgag cgtatcgaag gcggatggca ggacgggcag actgtgacgc    145200
     gcgactactt cgttgccgag gacgacaacg gcatctgcta ctggatcttc aaggagcggc    145260
     cgacggccag cgacgaaagc gactcgcgct actttctgca cggcctgttc ggttgattcg    145320
     cgatgagcgc tgcgagctac ggcgccctgc ccgcctatgc ggagctgcag gtcgccagcg    145380
     acttctcgtt tctgcacggc gcgtcgcgcg ccgaggaata cgtggcgcgc gcggcacagc    145440
     tcggctacag cgcgatcgcg atcaccgatg agtgctcgct cgccggcgtc gtgcgcgcgc    145500
     acgtcgaagc gaaggcagcc ggcctgcctc tgatcatcgg ctcgcacttc cggctgacgg    145560
     ccgccgacgg cgcgccggcg atcgcgttca gcgcgctcgc gatgaatcgc gacggctacg    145620
     gcaacctctg cgaactggtg tcgctcggcc gtatgcgcgg caagaaaggc agctaccggt    145680
     tggcgccgcg cgatctcgag cagccggacg cgccattcac gcatctgcgc ggcttgcccg    145740
     actgcattgc gatcctgtcg cccgacttcc cggccaatga gcagcggctc gacgcgcagg    145800
     tcgaatggtt cgcgcgcgtg ttcggcgatc gcgcatgggt cgcgctcacg ctgcatgcgc    145860
     gtgcgatgga cgatatccac cgcggtgtcg ttgaacgcgt cgccgcgcgc cacggcgtgc    145920
     cggtggtcgc aaccagctgg ccgctgatgc atgtgcgatc gcgcaaaccg ctgcaggacg    145980
     ttctgacgtc aatccggctg gggcggccgg tgtccgagtg cggatacgag ctcgcgccga    146040
     atgcagagcg gcatttgcga tcgcgcttgc ggcttgccaa cctctacccg gccggcgcgc    146100
     tcgaggagac cgtgcgggtc gcgcggcgct gcacgttctc actcgacgac ctgaagtacg    146160
     aatatccgga cgaggtggtt ccagccggct acgacgtcgc gacctacctg cgcgaacaga    146220
     cgtatatcgg tgcgcagcgg cgctttccgg ccggcattcc ggtcgacgtg caggcgcaga    146280
     tcgaacacga gctgcagttg atcgcggaac tgaactacga ggcgtatttc ctgaccgtct    146340
     acgacatcgt gcaattcgcg cgtcagaacg gcatcttgtg ccagggccgc gggtcggcgg    146400
     cgaactccgc cgtctgctac tgcctcggca tgacggaggt cgatccctcc cgtcagtcga    146460
     tgctgttcga gcggttcatg agcaaggagc gcaacgagcc gccggacatc gacgtcgact    146520
     tcgagcatca gcgtcgcgaa gaggtgatgc agtacatcta ccgcaagtac ggccgcgatc    146580
     gcgcggcgct gaccgcggcc gtcagcacgt accgaccgcg cagcgcattg cgcgaggccg    146640
     gcaaagcgct cggcgtggat ccggcgatcg tcgatcgggt cgccaaaagt caccactggt    146700
     tcgactcgcg cgcggatctg ctccagcgtt tcgccgaagc cggtctcgat cccgaggcgc    146760
     cgctcaatca gcagtgggcc gcgttcgccg ctcagctgct cggctacccg cgccatctgt    146820
     cgcagcactc gggtggcttc gtgatcagcc gcggcaagct cacgcgactc gtgccggtcg    146880
     agaatgccgc gatggaagat cgcacgatca tccagtggga caaggacgat atcgaagcgc    146940
     tcggcatcct gaaaatcgac gtgctcgcgc tcggcatgct gtcgatggtg cgccgcgcgc    147000
     tcgacatgat ctcggagaag cgcggcgaaa cgtttgagct gcaggacata ccggccgaag    147060
     acaaagcgac ctacgacatg ctgtgcgacg gcgacagcat gggcgtattc caggtcgagt    147120
     cgcgcgcgca gatgtcgatg ctgccgcgcc tacggccgca atgcttctac gatctcgtga    147180
     tcgaggtcgc gatcgttcga cccggccccg tgcagggcgg catggtgcat ccatatctcc    147240
     gccgccggca gggacttgag cccgtcacgt tcccttcaga cggcatggaa aaggcgctga    147300
     agcgcacgct cggcgtgccg atcttccagg agcaggtgat gcaggtcgcc atgcttgcgg    147360
     ccggcttctc cgccggcgag gccgatcagc tgcgacgtgc gatggcggca tggaaacgca    147420
     agggcggcct cgagccatac cacgatcggc tcgtgagcgg catgctcgag cgcggctacg    147480
     atcgcgaatt cgccgaggcg atcttcgcgc agatcaaggg cttcggcgag tacgggtttc    147540
     cggagagcca tgcggccagc ttcgcgttgc tcgtctactc gagcgcgtgg ttgcgccggc    147600
     acgagccggc cgtgtttctg gcctcgttgc tcaacagtca gccgatgggc ttctatacac    147660
     catcgcagct gctgcaggac gcgcgacgcc gtggcgttga agtattacct gtcgacgtga    147720
     acgtgagcac gtgggattca gtcatcgagg ggccgacgac ctcggcgccg gtgcgtctcg    147780
     gattctcact gctgcgcggc atgcgcgcgg acgtcgccgg ccgcatcgag ctcgcgcgcg    147840
     cggtgcggcc gttcgtcgac gtcgcggatc tcgctcgacg ggcgcagctc gatcggcacg    147900
     acctgcaggt actcgcccgc gcgaacgcgc tgcgctcgct cgccggcggc aatcgtcgcg    147960
     ccgcgctgtg gctggcggcc gcggcgatcc ccgatcggga tctgttgcgc ggcactgagc    148020
     gtgacgacgc cgtgccggcg ctgccgcagg cgtcggaagg caaggagatt gtgaccgact    148080
     atcgcgcgat gggcttcacg ctcggccggc acccactggc gctgctgcgc gatcgtctga    148140
     cgctcgatcg tttgcagtcg gccgagcagc tggcaacgtt acgcagcggc cagctcgcgc    148200
     gcgcatgcgg actggtcacc gtgcgacaac ggccgggcac ggccaacggc gtgctgttca    148260
     tgacgctcga ggacgagacg ggccaggtga acgtgatcct gtggcccggt ctgctggaga    148320
     agtttcgcaa ggaggcgcta ggcgcggcgc tcctcgcggt ctacggtgta tggcaggccg    148380
     aggggaaggt gcggcacttg atcgcgagca agctcgtcga ccggagcgaa ttgctcggct    148440
     cgctgccgac gacggcaagg gagttttgtt gatggtgctc tagcaagcca gagcgcccga    148500
     cgcgaagctt tagaacaacg acatttgcct cgggtcgcat tccggcccct ttggcgatcg    148560
     cttgaccgcc acagtgcgac gcatccacgc gaccagtgga acgcccatgc catccacggt    148620
     aactgcaaag ccgaacgcct cttgcccctc gcgagtccag tccgggagct gcttccaagt    148680
     cgggctccat ccgcgggccc tcgcgcactc catcaagcgc tctttcgtga gacccggctc    148740
     gcagcacgcg acgaatcggg caaggggtgt cggcaccagt tccttcggaa aagtccccgg    148800
     taacgagaat gaaaccaatc gcaacgtcct cgccatttct accctcgaca ggcagtaagc    148860
     agttcaatcg ctcggatccg gccgctacgg ctcgggcgaa ctatgtccca gcaatcagtt    148920
     caagctggcc aacgtctcgc gcgtccgaat cccagcggcg cagcgcgtag taccactttg    148980
     acagcttctt ggccagcaac tcacgatgaa tgctcgctgt gagttgctcg tcctgccgtc    149040
     ggttgtcacg gtcgcaccga aagaagacga ccattgcctt gtcgtcgtcg agcgctatgt    149100
     gaaattccgg cagtttgtcc gctttcatgg ccgcaatgag atctctgcgg aaatacttaa    149160
     gtgcttgagc ggaccccgac ttgccgtaga gcttttcaag gccgattttg aaccacagct    149220
     tgtcaccaca gtgcttcttg gccaaatcgt aaaggcgacg ctcaagacct tgccccaaat    149280
     cgaagtaacc cggatgtagg gttaggatgc gccgactcag caacaaatcg taggtccaac    149340
     tcgacaatac tagctcgacc tccagcgccc ctttccgatt ggcggtatac gtgatcaccg    149400
     aatattcctg gatcaacccg tatccgcgta aggtctcgtg gatcccggct tcattggcac    149460
     ccgggcgcgt cgtatcgaaa tttgtttcga tgatggtgcc tttcaagcgt cggcagctat    149520
     caacgatgcg ctcatacgaa gcgccgcccg tactgcgtcg ggtgtatttg agaaagtcac    149580
     ggaccttgaa tcggattcgg cgtgaaaccg ggatatcgga gtcggccgcc ttgcaaatca    149640
     gtgtagcggc gtagacgagc agatccttat cgaagatatt tgccgccccc accccgcttg    149700
     ggatgattct gacgatttgt tcgccgttgc ggtagacgcg aacccgcgtg tctttgccct    149760
     tttgcagtga gaaaaggggg aactcgagag aatgaaggtc ctcgcggggc ttccaggaca    149820
     agtcaagttg ctcgccgaaa aacagttcga gctgctctgg atcgaactcg ccctcgtcca    149880
     gtcgaacgac atcatcgccg tcggctgagt tttccgattg ctcagcgcct tggctgcgtg    149940
     ccaatggtgg tcgtgcgccc atcggcaact gcgccgctcc tgcccccctc agtgagtagc    150000
     tgttctcgga attgactgta ctcattctct cctgctttcc ccgtatttca ttccagcttg    150060
     ctcgtttgcg tgccgagatg tttgatcagg gcagacactg ccgactggac tttattcgta    150120
     tctttcgatc gttgtgcctt cgcaaggaag cgcgcgagcg gttcgacaag cgggctcggc    150180
     acttcgaatt cctgctttag ccagacgatg acctccgcac ttcgcagttc cgagttcgtc    150240
     aggctctcgt agtagcgctt caccaactgg ctgacgcgtt gtcgagaaac cccaaattca    150300
     ctcgcaacgt ccgccgccgg ccgcccgtcg acgatcacgg cgcgtgcgat atcgcgagta    150360
     gcttcgtcaa acggacgtgt cccgaactcg cgcgcgtgct tccgcatggc ggagtccaat    150420
     gctgaaaaat gcttcgctga aaggcggaat gtagccaaga ttgctttccg aataggttga    150480
     caagcaacga actggcgcct gcccgcctcg gtccgttgcg ttacagcgac cagtcgttcg    150540
     gcgccagagg atgaatttcg cggtcggtat cgtaaccgaa gtcatctggc agaacgccgg    150600
     gtcgccggca cggatgcaat ctgttcagca gctcgagcgg cccactcgaa tttatttcat    150660
     cattgaacct gtttattatt ttacccgctg tttcagttgg catgccagca agcgccgagg    150720
     cagccaggtc cacaaagcag acccacaacc tccattcgat gtcctccgca cgcacgccag    150780
     ccgccgaaag gtcggcgtgc aaccggcgaa ctctctcgac ggatccggtg ccgatttcgt    150840
     agatttcctc tacgcgccaa accgacgtct cactcggatc ggcggcggca gcgtgcaaac    150900
     gcttcgcttt gggtacttgc cgcagcccct ccggagatgc cgccgggctc ggagctaggc    150960
     gagcgtccgc catattcggc acatcggcat catgttctgc gccgtgggcc gcctgaccct    151020
     cgaatacagg accaggtgac ggttgttggc catcgtcaat ggactgcgat gcagtagaac    151080
     ccggtgcctc ggccggcgcg ctcgagcgag ccatagcagc tgcctcgccg accgcatctt    151140
     tcaccgacgg agcggcgacc tgcttcagca ggttcagtcg cgcatcgagc gtcaagcgtc    151200
     cgaacttctt tcctgcccgc atgtccgttg cgatttcgtg cgcagtcgcg gcactgcaag    151260
     cctcgatgtc ggccattttg ttggccgctt cgacgtcgtc gaacatgtcc tcatcgaaca    151320
     aggctcgggt cgtgggacca taacgaagga accgcaagtg tttcgagacc catgacgcgc    151380
     tgcgctcctt gccgctcggc gccgcccaga tgctggctgc ttgctctcgc ccgtacaact    151440
     cgacgtctgt cgcaaggccg atagccgtct ctctcaccga gagttgcttt cgatcgatgt    151500
     tctcggacac ctgatacatc cggattgcca agtctgacgt cccggcgggg aaaatctttg    151560
     cctgtatctc cggccagtcg ttcaaaaggc tgcctcggat gcgccgctcg ccggcgatca    151620
     gctcatactc gtcgctgtcc gaaattgctc gcaccaatat cggcgtgtgc acgtgaccga    151680
     tcgcccgaag ccgctcggcg aacgcctgca catcggcgaa atcgtcgcga acttgaggtt    151740
     tgatccgaac tttattgacc gcgatgaacc tcgtcaccgc ccctgtggcc tgctcgattt    151800
     cagccacacg cgatgccgcg cttgccgctc gagtcagtgc cgaaatagaa gcaaacttcc    151860
     cgcttgtcgc ctgctgcatt caacgacccc tctttatgcg ttgctcaccg aaaggccgat    151920
     gcgctccaaa atggagtcgc acacggcgtg catttctttc gcagcaagcc gatcactttc    151980
     gcccctccga cgcgcccaca ccggatgaaa acttgtcagg cggacccccg cacgatcgcg    152040
     caattcgtgt tcgagtactg cgtcgtcgaa cgcattccga acagtcgtcc tcatcgattg    152100
     gtcatcggcg cgtcgcagat tgaccttgtt gagcagaacg cccaccagct cgagatccgg    152160
     attccattcg cgcttgacga gctcaagctt ctccgacgta ctgagaaggc ccgacatact    152220
     gtcaattccg agatcagtcg gaatcacgac gtagtcggcg cagatcatcc cgcccaacac    152280
     gaggttgctc atcgttggcg cggtgtcgat cacgcacaga tcaaattggt ccgccagtgc    152340
     atccaaggat tcccgcgcct tcgccgctga ttcgagcggc caagtcatga cgtcctcgag    152400
     ctccggcgtc gcgccgatca ttgccgcccc gtcgacaatt cgcattggat tgacgtcccg    152460
     tttgccctgg tagagcaagt gcgcactcga attttctgtc acatccggta ggcccaagtg    152520
     ctcccatgta agtgccgcgc ccatcaccga cggacccgac ttcgcggtca gctttcggta    152580
     cagcatcgac cttgtcagat tgccttgcgg atccagatcc accaccaaca cgcggatccc    152640
     tcgctcgatt gccgtgtaga ccagatgccg aacaatagtc gtcttgccgg tgccgccctt    152700
     cccattcacg atgcttatct tcttcatggc caccatctca tgcgcaggcc agtgcttcga    152760
     ttggctgaaa cgagcggccc aacgtatgga agaccgctag ccagttcgcc gcataaacat    152820
     tcacgcgccc gctcgccaca ctgaagtaac cgccttgctc cagctgggtt acgcatgctg    152880
     tgcctcgcat cagatctacg tcgaagcaaa tgcgggattg ggaacgccgg tggtcaccgg    152940
     caatatcctg tgcaatctcg atctcgagat ggccgtcaac tccatcgtcg atcgtgcaat    153000
     gaaccgccat atcccccggc acgcgcggtg gagcaaaccg tgttcgtgat gcgctcaccc    153060
     ccagctccgg aatgaggtcg acaagaagtc ggtagatgcg ggattgcacg gtgctcgaca    153120
     tttggttctc catctttttt tggttgctct ttttccggcg ttggcacacc gccggacctc    153180
     gtagttcttt catcttatta ttagatacgt tgacggtcaa catatctagg ttgaatgctg    153240
     gcgaaatcgt gcggtcgaac gctctgggct gttgaaattg aacgctgaga gccaggtccc    153300
     caaggcggac agcatttcgc tcgcctgcga tatataattt taatcactta tcacagtgat    153360
     ctattttcgc atgcgaaacc gcttacctcc aagcattcga gctggagtgc atagaatgag    153420
     cgctcgaagt gtgtttgccg cgccacaaag cggcctgctc gggccgcgca gatttccgac    153480
     ttcccctttg tccaaccgac ctgcatcaca ttgcgctgcg ttaagccgcg ccgcatcctg    153540
     catcggacgg ctcggtgaaa ccgccggagc aaagaggctg gtccggtaaa atggggccac    153600
     attaaaaacg taagcacccg cagcgggatc atatccgatc taggtcaaaa tgggatagcc    153660
     actggaacgg gcgagcattc ggatatgccc cggtccatcc cgattaccag tgagcgctat    153720
     cggcgccttc gcgttcaact tgccaccatg cgcatccgcg caggtctaac gcaaactgaa    153780
     ctcgcaaaac gtttgcacat cgaccaatcg aacctgtcca agatcgaacg aggagagcgc    153840
     tacgtcgact tcctgaccta cgtcgactgg tgccgagcct gtggcgtctc ccctgccaca    153900
     tcaatgagaa agttcttgga gcaggacgac agtccacgac ggccagccga cacctcgatt    153960
     cctaaatcgg cgcgcagcca gccgacgaag cacgggccgc ggcgcgatca gcaacatagt    154020
     ccgcaccgcg taccgcccgt caaagtcgtg tcatcgataa gccagcagga attcttgagg    154080
     ttcgcgaaag caacgctcgg aatgacgtgg gatcaacttg cagcagctgc agagatcaac    154140
     gcccgcgccc tgaaaacgta ccgcatgccg gatacgtcga aggacttcag gccactcccg    154200
     atgcttgcga gagccgcaat cgagaagctt cttgacgggc actccgcctg aatggtacgc    154260
     ggtgcgtacc attactatag acgtctgcaa tggaaggcga tcgatggatg atgcggcgtc    154320
     gcgactcggc gccgggcctc ggcgtgtcgg acacatgccc cccgccagga accgttatgc    154380
     gttcccgttt cggatgtcgc gcgtgaacca agtccggacg cgccagtagc cgcccgggcg    154440
     caacgcatcc ggtcgagtag ccacaacggg tgcccacggc aacggttgcg gtctcaagtt    154500
     gcggcgccaa ttgccgatat acgacacata tcggacatct ttgaggagga attgagccac    154560
     atgcgcaaga agttcattgc atcaacgcta gtcgctatag cccttgctgc tggtgcggtt    154620
     tgcaacgcca tcgcggtgcc aagcacgcaa tttacccaag ccttctcacc cgccgaatac    154680
     caagcgcttg cggtcgaaca gcgccagatc tacgttgcag gagcgctcga caccgttcgt    154740
     attttcgcgc cgtccgccga gctcagaaat ttctacaatg tgtgcctcac ccggacgacc    154800
     ctcgctcaag tgaccgccgt ggtcgatgct cgcgcaagtc atccagagcc gatcgaccaa    154860
     gggcttatgc cgttgatcgt gaataacgcg gtggcagcgg agtgcaatcg gagcggtttc    154920
     aggtactaac ccggattgcc gatagctggc cccacggcca tcgagcaccc atcgcctgcc    154980
     acgcaggaat cgattgcaac atgggccttt cctaataccg cggcatttac gtgctcggtc    155040
     cgccggagga tgtcgacgac gttcaacaga gacgacagcg attcgatgcc gcgctgcctt    155100
     gcagcacgcg cgaggcgatg cttcagcgat agtctccgga cctggtcgcg tgccagaggc    155160
     agcaaccgag ctgttgaaat cggaccgcga ctctttattg agcacctcgc gtcggcgcaa    155220
     tcgcgacaga ggccggtcga gccgtggcgg tcgcgttttc gtttgtcgcg tggaaggctg    155280
     gagtctcgcc ggtaggctta tcgaaccatt cctgcttcac gttcacaacg gcttgcactg    155340
     cgcttgcaac ggccgcaact ccacccagga tcatcacctt gcgctgcagt gcctggctgt    155400
     cagcgtgtcg gcgctcctcg gtcaagtatt gatcgagcac gcgaacagcg ttgggaagca    155460
     ttcggtaagc cgtgttctgt tgcactactt caacgagccc ctcggcaacc aatacgcgga    155520
     ccagcgcgcg aatccgctgg agcacctcat cggctgcggg gtgacgaatc caaccgcgct    155580
     gatacaaaag cgtggcgatc atcacggcgt cgatcgtgcg tccatcttgg tccatcgaaa    155640
     gcctgacgat cgcctgcaag acgtccatgc gctctttgcg ttctaactgg cggcggttga    155700
     atcgaccctc tcgccgttcc ttgcgtcgtg caactcggct gtagtggcga gttcggacct    155760
     tcagccagaa ccgaaacggg tcgcgctcga taaactcaaa gcggcgaagg tagtagacga    155820
     aggtcggttt cgcctgcact gcgcgcgcca ttggaatatc gactgcgtct ggttggtatc    155880
     gaccgtcgtg ccacggccga cccagtaccc cggatctcga caggccgacg atcagcacgt    155940
     ctccctcccc ttcaataccg tcgagtcccg cgtagaaata gtttcgttgt ttcaagcgct    156000
     cgtcacccgt taccgggatg cgatcaggcg acgggttctt ctgcacgatt tcgatggcct    156060
     tacgcagcca cagctcgttc ggaaacatag gtcgtgtttt tatctggcgc gtactcgccg    156120
     tattgtttgg ttcagcgtta agagcgtcgc gaaaatttcc aaccgcgatt tcaatcaaag    156180
     cgctgttgga acagtcgcgt accggataga ctgctcgatg cccgcccctc tcggggcggg    156240
     ctggccttgt cagtggagca taggtccgta cagtcgactc agcctgatgc tccaggacag    156300
     cagttcgacg ccggcggcgg cgcagttcag tcagagagtc agcgttttga gtttcatccg    156360
     ggcacatcca ttttcatttg atgtgctccg tataggcgtt caaagagacg atgcccgcga    156420
     tgccggcgcg gtatgtcgga aaaaccgaat cgttcttcta ttccttctgc tcgccgtgtc    156480
     cggcccttca cccccgattc aaacgcggcc ttatatctga cgccagtaca tcacacctat    156540
     ccggatgtgt catctggcgt agtacaccac tggttgccgg ccgggctgcg tttgggccgg    156600
     tcgtcgcata gccgtcattg gcctacgcaa cctgcagaag gacgctctga tacttttccc    156660
     attatcgccg ccgcgcgcaa cgatgtcggg atgacgagca gctcctcgaa cgatgtcgcc    156720
     cgattgctac tgcgtcggtc accacgtcca gcgctcaccg gccacttcgg cccacgcctc    156780
     gctctccgac gcacaccgat gctgttctgc ggtcatcgcg atctgaacaa gcaggtcatc    156840
     gacgcgccga tcgaacgcat cttggttgtc aaatggcacc tgtagcacgg tcacaccgtc    156900
     tcggatcggc gtccgcccga acccggccag tacttcacgt tcgacgcgct cgaggacgcg    156960
     tgcgcgacca cgcccgcccg gccgcttcgg ctcgacccgc agcttcacgt gcacggcgac    157020
     gagttgggcc gctgcgcccg tgtccgcccg ggcaggcggc gacgcgaccg gcacgcccat    157080
     ggccgccggc ggatccgcgc gatcgagcgc ggcgttgaac aacgcctcga ccgactggaa    157140
     ctggcgtacc gcatccgcct ttgtatatag cgtggtggtc cctaggctgg catgaccgag    157200
     caactcctgc atgtctcgta tgtccgcgcc ggcgtccagg ccatggttcg cgaaagtgtg    157260
     gcgcaaccag tgcgtgctcg cacggcgcaa gtccgccgcc gcgttcggat acgtggcggc    157320
     caactgatcc gccgcccgcg caaaaatccc cttgtagagc cgtccgacca cgtccggatg    157380
     cagtgcttcg ccggtcacca ggttcgcgat gagcggcgta tcggccggcg cggtttcgag    157440
     cgtcagcgga atcgggcggg cgcgcagctg cgcgcgcagc gcgtcgatga gtcgccgcgg    157500
     catcggcaca gtgcgtgcgc gccggccctt gcccatcacc ttcaggctcc acgcatcgtc    157560
     gagcgcgcca tcgagcgcgg tgcgcgtgag tgcgccggtg gtcgcggcgg cgatttcagc    157620
     ccgtcgcagt ccggtgacgt aggcaaacaa cagcaggaac gcgtcgcgcg cgtttgcagc    157680
     ctgattcgct gaccgattcg ccagttggga gtcgccgcca tcgaaggccg acgtagggcg    157740
     cagcaccgtc tgcagcacat actgccactg cgcacgcgtg agcgagcgcc cggtcgcgtc    157800
     gatcggtacc gagggcgcgg ccggaagtcc agcgaacgga ttcacacgca gatactgctg    157860
     ggcaaccaac cattcgccca tcgcattcag gatccgccgc gcggtgtcgc ggctgcgttc    157920
     ggacagcggc ccgacgaacg gtcgccatgc gggatcgaaa cgctcgacgc ggctgcggcc    157980
     gatccagcgc gcagcgggtt gcgggtcgcg caggaacacg tcgagatatt ccgcgcagtc    158040
     catcgtattc aacgacgaca gcggcttgcc cttcgcgacg atcgcccaca gcagcaatcg    158100
     ctcggcttcg cgccggtacg cgcggcgggt cgcttcgctg cgcgcgccgc gcgtcgcgat    158160
     ccaggcatgt accgcctgca ggtcggtgtt cagttcggcc tggtgcgcag gcacaggtgc    158220
     acggttcagg ccggccgagc cgtcgagggc ggctggcacg cgcagcgcct cgagcggcgc    158280
     cacgtcggca gcagcgcccg gtagcggctg cagcgccggg tgacccggtg cgaaatgccg    158340
     acgcggcgtg acggcgagag gcgaaaggta cccaagcgtg tccgggtgtt gcgcaatgaa    158400
     gtcggtaatg cgctgcgcgc cgatcgcgcc caggcgcggt atcgcgcggt accaccgttg    158460
     gcgccgtgta cgcatcagcg cgagcagctc ggcgaacgtc gtgatgccgg ccgccgcgag    158520
     ccgtgcgacc acgcgcgagt cgaaccagcc gtcgagcgtg tggtcgggcc gcggcgcctc    158580
     gacgagactg gcctccatgc gcgcgagtgc ggcgtcctgg cgatcgcgta gtcgacgatt    158640
     gcgcgcggtc ttgctatcga gcgcgggcga cgacgccggc gggtaggtct cgatatacag    158700
     cgcgacgagc tcccgctcgc tgtagaacgc gtccggatcc acctcggccc ggaactcctc    158760
     gagcgtcggc acttcccggc cggccgcggc gccggcgtgc gcgtcgcgcg gcaggctacc    158820
     aggtttcagg cgtagcaggt gcgcggcgtc gacgtcgcgc gcgcgccgcg cggcgatcgt    158880
     gagcgtatcg cgcagcgtcg cgatcgtgcg gcgcgtcacg cgcacgtcgg tccccggcac    158940
     gccgtagtgc gcatgcagcg tcgcttcgtc gagcccttcg aggtacgctc ggtacagcgc    159000
     gaagtggccc ggggtcaggc gcagcgttgc gcgagcgggt gaagcacgca cgtcactggc    159060
     ctccggtcgg cgtcgggtgc agccacgcgg tgcgccgcgc gatccagccg aggccccagc    159120
     tgacgcccat caggccagcg aggccgagac cgagatgcac ggcgaccaac gccggcgcct    159180
     cgtgcacgcg cggcgcgtga tagatcttcc acatgacgtc gagaaacaac cagaatcccg    159240
     accccgcaac ggcggtgaac cactgcggca ccgcgagcgc ggcctgggcg acctgctgtc    159300
     gataaatcag cggcacgagc acgtacgcag ccgtaatcac ccccatcagc acccgcgtgc    159360
     ccggatacat caccgacccc acgccgtagc tcaaggcggc cgcgccgagc gcgaagatcg    159420
     cccattgcca cgcgacgaac ggttcggcga agggttcaac gggccggtcg cgtcccgaca    159480
     cgagcaccgc gtagccgacc tgcaggatcc cgaagccgat cagggcgcag cccgcaccgg    159540
     tggcagcgtg ctccagcgcg gagagcgcat cgtgatggcc gacggccgcg cggacccatg    159600
     cgcgcgcggc gcgcgcggca gtgtccccgt gttgcgccgc cttgcgccat gcgtcgccgg    159660
     cggcctcgaa tgtcgacgcg atcacgatga gcaggccgcc cagcaacgcg tgatagagga    159720
     tgcgcagcgg ctccggccag tgttcgatcg accagcagcg gcgcgacgcg cgtagttcgc    159780
     tcatgcgtgg cctccggttg ccgagcgccg cggcgcgccc tcgatgaggg cggccatgcg    159840
     cgccagcacg tcgcgcatga acgcgggtgc cgcgcactgc gcgtcggccg ggtggaagat    159900
     ccgctcagag cggaacccga ggtaggacaa gcgccacgcg ccgtctgtct cgaactgcag    159960
     gtgtgcggga tggccggcga acagtgcgct gaatttgttc gtgtcctgcg cggcgtgctg    160020
     gtcggcgatc cagcgctgtt gcgcgaacgc gagaaaccgc gcgcgcacgt aggtggtggt    160080
     cagggccatg agcagatctt cagggattag cgcgcaacgc cagcgccgcg cgcaggttcg    160140
     attcggccag cgcgagccgg cgctgcagcg cgtccttttg gtcgaccacg acggcgaacg    160200
     cgtcctcggt cgcctcgagc tcgtgcgcga cgtcgagcag cgcctgcacg acatcggccg    160260
     gcagcgtgcc gcggtaacgc cgcatgcagt ctcgcaagtg cgcggggctc ggcgaattcg    160320
     gtgcgtacag tcgcgtcgtc gttcagcaaa gcgaggcgca tgctatcggg ctcgctcagt    160380
     ggtggaacag gtgcgttcat gcgacaccgc ccgcgggcgc agcgggcgaa tccgcctgca    160440
     gacacgagaa gcctcgagca gccaactcgc gcagcgtcag ttgcacaacc tgcccgccgt    160500
     cgacttcgca tggcagagac aggtcaaacg cgtcacggac cttggcgatg tacgagcagt    160560
     ccgtgtccgg ttcctggctc gacacgttga tgccaacaac cgccccactg tcgtcaaaga    160620
     ccggcccacc gctggcgccc ccgtggagat gcatcgatgt ctcgaagctg ggaaacggca    160680
     gcaagacgcg atcgcgcatc accggataat gctcgacgat atgaccgtcg tagtaatgtg    160740
     agtggaggtc aagccgagcg ttccgtcctc cttgttgagc ctcgaatacc gcatcgggaa    160800
     gcgcaaacgt gaagacgtgc tctccaatca cgggatcgcg ggcactcaat cgcaggatcg    160860
     ggttaggcag cggcgcaccg gtcacccgat gaacactcgg ggccagcacg cagagcgcga    160920
     tgtcggtaac cgcatgcgtt acagcatgaa ccacgggtcg acgttgatac tggccgccgt    160980
     ccaggacatg cacgcaccac agccgcggat acccgtgagg gtccgactca aatgcgacct    161040
     gggccacatg cgccgcggtg atcaacacac ccggtgccac gaagaagccc gtcccgacga    161100
     tctccatcgc ctggccatct tcggtgcgcc gaaacatcga caccactacg gtcgccggat    161160
     cggctggtcg gccgtccgcg aagcgcggtt caaagaactc gggtgcggca acgccgacca    161220
     gggcggccgc acggtgtcgg tccaattcgg cttgtttgcg cgctttcgcc tgctcgacac    161280
     gttgtgcgta agtgccgcgt tgccgtgatt cactcatctg cgatgctccg ttggcggtcg    161340
     tcgatcagga ccatagcagt gtctgggccg ccacggaaac ggtgcgtgcc gtgcggatcc    161400
     aggccgagcc gttccagcgc gtggtggccg gccgcctcga gcgcgtgatt gacgaccgca    161460
     gcgctcattc gccaagcccc gatggagggg ccacgtcggc cgccacacgc atcagctcca    161520
     tcacgtagtc gggcatcgtc agcgcgatcg ccgacgcctg ctcgaagctg acgatgctct    161580
     tcggctcgtc gccataagac agatccgtga tggcgaattc gactgcctgc ttgccgagct    161640
     tcatgcgccg cttcaccgca taggtggccc tgccgcccag ttcgtatccg acgatctccg    161700
     ccacggtcgt gccgatcacc gcgtgccagt gggacgcatc ggccgcgagc gcgtaccagg    161760
     tcacactgcc gctgcgacgt ttcgcaaatt cgaacgcggt cgcccatgcg agcgcgtcct    161820
     ccgcagtggc aaagccgtcc ttgcgggcag ccagctcgta caagccggtc gcccggacgg    161880
     tcgctaggaa cgttggagcg cgttcattgg cgccgggccg ttcaacgagc gtcacgtcgg    161940
     gcaggcgcgg ctcgccgctc gggctgagtt cgaccgagcc gtcgctccga tggaggagca    162000
     tccagctgta gcctccgacg tcgacggtcg aatagttcgc catggcggcg aacgagctgg    162060
     ggatctgggt catgttaggt cctggtcgag ggtcgaggtc gggttcactt ccagaacagc    162120
     gcgggcgcgt ccagcgtcag ggccaacgct tggtcgtctg aaagcccggc gtcgacctgt    162180
     ttgccgtcct gatccgtcac gctcgtcagg acgagaaaat cgcgcgtctc gggaccggcg    162240
     tcggtctgac gggtcaacgg ccgaccctca taaagcgctt ggcgcgccgg ctcgcccgca    162300
     aaatcgtgag tcaggcgaaa caggaggccg gcggaaccgc cgtacggcga caggccatcg    162360
     cgatgaaggg gcccgcctac acagcggcag atgtcttggt ggttcgatgc agcgaagctg    162420
     gtcatgccgg aattccccgt cagagtggtt ggggctcgcg cgccgcgagc cgtgttggac    162480
     gccacgaaaa acgtagcgcc gatcattgtg ccggtcgcgg tccgaaggcg gaccgacgcc    162540
     gacgaatcga accaggcgcc ctcgccggcc ttgcgcggcg gggtctggac aagtatagga    162600
     gaaaatgcgg ccgatctgac agcgaaaagt cgcccatctg ataagtagag ttatcagatg    162660
     tagcagtttt gccgcctgcc ctactgcacg ctgccgccga ccatgaaaaa acccggccgg    162720
     agccgggtgt tgctgcacga acagatcgac gtgcgcgctt gcatttcgct acgcaggccg    162780
     gagccagttt tcgacggcga gtcctgtaac gcgagtgaat tcggccgtat tgtccgtgac    162840
     caagacggcg tcgacggcca tcgcgtgggc agcgatcagc atgtcgttcg ccccgatcaa    162900
     ctgaccctgc ctctcgagat cggctcgcag ccgcccgtag cactgatccg cgtcggactg    162960
     cagcggtaat acggtcaagc tcgcgagcag ctgctcgaca cgctgggcga gcgccgagga    163020
     gccgcgctta cagacgccgt accgtagctc ggccgcgacg acgatcgagg tgcacacttg    163080
     ctcgggccgc gtttccccga tgcgcgaagc gcatgcgccc cgtgggtctc ggatcacgtt    163140
     cgacaaaata ttggtgtcga gcagatagag gctcattcaa tatcgaccgg ttcagcgggg    163200
     aggttttcga tgtcagggaa agtttcgtcc aagggcgccc attgcgcaaa tagctcgcgt    163260
     agagacggcg cttcgaccgg ttcgatgatt aggcgccggc cttcacgatg aatagtgact    163320
     tccgagaccg gcagctcgaa ctcgcgcggg atccgcacgg cctggctacg tccgttgcga    163380
     aataggcgtg cgtggcgggt gtcatgggtt ggcataggga cggctccagt tcaattgcga    163440
     cggcatatgc cacagcatat acaaggtgca gaaaattcgc aaatatccgc cgacatgcga    163500
     gccggccggc gcccatttat ctgcggctac ctgcgccctt cgggctggcc ggattttcgc    163560
     gggaaactgt gcgtgccggc ttgtcggcgc gcagcccgca aaaagacgga tgccgtaacc    163620
     ggccggccgg cgtccactcg agaaacgcca cttcggcgac gaggtcgggc ttcagccagt    163680
     gaaactcacg atcgacctca gggtcggggg cgctggcaaa cggcgagcgt ttgcggccca    163740
     acgccgagag ccgactctcg aattcccgag cctgtcgcgg cgtaaagctc ggcgcgacgt    163800
     ggccgacata gcgcaggcga ccaccctcct cgtacacgcc caacagcaac gcccgcaccc    163860
     ctgctgtcgc ccctttccgg cgggaaaacc cgccgatcac gaactcctgg cgtctgacac    163920
     atttcaattt gatccaccga tccgaccgtc cggaccgata cggtgcgtcg atttgcttgc    163980
     caatgatgcc ttcgaggccg agctcacatg cggatgccag catggcggac gcatctgcct    164040
     cgatcgcctc ggaaaatcga acctcctccc gaagaacttc accgatgatt cccgttagag    164100
     cggatcggcg ctcgtgccat ggccgacggc gaaggtcagt gtcgtctatc cacataaggt    164160
     cgaagaccac aagacatata ccggtggtac gccgactgtt gaatgcttcc tgcagacggc    164220
     tgaagttagg gcgcccatcg ggggcgaaac atacggcctc ggcatcaagc cacgcgcgtt    164280
     ggaccggtaa cctcttcagg accgcggtca ggtgcgggag cttactcgtc caatcgtggc    164340
     cattccttgt atagagccgt acgtcaccat catcgacgcg cacgagcatc cggtaaccgt    164400
     cgaactttat ctcgtaggcc caatctcccg ccggcggcgg ctcggacatt agcacggcca    164460
     aggcaggcgc aatgaattcg gacatgcgcg cattcttggc tacgaccacc cccgctcggg    164520
     tcttttgtgc tgttgtacgc cgttgcatac ggcctccctc ttgccgatcg gaatgcgcgc    164580
     aatcgagcgc aatcgatata cccgacggcc ttcgcaattg accgaggctt gcaccttggc    164640
     tcgagccaag atctcggcga tccatcgggg tcagcttcca ctgcttcagc cgatactcga    164700
     tcctgctctg gatttgcagg tcttgctggc tatcggcaca agagcgagtc cttgacgatc    164760
     tggctggcgc gatacgctct tgcaggtgcc atgtccggct ggcgagcgac gttcattgga    164820
     acgtctttgc ggtcttggct cgagccaaga tgcgcgcagg caacgccaat tcagacgtgg    164880
     ctgcggtgat cttggctcga gccaatcgca tagcgggccc gaagcgttgt agtgcgacca    164940
     catttataag tcttttttcg ggatttttac tcggttgatt gacatagttt gttggtcgaa    165000
     tgacaatccg atcgtcgaaa catgcttcga gcggaggtta aatggtcatc accatcggtg    165060
     cggaaaaagg cggcgttgcg aagacacgat tagcgacgca catcgcggca ttagctgcga    165120
     gcgagggagt ggacgtggtt cttctcgata cggacaaaca ggggtccgct atgagctggt    165180
     cgcgaattcg aaatgaggaa ggcgtcacac cttccatccc tgtactcgcg ctcccggcga    165240
     atcccgcacg cgagctagcg aatctggcaa acaagtacac gctagtggtg gttgatatcg    165300
     gggcgcaaaa ctaccggacc atgctggaat gcgcactttt atccgatctc gtgctagttc    165360
     cgtgtggtcc cgaccaacag gaagttgaat caactctcaa cgtttttgcg acccttaagg    165420
     acatggggcc caggcacgag agtggggaaa tcccagccta cgttgttctt acgcgagttt    165480
     cgccgattga aggatccaag gcgacggcgg aactgagaag ctatttcaaa agcgaagata    165540
     tccggttgtt tgattcgcag attccccagc gggaagcatg gcgcgcgacc ggcaagactg    165600
     gacgcgcggt tcacgagctg aaaggccgcg atcgttccaa aaaagcgatt gaagagatgg    165660
     aagcggtcta ccgggaaatc attaagcgga tcaatggtgg ggaggaggaa taatggctac    165720
     tttccggaaa aaggcggttg atatcgaacg agtggcagcc gtcgaggatg cagcttcgtc    165780
     ggcgccgatc gtcggcgacc ctcgcttggc accgacgatg ccctcagttt cgcagcgtga    165840
     gagcggggcg gttggctcga gccaagaccc taggaagtat gaggttggac acgtatatga    165900
     aatcccgatt ggcaaaataa gatcaaattc tgtcaatcca agagcgatct acaccgcttc    165960
     tgctgtctcc gagatggcgg aatctctcct cgcgcggggc caaggtcaag ccgcgatcgg    166020
     ctatgtcaac gatgacgcag agattgtgct catcgacggc gagcggcggc ttcgcggcgc    166080
     tcggactgcc ggcctttcga ccctgcggat cgagattcgt ccgaagcccg gaagcgagcg    166140
     cgagctttat gaggaagccc gggctgcgaa cgtagagcgg aaggatcaaa gcccgttgga    166200
     cgacgctatc aaatggaagg agttgatcgc gcggaagatc tatcccacgc aagcggcgct    166260
     tgctaaggcg ctgaatctcg gcgaagacca cgtgagccgc acattgtctc tcgcccaatt    166320
     gccgaacaag cttgtccaag cagcggcgga gcacccggaa cttctttctc tcaaaatgct    166380
     gaacgccatt cgagagttct gggaagtgaa gggggacgat gaaactctcg agctgatttc    166440
     cgaggctgcg aagaatgggc tggggtatcg cgacgtagcc gctcgccgta aggccgctgc    166500
     aaaaggaccg gttcggcggc cgcggtcgac gcgggaacag ctgagttttc gaggagcgaa    166560
     gggggagttt aagtcttttg aagaggacgg ccggatcgag ttgaagctga agggcttggc    166620
     accggacgtc gcggccgaga tcagtgaaaa aatcttggct cttttcccga aggagtaggg    166680
     ggcgctgctg cttcgcagcg caagcgggtt accgacacag gggctagagg acgttgagct    166740
     gggatgtgct gcgctgtgca actgtgcacg gctgcagcat ctggaaacta tcggctctgg    166800
     agcgatgggt tctctttaca tcctgtaaga aagtctcgtg cttggagcga tggtgtatga    166860
     cgttcctcca gcgatggtgc agacgcggcg ggcttgagcg cgagagtgtg tgctcacctt    166920
     gctttgcgca tctcgggtcg ttcttccagc gatgcttctc gtcgagaatc gttcctccag    166980
     cgatgtttgt gggtgactcg gcggccggta ctgtcgttca tggagcgatg agtgacggat    167040
     ccaccgtgag attgttgggc tgcaggtatc gtgcttccag cgatggatga catgattaga    167100
     aaaagattaa agacgattag gctttgtgga aaacataggt agcccactga ttgcaaagag    167160
     gttttttgcg gatcgtgctc gctggaagaa cgatagatgc atcgctggcg atacgatgca    167220
     cgcctcgctg gagagacgat gggcaacgct gcaggaacga cagaggttgc acgctggagg    167280
     aacgaggaac atcgctgcag gaacgactgc gccgcgatac ctcgctggag ggacgatagt    167340
     cccgtagttt ttttgctgaa ccatcgctgg agagacgaga caagggtctt gatggcggga    167400
     ccgacctaca tatacttctc gc                                             167422
//

If you have problems or comments...

PBIL Back to PBIL home page