(data stored in ACNUC7421 zone)

EMBL: AP009389

ID   AP009389; SV 1; circular; genomic DNA; STD; PRO; 3025375 BP.
XX
AC   AP009389; BAAC01000000-BAAC01000195;
XX
PR   Project:PRJDA19023;
XX
DT   08-MAY-2007 (Rel. 91, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 8)
XX
DE   Pelotomaculum thermopropionicum SI DNA, complete genome.
XX
KW   .
XX
OS   Pelotomaculum thermopropionicum SI
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae;
OC   Pelotomaculum.
XX
RN   [1]
RP   1-3025375
RA   Watanabe K., Kosaka T.;
RT   ;
RL   Submitted (07-MAY-2007) to the INSDC.
RL   Contact:Kazuya Watanabe Marine Biotechnology Institute Co., Ltd.; 3-75-1
RL   Heita, Kamaishi, Iwate 026-0001, Japan
XX
RN   [2]
RA   Kosaka T., Kato S., Shimoyama T., Ishii S., Asami H., Watanabe K.;
RT   "The complete genome sequence of Pelotomaculum thermopropionicum.";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1128/JB.188.1.202-210.2006.
RX   PUBMED; 16352836.
RA   Kosaka T., Uchiyama T., Ishii S., Enoki M., Imachi H., Kamagata Y.,
RA   Ohashi A., Harada H., Ikenaga H., Watanabe K.;
RT   "Reconstruction and regulation of the central catabolic pathway in the
RT   thermophilic propionate-oxidizing syntroph Pelotomaculum
RT   thermopropionicum";
RL   J. Bacteriol. 188(1):202-210(2006).
XX
DR   MD5; 1329a630c76c54e21782c1ab3f42629a.
DR   BioSample; SAMD00060921.
DR   EnsemblGenomes-Gn; EBG00001023637.
DR   EnsemblGenomes-Gn; EBG00001023638.
DR   EnsemblGenomes-Gn; EBG00001023640.
DR   EnsemblGenomes-Gn; EBG00001023641.
DR   EnsemblGenomes-Gn; EBG00001023643.
DR   EnsemblGenomes-Gn; EBG00001023645.
DR   EnsemblGenomes-Gn; EBG00001023647.
DR   EnsemblGenomes-Gn; EBG00001023649.
DR   EnsemblGenomes-Gn; EBG00001023652.
DR   EnsemblGenomes-Gn; EBG00001023654.
DR   EnsemblGenomes-Gn; EBG00001023656.
DR   EnsemblGenomes-Gn; EBG00001023658.
DR   EnsemblGenomes-Gn; EBG00001023661.
DR   EnsemblGenomes-Gn; EBG00001023662.
DR   EnsemblGenomes-Gn; EBG00001023665.
DR   EnsemblGenomes-Gn; EBG00001023667.
DR   EnsemblGenomes-Gn; EBG00001023669.
DR   EnsemblGenomes-Gn; EBG00001023671.
DR   EnsemblGenomes-Gn; EBG00001023674.
DR   EnsemblGenomes-Gn; EBG00001023676.
DR   EnsemblGenomes-Gn; EBG00001023678.
DR   EnsemblGenomes-Gn; EBG00001023681.
DR   EnsemblGenomes-Gn; EBG00001023683.
DR   EnsemblGenomes-Gn; EBG00001023685.
DR   EnsemblGenomes-Gn; EBG00001023687.
DR   EnsemblGenomes-Gn; EBG00001023689.
DR   EnsemblGenomes-Gn; EBG00001023692.
DR   EnsemblGenomes-Gn; EBG00001023694.
DR   EnsemblGenomes-Gn; EBG00001023696.
DR   EnsemblGenomes-Gn; EBG00001023698.
DR   EnsemblGenomes-Gn; EBG00001023700.
DR   EnsemblGenomes-Gn; EBG00001023703.
DR   EnsemblGenomes-Gn; EBG00001023705.
DR   EnsemblGenomes-Gn; EBG00001023707.
DR   EnsemblGenomes-Gn; EBG00001023709.
DR   EnsemblGenomes-Gn; EBG00001023711.
DR   EnsemblGenomes-Gn; EBG00001023713.
DR   EnsemblGenomes-Gn; EBG00001023715.
DR   EnsemblGenomes-Gn; EBG00001023716.
DR   EnsemblGenomes-Gn; EBG00001023717.
DR   EnsemblGenomes-Gn; EBG00001023719.
DR   EnsemblGenomes-Gn; EBG00001023722.
DR   EnsemblGenomes-Gn; EBG00001023723.
DR   EnsemblGenomes-Gn; EBG00001023725.
DR   EnsemblGenomes-Gn; EBG00001023727.
DR   EnsemblGenomes-Gn; EBG00001023729.
DR   EnsemblGenomes-Gn; EBG00001023731.
DR   EnsemblGenomes-Gn; EBG00001023734.
DR   EnsemblGenomes-Gn; EBG00001023736.
DR   EnsemblGenomes-Gn; EBG00001023739.
DR   EnsemblGenomes-Gn; EBG00001023741.
DR   EnsemblGenomes-Gn; EBG00001023744.
DR   EnsemblGenomes-Gn; EBG00001023746.
DR   EnsemblGenomes-Gn; EBG00001023748.
DR   EnsemblGenomes-Gn; EBG00001023749.
DR   EnsemblGenomes-Gn; EBG00001023751.
DR   EnsemblGenomes-Gn; EBG00001023753.
DR   EnsemblGenomes-Gn; EBG00001023755.
DR   EnsemblGenomes-Gn; EBG00001023757.
DR   EnsemblGenomes-Gn; EBG00001023759.
DR   EnsemblGenomes-Gn; EBG00001023761.
DR   EnsemblGenomes-Gn; EBG00001023763.
DR   EnsemblGenomes-Gn; EBG00001023766.
DR   EnsemblGenomes-Gn; EBG00001023768.
DR   EnsemblGenomes-Gn; EBG00001023770.
DR   EnsemblGenomes-Gn; EBG00001023773.
DR   EnsemblGenomes-Gn; EBG00001023775.
DR   EnsemblGenomes-Gn; EBG00001023777.
DR   EnsemblGenomes-Gn; EBG00001023779.
DR   EnsemblGenomes-Gn; EBG00001023781.
DR   EnsemblGenomes-Gn; EBG00001023783.
DR   EnsemblGenomes-Gn; EBG00001023785.
DR   EnsemblGenomes-Gn; EBG00001023787.
DR   EnsemblGenomes-Gn; EBG00001023789.
DR   EnsemblGenomes-Gn; EBG00001023791.
DR   EnsemblGenomes-Gn; EBG00001023792.
DR   EnsemblGenomes-Gn; EBG00001023794.
DR   EnsemblGenomes-Gn; EBG00001023796.
DR   EnsemblGenomes-Gn; EBG00001023799.
DR   EnsemblGenomes-Gn; EBG00001023801.
DR   EnsemblGenomes-Gn; EBG00001023803.
DR   EnsemblGenomes-Gn; EBG00001023805.
DR   EnsemblGenomes-Gn; EBG00001023807.
DR   EnsemblGenomes-Gn; EBG00001023809.
DR   EnsemblGenomes-Gn; EBG00001023811.
DR   EnsemblGenomes-Gn; EBG00001023814.
DR   EnsemblGenomes-Gn; EBG00001023816.
DR   EnsemblGenomes-Gn; EBG00001023818.
DR   EnsemblGenomes-Gn; EBG00001023820.
DR   EnsemblGenomes-Gn; EBG00001023823.
DR   EnsemblGenomes-Gn; EBG00001023825.
DR   EnsemblGenomes-Gn; EBG00001023826.
DR   EnsemblGenomes-Gn; EBG00001023827.
DR   EnsemblGenomes-Gn; EBG00001023829.
DR   EnsemblGenomes-Gn; EBG00001023832.
DR   EnsemblGenomes-Gn; EBG00001023834.
DR   EnsemblGenomes-Gn; EBG00001023835.
DR   EnsemblGenomes-Gn; EBG00001023837.
DR   EnsemblGenomes-Gn; EBG00001023839.
DR   EnsemblGenomes-Gn; EBG00001023841.
DR   EnsemblGenomes-Gn; EBG00001023843.
DR   EnsemblGenomes-Gn; EBG00001023846.
DR   EnsemblGenomes-Gn; EBG00001023847.
DR   EnsemblGenomes-Gn; EBG00001023848.
DR   EnsemblGenomes-Gn; EBG00001023849.
DR   EnsemblGenomes-Gn; EBG00001023850.
DR   EnsemblGenomes-Gn; EBG00001023851.
DR   EnsemblGenomes-Gn; EBG00001023852.
DR   EnsemblGenomes-Gn; EBG00001023853.
DR   EnsemblGenomes-Gn; EBG00001023854.
DR   EnsemblGenomes-Gn; EBG00001023855.
DR   EnsemblGenomes-Gn; EBG00001023856.
DR   EnsemblGenomes-Gn; EBG00001023857.
DR   EnsemblGenomes-Gn; EBG00001023858.
DR   EnsemblGenomes-Gn; EBG00001023859.
DR   EnsemblGenomes-Gn; EBG00001023860.
DR   EnsemblGenomes-Gn; EBG00001023861.
DR   EnsemblGenomes-Gn; EBG00001023862.
DR   EnsemblGenomes-Gn; EBG00001023863.
DR   EnsemblGenomes-Gn; EBG00001023864.
DR   EnsemblGenomes-Gn; EBG00001023865.
DR   EnsemblGenomes-Gn; EBG00001023866.
DR   EnsemblGenomes-Gn; EBG00001023867.
DR   EnsemblGenomes-Gn; EBG00001023868.
DR   EnsemblGenomes-Gn; EBG00001023869.
DR   EnsemblGenomes-Gn; EBG00001023870.
DR   EnsemblGenomes-Gn; EBG00001023871.
DR   EnsemblGenomes-Gn; EBG00001023872.
DR   EnsemblGenomes-Gn; EBG00001023873.
DR   EnsemblGenomes-Gn; EBG00001023874.
DR   EnsemblGenomes-Gn; EBG00001023875.
DR   EnsemblGenomes-Gn; EBG00001023876.
DR   EnsemblGenomes-Gn; EBG00001023877.
DR   EnsemblGenomes-Gn; EBG00001023878.
DR   EnsemblGenomes-Gn; EBG00001023879.
DR   EnsemblGenomes-Gn; EBG00001023880.
DR   EnsemblGenomes-Gn; EBG00001023881.
DR   EnsemblGenomes-Gn; EBG00001023882.
DR   EnsemblGenomes-Gn; EBG00001023883.
DR   EnsemblGenomes-Gn; EBG00001023884.
DR   EnsemblGenomes-Gn; EBG00001023885.
DR   EnsemblGenomes-Gn; EBG00001023886.
DR   EnsemblGenomes-Gn; EBG00001023887.
DR   EnsemblGenomes-Gn; EBG00001023888.
DR   EnsemblGenomes-Gn; EBG00001023889.
DR   EnsemblGenomes-Gn; EBG00001023890.
DR   EnsemblGenomes-Gn; EBG00001023891.
DR   EnsemblGenomes-Gn; EBG00001023892.
DR   EnsemblGenomes-Gn; EBG00001023893.
DR   EnsemblGenomes-Gn; EBG00001023894.
DR   EnsemblGenomes-Gn; EBG00001023895.
DR   EnsemblGenomes-Gn; EBG00001023896.
DR   EnsemblGenomes-Gn; EBG00001023897.
DR   EnsemblGenomes-Gn; EBG00001023898.
DR   EnsemblGenomes-Gn; EBG00001023899.
DR   EnsemblGenomes-Gn; EBG00001023900.
DR   EnsemblGenomes-Gn; EBG00001023901.
DR   EnsemblGenomes-Gn; EBG00001023902.
DR   EnsemblGenomes-Gn; EBG00001023903.
DR   EnsemblGenomes-Gn; EBG00001023904.
DR   EnsemblGenomes-Gn; EBG00001023905.
DR   EnsemblGenomes-Gn; EBG00001023906.
DR   EnsemblGenomes-Gn; EBG00001023907.
DR   EnsemblGenomes-Gn; EBG00001023908.
DR   EnsemblGenomes-Gn; EBG00001023909.
DR   EnsemblGenomes-Gn; EBG00001023910.
DR   EnsemblGenomes-Gn; EBG00001023911.
DR   EnsemblGenomes-Gn; EBG00001023912.
DR   EnsemblGenomes-Gn; EBG00001023913.
DR   EnsemblGenomes-Gn; EBG00001023914.
DR   EnsemblGenomes-Gn; EBG00001023915.
DR   EnsemblGenomes-Gn; EBG00001023916.
DR   EnsemblGenomes-Gn; EBG00001023917.
DR   EnsemblGenomes-Gn; EBG00001023918.
DR   EnsemblGenomes-Gn; EBG00001023919.
DR   EnsemblGenomes-Gn; EBG00001023920.
DR   EnsemblGenomes-Gn; EBG00001023921.
DR   EnsemblGenomes-Gn; EBG00001023922.
DR   EnsemblGenomes-Gn; EBG00001023923.
DR   EnsemblGenomes-Gn; EBG00001023924.
DR   EnsemblGenomes-Gn; EBG00001023925.
DR   EnsemblGenomes-Gn; EBG00001023926.
DR   EnsemblGenomes-Gn; EBG00001023927.
DR   EnsemblGenomes-Gn; EBG00001023928.
DR   EnsemblGenomes-Gn; EBG00001023929.
DR   EnsemblGenomes-Gn; EBG00001023930.
DR   EnsemblGenomes-Gn; EBG00001023931.
DR   EnsemblGenomes-Gn; EBG00001023932.
DR   EnsemblGenomes-Gn; EBG00001023933.
DR   EnsemblGenomes-Gn; EBG00001023934.
DR   EnsemblGenomes-Gn; EBG00001023935.
DR   EnsemblGenomes-Gn; EBG00001023936.
DR   EnsemblGenomes-Gn; EBG00001023937.
DR   EnsemblGenomes-Gn; EBG00001023938.
DR   EnsemblGenomes-Gn; EBG00001023939.
DR   EnsemblGenomes-Gn; EBG00001023940.
DR   EnsemblGenomes-Gn; EBG00001023941.
DR   EnsemblGenomes-Gn; EBG00001023942.
DR   EnsemblGenomes-Gn; EBG00001023943.
DR   EnsemblGenomes-Gn; EBG00001023944.
DR   EnsemblGenomes-Gn; EBG00001023945.
DR   EnsemblGenomes-Gn; EBG00001023946.
DR   EnsemblGenomes-Gn; EBG00001023947.
DR   EnsemblGenomes-Gn; EBG00001023948.
DR   EnsemblGenomes-Gn; EBG00001023949.
DR   EnsemblGenomes-Gn; EBG00001023950.
DR   EnsemblGenomes-Gn; EBG00001023951.
DR   EnsemblGenomes-Gn; EBG00001023952.
DR   EnsemblGenomes-Gn; EBG00001023953.
DR   EnsemblGenomes-Gn; EBG00001023954.
DR   EnsemblGenomes-Gn; EBG00001023955.
DR   EnsemblGenomes-Gn; EBG00001023956.
DR   EnsemblGenomes-Gn; EBG00001023957.
DR   EnsemblGenomes-Gn; EBG00001023958.
DR   EnsemblGenomes-Gn; EBG00001023959.
DR   EnsemblGenomes-Gn; EBG00001023960.
DR   EnsemblGenomes-Gn; EBG00001023961.
DR   EnsemblGenomes-Gn; EBG00001023962.
DR   EnsemblGenomes-Gn; EBG00001023963.
DR   EnsemblGenomes-Gn; EBG00001023964.
DR   EnsemblGenomes-Gn; EBG00001023965.
DR   EnsemblGenomes-Gn; EBG00001023966.
DR   EnsemblGenomes-Gn; EBG00001023967.
DR   EnsemblGenomes-Gn; EBG00001023968.
DR   EnsemblGenomes-Gn; EBG00001023969.
DR   EnsemblGenomes-Gn; EBG00001023970.
DR   EnsemblGenomes-Gn; EBG00001023971.
DR   EnsemblGenomes-Gn; EBG00001023972.
DR   EnsemblGenomes-Gn; EBG00001023973.
DR   EnsemblGenomes-Gn; EBG00001023974.
DR   EnsemblGenomes-Gn; EBG00001023975.
DR   EnsemblGenomes-Gn; EBG00001023976.
DR   EnsemblGenomes-Gn; EBG00001023977.
DR   EnsemblGenomes-Gn; EBG00001023978.
DR   EnsemblGenomes-Gn; EBG00001023979.
DR   EnsemblGenomes-Gn; EBG00001023980.
DR   EnsemblGenomes-Gn; EBG00001023981.
DR   EnsemblGenomes-Gn; EBG00001023982.
DR   EnsemblGenomes-Gn; EBG00001023983.
DR   EnsemblGenomes-Gn; EBG00001023984.
DR   EnsemblGenomes-Gn; EBG00001023985.
DR   EnsemblGenomes-Gn; EBG00001023986.
DR   EnsemblGenomes-Gn; EBG00001023987.
DR   EnsemblGenomes-Gn; EBG00001023988.
DR   EnsemblGenomes-Gn; EBG00001023989.
DR   EnsemblGenomes-Gn; EBG00001023990.
DR   EnsemblGenomes-Gn; EBG00001023991.
DR   EnsemblGenomes-Gn; EBG00001023992.
DR   EnsemblGenomes-Gn; EBG00001023993.
DR   EnsemblGenomes-Gn; EBG00001023994.
DR   EnsemblGenomes-Gn; EBG00001023995.
DR   EnsemblGenomes-Gn; EBG00001023996.
DR   EnsemblGenomes-Gn; EBG00001023997.
DR   EnsemblGenomes-Gn; EBG00001023998.
DR   EnsemblGenomes-Gn; EBG00001023999.
DR   EnsemblGenomes-Gn; EBG00001024000.
DR   EnsemblGenomes-Gn; EBG00001024001.
DR   EnsemblGenomes-Gn; EBG00001024002.
DR   EnsemblGenomes-Gn; EBG00001024003.
DR   EnsemblGenomes-Gn; EBG00001024004.
DR   EnsemblGenomes-Gn; EBG00001024005.
DR   EnsemblGenomes-Gn; EBG00001024006.
DR   EnsemblGenomes-Gn; EBG00001024007.
DR   EnsemblGenomes-Gn; EBG00001024008.
DR   EnsemblGenomes-Gn; EBG00001024009.
DR   EnsemblGenomes-Gn; EBG00001024010.
DR   EnsemblGenomes-Gn; EBG00001024011.
DR   EnsemblGenomes-Gn; EBG00001024012.
DR   EnsemblGenomes-Gn; EBG00001024014.
DR   EnsemblGenomes-Gn; EBG00001024015.
DR   EnsemblGenomes-Gn; EBG00001024017.
DR   EnsemblGenomes-Gn; EBG00001024019.
DR   EnsemblGenomes-Gn; EBG00001024021.
DR   EnsemblGenomes-Gn; EBG00001024022.
DR   EnsemblGenomes-Gn; EBG00001024024.
DR   EnsemblGenomes-Gn; EBG00001024026.
DR   EnsemblGenomes-Gn; EBG00001024029.
DR   EnsemblGenomes-Gn; EBG00001024031.
DR   EnsemblGenomes-Gn; EBG00001024032.
DR   EnsemblGenomes-Gn; EBG00001024034.
DR   EnsemblGenomes-Gn; EBG00001024036.
DR   EnsemblGenomes-Gn; EBG00001024038.
DR   EnsemblGenomes-Gn; EBG00001024040.
DR   EnsemblGenomes-Gn; EBG00001024042.
DR   EnsemblGenomes-Gn; EBG00001024044.
DR   EnsemblGenomes-Gn; EBG00001024046.
DR   EnsemblGenomes-Gn; EBG00001024047.
DR   EnsemblGenomes-Gn; EBG00001024049.
DR   EnsemblGenomes-Gn; EBG00001024051.
DR   EnsemblGenomes-Gn; EBG00001024053.
DR   EnsemblGenomes-Gn; EBG00001024055.
DR   EnsemblGenomes-Gn; EBG00001024057.
DR   EnsemblGenomes-Gn; EBG00001024059.
DR   EnsemblGenomes-Gn; EBG00001024061.
DR   EnsemblGenomes-Gn; EBG00001024063.
DR   EnsemblGenomes-Gn; EBG00001024064.
DR   EnsemblGenomes-Gn; EBG00001024066.
DR   EnsemblGenomes-Gn; EBG00001024067.
DR   EnsemblGenomes-Gn; EBG00001024068.
DR   EnsemblGenomes-Gn; EBG00001024069.
DR   EnsemblGenomes-Gn; EBG00001024070.
DR   EnsemblGenomes-Gn; EBG00001024071.
DR   EnsemblGenomes-Gn; EBG00001024072.
DR   EnsemblGenomes-Gn; EBG00001024074.
DR   EnsemblGenomes-Gn; EBG00001024076.
DR   EnsemblGenomes-Gn; EBG00001024078.
DR   EnsemblGenomes-Gn; EBG00001024080.
DR   EnsemblGenomes-Gn; EBG00001024082.
DR   EnsemblGenomes-Gn; EBG00001024084.
DR   EnsemblGenomes-Gn; EBG00001024086.
DR   EnsemblGenomes-Gn; EBG00001024088.
DR   EnsemblGenomes-Gn; EBG00001024090.
DR   EnsemblGenomes-Gn; EBG00001024092.
DR   EnsemblGenomes-Gn; EBG00001024094.
DR   EnsemblGenomes-Gn; EBG00001024096.
DR   EnsemblGenomes-Gn; EBG00001024098.
DR   EnsemblGenomes-Gn; EBG00001024100.
DR   EnsemblGenomes-Gn; EBG00001024102.
DR   EnsemblGenomes-Gn; EBG00001024104.
DR   EnsemblGenomes-Gn; EBG00001024106.
DR   EnsemblGenomes-Gn; EBG00001024108.
DR   EnsemblGenomes-Gn; EBG00001024110.
DR   EnsemblGenomes-Gn; EBG00001024112.
DR   EnsemblGenomes-Gn; EBG00001024114.
DR   EnsemblGenomes-Gn; EBG00001024116.
DR   EnsemblGenomes-Gn; EBG00001024118.
DR   EnsemblGenomes-Gn; EBG00001024120.
DR   EnsemblGenomes-Gn; EBG00001024122.
DR   EnsemblGenomes-Gn; EBG00001024124.
DR   EnsemblGenomes-Gn; EBG00001024126.
DR   EnsemblGenomes-Gn; EBG00001024127.
DR   EnsemblGenomes-Gn; EBG00001024129.
DR   EnsemblGenomes-Gn; EBG00001024131.
DR   EnsemblGenomes-Gn; EBG00001024132.
DR   EnsemblGenomes-Gn; EBG00001024133.
DR   EnsemblGenomes-Gn; EBG00001024134.
DR   EnsemblGenomes-Gn; EBG00001024135.
DR   EnsemblGenomes-Gn; EBG00001024136.
DR   EnsemblGenomes-Gn; EBG00001024138.
DR   EnsemblGenomes-Gn; EBG00001024139.
DR   EnsemblGenomes-Gn; EBG00001024141.
DR   EnsemblGenomes-Gn; EBG00001024143.
DR   EnsemblGenomes-Gn; EBG00001024145.
DR   EnsemblGenomes-Gn; EBG00001024147.
DR   EnsemblGenomes-Gn; EBG00001024152.
DR   EnsemblGenomes-Gn; EBG00001024154.
DR   EnsemblGenomes-Gn; EBG00001024155.
DR   EnsemblGenomes-Gn; EBG00001024157.
DR   EnsemblGenomes-Gn; EBG00001024159.
DR   EnsemblGenomes-Gn; EBG00001024161.
DR   EnsemblGenomes-Gn; EBG00001024162.
DR   EnsemblGenomes-Gn; EBG00001024164.
DR   EnsemblGenomes-Gn; EBG00001024166.
DR   EnsemblGenomes-Gn; EBG00001024168.
DR   EnsemblGenomes-Gn; EBG00001024171.
DR   EnsemblGenomes-Gn; EBG00001024173.
DR   EnsemblGenomes-Gn; EBG00001024175.
DR   EnsemblGenomes-Gn; EBG00001024177.
DR   EnsemblGenomes-Gn; EBG00001024179.
DR   EnsemblGenomes-Gn; EBG00001024180.
DR   EnsemblGenomes-Gn; EBG00001024181.
DR   EnsemblGenomes-Gn; EBG00001024184.
DR   EnsemblGenomes-Gn; EBG00001024185.
DR   EnsemblGenomes-Gn; EBG00001024186.
DR   EnsemblGenomes-Gn; EBG00001024187.
DR   EnsemblGenomes-Gn; EBG00001024188.
DR   EnsemblGenomes-Gn; EBG00001024190.
DR   EnsemblGenomes-Gn; EBG00001024192.
DR   EnsemblGenomes-Gn; EBG00001024194.
DR   EnsemblGenomes-Gn; EBG00001024196.
DR   EnsemblGenomes-Gn; EBG00001024198.
DR   EnsemblGenomes-Gn; EBG00001024200.
DR   EnsemblGenomes-Gn; EBG00001024202.
DR   EnsemblGenomes-Gn; EBG00001024204.
DR   EnsemblGenomes-Gn; EBG00001024206.
DR   EnsemblGenomes-Gn; EBG00001024208.
DR   EnsemblGenomes-Gn; EBG00001024210.
DR   EnsemblGenomes-Gn; EBG00001024212.
DR   EnsemblGenomes-Gn; EBG00001024214.
DR   EnsemblGenomes-Gn; EBG00001024216.
DR   EnsemblGenomes-Gn; EBG00001024218.
DR   EnsemblGenomes-Gn; EBG00001024220.
DR   EnsemblGenomes-Gn; EBG00001024222.
DR   EnsemblGenomes-Gn; EBG00001024224.
DR   EnsemblGenomes-Gn; EBG00001024226.
DR   EnsemblGenomes-Gn; EBG00001024228.
DR   EnsemblGenomes-Gn; EBG00001024230.
DR   EnsemblGenomes-Gn; EBG00001024232.
DR   EnsemblGenomes-Gn; EBG00001024234.
DR   EnsemblGenomes-Gn; EBG00001024236.
DR   EnsemblGenomes-Gn; EBG00001024238.
DR   EnsemblGenomes-Gn; EBG00001024239.
DR   EnsemblGenomes-Gn; EBG00001024240.
DR   EnsemblGenomes-Gn; EBG00001024241.
DR   EnsemblGenomes-Gn; EBG00001024242.
DR   EnsemblGenomes-Gn; EBG00001024244.
DR   EnsemblGenomes-Gn; EBG00001024246.
DR   EnsemblGenomes-Gn; EBG00001024249.
DR   EnsemblGenomes-Gn; EBG00001024251.
DR   EnsemblGenomes-Gn; EBG00001024253.
DR   EnsemblGenomes-Gn; EBG00001024255.
DR   EnsemblGenomes-Gn; EBG00001024257.
DR   EnsemblGenomes-Gn; EBG00001024259.
DR   EnsemblGenomes-Gn; EBG00001024261.
DR   EnsemblGenomes-Gn; EBG00001024263.
DR   EnsemblGenomes-Gn; EBG00001024265.
DR   EnsemblGenomes-Gn; EBG00001024267.
DR   EnsemblGenomes-Gn; EBG00001024269.
DR   EnsemblGenomes-Gn; EBG00001024271.
DR   EnsemblGenomes-Gn; EBG00001024273.
DR   EnsemblGenomes-Gn; EBG00001024275.
DR   EnsemblGenomes-Gn; EBG00001024277.
DR   EnsemblGenomes-Gn; EBG00001024278.
DR   EnsemblGenomes-Gn; EBG00001024279.
DR   EnsemblGenomes-Gn; EBG00001024280.
DR   EnsemblGenomes-Gn; EBG00001024281.
DR   EnsemblGenomes-Gn; EBG00001024282.
DR   EnsemblGenomes-Gn; EBG00001024283.
DR   EnsemblGenomes-Gn; EBG00001024285.
DR   EnsemblGenomes-Gn; EBG00001024287.
DR   EnsemblGenomes-Gn; EBG00001024289.
DR   EnsemblGenomes-Gn; EBG00001024291.
DR   EnsemblGenomes-Gn; EBG00001024293.
DR   EnsemblGenomes-Gn; EBG00001024295.
DR   EnsemblGenomes-Gn; EBG00001024297.
DR   EnsemblGenomes-Gn; EBG00001024298.
DR   EnsemblGenomes-Gn; EBG00001024301.
DR   EnsemblGenomes-Gn; EBG00001024303.
DR   EnsemblGenomes-Gn; EBG00001024305.
DR   EnsemblGenomes-Gn; EBG00001024307.
DR   EnsemblGenomes-Gn; EBG00001024309.
DR   EnsemblGenomes-Gn; EBG00001024311.
DR   EnsemblGenomes-Gn; EBG00001024313.
DR   EnsemblGenomes-Gn; EBG00001024315.
DR   EnsemblGenomes-Gn; EBG00001024317.
DR   EnsemblGenomes-Gn; EBG00001024318.
DR   EnsemblGenomes-Gn; EBG00001024319.
DR   EnsemblGenomes-Gn; EBG00001024320.
DR   EnsemblGenomes-Gn; EBG00001024321.
DR   EnsemblGenomes-Gn; EBG00001024322.
DR   EnsemblGenomes-Gn; EBG00001024324.
DR   EnsemblGenomes-Gn; EBG00001024326.
DR   EnsemblGenomes-Gn; EBG00001024328.
DR   EnsemblGenomes-Gn; EBG00001024329.
DR   EnsemblGenomes-Gn; EBG00001024331.
DR   EnsemblGenomes-Gn; EBG00001024333.
DR   EnsemblGenomes-Gn; EBG00001024335.
DR   EnsemblGenomes-Gn; EBG00001024337.
DR   EnsemblGenomes-Gn; EBG00001024338.
DR   EnsemblGenomes-Gn; EBG00001024340.
DR   EnsemblGenomes-Gn; EBG00001024342.
DR   EnsemblGenomes-Gn; EBG00001024343.
DR   EnsemblGenomes-Gn; EBG00001024345.
DR   EnsemblGenomes-Gn; EBG00001024347.
DR   EnsemblGenomes-Gn; EBG00001024349.
DR   EnsemblGenomes-Gn; EBG00001024351.
DR   EnsemblGenomes-Gn; EBG00001024353.
DR   EnsemblGenomes-Gn; EBG00001024355.
DR   EnsemblGenomes-Gn; EBG00001024356.
DR   EnsemblGenomes-Gn; EBG00001024357.
DR   EnsemblGenomes-Gn; EBG00001024358.
DR   EnsemblGenomes-Gn; EBG00001024359.
DR   EnsemblGenomes-Gn; EBG00001024360.
DR   EnsemblGenomes-Gn; EBG00001024361.
DR   EnsemblGenomes-Gn; EBG00001024362.
DR   EnsemblGenomes-Gn; EBG00001024363.
DR   EnsemblGenomes-Gn; EBG00001024365.
DR   EnsemblGenomes-Gn; EBG00001024366.
DR   EnsemblGenomes-Gn; EBG00001024368.
DR   EnsemblGenomes-Gn; EBG00001024370.
DR   EnsemblGenomes-Gn; EBG00001024373.
DR   EnsemblGenomes-Gn; EBG00001024375.
DR   EnsemblGenomes-Gn; EBG00001024377.
DR   EnsemblGenomes-Gn; EBG00001024379.
DR   EnsemblGenomes-Gn; EBG00001024380.
DR   EnsemblGenomes-Gn; EBG00001024382.
DR   EnsemblGenomes-Gn; EBG00001024384.
DR   EnsemblGenomes-Gn; EBG00001024385.
DR   EnsemblGenomes-Gn; EBG00001024387.
DR   EnsemblGenomes-Gn; EBG00001024388.
DR   EnsemblGenomes-Gn; EBG00001024390.
DR   EnsemblGenomes-Gn; EBG00001024391.
DR   EnsemblGenomes-Gn; EBG00001024392.
DR   EnsemblGenomes-Gn; EBG00001024393.
DR   EnsemblGenomes-Gn; EBG00001024394.
DR   EnsemblGenomes-Gn; EBG00001024395.
DR   EnsemblGenomes-Gn; EBG00001024397.
DR   EnsemblGenomes-Gn; EBG00001024399.
DR   EnsemblGenomes-Gn; EBG00001024401.
DR   EnsemblGenomes-Gn; EBG00001024403.
DR   EnsemblGenomes-Gn; EBG00001024405.
DR   EnsemblGenomes-Gn; PTH_r001.
DR   EnsemblGenomes-Gn; PTH_r002.
DR   EnsemblGenomes-Gn; PTH_r003.
DR   EnsemblGenomes-Gn; PTH_r004.
DR   EnsemblGenomes-Gn; PTH_r005.
DR   EnsemblGenomes-Gn; PTH_r006.
DR   EnsemblGenomes-Gn; PTH_t001.
DR   EnsemblGenomes-Gn; PTH_t002.
DR   EnsemblGenomes-Gn; PTH_t003.
DR   EnsemblGenomes-Gn; PTH_t004.
DR   EnsemblGenomes-Gn; PTH_t005.
DR   EnsemblGenomes-Gn; PTH_t006.
DR   EnsemblGenomes-Gn; PTH_t007.
DR   EnsemblGenomes-Gn; PTH_t008.
DR   EnsemblGenomes-Gn; PTH_t009.
DR   EnsemblGenomes-Gn; PTH_t010.
DR   EnsemblGenomes-Gn; PTH_t011.
DR   EnsemblGenomes-Gn; PTH_t012.
DR   EnsemblGenomes-Gn; PTH_t013.
DR   EnsemblGenomes-Gn; PTH_t014.
DR   EnsemblGenomes-Gn; PTH_t015.
DR   EnsemblGenomes-Gn; PTH_t016.
DR   EnsemblGenomes-Gn; PTH_t017.
DR   EnsemblGenomes-Gn; PTH_t018.
DR   EnsemblGenomes-Gn; PTH_t019.
DR   EnsemblGenomes-Gn; PTH_t020.
DR   EnsemblGenomes-Gn; PTH_t021.
DR   EnsemblGenomes-Gn; PTH_t022.
DR   EnsemblGenomes-Gn; PTH_t023.
DR   EnsemblGenomes-Gn; PTH_t024.
DR   EnsemblGenomes-Gn; PTH_t025.
DR   EnsemblGenomes-Gn; PTH_t026.
DR   EnsemblGenomes-Gn; PTH_t027.
DR   EnsemblGenomes-Gn; PTH_t028.
DR   EnsemblGenomes-Gn; PTH_t029.
DR   EnsemblGenomes-Gn; PTH_t030.
DR   EnsemblGenomes-Gn; PTH_t031.
DR   EnsemblGenomes-Gn; PTH_t032.
DR   EnsemblGenomes-Gn; PTH_t033.
DR   EnsemblGenomes-Gn; PTH_t034.
DR   EnsemblGenomes-Gn; PTH_t035.
DR   EnsemblGenomes-Gn; PTH_t036.
DR   EnsemblGenomes-Gn; PTH_t037.
DR   EnsemblGenomes-Gn; PTH_t038.
DR   EnsemblGenomes-Gn; PTH_t039.
DR   EnsemblGenomes-Gn; PTH_t040.
DR   EnsemblGenomes-Gn; PTH_t041.
DR   EnsemblGenomes-Gn; PTH_t042.
DR   EnsemblGenomes-Gn; PTH_t043.
DR   EnsemblGenomes-Gn; PTH_t044.
DR   EnsemblGenomes-Gn; PTH_t045.
DR   EnsemblGenomes-Gn; PTH_t046.
DR   EnsemblGenomes-Gn; PTH_t047.
DR   EnsemblGenomes-Gn; PTH_t048.
DR   EnsemblGenomes-Gn; PTH_t049.
DR   EnsemblGenomes-Gn; PTH_t050.
DR   EnsemblGenomes-Gn; PTH_t051.
DR   EnsemblGenomes-Tr; EBT00001626779.
DR   EnsemblGenomes-Tr; EBT00001626780.
DR   EnsemblGenomes-Tr; EBT00001626781.
DR   EnsemblGenomes-Tr; EBT00001626782.
DR   EnsemblGenomes-Tr; EBT00001626783.
DR   EnsemblGenomes-Tr; EBT00001626784.
DR   EnsemblGenomes-Tr; EBT00001626785.
DR   EnsemblGenomes-Tr; EBT00001626786.
DR   EnsemblGenomes-Tr; EBT00001626787.
DR   EnsemblGenomes-Tr; EBT00001626788.
DR   EnsemblGenomes-Tr; EBT00001626789.
DR   EnsemblGenomes-Tr; EBT00001626790.
DR   EnsemblGenomes-Tr; EBT00001626791.
DR   EnsemblGenomes-Tr; EBT00001626792.
DR   EnsemblGenomes-Tr; EBT00001626793.
DR   EnsemblGenomes-Tr; EBT00001626794.
DR   EnsemblGenomes-Tr; EBT00001626795.
DR   EnsemblGenomes-Tr; EBT00001626796.
DR   EnsemblGenomes-Tr; EBT00001626797.
DR   EnsemblGenomes-Tr; EBT00001626798.
DR   EnsemblGenomes-Tr; EBT00001626799.
DR   EnsemblGenomes-Tr; EBT00001626801.
DR   EnsemblGenomes-Tr; EBT00001626803.
DR   EnsemblGenomes-Tr; EBT00001626804.
DR   EnsemblGenomes-Tr; EBT00001626805.
DR   EnsemblGenomes-Tr; EBT00001626807.
DR   EnsemblGenomes-Tr; EBT00001626808.
DR   EnsemblGenomes-Tr; EBT00001626809.
DR   EnsemblGenomes-Tr; EBT00001626811.
DR   EnsemblGenomes-Tr; EBT00001626812.
DR   EnsemblGenomes-Tr; EBT00001626813.
DR   EnsemblGenomes-Tr; EBT00001626816.
DR   EnsemblGenomes-Tr; EBT00001626818.
DR   EnsemblGenomes-Tr; EBT00001626821.
DR   EnsemblGenomes-Tr; EBT00001626823.
DR   EnsemblGenomes-Tr; EBT00001626825.
DR   EnsemblGenomes-Tr; EBT00001626827.
DR   EnsemblGenomes-Tr; EBT00001626829.
DR   EnsemblGenomes-Tr; EBT00001626832.
DR   EnsemblGenomes-Tr; EBT00001626834.
DR   EnsemblGenomes-Tr; EBT00001626836.
DR   EnsemblGenomes-Tr; EBT00001626838.
DR   EnsemblGenomes-Tr; EBT00001626840.
DR   EnsemblGenomes-Tr; EBT00001626842.
DR   EnsemblGenomes-Tr; EBT00001626843.
DR   EnsemblGenomes-Tr; EBT00001626846.
DR   EnsemblGenomes-Tr; EBT00001626848.
DR   EnsemblGenomes-Tr; EBT00001626850.
DR   EnsemblGenomes-Tr; EBT00001626852.
DR   EnsemblGenomes-Tr; EBT00001626854.
DR   EnsemblGenomes-Tr; EBT00001626859.
DR   EnsemblGenomes-Tr; EBT00001626861.
DR   EnsemblGenomes-Tr; EBT00001626863.
DR   EnsemblGenomes-Tr; EBT00001626865.
DR   EnsemblGenomes-Tr; EBT00001626867.
DR   EnsemblGenomes-Tr; EBT00001626868.
DR   EnsemblGenomes-Tr; EBT00001626871.
DR   EnsemblGenomes-Tr; EBT00001626873.
DR   EnsemblGenomes-Tr; EBT00001626875.
DR   EnsemblGenomes-Tr; EBT00001626878.
DR   EnsemblGenomes-Tr; EBT00001626879.
DR   EnsemblGenomes-Tr; EBT00001626882.
DR   EnsemblGenomes-Tr; EBT00001626883.
DR   EnsemblGenomes-Tr; EBT00001626885.
DR   EnsemblGenomes-Tr; EBT00001626887.
DR   EnsemblGenomes-Tr; EBT00001626889.
DR   EnsemblGenomes-Tr; EBT00001626891.
DR   EnsemblGenomes-Tr; EBT00001626893.
DR   EnsemblGenomes-Tr; EBT00001626895.
DR   EnsemblGenomes-Tr; EBT00001626897.
DR   EnsemblGenomes-Tr; EBT00001626898.
DR   EnsemblGenomes-Tr; EBT00001626900.
DR   EnsemblGenomes-Tr; EBT00001626902.
DR   EnsemblGenomes-Tr; EBT00001626905.
DR   EnsemblGenomes-Tr; EBT00001626907.
DR   EnsemblGenomes-Tr; EBT00001626910.
DR   EnsemblGenomes-Tr; EBT00001626913.
DR   EnsemblGenomes-Tr; EBT00001626917.
DR   EnsemblGenomes-Tr; EBT00001626919.
DR   EnsemblGenomes-Tr; EBT00001626920.
DR   EnsemblGenomes-Tr; EBT00001626923.
DR   EnsemblGenomes-Tr; EBT00001626927.
DR   EnsemblGenomes-Tr; EBT00001626929.
DR   EnsemblGenomes-Tr; EBT00001626931.
DR   EnsemblGenomes-Tr; EBT00001626933.
DR   EnsemblGenomes-Tr; EBT00001626934.
DR   EnsemblGenomes-Tr; EBT00001626937.
DR   EnsemblGenomes-Tr; EBT00001626938.
DR   EnsemblGenomes-Tr; EBT00001626941.
DR   EnsemblGenomes-Tr; EBT00001626943.
DR   EnsemblGenomes-Tr; EBT00001626946.
DR   EnsemblGenomes-Tr; EBT00001626948.
DR   EnsemblGenomes-Tr; EBT00001626950.
DR   EnsemblGenomes-Tr; EBT00001626953.
DR   EnsemblGenomes-Tr; EBT00001626954.
DR   EnsemblGenomes-Tr; EBT00001626956.
DR   EnsemblGenomes-Tr; EBT00001626958.
DR   EnsemblGenomes-Tr; EBT00001626960.
DR   EnsemblGenomes-Tr; EBT00001626962.
DR   EnsemblGenomes-Tr; EBT00001626965.
DR   EnsemblGenomes-Tr; EBT00001626967.
DR   EnsemblGenomes-Tr; EBT00001626969.
DR   EnsemblGenomes-Tr; EBT00001626970.
DR   EnsemblGenomes-Tr; EBT00001626972.
DR   EnsemblGenomes-Tr; EBT00001626974.
DR   EnsemblGenomes-Tr; EBT00001626976.
DR   EnsemblGenomes-Tr; EBT00001626978.
DR   EnsemblGenomes-Tr; EBT00001626980.
DR   EnsemblGenomes-Tr; EBT00001626982.
DR   EnsemblGenomes-Tr; EBT00001626985.
DR   EnsemblGenomes-Tr; EBT00001626989.
DR   EnsemblGenomes-Tr; EBT00001626991.
DR   EnsemblGenomes-Tr; EBT00001626993.
DR   EnsemblGenomes-Tr; EBT00001626995.
DR   EnsemblGenomes-Tr; EBT00001626996.
DR   EnsemblGenomes-Tr; EBT00001626997.
DR   EnsemblGenomes-Tr; EBT00001626998.
DR   EnsemblGenomes-Tr; EBT00001627001.
DR   EnsemblGenomes-Tr; EBT00001627003.
DR   EnsemblGenomes-Tr; EBT00001627005.
DR   EnsemblGenomes-Tr; EBT00001627007.
DR   EnsemblGenomes-Tr; EBT00001627009.
DR   EnsemblGenomes-Tr; EBT00001627011.
DR   EnsemblGenomes-Tr; EBT00001627012.
DR   EnsemblGenomes-Tr; EBT00001627014.
DR   EnsemblGenomes-Tr; EBT00001627016.
DR   EnsemblGenomes-Tr; EBT00001627018.
DR   EnsemblGenomes-Tr; EBT00001627020.
DR   EnsemblGenomes-Tr; EBT00001627022.
DR   EnsemblGenomes-Tr; EBT00001627024.
DR   EnsemblGenomes-Tr; EBT00001627027.
DR   EnsemblGenomes-Tr; EBT00001627029.
DR   EnsemblGenomes-Tr; EBT00001627032.
DR   EnsemblGenomes-Tr; EBT00001627033.
DR   EnsemblGenomes-Tr; EBT00001627035.
DR   EnsemblGenomes-Tr; EBT00001627039.
DR   EnsemblGenomes-Tr; EBT00001627041.
DR   EnsemblGenomes-Tr; EBT00001627043.
DR   EnsemblGenomes-Tr; EBT00001627045.
DR   EnsemblGenomes-Tr; EBT00001627047.
DR   EnsemblGenomes-Tr; EBT00001627049.
DR   EnsemblGenomes-Tr; EBT00001627052.
DR   EnsemblGenomes-Tr; EBT00001627053.
DR   EnsemblGenomes-Tr; EBT00001627055.
DR   EnsemblGenomes-Tr; EBT00001627057.
DR   EnsemblGenomes-Tr; EBT00001627059.
DR   EnsemblGenomes-Tr; EBT00001627061.
DR   EnsemblGenomes-Tr; EBT00001627064.
DR   EnsemblGenomes-Tr; EBT00001627065.
DR   EnsemblGenomes-Tr; EBT00001627066.
DR   EnsemblGenomes-Tr; EBT00001627068.
DR   EnsemblGenomes-Tr; EBT00001627071.
DR   EnsemblGenomes-Tr; EBT00001627073.
DR   EnsemblGenomes-Tr; EBT00001627075.
DR   EnsemblGenomes-Tr; EBT00001627079.
DR   EnsemblGenomes-Tr; EBT00001627082.
DR   EnsemblGenomes-Tr; EBT00001627084.
DR   EnsemblGenomes-Tr; EBT00001627086.
DR   EnsemblGenomes-Tr; EBT00001627088.
DR   EnsemblGenomes-Tr; EBT00001627090.
DR   EnsemblGenomes-Tr; EBT00001627092.
DR   EnsemblGenomes-Tr; EBT00001627094.
DR   EnsemblGenomes-Tr; EBT00001627098.
DR   EnsemblGenomes-Tr; EBT00001627100.
DR   EnsemblGenomes-Tr; EBT00001627101.
DR   EnsemblGenomes-Tr; EBT00001627103.
DR   EnsemblGenomes-Tr; EBT00001627105.
DR   EnsemblGenomes-Tr; EBT00001627108.
DR   EnsemblGenomes-Tr; EBT00001627110.
DR   EnsemblGenomes-Tr; EBT00001627112.
DR   EnsemblGenomes-Tr; EBT00001627114.
DR   EnsemblGenomes-Tr; EBT00001627116.
DR   EnsemblGenomes-Tr; EBT00001627118.
DR   EnsemblGenomes-Tr; EBT00001627120.
DR   EnsemblGenomes-Tr; EBT00001627122.
DR   EnsemblGenomes-Tr; EBT00001627124.
DR   EnsemblGenomes-Tr; EBT00001627127.
DR   EnsemblGenomes-Tr; EBT00001627131.
DR   EnsemblGenomes-Tr; EBT00001627134.
DR   EnsemblGenomes-Tr; EBT00001627136.
DR   EnsemblGenomes-Tr; EBT00001627138.
DR   EnsemblGenomes-Tr; EBT00001627139.
DR   EnsemblGenomes-Tr; EBT00001627143.
DR   EnsemblGenomes-Tr; EBT00001627145.
DR   EnsemblGenomes-Tr; EBT00001627147.
DR   EnsemblGenomes-Tr; EBT00001627149.
DR   EnsemblGenomes-Tr; EBT00001627151.
DR   EnsemblGenomes-Tr; EBT00001627152.
DR   EnsemblGenomes-Tr; EBT00001627154.
DR   EnsemblGenomes-Tr; EBT00001627156.
DR   EnsemblGenomes-Tr; EBT00001627159.
DR   EnsemblGenomes-Tr; EBT00001627161.
DR   EnsemblGenomes-Tr; EBT00001627163.
DR   EnsemblGenomes-Tr; EBT00001627165.
DR   EnsemblGenomes-Tr; EBT00001627167.
DR   EnsemblGenomes-Tr; EBT00001627170.
DR   EnsemblGenomes-Tr; EBT00001627172.
DR   EnsemblGenomes-Tr; EBT00001627174.
DR   EnsemblGenomes-Tr; EBT00001627177.
DR   EnsemblGenomes-Tr; EBT00001627179.
DR   EnsemblGenomes-Tr; EBT00001627181.
DR   EnsemblGenomes-Tr; EBT00001627183.
DR   EnsemblGenomes-Tr; EBT00001627184.
DR   EnsemblGenomes-Tr; EBT00001627185.
DR   EnsemblGenomes-Tr; EBT00001627188.
DR   EnsemblGenomes-Tr; EBT00001627189.
DR   EnsemblGenomes-Tr; EBT00001627192.
DR   EnsemblGenomes-Tr; EBT00001627194.
DR   EnsemblGenomes-Tr; EBT00001627195.
DR   EnsemblGenomes-Tr; EBT00001627197.
DR   EnsemblGenomes-Tr; EBT00001627198.
DR   EnsemblGenomes-Tr; EBT00001627200.
DR   EnsemblGenomes-Tr; EBT00001627202.
DR   EnsemblGenomes-Tr; EBT00001627205.
DR   EnsemblGenomes-Tr; EBT00001627207.
DR   EnsemblGenomes-Tr; EBT00001627209.
DR   EnsemblGenomes-Tr; EBT00001627210.
DR   EnsemblGenomes-Tr; EBT00001627212.
DR   EnsemblGenomes-Tr; EBT00001627214.
DR   EnsemblGenomes-Tr; EBT00001627216.
DR   EnsemblGenomes-Tr; EBT00001627217.
DR   EnsemblGenomes-Tr; EBT00001627219.
DR   EnsemblGenomes-Tr; EBT00001627221.
DR   EnsemblGenomes-Tr; EBT00001627222.
DR   EnsemblGenomes-Tr; EBT00001627224.
DR   EnsemblGenomes-Tr; EBT00001627226.
DR   EnsemblGenomes-Tr; EBT00001627228.
DR   EnsemblGenomes-Tr; EBT00001627230.
DR   EnsemblGenomes-Tr; EBT00001627232.
DR   EnsemblGenomes-Tr; EBT00001627234.
DR   EnsemblGenomes-Tr; EBT00001627236.
DR   EnsemblGenomes-Tr; EBT00001627238.
DR   EnsemblGenomes-Tr; EBT00001627240.
DR   EnsemblGenomes-Tr; EBT00001627242.
DR   EnsemblGenomes-Tr; EBT00001627244.
DR   EnsemblGenomes-Tr; EBT00001627245.
DR   EnsemblGenomes-Tr; EBT00001627248.
DR   EnsemblGenomes-Tr; EBT00001627249.
DR   EnsemblGenomes-Tr; EBT00001627250.
DR   EnsemblGenomes-Tr; EBT00001627253.
DR   EnsemblGenomes-Tr; EBT00001627255.
DR   EnsemblGenomes-Tr; EBT00001627256.
DR   EnsemblGenomes-Tr; EBT00001627259.
DR   EnsemblGenomes-Tr; EBT00001627262.
DR   EnsemblGenomes-Tr; EBT00001627264.
DR   EnsemblGenomes-Tr; EBT00001627266.
DR   EnsemblGenomes-Tr; EBT00001627268.
DR   EnsemblGenomes-Tr; EBT00001627270.
DR   EnsemblGenomes-Tr; EBT00001627273.
DR   EnsemblGenomes-Tr; EBT00001627274.
DR   EnsemblGenomes-Tr; EBT00001627277.
DR   EnsemblGenomes-Tr; EBT00001627279.
DR   EnsemblGenomes-Tr; EBT00001627281.
DR   EnsemblGenomes-Tr; EBT00001627283.
DR   EnsemblGenomes-Tr; EBT00001627286.
DR   EnsemblGenomes-Tr; EBT00001627288.
DR   EnsemblGenomes-Tr; EBT00001627290.
DR   EnsemblGenomes-Tr; EBT00001627292.
DR   EnsemblGenomes-Tr; EBT00001627294.
DR   EnsemblGenomes-Tr; EBT00001627295.
DR   EnsemblGenomes-Tr; EBT00001627296.
DR   EnsemblGenomes-Tr; EBT00001627298.
DR   EnsemblGenomes-Tr; EBT00001627299.
DR   EnsemblGenomes-Tr; EBT00001627301.
DR   EnsemblGenomes-Tr; EBT00001627303.
DR   EnsemblGenomes-Tr; EBT00001627305.
DR   EnsemblGenomes-Tr; EBT00001627306.
DR   EnsemblGenomes-Tr; EBT00001627307.
DR   EnsemblGenomes-Tr; EBT00001627310.
DR   EnsemblGenomes-Tr; EBT00001627312.
DR   EnsemblGenomes-Tr; EBT00001627314.
DR   EnsemblGenomes-Tr; EBT00001627316.
DR   EnsemblGenomes-Tr; EBT00001627317.
DR   EnsemblGenomes-Tr; EBT00001627319.
DR   EnsemblGenomes-Tr; EBT00001627321.
DR   EnsemblGenomes-Tr; EBT00001627323.
DR   EnsemblGenomes-Tr; EBT00001627325.
DR   EnsemblGenomes-Tr; EBT00001627330.
DR   EnsemblGenomes-Tr; EBT00001627332.
DR   EnsemblGenomes-Tr; EBT00001627334.
DR   EnsemblGenomes-Tr; EBT00001627336.
DR   EnsemblGenomes-Tr; EBT00001627339.
DR   EnsemblGenomes-Tr; EBT00001627340.
DR   EnsemblGenomes-Tr; EBT00001627341.
DR   EnsemblGenomes-Tr; EBT00001627343.
DR   EnsemblGenomes-Tr; EBT00001627344.
DR   EnsemblGenomes-Tr; EBT00001627345.
DR   EnsemblGenomes-Tr; EBT00001627346.
DR   EnsemblGenomes-Tr; EBT00001627347.
DR   EnsemblGenomes-Tr; EBT00001627348.
DR   EnsemblGenomes-Tr; EBT00001627349.
DR   EnsemblGenomes-Tr; EBT00001627353.
DR   EnsemblGenomes-Tr; EBT00001627354.
DR   EnsemblGenomes-Tr; EBT00001627355.
DR   EnsemblGenomes-Tr; EBT00001627358.
DR   EnsemblGenomes-Tr; EBT00001627359.
DR   EnsemblGenomes-Tr; EBT00001627361.
DR   EnsemblGenomes-Tr; EBT00001627363.
DR   EnsemblGenomes-Tr; EBT00001627364.
DR   EnsemblGenomes-Tr; EBT00001627365.
DR   EnsemblGenomes-Tr; EBT00001627366.
DR   EnsemblGenomes-Tr; EBT00001627367.
DR   EnsemblGenomes-Tr; EBT00001627368.
DR   EnsemblGenomes-Tr; EBT00001627369.
DR   EnsemblGenomes-Tr; EBT00001627370.
DR   EnsemblGenomes-Tr; EBT00001627371.
DR   EnsemblGenomes-Tr; EBT00001627372.
DR   EnsemblGenomes-Tr; EBT00001627373.
DR   EnsemblGenomes-Tr; EBT00001627374.
DR   EnsemblGenomes-Tr; EBT00001627375.
DR   EnsemblGenomes-Tr; EBT00001627376.
DR   EnsemblGenomes-Tr; EBT00001627377.
DR   EnsemblGenomes-Tr; EBT00001627378.
DR   EnsemblGenomes-Tr; EBT00001627379.
DR   EnsemblGenomes-Tr; EBT00001627380.
DR   EnsemblGenomes-Tr; EBT00001627381.
DR   EnsemblGenomes-Tr; EBT00001627382.
DR   EnsemblGenomes-Tr; EBT00001627383.
DR   EnsemblGenomes-Tr; EBT00001627384.
DR   EnsemblGenomes-Tr; EBT00001627385.
DR   EnsemblGenomes-Tr; EBT00001627386.
DR   EnsemblGenomes-Tr; EBT00001627387.
DR   EnsemblGenomes-Tr; EBT00001627388.
DR   EnsemblGenomes-Tr; EBT00001627389.
DR   EnsemblGenomes-Tr; EBT00001627390.
DR   EnsemblGenomes-Tr; EBT00001627391.
DR   EnsemblGenomes-Tr; EBT00001627392.
DR   EnsemblGenomes-Tr; EBT00001627393.
DR   EnsemblGenomes-Tr; EBT00001627394.
DR   EnsemblGenomes-Tr; EBT00001627395.
DR   EnsemblGenomes-Tr; EBT00001627396.
DR   EnsemblGenomes-Tr; EBT00001627397.
DR   EnsemblGenomes-Tr; EBT00001627398.
DR   EnsemblGenomes-Tr; EBT00001627399.
DR   EnsemblGenomes-Tr; EBT00001627400.
DR   EnsemblGenomes-Tr; EBT00001627401.
DR   EnsemblGenomes-Tr; EBT00001627402.
DR   EnsemblGenomes-Tr; EBT00001627403.
DR   EnsemblGenomes-Tr; EBT00001627404.
DR   EnsemblGenomes-Tr; EBT00001627405.
DR   EnsemblGenomes-Tr; EBT00001627406.
DR   EnsemblGenomes-Tr; EBT00001627407.
DR   EnsemblGenomes-Tr; EBT00001627408.
DR   EnsemblGenomes-Tr; EBT00001627409.
DR   EnsemblGenomes-Tr; EBT00001627410.
DR   EnsemblGenomes-Tr; EBT00001627411.
DR   EnsemblGenomes-Tr; EBT00001627412.
DR   EnsemblGenomes-Tr; EBT00001627413.
DR   EnsemblGenomes-Tr; EBT00001627414.
DR   EnsemblGenomes-Tr; EBT00001627415.
DR   EnsemblGenomes-Tr; EBT00001627416.
DR   EnsemblGenomes-Tr; EBT00001627417.
DR   EnsemblGenomes-Tr; EBT00001627418.
DR   EnsemblGenomes-Tr; EBT00001627419.
DR   EnsemblGenomes-Tr; EBT00001627420.
DR   EnsemblGenomes-Tr; EBT00001627421.
DR   EnsemblGenomes-Tr; EBT00001627422.
DR   EnsemblGenomes-Tr; EBT00001627423.
DR   EnsemblGenomes-Tr; EBT00001627424.
DR   EnsemblGenomes-Tr; EBT00001627425.
DR   EnsemblGenomes-Tr; EBT00001627426.
DR   EnsemblGenomes-Tr; EBT00001627427.
DR   EnsemblGenomes-Tr; EBT00001627428.
DR   EnsemblGenomes-Tr; EBT00001627429.
DR   EnsemblGenomes-Tr; EBT00001627430.
DR   EnsemblGenomes-Tr; EBT00001627431.
DR   EnsemblGenomes-Tr; EBT00001627432.
DR   EnsemblGenomes-Tr; EBT00001627433.
DR   EnsemblGenomes-Tr; EBT00001627434.
DR   EnsemblGenomes-Tr; EBT00001627435.
DR   EnsemblGenomes-Tr; EBT00001627436.
DR   EnsemblGenomes-Tr; EBT00001627437.
DR   EnsemblGenomes-Tr; EBT00001627438.
DR   EnsemblGenomes-Tr; EBT00001627439.
DR   EnsemblGenomes-Tr; EBT00001627440.
DR   EnsemblGenomes-Tr; EBT00001627441.
DR   EnsemblGenomes-Tr; EBT00001627442.
DR   EnsemblGenomes-Tr; EBT00001627443.
DR   EnsemblGenomes-Tr; EBT00001627444.
DR   EnsemblGenomes-Tr; EBT00001627445.
DR   EnsemblGenomes-Tr; EBT00001627446.
DR   EnsemblGenomes-Tr; EBT00001627447.
DR   EnsemblGenomes-Tr; EBT00001627448.
DR   EnsemblGenomes-Tr; EBT00001627449.
DR   EnsemblGenomes-Tr; EBT00001627450.
DR   EnsemblGenomes-Tr; EBT00001627451.
DR   EnsemblGenomes-Tr; EBT00001627452.
DR   EnsemblGenomes-Tr; EBT00001627453.
DR   EnsemblGenomes-Tr; EBT00001627454.
DR   EnsemblGenomes-Tr; EBT00001627455.
DR   EnsemblGenomes-Tr; EBT00001627456.
DR   EnsemblGenomes-Tr; EBT00001627457.
DR   EnsemblGenomes-Tr; EBT00001627458.
DR   EnsemblGenomes-Tr; EBT00001627459.
DR   EnsemblGenomes-Tr; EBT00001627460.
DR   EnsemblGenomes-Tr; EBT00001627461.
DR   EnsemblGenomes-Tr; EBT00001627462.
DR   EnsemblGenomes-Tr; EBT00001627463.
DR   EnsemblGenomes-Tr; EBT00001627464.
DR   EnsemblGenomes-Tr; EBT00001627465.
DR   EnsemblGenomes-Tr; EBT00001627466.
DR   EnsemblGenomes-Tr; EBT00001627467.
DR   EnsemblGenomes-Tr; EBT00001627468.
DR   EnsemblGenomes-Tr; EBT00001627469.
DR   EnsemblGenomes-Tr; EBT00001627470.
DR   EnsemblGenomes-Tr; EBT00001627471.
DR   EnsemblGenomes-Tr; EBT00001627472.
DR   EnsemblGenomes-Tr; EBT00001627473.
DR   EnsemblGenomes-Tr; EBT00001627474.
DR   EnsemblGenomes-Tr; EBT00001627475.
DR   EnsemblGenomes-Tr; EBT00001627476.
DR   EnsemblGenomes-Tr; EBT00001627477.
DR   EnsemblGenomes-Tr; EBT00001627478.
DR   EnsemblGenomes-Tr; EBT00001627479.
DR   EnsemblGenomes-Tr; EBT00001627480.
DR   EnsemblGenomes-Tr; EBT00001627481.
DR   EnsemblGenomes-Tr; EBT00001627482.
DR   EnsemblGenomes-Tr; EBT00001627483.
DR   EnsemblGenomes-Tr; EBT00001627484.
DR   EnsemblGenomes-Tr; EBT00001627485.
DR   EnsemblGenomes-Tr; EBT00001627486.
DR   EnsemblGenomes-Tr; EBT00001627487.
DR   EnsemblGenomes-Tr; EBT00001627488.
DR   EnsemblGenomes-Tr; EBT00001627489.
DR   EnsemblGenomes-Tr; EBT00001627490.
DR   EnsemblGenomes-Tr; EBT00001627491.
DR   EnsemblGenomes-Tr; EBT00001627492.
DR   EnsemblGenomes-Tr; EBT00001627493.
DR   EnsemblGenomes-Tr; EBT00001627494.
DR   EnsemblGenomes-Tr; EBT00001627495.
DR   EnsemblGenomes-Tr; EBT00001627496.
DR   EnsemblGenomes-Tr; EBT00001627497.
DR   EnsemblGenomes-Tr; EBT00001627498.
DR   EnsemblGenomes-Tr; EBT00001627499.
DR   EnsemblGenomes-Tr; EBT00001627500.
DR   EnsemblGenomes-Tr; EBT00001627501.
DR   EnsemblGenomes-Tr; EBT00001627502.
DR   EnsemblGenomes-Tr; EBT00001627503.
DR   EnsemblGenomes-Tr; EBT00001627504.
DR   EnsemblGenomes-Tr; EBT00001627505.
DR   EnsemblGenomes-Tr; EBT00001627506.
DR   EnsemblGenomes-Tr; EBT00001627507.
DR   EnsemblGenomes-Tr; EBT00001627508.
DR   EnsemblGenomes-Tr; EBT00001627509.
DR   EnsemblGenomes-Tr; EBT00001627510.
DR   EnsemblGenomes-Tr; EBT00001627511.
DR   EnsemblGenomes-Tr; EBT00001627512.
DR   EnsemblGenomes-Tr; EBT00001627513.
DR   EnsemblGenomes-Tr; EBT00001627514.
DR   EnsemblGenomes-Tr; EBT00001627515.
DR   EnsemblGenomes-Tr; EBT00001627516.
DR   EnsemblGenomes-Tr; EBT00001627517.
DR   EnsemblGenomes-Tr; EBT00001627518.
DR   EnsemblGenomes-Tr; EBT00001627519.
DR   EnsemblGenomes-Tr; EBT00001627520.
DR   EnsemblGenomes-Tr; EBT00001627521.
DR   EnsemblGenomes-Tr; EBT00001627522.
DR   EnsemblGenomes-Tr; EBT00001627523.
DR   EnsemblGenomes-Tr; EBT00001627524.
DR   EnsemblGenomes-Tr; EBT00001627525.
DR   EnsemblGenomes-Tr; EBT00001627526.
DR   EnsemblGenomes-Tr; EBT00001627527.
DR   EnsemblGenomes-Tr; EBT00001627528.
DR   EnsemblGenomes-Tr; EBT00001627529.
DR   EnsemblGenomes-Tr; EBT00001627530.
DR   EnsemblGenomes-Tr; EBT00001627531.
DR   EnsemblGenomes-Tr; EBT00001627532.
DR   EnsemblGenomes-Tr; EBT00001627533.
DR   EnsemblGenomes-Tr; EBT00001627534.
DR   EnsemblGenomes-Tr; EBT00001627535.
DR   EnsemblGenomes-Tr; EBT00001627536.
DR   EnsemblGenomes-Tr; EBT00001627537.
DR   EnsemblGenomes-Tr; EBT00001627538.
DR   EnsemblGenomes-Tr; EBT00001627539.
DR   EnsemblGenomes-Tr; EBT00001627540.
DR   EnsemblGenomes-Tr; EBT00001627541.
DR   EnsemblGenomes-Tr; EBT00001627542.
DR   EnsemblGenomes-Tr; EBT00001627543.
DR   EnsemblGenomes-Tr; EBT00001627544.
DR   EnsemblGenomes-Tr; EBT00001627545.
DR   EnsemblGenomes-Tr; EBT00001627546.
DR   EnsemblGenomes-Tr; EBT00001627547.
DR   EnsemblGenomes-Tr; EBT00001627548.
DR   EnsemblGenomes-Tr; EBT00001627549.
DR   EnsemblGenomes-Tr; EBT00001627550.
DR   EnsemblGenomes-Tr; EBT00001627551.
DR   EnsemblGenomes-Tr; EBT00001627552.
DR   EnsemblGenomes-Tr; EBT00001627553.
DR   EnsemblGenomes-Tr; EBT00001627554.
DR   EnsemblGenomes-Tr; EBT00001627555.
DR   EnsemblGenomes-Tr; EBT00001627556.
DR   EnsemblGenomes-Tr; PTH_r001-1.
DR   EnsemblGenomes-Tr; PTH_r002-1.
DR   EnsemblGenomes-Tr; PTH_r003-1.
DR   EnsemblGenomes-Tr; PTH_r004-1.
DR   EnsemblGenomes-Tr; PTH_r005-1.
DR   EnsemblGenomes-Tr; PTH_r006-1.
DR   EnsemblGenomes-Tr; PTH_t001-1.
DR   EnsemblGenomes-Tr; PTH_t002-1.
DR   EnsemblGenomes-Tr; PTH_t003-1.
DR   EnsemblGenomes-Tr; PTH_t004-1.
DR   EnsemblGenomes-Tr; PTH_t005-1.
DR   EnsemblGenomes-Tr; PTH_t006-1.
DR   EnsemblGenomes-Tr; PTH_t007-1.
DR   EnsemblGenomes-Tr; PTH_t008-1.
DR   EnsemblGenomes-Tr; PTH_t009-1.
DR   EnsemblGenomes-Tr; PTH_t010-1.
DR   EnsemblGenomes-Tr; PTH_t011-1.
DR   EnsemblGenomes-Tr; PTH_t012-1.
DR   EnsemblGenomes-Tr; PTH_t013-1.
DR   EnsemblGenomes-Tr; PTH_t014-1.
DR   EnsemblGenomes-Tr; PTH_t015-1.
DR   EnsemblGenomes-Tr; PTH_t016-1.
DR   EnsemblGenomes-Tr; PTH_t017-1.
DR   EnsemblGenomes-Tr; PTH_t018-1.
DR   EnsemblGenomes-Tr; PTH_t019-1.
DR   EnsemblGenomes-Tr; PTH_t020-1.
DR   EnsemblGenomes-Tr; PTH_t021-1.
DR   EnsemblGenomes-Tr; PTH_t022-1.
DR   EnsemblGenomes-Tr; PTH_t023-1.
DR   EnsemblGenomes-Tr; PTH_t024-1.
DR   EnsemblGenomes-Tr; PTH_t025-1.
DR   EnsemblGenomes-Tr; PTH_t026-1.
DR   EnsemblGenomes-Tr; PTH_t027-1.
DR   EnsemblGenomes-Tr; PTH_t028-1.
DR   EnsemblGenomes-Tr; PTH_t029-1.
DR   EnsemblGenomes-Tr; PTH_t030-1.
DR   EnsemblGenomes-Tr; PTH_t031-1.
DR   EnsemblGenomes-Tr; PTH_t032-1.
DR   EnsemblGenomes-Tr; PTH_t033-1.
DR   EnsemblGenomes-Tr; PTH_t034-1.
DR   EnsemblGenomes-Tr; PTH_t035-1.
DR   EnsemblGenomes-Tr; PTH_t036-1.
DR   EnsemblGenomes-Tr; PTH_t037-1.
DR   EnsemblGenomes-Tr; PTH_t038-1.
DR   EnsemblGenomes-Tr; PTH_t039-1.
DR   EnsemblGenomes-Tr; PTH_t040-1.
DR   EnsemblGenomes-Tr; PTH_t041-1.
DR   EnsemblGenomes-Tr; PTH_t042-1.
DR   EnsemblGenomes-Tr; PTH_t043-1.
DR   EnsemblGenomes-Tr; PTH_t044-1.
DR   EnsemblGenomes-Tr; PTH_t045-1.
DR   EnsemblGenomes-Tr; PTH_t046-1.
DR   EnsemblGenomes-Tr; PTH_t047-1.
DR   EnsemblGenomes-Tr; PTH_t048-1.
DR   EnsemblGenomes-Tr; PTH_t049-1.
DR   EnsemblGenomes-Tr; PTH_t050-1.
DR   EnsemblGenomes-Tr; PTH_t051-1.
DR   EuropePMC; PMC2259108; 18218977.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; AP009389.
DR   SILVA-SSU; AP009389.
DR   StrainInfo; 303408; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3025375
FT                   /organism="Pelotomaculum thermopropionicum SI"
FT                   /strain="SI"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:370438"
FT   CDS_pept        1..1344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DnaA"
FT                   /locus_tag="PTH_0001"
FT                   /product="ATPase"
FT                   /note="involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58182"
FT                   /db_xref="GOA:A5D6E4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6E4"
FT                   /protein_id="BAF58182.1"
FT                   /translation="MVKSEVIDLWEKALQFLEKKINRHSFETWLKPLKPLGYHENTVII
FT                   EVPNHFSREWLNERYAPLIKNIFRHILEQDIGVQFLLSGEVSVVESDPLKKAVKNNFEE
FT                   ASTIHLNPKYTFDTFVVGNSNRFAHAACLAVAESPAKAYNPLFIYGGVGLGKTHLMHAI
FT                   GQHILEHSNKMKVSYVTSEKFTNELINAIKDDKTVEFRNKYRGMDILLVDDIQFLAGKE
FT                   RTQEEFFHTFNTLYEANKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQPPDLETRI
FT                   AILRKKSQQENLFVPDDTIFYIANRIQSNIRELEGALIRVIAYASLNGKEISPELAAEV
FT                   LKDILPPEKPRQITVELIQEVVAGYYNIRVEDFKSKNRSRAVAFPRQVAMYLARELTDL
FT                   SLPKIGEYFGGRDHTTVIHAYEKINNELNIDMSLQESIKQLISKIENK"
FT   CDS_pept        1494..2603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DnaN"
FT                   /locus_tag="PTH_0002"
FT                   /product="DNA polymerase sliding clamp subunit"
FT                   /note="PCNA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58183"
FT                   /db_xref="GOA:A5D6E5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6E5"
FT                   /protein_id="BAF58183.1"
FT                   /translation="MKIISDRENLFNALQVVQRAVSVKNPLPILSGIKFEAEDDRLFLT
FT                   ATDLEMGIRCSITAEVLQPGAAVLPARYITELIRKLPDQPFLIESDQDTGHVTIRYASS
FT                   EASMNCFQADEYPEFPVPEGKIEFTVPADTVREVIRQVIFAVGSDENRPVFTGVLFEVR
FT                   EGQVQVVATDTHRLAWRKFDLEERISGADINLIIPGRSLNELARIAGGQDGRVKVTAAE
FT                   SQVLFTVGETSLITRLIGGNFPNYRQVIPQEFVSRIRAKTKDLAEATERASLLSKDGAP
FT                   AVRLDAGGNVMVVTANSEVGRVREELAVQQEGEPVQIAFNARYLSDVLKVVGSEEIDIE
FT                   FTGPLSPGVIRPVGSTDYLSLLLPVRLRD"
FT   CDS_pept        2628..3722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RecF"
FT                   /locus_tag="PTH_0003"
FT                   /product="recombinational DNA repair ATPase"
FT                   /note="RecF pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58184"
FT                   /db_xref="GOA:A5D6E6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D6E6"
FT                   /protein_id="BAF58184.1"
FT                   /translation="MLLRRLEMLNFRNFARQAVEPGLYFNVLSGRNAQGKTNILESIYL
FT                   ACTGRSFRTAREKELIKREKEFSSIRCLFETRGREVEVKVTLVPGRKRIEVNGVLKSGH
FT                   PFGWPGVVLFTPDDLVMIKGSPAERRRFLDYDLGPFHPHYAHCLDRYNRVLSQRNALLR
FT                   EAKEKRTTGGPLEVWDEQLCRYGSRLLFLRVSLLKKFFPAIRALHRELTEGAENIEISY
FT                   LSSLKIGEECGEDEIYERFSGELRLVRDEEIARMQTLVGPHRDDLHIKVDGHDARVYCS
FT                   QGQQRTIVLTLKVFLIEQWRSETGEYPILLLDDVLFELDDNRREALMCRLGGLVQTFLT
FT                   CTRVNFDIEGFKAKVFTVSGGEVT"
FT   CDS_pept        3741..3989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58185"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6E7"
FT                   /protein_id="BAF58185.1"
FT                   /translation="MFLHLGGDVVVPKRDIIAIFDIQTALSPATREFIEIARDEGFVRN
FT                   ISDHNKEKSYVLTAKEIFLSPISCTTLKKRSEKLFEY"
FT   CDS_pept        4049..5980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GyrB"
FT                   /locus_tag="PTH_0005"
FT                   /product="type IIA topoisomerase, B subunit"
FT                   /note="DNA gyrase/topo II, topoisomerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58186"
FT                   /db_xref="GOA:A5D6E8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6E8"
FT                   /protein_id="BAF58186.1"
FT                   /translation="MYLALTGDTSNNNNSKYGAEEIQILEGLEAVRRRPGMYIGSTSAR
FT                   GLHHLVYEVVDNSIDEAMAGFCDRIEVILNEDGSATVIDNGRGIPVDIHPKTGRPAVEV
FT                   VMTMLHAGGKFGGGGYKVSGGLHGVGVSVVNALSLWLEVEVKRDGKVYYQRYSRGIPVT
FT                   GLLVKGKSSATGTKVTFMPDPEIFEDLIFNQDILAQRLRELSFLNMGVKIILKDRRSGQ
FT                   ETVFQHDGGIMDFVRYLNKSKTPLHGKPIYIQKQKDDVLVEVALQYTDTYVESILSYAN
FT                   NINTIDGGTHEAGFKAALTRVINDYGRKYNLLKNGAGNLSGEDIREGLTAVISVKVPEP
FT                   QFEGQTKTKLGNSEVRSIVDSVVGEGLGIFLEENPSIARRILEKAVTASRAREAARKAR
FT                   ELTRRKSALEGSTLPGKLADCSERDPSVSELYLVEGDSAGGSAKQGRDRRFQAILPLRG
FT                   KILNVEKARLDKILANEEIRAMITALGTGIGEEFDVSKARYHKIILMSDADVDGAHIRT
FT                   LLLTFFYRYMRPLIEKGYVFIAQPPLYRVKKGKLEKYAYSDAELEKLLDQIGRDGVSIQ
FT                   RYKGLGEMNAEQLWETTMDPETRTVMQVNLEDAIEADAVFSMLMGDRVEPRRDFIQENA
FT                   RLVRNLDI"
FT   CDS_pept        complement(6049..7638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0006"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing HAMP and methyl-accepting chemotaxis-like
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58187"
FT                   /db_xref="GOA:A5D6E9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6E9"
FT                   /protein_id="BAF58187.1"
FT                   /translation="MKLKLGAKIALGFSIVLLLLVIMGLNSIVQTRSISKDVDAIDIIN
FT                   QELSLEKDIEIHFYNGVAGIRGYIAYGKENFRDTYNKELDQVLEMENRLLEIAPADKKA
FT                   EIQKLIEITSAYHKGIQNDLIPAIEIRYKATEHEAIQAAQKEVERIAGGLVPITGQLTE
FT                   TLRGLTENNNKIFQQKINDTGRNVLKVISISVILSLAALLIGMILSFFISSSIKKPIKE
FT                   MVDGANRFAQGDFTGEIKAASSDEVGDLARSLNDMSKQLRELISEVVTNAQTLAAHSEE
FT                   LAASGQEVSASIEEVAGTTNEVAAMAEKSMENAEAAAGESRQVIAVAETGNETVQKTID
FT                   KINSISQSASRVQEAIRNLGELSAQVGNITNVITGIADQTNLLALNAAIEAARAGDQGR
FT                   GFAVVAEEVRKLAEQSAGAAKEIGQIINRIQSGVDTAIKSMDQGAAEVREGVSLASEAG
FT                   NALRDIINAVNNSIVLTEEIATSAKQTSEGMQQLSASNEQVTSTIQQVATATQELAGIA
FT                   NKLQSLVERFKI"
FT   CDS_pept        8063..8356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58188"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6F0"
FT                   /protein_id="BAF58188.1"
FT                   /translation="MRALSERRQTRPGKIRSLLLVALLLAAAFLAGAAAEKSAHFLQDL
FT                   ISTVPFAVEEIKDFVNEKAYFRIDAVNGRFRQLSETVIAYMKEKPQLFIRGP"
FT   CDS_pept        8894..11320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GyrA"
FT                   /locus_tag="PTH_0008"
FT                   /product="type IIA topoisomerase, A subunit"
FT                   /note="DNA gyrase/topo II topoisomerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58189"
FT                   /db_xref="GOA:A5D6F1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6F1"
FT                   /protein_id="BAF58189.1"
FT                   /translation="MPSMTGKVIPIDINEEMKHSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYAMHSLGLTPDRPHRKSAYIVGEVLAKYHPHGDVAVYDALVRLAQDFACRYPLVD
FT                   GHGNFGSVDGDSAAAMRYTEARMARITLEMLADIEKETVNFIPNYDGKTVEPTVLPARI
FT                   PNLLINGSSGIAVGMATNIPPHNLGEVIDGVIMLIDNPDANIRDLMSVIKGPDFPTGGK
FT                   IMGREGIWDAYRTGRGSIKVRAQASIEKIGGGRHSIVVSEIPYQVNKARLIEKIAELVK
FT                   DKKIDGISDLRDESDRRGMRIVIELRRDANPQVVLNQLYKHTQMQDSFGVIMLALVEGE
FT                   PRVLNLKEVLFYYLQHQKDVVVRRTRFELNRAEARAHIVEGLRIAIAHLDEVIKTIRSS
FT                   RTPEVARKALMEKFGLTEKQAEAIVEMRLRQLTGLEREKLEQEYRELVEKIAYLRSVLD
FT                   DERKVLGIIKDELLAVKKKFADPRRTAITSEEAAFEEEDLIPEEDVVITITSQGYIKRI
FT                   PLDTYRSQRRGGRGVTAMGTKEEDFVRHLFITTTHHFFLFFTNQGKVYRLKVHEIPEAG
FT                   RQAKGTAIVNLLYIGSEEKITTVIPVREFDPAQYLFMATKRGIVKKTPLNEYDTSRRDG
FT                   IIAISLNEGDHLVDVKLTGGREEIILATRGGLAIRFLEEEVRPTGRVTQGVKGINLVGD
FT                   DEVVGMEVARPDEFLLSVTANGFGKRTRLSEYRAQARGGKGIINIKTTARNGPLVAIQA
FT                   VKGEEEVMMISAEGIIIRLKAQDIPVMGRATQGVTLMRLDRGDSLVAAAKVETEE"
FT   CDS_pept        11634..12518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SNZ1"
FT                   /locus_tag="PTH_0009"
FT                   /product="pyridoxine biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58190"
FT                   /db_xref="GOA:A5D6D1"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6D1"
FT                   /protein_id="BAF58190.1"
FT                   /translation="MVEKGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMAL
FT                   ERVPADIRAAGGVARMADPAVILRIMDAVTIPVMAKARIGHFVEAQILEALGVDYIDES
FT                   EVLTPADETHHIDKHAFRVPFVCGARNLGEALRRIGEGAAMIRTKGEPGTGNVVEAVRH
FT                   MRMMMSEIRRVQNMPREELMAAAKEMGAPYELLVQVAELGRLPVVNFAAGGIATPADAA
FT                   LMMQLGSDGIFVGSGIFKSKDPVARARAIVAATTHYNDPQVLAEVSKDLGEAMPGLEIA
FT                   TIAAEQRMQDRGW"
FT   CDS_pept        12660..13250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PDX2"
FT                   /locus_tag="PTH_0010"
FT                   /product="predicted glutamine amidotransferase"
FT                   /note="involved in pyridoxine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58191"
FT                   /db_xref="GOA:A5D6D2"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D6D2"
FT                   /protein_id="BAF58191.1"
FT                   /translation="MKVGVLALQGAFREHQKVLAACGAESVQVRKPEQLEDISALVIPG
FT                   GESTTIGKLLLEFNLFEPLVKLGQGGLPVFGTCAGMILLAREIAGSGQPRLGLMDISVE
FT                   RNAFGRQVESFEADLDIPVLGEEPFRAVFIRAPYIIEAGGGVEVLARFGEKIVMARQGR
FT                   CLAAAFHPELTGDLRIHRYFLEKCVRAGQNCKG"
FT   CDS_pept        13698..14852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0011"
FT                   /product="serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58192"
FT                   /db_xref="GOA:A5D6D3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6D3"
FT                   /protein_id="BAF58192.1"
FT                   /translation="MQDKEYLMIPGPTPVPPAVYAAMSRPVGGHRTDEFARLYMRIVEK
FT                   LKKVFQTENDVFVLTNSGTGALETAVANTVSPGDKALALITGNFGERFAAIARAYGAEL
FT                   IELNFGYGNDVDLKAVEEKLNEHPDIKVVLATQNETSTGVCNDIAGIGALVARTPALLL
FT                   VDGVSGVGAIEIKVDEWGVDILCTASQKAFMLPPGLAMVSVSEKAWQVVNGNRSPRFYF
FT                   SLPACKKVYGKWNTPYTPSVTLFYGLEAALDMMLAEGLDNVYARHALLARATRAAVRAL
FT                   GLKLLAEDRCASNALTAVWGPEGVAADELRKIIKKQYGVAFAGGQGDVKGKIFRIAHMG
FT                   FSDKMDVIIAISALEMALAQTGYPVQLGAGVKAAQEVFLGREQK"
FT   CDS_pept        14849..16429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SerA"
FT                   /locus_tag="PTH_0012"
FT                   /product="phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58193"
FT                   /db_xref="GOA:A5D6D4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6D4"
FT                   /protein_id="BAF58193.1"
FT                   /translation="MKVLVLDGVEEEGLKALRQEPGIQVDVKDKMSEDELVAAIGDYDG
FT                   IIVRSATKVTARIIEKAARLKVVGRAGVGVDNIDVPAATARGILVVNAPEGNTLAVAEH
FT                   TIAMMLSLARNIPQANASLRAGKWDKKSFMGVELRGKVLGVIGLGRIGSAVAKRAQGME
FT                   MKVVAYDPYINEEKAGLLGVTLLSLEELLKQADFITVHLPLTRESKYMLGEKAFSLMKD
FT                   GVRIINCARGGVVDEQALYNAMKSGKVAGAALDVFEKEPNTDSPLFEFKNFIATPHLGA
FT                   STQEAQLSVATDVAREVVAALKGELVKNAVNIPSVSPKVLAVIKPYLSLAEKMGKFAAQ
FT                   VICGRVNKIEATYSGDLAGQEVSPLTTAILKGFLDSILQEMVNFVNAPLLAKKRGINVI
FT                   QRQETEEADYANLITVKVKSDQEEISVAGTIFGKVDQRIVSIDGYHVDAVPEGHMLYIP
FT                   HIDKPRIIGPVGNLIGTHNINISGMQVGRKVIGGKAVMLLNIDSPVPEETMAEIAKIDG
FT                   VLGVKSVSI"
FT   CDS_pept        16565..17833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SerS"
FT                   /locus_tag="PTH_0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58194"
FT                   /db_xref="GOA:A5D6D5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D6D5"
FT                   /protein_id="BAF58194.1"
FT                   /translation="MLDMKFVRNNPAAVRDALARRGVSVALDEFYKLDEERREKLFIVE
FT                   QMKNRRNVVSEEIGRLKKSGKDAPEMVLEMRDLSRQIKEIDEEIKELDGRLQDMLLNIP
FT                   NIPHESVPEGAGAAENPVVRTWGKPRDFGFTPRPHWEIGEQLDIIDFERGGKVAGARFS
FT                   FYKGYGARLERAVINFMLDLHTAEHGYVEIFPPFIVNRDSMVGTGQLPKFAEDMFKLEG
FT                   AEYYLIPTAEVPVTNLYRNEILDGEKLPILHCAYSACFRAEAGAAGRDTRGLIRQHQFN
FT                   KVELVKFCRPEDSYDELEKLTADAEKVLQKLGLPYRVVVLCTGDLGFSAAKTYDLEVWL
FT                   PSYQEYKEISSCSNFADFQARRAGIRFRNARGKTEFVHTLNGSGLAVGRTVAAILENYQ
FT                   EADGSVTVPEALRPYMGGLSRIG"
FT   CDS_pept        17865..18701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0014"
FT                   /product="predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58195"
FT                   /db_xref="GOA:A5D6D6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6D6"
FT                   /protein_id="BAF58195.1"
FT                   /translation="MSAPVIDFHIHPVAYESYCTSAAEWIKERQSVQDWPGFIKRYEDP
FT                   AVFSAFLAENGVDYGVVLAELTPVTTGICTNEYVLEFCRGREKLIPFASINPYTTEGGA
FT                   VGKEARRLLEKGFRGIKLYPTYQYFYPNDRMLYPLYAAAEEAGVPVMVHTGSSVFKGSR
FT                   LKYGDPLFLDDVAVDFPGLRILIVHSGRGLWYNNAFFLARLHENVYMEIAGLPPQKLLD
FT                   YFPELERNAGKIVFGSDWPGVASIKANIETIRNLPLSEETKEKILGGNAAGILGIK"
FT   tRNA            18890..18979
FT                   /locus_tag="PTH_t001"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:18924..18926,aa:Ser,seq:tga)"
FT                   /note="codon recognized: TCA"
FT   tRNA            19006..19100
FT                   /locus_tag="PTH_t002"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:19041..19043,aa:Ser,seq:gct)"
FT                   /note="codon recognized: AGC"
FT   CDS_pept        19396..20535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CaiA"
FT                   /locus_tag="PTH_0015"
FT                   /product="acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58196"
FT                   /db_xref="GOA:A5D1D8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5D1D8"
FT                   /protein_id="BAF58196.1"
FT                   /translation="MNFKLTEEQELVRASVREFCQKYVEPIADKVDQEAYFPMETVKKL
FT                   AEQEWTGIPYPVEYGGAGSDYLTYIIVLEELSRACATTGFTLECHTSLASYPIYKYGTE
FT                   EQKKKWLVPMCKGEILGSFALTEPGAGTDAASGQSTAVLVGDEYVLNGTKMFISNAPVA
FT                   GVLVIFASTDKSKGAKGISAFIVPADAPGLQIGKHLNKMGIRGSLTAEVIMKDCRIPKE
FT                   NLLGKEGEGFKIAMSTLDGGRIGIAAQALGIAQAALDESISYSKERVQFGKPISSFQAI
FT                   QWMIANMATDVEAARFLTYYAAWCYDQGRPYSKEAAMARLFASECAARHTNRAVQIHGG
FT                   IGYIKGHKVERLYRDAKITEIYEGTNEVMRMVIAGNLLR"
FT   CDS_pept        20707..21480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixA"
FT                   /locus_tag="PTH_0016"
FT                   /product="electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58197"
FT                   /db_xref="GOA:A5D1D7"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A5D1D7"
FT                   /protein_id="BAF58197.1"
FT                   /translation="MLKIIACFKWVIDEQDIRVDQKSRELIMERVGYKISDYDRNAIEE
FT                   AVRQQEAHGGSVVAVTVGPPGARQSLKDALSRGPERAWFISDPSFAALEPSQTAAILAE
FT                   AIKTKGEFDLIICGEGSSDLYAQQVGPALAQRLGIPCATYVNKVTLEPGEKKLTAERKL
FT                   DDGIETVSIQLPALITVLPDINTPRIPSLKQVLGAAKKPVEEIKKSDLGQDFQPRLETI
FT                   SILGATMERRRLKYSAEAADIKAVVDALLKEGVIA"
FT   CDS_pept        21498..22457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixB"
FT                   /locus_tag="PTH_0017"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58198"
FT                   /db_xref="GOA:A5D6D9"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6D9"
FT                   /protein_id="BAF58198.1"
FT                   /translation="MAGIWIFAESREQTLELISAGTSLARQLDGAAVVTFATSRQLAEE
FT                   YISCGAGEVLVLPPLAGGQPLEAYVPAIIEAVRGGDPDIFLISATQRGREIAARVAAAL
FT                   DTGLCSGCTALKLDKEKKQLIMERMLYGGAAVQTVVCSGRPQMATIPPRTFEPAAPQEG
FT                   RQGKITELAGVQPSPVKVVGRAPKAAEAVDITEAKVVVCAGRGFEKKEDLNLAQELAQV
FT                   TGGAVGCTRPVAEELRWLPEDLYIGISGKKVKPGLYIGLGVAGQIQHVTGMRDSKVVLA
FT                   VNRDENAPIFDAADYGIVGDLYDVVPKLIKELRIALNK"
FT   CDS_pept        22480..23778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixC"
FT                   /locus_tag="PTH_0018"
FT                   /product="dehydrogenases"
FT                   /note="flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58199"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6E0"
FT                   /protein_id="BAF58199.1"
FT                   /translation="MEEKFAAIVVGAGPAGSTAAYLMAKAGLEVLLIEKGAAPGSKNMF
FT                   GGRMYSHALNQVIPGFWAEAPVERPVAKEIITLMTGDQCLSISIQDLSWTKPPYHYHSF
FT                   TLLRAEFDAWLAAKAEEAGAMLACGIRVDDLLIKDGRVVGIRAGEDEMLADVVIAADGV
FT                   NSLMAQKAGLARMFSPGQVATGVKQVIKLSPEEISRRFQLEGNNGAAQLFVGECTKGMQ
FT                   GGGFIYTNKDTISLGLVIKAAELQKTQHKIADLVEEFKHNPHIRPLVEGGEVVEYSAHL
FT                   VPEAGLDMMPQLYGDGILVAGDAAGFVLNLGYIVRGMDFAIASGQAAAQTVIEAARNNN
FT                   FSRQSLSQYAKLLKESFVLRDLEFYRKAPHFLENRRMFEVYPQLACGLMSRMFTVDGSP
FT                   PAHLLNKVLSQVKESQAGLAQLAGDGWKGARIL"
FT   CDS_pept        23775..24062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixX"
FT                   /locus_tag="PTH_0019"
FT                   /product="ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58200"
FT                   /db_xref="GOA:A5D6E1"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6E1"
FT                   /protein_id="BAF58200.1"
FT                   /translation="MKRLTVEQLLGINKFMVDDEEAHIVLNKEICASCATKPCTFACPA
FT                   CLYTLKENGEVNFDYAGCLECGTCRAVCPKEGAIAWGYPRGGFGVSFRYG"
FT   CDS_pept        complement(24205..24678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MarR"
FT                   /locus_tag="PTH_0020"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58201"
FT                   /db_xref="GOA:A5D6E2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6E2"
FT                   /protein_id="BAF58201.1"
FT                   /translation="MELNQCINFLLTKAQQAVLQYFRARLAAFDITPVQYGILSCLWAE
FT                   DGQTPTQIAQKLCLDGSTITGILDRMESKGLLTRTPDPEDRRAVRVVLTERSLRLMEPI
FT                   NEVISASNRDVLKIFSDEEQAQLKNFLERISQHKPAPPAGNHGHSARNSSRHA"
FT   CDS_pept        24898..25176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0021"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58202"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6E3"
FT                   /protein_id="BAF58202.1"
FT                   /translation="MKNCPVCSVPLDEIPKSGVLIDVCPKCKGVWLDRGELNRLLNTAR
FT                   EYYDEYEDFYKKHHHDYDDYHHHAREHYKHGHYKKRGLFKMLEDIFD"
FT   CDS_pept        complement(25202..26026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0022"
FT                   /product="predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58203"
FT                   /db_xref="GOA:A5D6B4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6B4"
FT                   /protein_id="BAF58203.1"
FT                   /translation="MTVDSILASTPGRGPEIIVVDDGSSDGCCRFLQQSNNYERVKLIS
FT                   SSGLGAARARNLGAASARGKYLIFCDAHITVPQNWLEALLDTFSRPGVDAVSPAIGSLE
FT                   NPAAVGYGQTWNSRLETVWLPPPGGMPAGPVPLLPGGCLAVRAGAFRRVGGFDEGFIVW
FT                   GCEDAELSLKLWLFGCRLYVVPSVRVLHLFRSRHPYPVTMDHVHHNLLRMALSHFKSSR
FT                   VKKVMGLIEPCGRLADTVRRVLQGGALQQRRRYLAGRMYDDDWFMKKFGIEF"
FT   tRNA            26218..26294
FT                   /locus_tag="PTH_t003"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:26252..26254,aa:Arg,seq:acg)"
FT                   /note="codon recognized: CGT"
FT   tRNA            26309..26385
FT                   /locus_tag="PTH_t004"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:26343..26345,aa:Arg,seq:cct)"
FT                   /note="codon recognized: AGG"
FT   CDS_pept        26544..26924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58204"
FT                   /db_xref="InterPro:IPR024700"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6B5"
FT                   /protein_id="BAF58204.1"
FT                   /translation="MKNRPVSQEYLENLRRAWQERARRKKEDMEKLRREALLKASAAAA
FT                   HLKAKYGAAAVYLFGSLAGGGHFCKSSDIDLLVEGFPPEKSYWRMLVELEEITSPLEVS
FT                   VVLAEDAVPGLREKARKEGILL"
FT   CDS_pept        26921..27190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58205"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6B6"
FT                   /protein_id="BAF58205.1"
FT                   /translation="MTRKQFAVIATRIKEEIDNIKSLSRELSKKGLTGSKKKIKSALPP
FT                   GDTFIPVNPDEQVYLGAGVLPVQADMQVQLSYEQHKTLCIMSIV"
FT   CDS_pept        27395..27865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CumB"
FT                   /locus_tag="PTH_0025"
FT                   /product="cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58206"
FT                   /db_xref="GOA:A5D6B7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6B7"
FT                   /protein_id="BAF58206.1"
FT                   /translation="MAVVNHAGYMREALAEAKKAYGLGEVPVGAVVVRDGEIIGRGHNL
FT                   RETLKDSTAHAEILAMREAARIVGDWRLNGTVLYSTIEPCAMCAGAIIQFRVATLVYGA
FT                   ADPKAGAAGSVIDVIGQPRFNHRVEVVSGVLEEECREIIQKFFRELREREET"
FT   tRNA            27909..28002
FT                   /locus_tag="PTH_t005"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:27944..27946,aa:Ser,seq:cga)"
FT                   /note="codon recognized: TCG"
FT   CDS_pept        complement(28217..28981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58207"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6B8"
FT                   /protein_id="BAF58207.1"
FT                   /translation="MDEGKKYMDKGDFQKAKFFYAKALKLEDSAPARNNLATAVFLGQD
FT                   PQRALRILAPVLKETEEDSTGAINTKVNPYTYALAYRIYCALGDMEASRQYLSQAVRRF
FT                   EKDLACLRQVLPRTKLYTFLEYTVAIMQAAADQQDHRQVFELYRRWKSEHVHWQNKHLA
FT                   AVACFNLGRYKRAASLWTPISAEHRFFTLLQKAAFLLERGTVPSFALEYEIPSLEILKA
FT                   IETASCLNMVLPRYHLKIQQYTNPIFNRLHSY"
FT   CDS_pept        29441..29722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58208"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6B9"
FT                   /protein_id="BAF58208.1"
FT                   /translation="MLVIQICVGSSCFLRGSREVIETVEKLINHYRLDDVVVLKGSFCM
FT                   EHCNDGVTLKIGDKTFTGVNRESITGLFEKEVFEQLYGVKNDEPDQHK"
FT   CDS_pept        29700..31436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0028"
FT                   /product="hypothtical hydrogenase"
FT                   /note="containing COG4624, iron only hydrogenase large
FT                   subunit, C-terminal domain; COG2000, predicted Fe-S
FT                   protein; and PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58209"
FT                   /db_xref="GOA:A5D6C0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C0"
FT                   /protein_id="BAF58209.1"
FT                   /translation="MSLISTNEAKCRDCYKCLRSCPVKAISIKTEKPGTAVRVRVIEES
FT                   CIQDGLCTLVCPQKAKVVNNCLEDVKKAIARNTVPVIASVAPSFPVALPLPEPGLFPAI
FT                   LRRLGFSRVEQTAVGAGLICLEHGRMEFKGPLISSACPVIVNIVERHYPRLIPHLSPLV
FT                   SPMIAHARLLKSLYPGSIVVFIGPCIAKKGEALSEEFKGDVDYVLGFTEVWEWIKSEGL
FT                   EIEKLSAGEFDGYNPGPARLFPLEGGQLMTTSLSTDMLDKNVHAFSGLKKCMELLASYG
FT                   EAAPSGKPEFIELLACEGGCVGGPYTVVEKSSFIKKQKLLDLHYRSLQEEAASGREAEP
FT                   GPQLPSGLLYRTYRNKKCELPLPSPEQIDKILAMTDKFSPEDELNCGACGFNTCRDKAV
FT                   AVFHGYAEPEMCIPYMRRRAESLSNQVLQALPDAVVIVRGDMAIEEINPAAEKMFNCTR
FT                   SVIGQDLEVLTDPTEFLKVFQTKKMVKLEVSDLKNKIDTRQIIFPLGDRVVGILTDITE
FT                   ELKREEELSLVKTQTINRAQEVIKKQMTVAQVIAGLLGETTAETKALLNELIKLMKDKK
FT                   EN"
FT   CDS_pept        31454..32605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0029"
FT                   /product="sigma factor PP2C-like phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58210"
FT                   /db_xref="GOA:A5D6C1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C1"
FT                   /protein_id="BAF58210.1"
FT                   /translation="MPFYLDIGYSQLNKKGEELCGDSVEILRSEKSTVIVLSDGLGSGV
FT                   KANILSRITAKTAATMLKMGCLIDEVIETMAETLPVCNVRHLAYSTFSIVQIFNDGRAY
FT                   LAEFDNPPAYLGYENEILPLKREERTVRDKQVKETLLDLMPGNWIVLISDGVLHAGLGN
FT                   VLNFGWGDRQLGRFIKETAGQNLEANDWAETITEKCNELYGGLPGDDVSVVVIKIRDTR
FT                   KLTVLVGPPRSRADDRKAVGSLIRTEGRKVVCGGSTSNMVSRILLKELVIDMSSFSEDV
FT                   PPTGTIEGIDLVTEGAITLYHALEMLKKGVKLRSLAGAKDGASLLLAEFLRADKVHFIV
FT                   GLAVNQAQHYPGFPPACLLKNQTVRDIAEILKSMGKEVTIEYL"
FT   CDS_pept        32766..33473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IclR"
FT                   /locus_tag="PTH_0030"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58211"
FT                   /db_xref="GOA:A5D6C2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C2"
FT                   /protein_id="BAF58211.1"
FT                   /translation="MLFLEEEKLTLSEIARRVGISKTAAYRMVTTLVEMNFLKKDETKR
FT                   YQLGHNILRLARMVEQSLKSIAVQVMKELAAKTGESVYLSMSKNCQYYYFIEGVESGQH
FT                   LKWTVNIGEPNSLLVGSAGKAHVAFRDRKEAEEIVQRARLIPFTPHTIIEKEKLIEELE
FT                   KIRSQEYSFSWGERYEEAVGISCPIWDSAKKRYAVAVLSIFIPKFRYSDLDLNRYLEPL
FT                   REAAKKIFLLLGG"
FT   CDS_pept        33552..34322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0031"
FT                   /product="hypothetical protein"
FT                   /note="containing partial COG0388, predicted
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58212"
FT                   /db_xref="GOA:A5D6C3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C3"
FT                   /protein_id="BAF58212.1"
FT                   /translation="MKYDIYTAVAIQPEVKVVEKRSDIKKNLQRCLELIDAAPQTAPSA
FT                   KEKYEGNWAPIKLVSFPEFFIQGHEGHWPFDHYINEVLIDIPGEETERLAEKAKEYQIY
FT                   IAGCALERDKDWIDDGYFFNTHFIIGPDGKIIHKYRKITVATHYELAVSPHDVYDKFVA
FT                   MHGDDLSVFLPVTDTEIGKIGTITCMDGHFPETARALGVQGAEVILHPLLVEPMMSPPQ
FT                   EIWQMMNRMRAWENVCYVIAASVRLTFRNMCQLR"
FT   CDS_pept        34307..35257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="UhpC"
FT                   /locus_tag="PTH_0032"
FT                   /product="sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58213"
FT                   /db_xref="GOA:A5D6C4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C4"
FT                   /protein_id="BAF58213.1"
FT                   /translation="MPAKVRGRFVSVFNACFSLGVALAYFLGYLVVVPFGWRWGFAIGV
FT                   LPILMFFVAKATLPESVRYLLEKGKIEEAVRIVEQIEKKILKRVTVPFEEAVKIEREAA
FT                   ASQRKESRIGIADLFTRGMARYTIVVAIAWFSLQYCVYAIMVWMPVVLRTELGFQLATG
FT                   LSFLALGSLLGAAATPLSGIAADTIGRKISLCAIFTIYGIIPYFLFLLGRDPALGFILL
FT                   MLTLIVVGLINGIVYVYSPENFPTKARGAGMGFVTAVGRVGAIAGPTIVGFIYSVAGFI
FT                   WVLHVNIALLLFGAIVVWIFGRETKGRVLEDIESS"
FT   CDS_pept        complement(35427..35720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58214"
FT                   /db_xref="InterPro:IPR031552"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C5"
FT                   /protein_id="BAF58214.1"
FT                   /translation="MYKLIILPPAARYLKKIKEKPLKAAFQKAVDEILKDPYMGEPKTG
FT                   DLAGVFCYDIYYNKTNYELAYTIIEEGGSTVVVILAGTRENFYEELKRYMST"
FT   CDS_pept        complement(35720..36061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58215"
FT                   /db_xref="GOA:A5D6C6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C6"
FT                   /protein_id="BAF58215.1"
FT                   /translation="MLKKRISVSQKRQITIPIEFFNSLGIEKEVECYLQNNAIVIRPVR
FT                   ENSGEFDEQILADLISQGLSGQELLEKFKELRRKVRPAVERLLGEARLAAAGKAGFSTY
FT                   EDVFGTEDK"
FT   CDS_pept        36352..37035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OmpR"
FT                   /locus_tag="PTH_0035"
FT                   /product="response regulator"
FT                   /note="consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58216"
FT                   /db_xref="GOA:A5D6C7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C7"
FT                   /protein_id="BAF58216.1"
FT                   /translation="MPKLKGIRVLLVDDEPNILQFLELGLQNEGFEVQTAQDGFTAINL
FT                   MKQFQPHVVILDVMMPGMDGFEVCRMLKKMENVAVIMLTARDEVDDRVKGLNIGADDYM
FT                   VKPFSFEELLARIHARVRNQFPNLFGEVAIGPFQIDDRRKEIKFEGRVLELSPTEYELL
FT                   KYLVLNHGLVLSKRMILDKVWGYDFAGEENIVEVYVRSLREKLKDKDHQIIRTLRGAGY
FT                   RVDLP"
FT   CDS_pept        37032..38468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0036"
FT                   /product="hypothetical membrane-associated sensory
FT                   histidine kinase"
FT                   /note="containing COG5002, VicK, signal transduction
FT                   histidine kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58217"
FT                   /db_xref="GOA:A5D6C8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C8"
FT                   /protein_id="BAF58217.1"
FT                   /translation="MNSKKSEFFGSLRIQLLSRSLLILALLLMLIGLFQYVLMKEFVYR
FT                   NKAASIQSQLLSVPRFDWPQLPGIPEDGRVRPPLFFIPEVNLAFVDLEGNFYVLSRGPG
FT                   DTSPPRLDTGEYLSILGKRPDLRYKVVYDSAGTEQLLVLQPVMARNGKVIGITQAGTLT
FT                   GPLKELLVRQLLVFLVLSLAAMFFGLLGFLPVIRRTLAPLSNMIDTAGQIDAGNLAKRF
FT                   PTQQGQVEIDRLAESFNGMLDRLEASFKAERETKEQMRRFIADASHELRTPLTSIHGFL
FT                   EVLLRGAASQPDQLQKALKSMHSESERLTRLVHDLLLLAKLDRTPQVELAEGLLSTMIL
FT                   DMEPQLRILAGNRELSLQIEPGVVCRYDVNKMKQVILNLFHNAVQHTDPEGGCIRLSLS
FT                   RVDGGVRLSVQDNGPGIGEEYLPHIFDRFYRIDVSRARKYGGSGLGLAITKAIVDIHGG
FT                   VISVESKPGEGCTFHIWLPV"
FT   CDS_pept        38715..40121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AcrA"
FT                   /locus_tag="PTH_0037"
FT                   /product="membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58218"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6C9"
FT                   /protein_id="BAF58218.1"
FT                   /translation="MAAALAGLYVLGGTKKAESNYITGTVKKGTVTTAISATGTVEPVS
FT                   TVSLSFENAEIIKKIYVKEGDHVTAGQLLAEQESDNLEAQVIQSSASLKGALAKLELLK
FT                   NGSTAEEIAQAEANVVMAQAAYDLTKTNLERYQALFQEGAVSRADLDSASNEYVNAEAK
FT                   LKQAQESLKALLNGNRREDIEAQAAQVESSRAQLQIAQKALAGTKLFSPINGVVSEVNG
FT                   GEGQRAAANNNSTSSGTGFIVVISDALQVRAQVNEADIGRLETGQKAEITVNAFPNKTF
FT                   TGRVGSISPQATTVSNVQVYDTVIELDENQQGLKAGMPANVNIIVERREDVLTVARGAV
FT                   TYAANYLNNAGQGTAAKTASPEGGNSNRTSVSGADGNSSSGIGAAGLAKENARKQQAVV
FT                   LVLDKSGRPAPRQVVLGLSDLKNYEVIEGLNEGDVVIIGGSGTAVSGSASNNSSGSGGG
FT                   PPLMGGPPPH"
FT   CDS_pept        40178..40942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SalX"
FT                   /locus_tag="PTH_0038"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58219"
FT                   /db_xref="GOA:A5D6D0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6D0"
FT                   /protein_id="BAF58219.1"
FT                   /translation="MSGNTAIVVENIKKVYNMGETKILALKDISFTIHEGEMVAIMGSS
FT                   GSGKSTLLNILGCLDKPTAGSYYLYGENVSQLDKNQLAFIRNKRIGFVFQGFNLLGRMS
FT                   VLANVELPLVYAGVPKKEMAERAKEALAWVGLSEYLHHYPNQMSGGQQQRVAIARALVN
FT                   NPSLILADEPTGALDSKTSVEIMAVIQRLNIERGITVVVVTHEKDISLYCQRLINVKDG
FT                   CITGDAPVLNQREAAGDLPVFPGEKEAAGWTF"
FT   CDS_pept        40930..42147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SalY"
FT                   /locus_tag="PTH_0039"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58220"
FT                   /db_xref="GOA:A5D699"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5D699"
FT                   /protein_id="BAF58220.1"
FT                   /translation="MDVLNSLEVAINGIRANKLRSSLTMLGIIIGVAAVIIMISMGQGA
FT                   SKRISDQISSMGSNLLMVFAGAGQGPVRGASGSVNTLTLEDAKAIAGLYGVARAVPELS
FT                   TGATVAYGSQTWTSQVDGTTPEMQQIKKWTVSQGSFFTEDDVKSARLVAVLGKTVADNL
FT                   FPAGFNPVGETIRINRLTFTVVGVLAPKGAAMAGQDQDDVIYVPVTTVQKRMMGVNYVR
FT                   VINVQTETKESMAYVQSSIEELLRERHRITGNKSDDFTVRNLTSVLEAAETATSTMTLL
FT                   LASVAAVSLLVGGIGIMNIMLVSVTERTREIGLRMAVGATENDIRNQFLVEAVALCLTG
FT                   GVAGILAGIAGSKIISKVAGWSTYITLYSILLSAGFSAAIGIFFGYYPAKKAAGLDPIE
FT                   ALRFEK"
FT   CDS_pept        42240..42659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0040"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58221"
FT                   /db_xref="GOA:A5D6A0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A0"
FT                   /protein_id="BAF58221.1"
FT                   /translation="MKKCRQLHLWIGLFTSVLILIESVTGLLMVEPWLIGANRPQAEQR
FT                   VQLEKAGAVDFAGDAAAYGRRAGAGAGQGRNAGSAGRQNSLMAFVRGLHSGKIGNTDLS
FT                   IFLDIVAVAMIVLTTTGIIMSVNILRAQARAKKRI"
FT   CDS_pept        42886..45048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0041"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing partial ArnT (COG1807),
FT                   4-amino-4-deoxy-L-arabinose transferase and related
FT                   glycosyltransferases of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58222"
FT                   /db_xref="GOA:A5D6A1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A1"
FT                   /protein_id="BAF58222.1"
FT                   /translation="MQSAKHAGRGVVAVRKKRLRKKRLRKNRSWGFDPVFTGIVLLSAF
FT                   LNIFNIWKDQYANAYYTAAVTSMLQNWRNFLFASFDPAGYITVDKPPAAFWVQAAFAYV
FT                   FGVHGWSVILPQALAGVGSVLLVYVLVKPAFGKTAARLASLVMASTPIAVAVSRTNNID
FT                   SLLVFTLLIATWMLFRAVRSQKFLWLLGAFAMIGAGFNMKMFQAYMVVPAFCLLYLIAY
FT                   EGGWKKKLAVLAAATAVMVVVSGAWATVVEVIPPENRPYIGGSRTNSVLELAVGYNGIM
FT                   RLTGMHGWGAGPGSAQDRRQMPAQDEGARPDPRQMPQGGENVPDRLQGQQEGSNAPAPA
FT                   QMPPDKSGLPGAVQGSRTGQGSAPGFGGGRPQGRGGGAFGTGQPGPLRLFQSELSGQTS
FT                   WLLPFVGFACTGLLAGVSRKRPLTAKQKETLFWLAWLVPAMAFFSVAGFFHHYYLIMLA
FT                   PPVAALAGAGWVELWSQYRDRDGWKMLLLPAGLLATTAFELYVLQPYQRQIGISWSICI
FT                   GAAGAGLALVLFIAATIKQKPAFVLALAAMLVLLAAPLYWACTPLLYGVNYTMPQAGPV
FT                   QQGFGQRPGIGRGPGSGVNEKLLEYLEKNNTGEKYLFATTDANTAAPYIIETGKAVMAM
FT                   GGFSGSDPVLTVEKLKQMVANKEVKYFLIPSVSGFVGREGGAAGEVLEWIRANSTEVPR
FT                   EEWQPNVIQSVPGGMRDGRTLYKIKG"
FT   CDS_pept        45059..45595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0042"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58223"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A2"
FT                   /protein_id="BAF58223.1"
FT                   /translation="MTGKVRYTIVIPVYNEAVVHETYRRLTKVMQSIGEPYELLFVNDG
FT                   SQDWTGKIIESLAAADGCVRKLDFSLCDVMRDIREKNRYVRGLVSWAGFQQAAVEYVRE
FT                   ERFAGETKYPFKKMLRLAADGIASFSCKSLRLALPFGLLVSSAGLAWLAFSLGRLLLHA
FT                   GEGVGWRPSLPACFC"
FT   CDS_pept        45562..45699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0043"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58224"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A3"
FT                   /protein_id="BAF58224.1"
FT                   /translation="MEALAACLFLLNGLILIQIGILGEYIGRIYDENKSRAGRCGKKAW
FT                   "
FT   CDS_pept        45966..46292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0044"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58225"
FT                   /db_xref="GOA:A5D6A4"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A4"
FT                   /protein_id="BAF58225.1"
FT                   /translation="MDSFFTLIVISAAVMLSERKVAASAALFAAAVMMKLQGIIFLPVL
FT                   FFELAGQRRADVIFKAAACALGTAAAVALPFSLNNGTLWIFKLFTSTAAEYPYSSVNAF
FT                   NFFK"
FT   CDS_pept        46358..46780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Fur"
FT                   /locus_tag="PTH_0045"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58226"
FT                   /db_xref="GOA:A5D6A5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A5"
FT                   /protein_id="BAF58226.1"
FT                   /translation="MITKKLKKLGLKLTPQRLAILNLLEGNTTHPSAEEIYNQLKPQFP
FT                   SLSLATVYNTLEVLAGAGELQEIRIKADKRNFDPNPVPHGHFLCRLCQSICDLDIRPLE
FT                   IQTPFNIKGYLVEEYTLYFYGVCPKCLEKGANKGGE"
FT   CDS_pept        46826..47371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0046"
FT                   /product="hypothetical protein"
FT                   /note="containing Rubrerythrin domain (COG1592),
FT                   Osmosensitive K+ channel histidine kinase."
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58227"
FT                   /db_xref="GOA:A5D6A6"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A6"
FT                   /protein_id="BAF58227.1"
FT                   /translation="MKRWRCTVCGYVHVGEAPPEKCPNCGAPKEKFELLTATGPDLVDW
FT                   NKIGVAKGTGFESDLEMQFKGECMEVGMYIAMARQAEREGYPEIAETMKRIAWEEAHHA
FT                   ARFAELLGDVVGESTEENLKKLVEGEAGANRGKKDIATRSKKEGQDAIHDAIHEACKDE
FT                   ARHCMAFYGLLKRYFPQA"
FT   CDS_pept        47724..48968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0047"
FT                   /product="hypothetical signal transduction protein"
FT                   /note="containing partial KdpD (COG2205)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58228"
FT                   /db_xref="GOA:A5D6A7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A7"
FT                   /protein_id="BAF58228.1"
FT                   /translation="MNLSKIDYLFDVSIKTLYFAGKLLQERGNFERVPGWLAETLGVNG
FT                   SALGIVAAKQCKVYFARAGQNGEAGSMEVAVDVLRCLCQNSFGNSNVKCRVFDCPVRQK
FT                   IFDKCGRSGLEASCFPMAGRKGFLMVCGEALLLNSSPVTEILKAITHIIACGLDAADRT
FT                   REAASYFLPPENMAQMWSEMLAGLSHDLRTPLACIKGYITTLMREDVTWDPADEKEFMN
FT                   IIVEETDHIESLINNLLDSTTFSWKGEIELRKELISLPQIVNKVLRDPSYRIKNHQFTV
FT                   LFPEGFPLVEADPVRIEQVLRNLVDNAVKYSMEDTQIVIKGEAMAGEIVVSIADQGIGI
FT                   DSEHLKWLFEKFFRVGIKENNKGMGLGLPLARQILISHGGRIWAESKLNQGTTFYFTLP
FT                   VGQQTAKMNKHPRGD"
FT   CDS_pept        48978..49676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OmpR"
FT                   /locus_tag="PTH_0048"
FT                   /product="response regulator"
FT                   /note="consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58229"
FT                   /db_xref="GOA:A5D6A8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A8"
FT                   /protein_id="BAF58229.1"
FT                   /translation="MKRKTILIVDDEPRLVRLVKVNLLASGYVVDTAADGKTAIEMLES
FT                   SGYDLLILDIMLPGPLNGFEVCKRIREFSDIPIIMLTGRAREQDRIRGFDAGADDYVTK
FT                   PFSVEELLLRVKAILRRSHPSEEFPKGPVYKFGDLVINFAQKRVFVRGREVRLTATEYQ
FT                   VLYHLGCNAGKVITHEDLLTRVWGAEYRNELHYLRNYISSLRKKIEDDPGDPKYILGKH
FT                   GIGYYLALGE"
FT   CDS_pept        49855..51186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GlnA"
FT                   /locus_tag="PTH_0049"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58230"
FT                   /db_xref="GOA:A5D6A9"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6A9"
FT                   /protein_id="BAF58230.1"
FT                   /translation="MLTREDVLEKAREERVKFLRLQFTDIFGALKNIAVTSEDLERALA
FT                   GRVSFDSSVVDGVVSSQEQDITLQPDLSTFLVLPWRPREEAVARFICDVANPDGTPYPG
FT                   CSRSVLKQVLSEADRAGFKILVGVEVEFYLFYTDENGNPTTNTHDSAGYCDLTPVDLGE
FT                   NARRDMVLVLEEMGTDIGFSHHEKGPGQHGITLKPDNALAVADKLVTFKFIVRTIAQRY
FT                   GLHASLMPKPLNGRPGSALNLCLFLQRNGYGFFDDAPKQPSQLGQEVGHFIAGILAHAR
FT                   ANTAITNPLVNSYKRLFPNGLTMPVRVAWSEDSRNTVLRVVTQCGQETRVEVRNPDPAC
FT                   NPYLALSVILKAGLEGIRQQLPQPPPLSENIFLADDNQSKGAQVACLPRTLGEALQELV
FT                   SDQLARATLGEYIFRRFVEAKGEEWERFQAFVHPWELQEYLSCF"
FT   CDS_pept        51366..52712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GdhA"
FT                   /locus_tag="PTH_0050"
FT                   /product="glutamate dehydrogenase/leucine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58231"
FT                   /db_xref="GOA:A5D6B0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6B0"
FT                   /protein_id="BAF58231.1"
FT                   /translation="MGMSQQVIDEVMEIVKKRNPNEPEFHQAVMEVFESLKPAIEKHPE
FT                   FVEAGILHRIIEPDRQVIFRVPWVDDQGRVQVNRGYRVQFNNAIGPYKGGLRFHPSVNL
FT                   GIMKFLAFEQTFKNSLTGLPIGGGKGGSDFDPKGKSDGEVMRFCQSFMTELYRHVGADV
FT                   DVPAGDIGVGSREIGYMYGQYKRITTLYNGVFTGKGLTYGGSLGRKEATGYGLLYFLEE
FT                   MLKEKGQTIAGKTVIVSGSGNVAIYAVEKAQQLGARVVAMSDSNGYVYDPEGIKLNTVK
FT                   QIKEIERKRIKAYVEHHPSAQYHEGSKGIWSIKCDIALPCATQNEIDGESAGKLVANGV
FT                   LAVAEGANMPSTPEAIKTFQDNKVLFGPAKAANAGGVATSALEMSQNSMRCSWTFEEVD
FT                   ARLKNIMVTIYRQVSRAAREYGCEDDLVTGANIAGFLKVAEAMMAQGIV"
FT   tRNA            53250..53339
FT                   /locus_tag="PTH_t006"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:53284..53286,aa:Ser,seq:gga)"
FT                   /note="codon recognized: TCC"
FT   CDS_pept        53804..55480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XerD"
FT                   /locus_tag="PTH_0051"
FT                   /product="DNA polymerase III, gamma/tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58232"
FT                   /db_xref="GOA:A5D6B1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D6B1"
FT                   /protein_id="BAF58232.1"
FT                   /translation="MTYLALYREWRPRTFGEIIGQEHITRTLKNAVEAGRVGHAYIFCG
FT                   ARGTGKTTAAKVLAKALNCTGREGAEPCNRCESCRAVNEGISVDVIEIDAASNRGIDEI
FT                   RDLREKIRFAPAAGRYRVYIIDEVHMLTSEAFNALLKTLEEPPRHAVLILATTEPHRVP
FT                   LTILSRCQRFDFRRIIPADIIKRLKEVAAGARLEVEEEALRLIARAAEGGLRDALSILD
FT                   QAAAFGGMKVTEAGVHQILGTVRTDALDRMAGCLAAGEAGRALRLVSELAGEGKDLRLF
FT                   ARELAGYLRALLLEKISPGTPAGEAWGDTARMAAQAAEFSEAGLVRAVEIIARAEQDMK
FT                   WSAMPGIVLELALVKACRPEAGWDLPSLAARVAGLEEKIKLLAPAEAPVKRPPAAAKAA
FT                   SAPRQAAPAPVPVAVPALPQKQVQEAGGPGGPAEAVSLEQVREAWEDLMNAMRKERLPL
FT                   YTNYSKAAPLAVKGRVLVVGFPEGEALFKEIAEMPENKKYFEGLLGRFFKGEWQAAFKF
FT                   YRGRIPLPRRREAPAEPVADVKRRFGGEEITLDDEPGDSLF"
FT   CDS_pept        55515..55832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0052"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58233"
FT                   /db_xref="GOA:A5D6B2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D6B2"
FT                   /protein_id="BAF58233.1"
FT                   /translation="MMGGNMSKMMKQVQKMQQDMLRLQEELGNRTVESTAGGGAVKVVA
FT                   NGRNEIVSIEIKPEALDPEDVEMLQDMILAAVNEALKKAQDMISQEMGRLTGNLKIPGL
FT                   F"
FT   CDS_pept        55836..56438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RecR"
FT                   /locus_tag="PTH_0053"
FT                   /product="recombinational DNA repair protein"
FT                   /note="RecF pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58234"
FT                   /db_xref="GOA:A5D6B3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D6B3"
FT                   /protein_id="BAF58234.1"
FT                   /translation="MDYYAKPVARLIEQLARLPGIGPKTAQRLAFYLLNAPLEVALNLA
FT                   RAVEEARQAVRYCSVCGNLTDTDPCFICGDDRRRRDLLCVVERPRDVVALEKARVFKGL
FT                   YHVLHGSISPVEGIGPEQLRIRELLKRLEGGTVREVILATNPTVEGETTALYLAGLIKP
FT                   LGVSVTRIAHGLPVGADLEYADEMTLSKALEGRREMK"
FT   CDS_pept        56489..56755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0054"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58235"
FT                   /db_xref="GOA:A5D682"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A5D682"
FT                   /protein_id="BAF58235.1"
FT                   /translation="MEWKLFLTGLAGLLGLYLVGTVLFRPLKFLIRLAVWALLGAVLLA
FT                   AANVLLGHFGFHIAVNPVTIMTAGILQLPGVVLLALINYLYMG"
FT   CDS_pept        56838..57503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58236"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D683"
FT                   /protein_id="BAF58236.1"
FT                   /translation="MAGRTVEAYTGEYASGKSENAVNRALELAGRGRRVTLVDLDIVEP
FT                   AYTLRPIQDELRAKGVDVIAWRTGEAPGPGEAGGLIRPQARWALRRQGDIILDVGYGAE
FT                   GLKTLNLLEGAGTDPDLKVLAVINARRPLTAGVEDIVEYVRGMGRVDGLINNTHLAGET
FT                   TAAVVQEGARTVAEAAGILGLPVVATAAVAEIAWEIGPLDCMGNPVRPLTRFMQKAFW"
FT   CDS_pept        57512..58606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PorA"
FT                   /locus_tag="PTH_0056"
FT                   /product="pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58237"
FT                   /db_xref="GOA:A5D684"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A5D684"
FT                   /protein_id="BAF58237.1"
FT                   /translation="MTVEIFEGEKRAFMTGNEVVAWAAVAAGADIMFGYPITPQNEIMH
FT                   YWTRLAPRYGKKFLQTEDELSAGFTTAGGVMAGLKAFTATAGPGNVLMQEPMSMAEMMR
FT                   LPTVVVVQQRGGPSTATVIYSQQEVTLTALGGNGEGLRVVYSTATHQELFDYTIKAFNT
FT                   AWKYRFPTFVLGDGYQAKMREPLTVYNPAGRGIRLIEPEPLVGLDGVPGRDRPPAQHRN
FT                   TFSLEEELYEKLMGDIKDYEKAAPEIAEYQSAGTEDADLVVVGHGVVFRAVRDAVKSLR
FT                   ENGLKAGYFRPVTLRPFPVPQFREVAGRAKKILVVESAYGQLARLLKEAACGTPAGIEV
FT                   LFRPGVGITAGEIEDRAREIISLF"
FT   CDS_pept        58706..59482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PorB"
FT                   /locus_tag="PTH_0057"
FT                   /product="pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58238"
FT                   /db_xref="GOA:A5D685"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5D685"
FT                   /protein_id="BAF58238.1"
FT                   /translation="MFPQPDMPQSWRAETKPHKFCPGCGHGIVLKCLGQAIDELGLQGR
FT                   TVFGCDIGCSLLSWDFFNLDSVQTHHGRTTPVMTGIKRARPELICVAYMGDGGGYSIGL
FT                   QHLISAAARDEKITVVLANNTLYAMTGGQLAPTTLPGQKTETTPYGRDPEATGRPLLGP
FT                   EMVAAVAGEGAYVARGSIANVRQLKGFLKKALENQMAGAGFSFVEALSACPTNWRMNAK
FT                   ETWRFIEEEMQGYFRTGEIKVPGAVRKEAEDGGHNS"
FT   CDS_pept        59463..60023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PorG"
FT                   /locus_tag="PTH_0058"
FT                   /product="pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58239"
FT                   /db_xref="GOA:A5D686"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A5D686"
FT                   /protein_id="BAF58239.1"
FT                   /translation="MVGTTVKIVLAGEGGQGVQAAAEIIAEAANEEGRQALYIPNFGVE
FT                   QRGGVSVAFVQVGDEPIGSPKFRTGDFVVALSGRAVQRTRQYAGPATTFVYDSSIQNAE
FT                   KELPGGAGRVLAVPAMETAKKELHPRVFNIIILGAVVALTGVISLERARAAVEKKLGYR
FT                   FEKQPELRELNFKALERGAAMVS"
FT   CDS_pept        60071..60328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0059"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58240"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D687"
FT                   /protein_id="BAF58240.1"
FT                   /translation="MTPEFVPKTQKLEKGTFILFPALCKGCGLCIEKCPKKSIGWSEVL
FT                   GVYGTPTVEANNSCIACGICQAVCPDCAIRIEKNGTAGRP"
FT   CDS_pept        60394..60588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58241"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:A5D688"
FT                   /protein_id="BAF58241.1"
FT                   /translation="MEAVFVPSACIICLRPRPDGGEGLLVRGCFICPECEARIVSLSAD
FT                   DPDYGRYRQSLKEIWRRPG"
FT   CDS_pept        60692..62212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LdcC"
FT                   /locus_tag="PTH_0061"
FT                   /product="arginine/lysine/ornithine decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58242"
FT                   /db_xref="GOA:A5D689"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A5D689"
FT                   /protein_id="BAF58242.1"
FT                   /translation="MKNKSLANTAFYGILFLLTFNISEVMLLGPEQERAPLFEALAAHV
FT                   RKNPAGLHVPGHSRGRGLPEELLSLGSALFGLDLTELPGLDDLHSPRGPIARAQELAAQ
FT                   AYGADRTFFLVNGTTAGIHALICAAGRGKIIVPRNAHRSVLGGLILSDADPVYVVPGII
FT                   PGFGVDCGITPREAAGALDEYPGAALLVVRPNYYGVAEDLDGLVLAAHMRDRPLMVDEA
FT                   HGAHLRFHPGLPEDAMAAGADASVQSTHKLGGSLTQSSMLHLRGGRLDAEKVAASLSLL
FT                   QTTSPSYILMVSLDLARRQLALMGEGLIERVLELARELRGRLARIRGLEVLTGEHLPGN
FT                   AARLDPTRLVISVRGLGLTGYQAAGLLAERYGVFVEMADYGNLVAVISAGTARADCNAL
FT                   AHALEDLAARERPGRRLPALPLPAGFRKVMKPREAWFSPAQRVALEDAKGRVCAEMVAV
FT                   YPPGIPAVCPGEVITPEVHEYLVLLSKMRVPCQGASDPELKTIKVVVE"
FT   CDS_pept        62245..62895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Tmk"
FT                   /locus_tag="PTH_0062"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58243"
FT                   /db_xref="GOA:A5D690"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D690"
FT                   /protein_id="BAF58243.1"
FT                   /translation="MKGKFIVFEGVDGSGKTTQIKLLGEKLESMGCPVVYTREPGGTRV
FT                   GERIREILLNPLYGELVPWAEALLYAAARAQHVAQVILPALREGKVVLCDRFTDSSLAY
FT                   QGYGRGVDIEMLEQVNRPAAAGVVPDLVLVLDFDREGQTERMARSGRSADRIEREAQEF
FT                   YRRVRSGYLALAARAPRRYRVIDASRAEKLVHLDVLKAAEEVLDAFLKGNSRA"
FT   CDS_pept        62864..63871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DnaX"
FT                   /locus_tag="PTH_0063"
FT                   /product="DNA polymerase III, gamma/tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58244"
FT                   /db_xref="GOA:A5D691"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D691"
FT                   /protein_id="BAF58244.1"
FT                   /translation="MLFLREIVGHRQITGALMNAVACGRVAHAYLFAGPAGVGKKTTAL
FT                   AFARALLCPVPEGGDACGTCRQCRQVEHRNHPDLYIVNPSGATIKIEQIRELQHRAPYR
FT                   PYQGGRKLFLICRAETMTAEAANCLLKTLEEPPHDTVLILVSDQPQSLLPTVLSRCQQC
FT                   FFKSIPLSELSGSLTARHGLAQEEALLAAAMSGGSMGKALAYASGSLAERRNAAGALAG
FT                   ALKTAGPLEALEMAGKISEDREEALLILEMLICWFRDLLVYRETEDAALLFNADRAGLV
FT                   KKEAQSFQPGRLVEIIEDIEATRNKIEANASTRLALEALFLRLSGGACAQEAPP"
FT   CDS_pept        63889..64782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0064"
FT                   /product="Uncharacterized homolog of PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58245"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A5D692"
FT                   /protein_id="BAF58245.1"
FT                   /translation="MGLTVVGVRFKKAGKIYYFDPDEHLLAPGDGVIVETARGVEYGQV
FT                   VCGPLQVEEEEVVAPLKKVLRKATEQDRQRLSANREKEKKAYQIGLEKIAAHGLPMKLV
FT                   DVELTFDGSKIIFYFTADGRIDFRELVKDLAAVFRTRIELRQIGVRDEAKMIGGLGCCG
FT                   RELCCATWLADFASVSIRMAKDQNLSLNPTKISGICGRLMCCLKYENESYEQAKEDFPE
FT                   TGSWVITPNGEGKVTGINIFKNTVSVELKESKSIKEYSTGEITLKEDRVKNCKGQKKEC
FT                   PNQPDEERIKCSPFIS"
FT   CDS_pept        64761..65102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0065"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58246"
FT                   /db_xref="GOA:A5D693"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:A5D693"
FT                   /protein_id="BAF58246.1"
FT                   /translation="MQSLYKLVKEMELKLHAVLSEALELKNRIQEMEEENALLRKELAA
FT                   AYRRNCSGRPRPAGADVPGRGFINLLELYDQGFHICNLYFGRKRAEECLFCMAFLRKEQ
FT                   EPAAGRPEG"
FT   CDS_pept        65143..66009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0066"
FT                   /product="predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58247"
FT                   /db_xref="GOA:A5D694"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5D694"
FT                   /protein_id="BAF58247.1"
FT                   /translation="MAGTKGVLYLCATPIGNLEDITLRALRVLREVDLIAAEDTRRTRK
FT                   LLSHYGIHTPLTSYHQHNRRKKGEYLLDMLESGKNVALVTDAGLPGISDPGSELVKAAL
FT                   EKGIRTVPLPGPSAGITALVVSGLPSDLFVFAGFLPSSKKSRVKELQELRRQRGTLIFY
FT                   EAPHRLKETLADVLEVLGDRPAAAARELTKVHEEVLRGPLSKLLEYFNEVEPQGEFTLV
FT                   VAGAEAGDEAEGVAGAARPGPDPAARVAMLEAEGMGRREAIKEVARLLGLSRREVYRLV
FT                   VEAGEKK"
FT   CDS_pept        complement(66045..66299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AbrB"
FT                   /locus_tag="PTH_0067"
FT                   /product="regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58248"
FT                   /db_xref="GOA:A5D695"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A5D695"
FT                   /protein_id="BAF58248.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIDEKDALEIYVDAEKIIL
FT                   KKYEPACVFCGNASDVQHYRGKMVCRECAIAMFENAKAM"
FT   CDS_pept        66516..66608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58249"
FT                   /db_xref="UniProtKB/TrEMBL:A5D696"
FT                   /protein_id="BAF58249.1"
FT                   /translation="MYPDRERGKVEARRGKLAEHGPGAALPKEE"
FT   CDS_pept        66705..68339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MetG"
FT                   /locus_tag="PTH_0069"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58250"
FT                   /db_xref="GOA:A5D697"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A5D697"
FT                   /protein_id="BAF58250.1"
FT                   /translation="MVPRELKLSPLAEGRGGSFLFKTGGVVCLSMSKGTFYITTPIYYP
FT                   SDNLHIGHAYTTVAADAVARFKKMTGYDTRFLTGTDEHGQKIERAARSRGEDPQEFVDK
FT                   IVAGIKLLWQKLEVDYDDFIRTTEPRHKKVVSAFFQKLYEQGDIYKAGYEGWYCTPCEA
FT                   FWAESRLEGGNCPDCGRPVELLREESYFFRMSKYAERLLRHIEEHPEFIQPASRRNEMV
FT                   SFIKSGLEDLCVSRTTFNWGIPVPFDPGHVIYVWVDALTNYISALGYGTEDDSLFKKYW
FT                   PADVHLMGKDIVRFHSVIWPILLMAAGLELPRQVVGHGWLLLESGKMSKSKGNVVDPLV
FT                   LIDKYGVDAIRYYLLRELPFGADGYYSEEALVERINKDLANDLGNLVSRSIAMVEKYFQ
FT                   GRVQPPGLPEGPDRELIDLAEQTPAAVEELMDKMDLSGALAAIWRLVGRANKYVDETAP
FT                   WGLAKDPSRADRLATVMYNLAESLRFITVMVSPFMPKLPARVWAQLGLENRPELHTWES
FT                   LVWGKLPANTCVKRGPALFPRIDTAGK"
FT   CDS_pept        68361..69131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TatD"
FT                   /locus_tag="PTH_0070"
FT                   /product="Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58251"
FT                   /db_xref="GOA:A5D698"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5D698"
FT                   /protein_id="BAF58251.1"
FT                   /translation="MVLFDTHAHLDDRSFEADREEVVRRAREAGVSCIVNVGFDLESSA
FT                   QSIALAEKYGMVYAAVGVHPHDAGKVKPGYLKELEKMAAHPRVVALGEMGLDFYRDLSP
FT                   RPAQRRVFQEQMALARKLEKPVIIHDREAHGEIMSILRREGPGPAGGVLHCFSGSWEMA
FT                   RECLAMGFYISIAGPVTFPNAPRLKDIASRVPLDRLLIETDAPYLAPVPHRGRRNEPAY
FT                   VVFTAEEIARLRGMKTEELARICAENGRKLFRIG"
FT   CDS_pept        69189..69728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BtuR"
FT                   /locus_tag="PTH_0071"
FT                   /product="ATP:corrinoid adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58252"
FT                   /db_xref="GOA:A5D664"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D664"
FT                   /protein_id="BAF58252.1"
FT                   /translation="MKSRQKKGLILVNTGNGKGKTTAALGMALRAWGQGMRVLVLQFIK
FT                   GGWKYGELKAAEKLAPGFEIRQMGEGFIKGENDSALDEHRHAAQQALKAAGEEILSGKY
FT                   DLIILDEILYALHFGLVSLDDVLALLAQKPEGLHLVLTGRNAPPEIIERADLVTEMREV
FT                   KHHFTSGVPAQKGIEF"
FT   CDS_pept        69787..70227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58253"
FT                   /db_xref="InterPro:IPR005361"
FT                   /db_xref="UniProtKB/TrEMBL:A5D665"
FT                   /protein_id="BAF58253.1"
FT                   /translation="MRQVPVTIAWMVNAFENSSEHSEYYLDMQTGDIKYFSPMDFPEHA
FT                   ELIKKLDRQTDRYIRLPKLDRELSVRVEREFAATVPDPSLRSLLENALANGLKFRNALM
FT                   EHEEERRRWYKFQNEKYEEYLRRWFREKGIELVDRPAGNIRV"
FT   CDS_pept        complement(70365..71090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivF"
FT                   /locus_tag="PTH_0073"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58254"
FT                   /db_xref="GOA:A5D666"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A5D666"
FT                   /protein_id="BAF58254.1"
FT                   /translation="MLSVTNLQVFYGTIQALHGISFEVREGEIVTLIGANGAGKSTTLR
FT                   TISGLIRPKEGKIEFNGQDITRMPAHKIVQMGIAHVPEGRKIFPNLTVRENLLMGAYTR
FT                   ADKAEIAASLENVFARFPRLKEREKQVAGTLSGGEQQMLAMGRGLMCKPKLLILDEPSM
FT                   GLSPILVEEIFNIIREINRGGTTVLLVEQNAFMALQIASRAYVLETGRIMISGPAYELQ
FT                   ADPQVRSAYLGSIGKADKA"
FT   CDS_pept        complement(71090..71863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivG"
FT                   /locus_tag="PTH_0074"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58255"
FT                   /db_xref="GOA:A5D667"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A5D667"
FT                   /protein_id="BAF58255.1"
FT                   /translation="MPVLEIKGLSKNFGGLRALSNFSLTLAENEIVGLIGPNGAGKTTV
FT                   FNLITGVFPVSSGSIEFMGKNILGMKPFKINRLGIARTFQNIRLFKQCSVLDNVRAVFH
FT                   SRTGYGLLDAFLHTPRYSAGEEQIYAKSMELLETMNLADRAGMTAASLPYGDQRRLEIA
FT                   RALAGEPRLLLLDEPAAGMNPAEASALVDLIRFIRDRFKLTILLIEHQMGVVMNVCERL
FT                   VVLDFGEVIATGLPEEVRTNQKVLEAYLGKGVTVA"
FT   CDS_pept        complement(71844..72869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivM"
FT                   /locus_tag="PTH_0075"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58256"
FT                   /db_xref="GOA:A5D668"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5D668"
FT                   /protein_id="BAF58256.1"
FT                   /translation="MGKRALNNSRQTAALLLLAAAIYTAVKILALSGLLTPYWLLVLDQ
FT                   ALITTIGALGLCIIYGFAGQFSLGHAAFYGLGAYTAGTISKLLGHGSLAWFIAALPAGM
FT                   LAAALVAFLIGLPILRLRSDYLGIATLGFGIIVKVGMDNSNKLFPVLGGATGMAGLPQV
FT                   ATFDFIFLFAVISVLLVRNFIHSSYGRSCKAIRDDEIAADIMGIDTTRSKVLAFVFGCA
FT                   LAGLAGALYAHRYPFIHPSSFDFLKSFDFLLIVVLGGLGSMTGTVITAIGWVFLLEGLR
FT                   FVLGQQFIEFRGVIYALILVITILSRPQGIFGGKELGIFTPPRARPAVPGKEGEHAGSG
FT                   N"
FT   CDS_pept        complement(72879..73763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivH"
FT                   /locus_tag="PTH_0076"
FT                   /product="branched-chain amino acid ABC-type transport
FT                   system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58257"
FT                   /db_xref="GOA:A5D669"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5D669"
FT                   /protein_id="BAF58257.1"
FT                   /translation="MEHFLDQVINGLQLGFMYALIALGYTMVYGIIKLINFAHGDVFMV
FT                   GAFIGYFGFAQWGLPLPLAVITAMAACAVLGMIIEKIAYRPLRYAPTISILISALGVSL
FT                   FLEYFCSLRFVFGPNYRVVQRPFEEVHWSLGGVTVTNIQVMVAAVVIVMLLMLQYLIYR
FT                   TKIGMAMRTVSYDHDAARLMGVNVDSVISITFAIGSALAAAGGVLYAIAYPQIQPFMGI
FT                   MPGLKAFTAAVLGGIGIIPGAVLGALIMGQVETLTAAFLSSQLRDAIAFAVLIIVLMVR
FT                   PAGILGKTNPEKV"
FT   CDS_pept        complement(73877..75034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivK"
FT                   /locus_tag="PTH_0077"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58258"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5D670"
FT                   /protein_id="BAF58258.1"
FT                   /translation="MFKNKWGPVLLILALGLVLVAAGCGGKEPAKSGEKVIKVGLVAPL
FT                   TGDVQSFGEYTKNGFLLALEEAGYKAGDYKIEPVIVDDRNDANEGANVATKLVSQDKVK
FT                   AIIGPVTTRSAIPVSDIANSNKVVMIASTATNEKVTVADGKRKEYVFRACFIDPFQGTI
FT                   GAKFALDTLKAKTAAVLYDQTNDYTIGLANYFKDNFTKGGGEIVAFEAYSKDDKDFSAV
FT                   LTNIARKNPDLLYLPDYHQKVSIIGKQAREKGIKAIFLGGDGWDSPDLDFATMSGGYFT
FT                   NHFSADDPRPEVKSFVEKYKAKYNTTPEFCAALSYDATKLLLNAIAKANSDDTTKIKDI
FT                   LKDTKDFPAVSGKISFDKDGNPTKAITILQVREDKKYNYVTTVNP"
FT   CDS_pept        complement(75252..76262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58259"
FT                   /db_xref="UniProtKB/TrEMBL:A5D671"
FT                   /protein_id="BAF58259.1"
FT                   /translation="MAGEGIARSQHFNAFGVPDIFTAPGNHHPAADHDHLIHRRRNYLS
FT                   GSKLAAHLPAVPVCDLPGAALRSFPPLLRYPGGTLRQGNGVPPFYLIRQRDLFHFQSGI
FT                   YPGHNYLRALDNCRLSPRRHLVLRPQDNAAFGKHVPHRLPSCPDLNFTAVNGHANLPGP
FT                   LHRHHHTFSQRCLRRRVHRVLIQQHNIQFFKNSPYRAGKSPHLGSLPVNNQHHRLFSPG
FT                   IAPGRQKKHGAKNRRPQEQNTPLPGFPCAAAVFSAGRFQQCAPVHSMPPSKKVRHFKCI
FT                   NHLPQFLYAAKAFFHIMLNGCRAGNFLAHFYFTTSWRFWVDFIFVAFDRLKNDQK"
FT   CDS_pept        75462..76481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0078"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58260"
FT                   /db_xref="GOA:A5D672"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A5D672"
FT                   /protein_id="BAF58260.1"
FT                   /translation="MNWSALLKPAGGEDGCSAGEPRKRGILFLWAAVFCAVFLLAAGGY
FT                   AWAKKSVVLVVDGKRTEVRTFSRTVGGVLKKLNIVLLDKDTVDPPPETPLREGMVVTVE
FT                   RAREVCVAVDGGEVQVRTRGQTVGDVLAECGIVLGPEDEVTPGREAAVVQGTKIVVSRV
FT                   NTALEVEEVPLAYEVKRRYTVALPQGATRIAQEGREGTERRTWQVTYRDGREVSRQLAS
FT                   AEVIAPPVDKVVMVGSGMVVSRGGENIRYSECIEMLASGYTFTGHNTAMGIYPSYGVAA
FT                   VDPGRIPMGTRLYVEGYGYATALDRGSAIKGDRIDLFFESREEAMNWGLKRVKVYVLN"
FT   CDS_pept        76598..77485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="KsgA"
FT                   /locus_tag="PTH_0080"
FT                   /product="dimethyladenosine transferase"
FT                   /note="rRNA methylation"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58261"
FT                   /db_xref="GOA:A5D673"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D673"
FT                   /protein_id="BAF58261.1"
FT                   /translation="MIVVASPAVVREIMRRHGISPRKSLGQNFLIDLNIIDKIIKAADL
FT                   TPADLVVEIGPGLGALTARAAARAGKVLAVEVDRGLLPALAEVLEGAGNVEIIRGDALD
FT                   VDFDRLAGEKTDGAFGRGGKKYKLLANLPYYLTGPLLLRLLLERFNFALMVVMVQLEVA
FT                   FRLTASPGTADYGALSVAVQYFTEPKVLFRVPRTVFYPPPGVDSAVVRLALRPAPAVTV
FT                   RNEDVFFQVVRAAFGFRRKTLLNSLAASGLGPGREAWLEVLKRAGIDPQRRGETLSLSE
FT                   FASIADSFLDAGGQ"
FT   CDS_pept        77510..77980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0081"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58262"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:A5D674"
FT                   /protein_id="BAF58262.1"
FT                   /translation="MYFISPSKGRMDFKEMMRDIVAYIKGLPTSSYKIIIGSDSQVKSD
FT                   TSFVTAVIVHRLGKGARYYYRKKTQRKIKSLRQKIFYETALSLEVGGMVHRYFAESGFD
FT                   DLSVEIHIDIGAYGESKDLIREVVGMVTGSGFRAKIKPEAYGASSVADKHTK"
FT   CDS_pept        complement(78053..78880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0082"
FT                   /product="hypothetical protein"
FT                   /note="containing partial COG1216 predicted
FT                   glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58263"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D675"
FT                   /protein_id="BAF58263.1"
FT                   /translation="MLAAVVPARNEEKSIKKIIDTLLGLPFDLIIPVINGCTDNSYGIV
FT                   MQIKSPRVAPLYFKEPLGIDVPRAMGAKAALDKGATAVLFLDGDMDGDIAASLAELIAK
FT                   VNNGADMALTNCYPGEYQVRTSLLASFVLKVRSKLNREINLEHVIGAASPSHGPHAVSR
FT                   RLLLSIPLKEVAMPPVTLALAAKKGLSVCVGTAVPHRALGSPDKDPAHSERIAETIIGD
FT                   CLEAIRVYKNKKRHRSLGAVEYNGYNSCRRWDLLDDFLGQAGPDKVVAAPEQA"
FT   CDS_pept        79007..79894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58264"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:A5D676"
FT                   /protein_id="BAF58264.1"
FT                   /translation="MGEIRKGDIVGRKSYNCDIFFKVKDFYSNAEGKVFVVLKGIHMRL
FT                   CADAPLDDLVRIDPGDLAAYLREQAVKSSEHMSRIFARREKEREYVFGRAVHQNKNGNA
FT                   GQVDGFDVPGTVLHIDGDGDYLDLCLTTYKQLQIPADGYCIDEEQQPKMVEELLRKHTP
FT                   DLLVLTGHDGFIKGREDFRDLNNYYSSRYFVEAVRAARRYEKSRDDLVIFAGACQSHYE
FT                   AILAAGANFASSPQRVMIHAYDPVFVVEKIAYTSIYDPISIKDIIAGTITGFDGIGGLE
FT                   TRGKYRMGIPKSPY"
FT   CDS_pept        79996..81003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58265"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A5D677"
FT                   /protein_id="BAF58265.1"
FT                   /translation="MERYFRAFKKTRAKLLSLENVVGIGVGYKQTGGENTGEPAFIIYV
FT                   EKKMPAAGLARGSVIPKRIDGLITDVIEIGRVKMLGVRTSRERPCQPGVSVGHYQSTAG
FT                   TLGAVVRDRETKKLMILSNNHVLANGSSESEAKAKQGDPILQPGPYDGGTLKDRIGVLD
FT                   RYVPLVKSAVKADCPVAAAVARGGTRLLNIFKQNYEVRFYKRLYGENTVDCALARLDSE
FT                   DLVKATILDIGDITGVSEAGPGDLVQKSGRTTGLTSGVVKSVNTTLQVEMKDDEKLWFS
FT                   DQVVADMVSQPGDSGSLVVDQERKVVGLLFAGSDKLTIFNRISNIMDCLGIDFI"
FT   CDS_pept        81100..81540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58266"
FT                   /db_xref="UniProtKB/TrEMBL:A5D678"
FT                   /protein_id="BAF58266.1"
FT                   /translation="MAYRSIVSGDVALAFLGDSIPAIGPVFKDREEAVKSARRYLEGIS
FT                   KLTGGMRETPVQIALNRQPDGRYSLVVESTCQSVGRLNNLDELFLKRFYKGLKKRLFIL
FT                   TCFVEETNGLDCLVLTEGLGAVIYAPNAGKNWLALRPGRRRQ"
FT   CDS_pept        81613..82023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58267"
FT                   /db_xref="UniProtKB/TrEMBL:A5D679"
FT                   /protein_id="BAF58267.1"
FT                   /translation="MGGNAYDAGGGGSARGPLQERRAERKKAEEEVFLAGKNLGYHLGY
FT                   SLGFESGFEKGYAEGSTFGYNNGFLAALKLGEGEPPSSEKPPEIYFCRALQKLVAGGLA
FT                   RVFLAGCAAREAEALFKILNISVAVLDKEINI"
FT   CDS_pept        82415..83362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0087"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58268"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR014258"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A5D680"
FT                   /protein_id="BAF58268.1"
FT                   /translation="MRLFRGHKFCCVATLLVIAVLAFLGAAWPAGAEAAAVTLTADEKQ
FT                   MVDLVNQARAQAGLAPLAADPVLTGLARIKAQDMASGGYFGHYSPTYGSPFDMMKKAGV
FT                   RYRYAGENLARASSVSSAFKALMNSSGHRSNMLSRNYDRIGVGIVSKGSYMIVVQMFTG
FT                   GQKVTAPSPQLQPQPQPQPQPQPAGSLNADEQKMFDLVNQERAKAGLSPLQIDMNLVKL
FT                   ARMKAQDMIDRGYFGHNSPTYGSPFDMMKAYGVRYSYAGENLAGAPTVESAHSSLMNSS
FT                   GHRANILNANYTKAGIGVVSGGPYGKMFVQMFTG"
FT   CDS_pept        83554..85095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0088"
FT                   /product="hypothetical protein"
FT                   /note="containing LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58269"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A5D681"
FT                   /protein_id="BAF58269.1"
FT                   /translation="MAGTERLKVNLVQGENRVQTVVRGQIEVPQAKPEIEKILSKDAKA
FT                   RTRNVSIVPDKVIVDGTLSLQVTYVAFKPDQSVHSMEGDVNFTAFVDVEGAMPGMDAVV
FT                   ELTVEDVSLTPSKRDPLKFDVAAVLSTFVKVTELDELEILTSVPEGNEALETQDIAVEH
FT                   MIGDKAAKQVIVSDQFEVPEEKPDVEKVLASKAEVEITGTKVLAGKVIVDGEVRLQILY
FT                   SAMDPRQTVHDLHHTIKFSDFVEVPEAQPGMNVQVRAEVEDADVQPVIDPKLTADAVIK
FT                   LTVFVSETRTLKDVPTKLKNEEGFEKRRLKVDREIGTGVTQVVLRETAAVPEEKPDIAK
FT                   VIETMVDKTEVTETNILKGKVLIRGYTDVEVVYVSTKPAQDVHALHQRLNFRTFVPVAG
FT                   AEPDMDVKVSVEPEFVSVDQLGADVHTEAVLRVKATVTEITQPNVYVPTGAAPTAAPTP
FT                   CPPTDYVVKAGDTLSKIAAAHGVSVQAILDINPQITNPDVIDVGQVIKIPCPAKG"
FT   CDS_pept        85227..86282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58270"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="UniProtKB/TrEMBL:A5D647"
FT                   /protein_id="BAF58270.1"
FT                   /translation="MPVEFFFTETQPVRCIEIKVPVVVAESDVEVVVDSVITLPELAMK
FT                   VDKIIASVRDLRGTPVFVEEEEQPTGPITVVELGEMEPRRVVVKKVVVSGTLHKQIFYV
FT                   NKNNEVKHTSEDLTFSKLVELKEPKRVHKRREVFIEFKNIDIDVNFELQRASRLHQTAV
FT                   LSVIAKAVEDRQIFVQTCPRPRECPAGNLVRDGGIEAWADATHPVFWGASNVAQTTMTH
FT                   SGSFAAEIGRLNPALPGSLFQMVTRGIVGGRQYRLTFWTMEDVFGANVSAFTLNAEVVF
FT                   YDHNGVQVGIGTQSLASTAIPDTAYSQVQFTTPVTDANVASALVRFSFTPAAGNTNTVK
FT                   IDSVMLECVPL"
FT   CDS_pept        86406..86708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0090"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58271"
FT                   /db_xref="GOA:A5D648"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A5D648"
FT                   /protein_id="BAF58271.1"
FT                   /translation="MINNMGAILTEVQRLQQELKNKTIEVSEGEGAFRVIINGHQEVLD
FT                   ARFSPSVLSPEKADELRAIVVRAVNRAINESKQMIKSELGKLTGGLNLPDISGLF"
FT   CDS_pept        86721..87341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58272"
FT                   /db_xref="UniProtKB/TrEMBL:A5D649"
FT                   /protein_id="BAF58272.1"
FT                   /translation="MLLAEEIKPGGAQDDPVSRILALQARYGMDQETMLIYISSVNLMS
FT                   ILNLIGRRYGGDVNLSVNAPAAAPALPPLTAGSAAGGGPALENLAGMLMKMLGSQGGGL
FT                   PGTQGINPALLMNLLGVLGGQNMDLGKLAGMLAGLMGAGVKPAPKPEQDGALPASSGGA
FT                   ADLGQEAGGGGVNNLKACADEKAVRRETPKIMKWDQLDDRKKA"
FT   CDS_pept        88096..88431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0092"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58273"
FT                   /db_xref="GOA:A5D650"
FT                   /db_xref="UniProtKB/TrEMBL:A5D650"
FT                   /protein_id="BAF58273.1"
FT                   /translation="MLATDSLVAIIKELKFSIFLSDSGLIASKKRNGSKRYKLFTSPFL
FT                   LISGVWLLIYFMSAPAILLQEKAGPLSGTVTRPRLRTGLPGIMAGLGERIRREVDWKWH
FT                   KNFCPWP"
FT   CDS_pept        88401..88847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0093"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /note="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58274"
FT                   /db_xref="GOA:A5D651"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A5D651"
FT                   /protein_id="BAF58274.1"
FT                   /translation="MAQKLLPLAIAALSGIAMAVQGSLNSALGKVVGLWETTFIVHVTG
FT                   LVLVSLLLLVCRDGDGSLANVFQAPWYTFLGGVLGVMIVYAVIRSMPRVGVAPATTAII
FT                   LGQVFTAGLVDHFGLFGMNKIPFSLYNVLGTLLMAGGAWLILKR"
FT   CDS_pept        complement(88837..89556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0094"
FT                   /product="predicted divalent heavy-metal cations
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58275"
FT                   /db_xref="GOA:A5D652"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A5D652"
FT                   /protein_id="BAF58275.1"
FT                   /translation="MAAIVLMGLIAGLGTCLGALLVALPGRPRPGVFSFLLGLAAGIMA
FT                   AVIVIDLVPSSLRYGSLPAALAGFLSGAGLMAILDLAFIFFSPSSARPGSFLKMGFLIA
FT                   AGIALHDFPEGLAIAAGYAAAKDLGPLLAFAIGLHNIPEGMACAAPLKYGGLSTGLILA
FT                   INAAISLVTPLGVLLGLAAVKVSGGLIGLLLAFAAGAMTYIILRELAPQSRRNSKFMAC
FT                   LGMAAGAAAIMALGLIF"
FT   CDS_pept        complement(89601..90158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0095"
FT                   /product="hypothetical protein"
FT                   /note="containing partial ErfK (COG1376), Uncharacterized
FT                   protein conserved in bacteria and partial LytE (COG1388),
FT                   FOG: LysM repeat."
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58276"
FT                   /db_xref="GOA:A5D653"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A5D653"
FT                   /protein_id="BAF58276.1"
FT                   /translation="MGENRGRTYGSHILINLATRQLSYFEGSRLMNTYPVGVGKPSTPT
FT                   PTGKYSIIEKIMNPGGVLGTRWMGLSIPGGRYGIHGTNNPSSIGGYVSNGCIRMFNEDV
FT                   EELFAKVEIGTPVEIIPGTGSQPENIQAGAQDGAKRHTVLPGESLWEIARRYGKSLESI
FT                   IAANNMANPDLIYPGQTIIIPS"
FT   CDS_pept        90265..91128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IspE"
FT                   /locus_tag="PTH_0096"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   2-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58277"
FT                   /db_xref="GOA:A5D654"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D654"
FT                   /protein_id="BAF58277.1"
FT                   /translation="MVITALARAKINLTLDVLGKRPDGYHEVEMVMQSIELHDRLEFRP
FT                   CAAGGISLAVEGADLPPGKENLVYRAAELLRAAGGVRAGAEIRLKKAIPVAAGLGGGSA
FT                   DAAAALVALNEMWNTGFSPAGLMELAEQLGSDVPFGLMGGTALARGRGERLERLFPCPP
FT                   LGLVLVKPPFGVSTAEVYRAFKPGLNPKKADAQAMVRAIKKGDAADIAACLGNALEPVT
FT                   VKMYPEVAEIKKKLMEAGALGALMAGSGPTVFGLTADLESARQVAARYRRTDEQILVTR
FT                   TFNPRL"
FT   CDS_pept        91213..91893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GntR"
FT                   /locus_tag="PTH_0097"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58278"
FT                   /db_xref="GOA:A5D655"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D655"
FT                   /protein_id="BAF58278.1"
FT                   /translation="MKQPRLVPIKLDNYKPLREMVFESLREAIILGRLKPGERLMEIQL
FT                   AEEMGVSRTPVREAIRKLELEGFVVMVPRKGAYVAGISLKDIADVFEVRAALEGLAAGL
FT                   AAERITEEEMDELERSLLKISTGVEEDFNAIVEGDSSFHDLIYKASRNQRLVSIITHLK
FT                   EQIHRFRMTSLSQPGRTKIALDEHKMIVEAICDRNVELAQTLAREHVENAEQSLLNALR
FT                   EEGS"
FT   CDS_pept        91893..92654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58279"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D656"
FT                   /protein_id="BAF58279.1"
FT                   /translation="MVDAVVLAGSTNDGPLKECSPACFEALIRIGRKAMVEYVVEALLA
FT                   AGGVRRVLVVGPAAELSDLLAGERVTVAGSAGGIMDNIEAGLNLLSGEKRVLLATSDIP
FT                   MLTPQAVDDFLNLCGDMSGDLYYPVISRQAVEKKFGSSKRTYVNLKEGVFTGGNLFLIN
FT                   PAKFKKCMENGKKLVSLRKSPLGLCRLLGLSFVVKFLMHTLTLGEVEKKVSQLLDVKGV
FT                   VVISEFPEIGVDVDKPGDLELAQKMIEVRRY"
FT   CDS_pept        92736..93773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0099"
FT                   /product="hypothetical protein"
FT                   /note="containing acetyltransf_1, Acetyltransferase (GNAT)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58280"
FT                   /db_xref="GOA:A5D657"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:A5D657"
FT                   /protein_id="BAF58280.1"
FT                   /translation="MAVEVVQAASEEAMKVFNAFPGAIYRNFFRAPRFPVMDRSSPHYD
FT                   PMFGRAEAQPFLALRNGLVMGRIAACINHALPDKQTGFFGYFESFDDPAVAGALLSAAA
FT                   GWLYARKRNRMIGPVDLTPHERLGLLVEGFGGRHQPGLPYNPPYYAALLERCGLKTEMN
FT                   LYAYRCGIGPPYPEKLVRVAARAGRNENLLLRQLNFNDLEGEGEIFSELHNGAMAEIWG
FT                   FVPLSPEEGTAILQRLKGIYDPGLVLVAEVDGRPAGLCLALHPGSRIPFARPDARLAVL
FT                   AVLPRFRFRGLEAALILECARRAWRRGITGMEFSLVSENNWMMNNIIQSMERARKNRVY
FT                   RVYKL"
FT   CDS_pept        93873..94943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NtrB"
FT                   /locus_tag="PTH_0100"
FT                   /product="signal transduction histidine kinase"
FT                   /note="nitrogenspecific"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58281"
FT                   /db_xref="GOA:A5D658"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5D658"
FT                   /protein_id="BAF58281.1"
FT                   /translation="MEDVAYLKALIRVCNAAVVAVDENMTVKVISPAAERLLNIKAGEY
FT                   VGRHLKNCPLLGRTSLKNLENTLKAGVEQEFDFCLCGKNDGKTMFRLFTRRLSDSKGKT
FT                   LGAALLIEVIDLNGDMERFIRNEKIKLIKQMSIGIAHHIRNPLTAVRGFIQIMREKSGG
FT                   DCVTGFNEFTSIALKELDRVNEVIGNLLLLADSSELKREAVNVNNLLKNVLFFIKGKAA
FT                   LSGIIVVEELSPDLPSVFVNQVQIVHVLFNILDNAIKFMPDGGRLKLRSYTVPAESKVC
FT                   IEVSDTGAGIPPANINKIFNPFFTTREDGMGFGLALANKIIHDHGGEIRVGSEEGKGST
FT                   FFVYLPVKNARLTVLE"
FT   CDS_pept        95015..95743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LytR"
FT                   /locus_tag="PTH_0101"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58282"
FT                   /db_xref="UniProtKB/TrEMBL:A5D659"
FT                   /protein_id="BAF58282.1"
FT                   /translation="MKPAGRTQIFAVFILLVVLLAGIWPNPAFAAAEDRENILVFWTEG
FT                   ERLKAVTLVCVQGSRGPLGIVAIPVHVRLDGGGTGWTVAEAYAKLGREGLTAQLEYLFR
FT                   TPISRYLSVDQATLDKVSSIIGPVMMGDRPATMAEVFEGTYTGGEIEPQAEIRCLAARL
FT                   TEPRVVVKAPQLVWLFSSEVKTNLGYRNIWNIYRAVAEKGPGILNKKALTGKDCWAGSR
FT                   RYREVPPEAWVNVLNEVSRA"
FT   CDS_pept        96181..97401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvA"
FT                   /locus_tag="PTH_0102"
FT                   /product="threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58283"
FT                   /db_xref="GOA:A5D660"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A5D660"
FT                   /protein_id="BAF58283.1"
FT                   /translation="MVESKLTLEKIEEARHRLAGVAHRTPLDFSATFSEMTGNDVFLKL
FT                   ENMQKTGSFKIRGAYNKVMSLDEKDRGRGVIAASAGNHAQGVAYAAARAGLPCTIVMPA
FT                   GAPISKIAATRGYGSEVVLAGGGYDEAYRLAVELREKSGAAFIHGFDDVDVIAGQATIA
FT                   LEILEDLPGVEAVLVPVGGGGLIAGISFALKTLRPEVRVVGVQAAGAPAMLLSWRKGRL
FT                   VETAHASTFADGIAVRRPGRVAFGIIRQCVDEIVTVDDEETAGAILMLLERSKLVVEGA
FT                   GAVGLAALVYQKTALRNARTVVVLSGGNIDVNILSIIIERGLVKTGRYARLRAVLSDEP
FT                   GNLGKLLAAVARTRANVISVAHNRIRPGVPLKQAEVELSLETRNKEHIGQILEVLARAG
FT                   YRPEIIA"
FT   CDS_pept        97506..97760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SpoVG"
FT                   /locus_tag="PTH_0103"
FT                   /product="Uncharacterized protein"
FT                   /note="involved in the regulation of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58284"
FT                   /db_xref="GOA:A5D661"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:A5D661"
FT                   /protein_id="BAF58284.1"
FT                   /translation="MEVTDVRVRKILTEGKMKAIVSVTLDNSFVIHDVKVVEGQNGLFV
FT                   AMPSRKTPDGEYRDIAHPITASARELIQTAVLQAYAEAT"
FT   CDS_pept        97984..99357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GlmU"
FT                   /locus_tag="PTH_0104"
FT                   /product="N-acetylglucosamine-1-phosphate
FT                   uridyltransferase"
FT                   /note="contains nucleotidyltransferase and I-patch
FT                   acetyltransferase domains"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58285"
FT                   /db_xref="GOA:A5D662"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D662"
FT                   /protein_id="BAF58285.1"
FT                   /translation="MDLAAVILAAGRGTRMKSKLPKVLHRVCGRPMLSYIVNAVAAAGI
FT                   KKIVVVAGYGAEQVAREVEGLAQVALQAEQLGTAHALLQAGPFLSGFAGKVLVLCGDTP
FT                   LIEAGTLAKLAGFHRTAGAAATLLTAEPDDPAGYGRVIRDGRGNVIKIVEEKDASPAEK
FT                   LIREINTGIYCFEAAGLFDALKGIRPANAQGEYYLTDIVEIYVRAGLAVAAFKLENPVE
FT                   VTGINDRRQLAEVEKYLRRRVLEDLMQSGVTVLDPASTFVDGTVRVGRDTVIYPFTFLE
FT                   GSTIIGEDCVIGPGSRLVNAVVGNGVSVQNSVVIESQIGDCCSIGPFAYLRPETRLGRN
FT                   VKVGDFVEIKKSVIGDGSKVPHLSYVGDATVGAGVNIGCGTITCNYDGRNKWPTRIGDG
FT                   AFIGSNTNLVAPVEIGAGAVTGAGSTITKNVPDGALAVERARQVLVPDWAAKKRDKKV"
FT   CDS_pept        99402..100349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PrsA"
FT                   /locus_tag="PTH_0105"
FT                   /product="phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58286"
FT                   /db_xref="GOA:A5D663"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A5D663"
FT                   /protein_id="BAF58286.1"
FT                   /translation="MSTRSKRLRIFSGNANPALAEEIAQYLGVTVGEAKVSRFSDGEIH
FT                   VKINESVRGADVFIIQPTCSPINEHLMELLIMIDALRRASARRITAVLPYYGYARQDRK
FT                   TRARDPITAKLVANLLTASGARRVLCMDLHAGQIQGFFDIPVDHLPGVPILAEYFLQSG
FT                   LKNVVVVSPDLGGVTRARDLAERIGASIAIIDKRRPEPNVAEVTNIIGAINGKTVVMID
FT                   DIIDTAGTITKGAEALKKWGASEIYVCCTHPVLSGPAVSRLAEAPIKEVIVTNTIPVPK
FT                   EKMIDKIKVLSVAPLLGEAIIRIHEDLSVSKLFD"
FT   CDS_pept        100518..101909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AraJ"
FT                   /locus_tag="PTH_0106"
FT                   /product="arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58287"
FT                   /db_xref="GOA:A5D626"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5D626"
FT                   /protein_id="BAF58287.1"
FT                   /translation="MNGDGSVKKYALITVSLASFLTPFMGSSINLAVPSIGREFDSGAV
FT                   LLSWVVSSYILASAAFLLPFGRLADIFGRKKIFVIGLLAFTLFSLLCGLSWSIEALIAF
FT                   RVLQGIGGAMIFGTAVAILTSVFPPQERGKVLGINVATVYTGLSLGPVLGGAMNQQLGW
FT                   PSIFYFNAALGLFVVLLTALKLKGEWAGARGEKFDLGGAVLYAAGLVAFMYGFSSLATS
FT                   TPAKFILAAGLLLIAVFVGHEAREEQPMLDMRLLSKNVPFAFSNLAALINYSATFAVGF
FT                   LLSLHLQVVMGYSSQTAGLILLFQPVVMALLSPLAGTLSDRIEPRIVASWGMGLTALGL
FT                   AVFAFLSASTPVWLIVLNLMLLGTGFALFSSPNSNAIMGSVEKKFYGVASSTMGTMRLI
FT                   GQSVSMAIATLIIDLHIGSAQLSPAIAGLIVTSVKMSFAIFAVTCLGGVFASLARGNVN
FT                   AGEKA"
FT   CDS_pept        101906..103174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AraJ"
FT                   /locus_tag="PTH_0107"
FT                   /product="arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58288"
FT                   /db_xref="GOA:A5D627"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5D627"
FT                   /protein_id="BAF58288.1"
FT                   /translation="MNGLKIALRSFQYRNYRLFFGGQSISLIGTWLQNIAMSWLVYRLT
FT                   NSALLLGVVGFAGQFPALFLTPFAGVLADRWDRRSILVITQTLFMIQAFTLACLVLTGH
FT                   ISIRHIIPLSVFSGLVSAFDVPARQSFVVEIVEKKEDLVNAIALNSSMFNGARLIGPSV
FT                   AGILISAVGEGFCFLLNGISYLAVITALLAMRVRLKKPAKGGPGVLQGMREGFAYAFGN
FT                   RPIRYIILLLALVSLVGMPYSVLMPVFAGEILHGGPHTLGFLVGFSGMGAISGAVYLAS
FT                   RKDAGGLIRIIPLAAGIFGAGLAVFSRSGILWLSLFLMLFTGFGMMVQMASSNTVLQTI
FT                   VDDDKRGRVMSFFSMSFMSISPFGSLLAGSLASRIGAPDTLLIGGACCILGAIVFAAKL
FT                   PVLKEALVLQGNIRGCSDKDYSP"
FT   CDS_pept        complement(103207..103326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58289"
FT                   /db_xref="UniProtKB/TrEMBL:A5D628"
FT                   /protein_id="BAF58289.1"
FT                   /translation="MVKAISLFTPFLALRWLLQKLFDRTLPMSYRQVPFLVKI"
FT   CDS_pept        103313..103879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0108"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58290"
FT                   /db_xref="GOA:A5D629"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A5D629"
FT                   /protein_id="BAF58290.1"
FT                   /translation="MAFTISGSFYDGRSQTWELIKSFGEAVRFQEQGGAACLLVFLAGV
FT                   LIMLAVMCFLNYRRREDFVLFTETAAGEQKREWFRLRLDRDVLYAPENSTDFSRGKIRD
FT                   LSAGGIQFAAGRELKANDMLQLVIDLSPYMKLNLAGRVVWTAENPEGGENSRFLTGVQF
FT                   VGMTPAEQDRLARIILWEQQAQMQK"
FT   CDS_pept        complement(104046..105914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HtpG"
FT                   /locus_tag="PTH_0110"
FT                   /product="molecular chaperone"
FT                   /note="HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58291"
FT                   /db_xref="GOA:A5D630"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:A5D630"
FT                   /protein_id="BAF58291.1"
FT                   /translation="MPANPLKEQFETREFQAEVKQLLDIVVNSLYTEREIFLRELISNS
FT                   ADALEKFRYESLVNREAAGGEDLPLEISIELDGRENTLTVADTGIGMTREELVENLGTI
FT                   AHSGSKQFIRELKENGKKDVNLIGQFGVGFYSAFMVAKRVRVLTRSYRPGADGCEWISD
FT                   GSGSYELGPAEGLRRGTRVILELKEDAREFTGAEKVKEIIRQYSSFVPFPIKVNGEQVN
FT                   TVQAIWMRNKNEVTEEEYKEFYKYIAGAFDEPLYRLHFTADAPLTINALLYVPKQNLER
FT                   FGFGRLEPGVNLYCRKVLIQQHPEGLLPDWLRFLKGVIDSEDIPLNISRETMQDSALAA
FT                   RLQKVITGRFLKFLSEQAREDPEKYSEFWNTFGIFLKEGTVSDFTHRNDLAKLLRFESS
FT                   ETEPGKLTSLSEYVERMKDGQKDIYFINGPSREAIECGPYLEAFRACGFEVIYTYEPVD
FT                   DFVLSTLGEFEGKKLLSADNAALELPALDGGQEEPLDGNELQSLITWLKEVLGDKAGEV
FT                   KSSRRLSDSPAILTNLDGHMTSSMERVMQAVNKDFRAAGRKAFEINPRHRLIKRLASLR
FT                   KENPGLAGCVAEQIYDNAVISAGLAVNPRDMVERIYRILESTLVDR"
FT   CDS_pept        complement(106173..106955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0111"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58292"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A5D631"
FT                   /protein_id="BAF58292.1"
FT                   /translation="MRKSKKFASMPVISLEEGRQIGTVKGLVVDPAAKKVAALIIEQKG
FT                   WFKEHRYVPYNKIHSTGTDAITIEKTSGVEKAAGLPEIIKLLKEKVTVTGARLVAENGT
FT                   VLGYVDEYYVDLDTGTIAGLEFSGNFLNSVIKGRAFLDIAYVRTLGKEVVVVTNEGLNN
FT                   IFKLEGGLQETVKTIRESTGQLWENTVQKTREISTSINKSLEKVKKDRRFGFRPKEETP
FT                   PQAGSGEEQKSPESSAPAHDPAESAPPPGSNGEARKDV"
FT   CDS_pept        107066..107695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplY"
FT                   /locus_tag="PTH_0112"
FT                   /product="ribosomal protein L25"
FT                   /note="general stress protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58293"
FT                   /db_xref="GOA:A5D632"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D632"
FT                   /protein_id="BAF58293.1"
FT                   /translation="MTAELEAQARTEKTRSFTHSLREKGMIPAVVYGKNVGSLSIAVDA
FT                   GELQKILEGAGSNALIRMKIKENGKIRKHNVLVKEVQRDPVRRELIHADFHQVSLKDRV
FT                   HATVPVHLTGSAAGTVEGGVLTPLLRRVEMECLASEIPEAITVDVSGLRIGDTITVADL
FT                   PLPPGVRALEDPEAPVVTVTAGERPAAEPAAAPGAAPAAGPEEAEE"
FT   CDS_pept        107845..108342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PTH"
FT                   /locus_tag="PTH_0113"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58294"
FT                   /db_xref="GOA:A5D633"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:A5D633"
FT                   /protein_id="BAF58294.1"
FT                   /translation="MVIDRLAPALGITVGKRMFKALVGQGRIDGEKVVLAKPQTYMNLS
FT                   GEAVGALLNWYGLTPADLIVVYDDLDLPPGKLRLRAGGGAGGHKGVQSVIRVLGTENFA
FT                   RVRVGIGRPAEPGLDPAGYVLSRFDRDEVEIMREALDLAAAAVLCMVRDGVDRAMNLYN
FT                   GR"
FT   CDS_pept        108410..108811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0114"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58295"
FT                   /db_xref="GOA:A5D634"
FT                   /db_xref="UniProtKB/TrEMBL:A5D634"
FT                   /protein_id="BAF58295.1"
FT                   /translation="MLMSLVLAVPAAVLAWLANCLLGGLPLKKKVIVASFVEEALKTLP
FT                   AAFFSASIFLTHLFFGAAEGIWEILAGRRNGFYAGLSALASHSLFGCITLFACDFYGVV
FT                   PALAAGYLAHALWNYAVLEYLPARRDGRR"
FT   CDS_pept        108839..109072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0115"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58296"
FT                   /db_xref="GOA:A5D635"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:A5D635"
FT                   /protein_id="BAF58296.1"
FT                   /translation="MKLLYVCECCDAVVGELSLPVPPAGGAPAGLTGLDREGIIKPGEE
FT                   GERVILTSLCDDCRETLYGGPGSTFFNGPALH"
FT   CDS_pept        109170..110795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="UvrB"
FT                   /locus_tag="PTH_0116"
FT                   /product="helicase subunit of the DNA excision repair
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58297"
FT                   /db_xref="GOA:A5D636"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A5D636"
FT                   /protein_id="BAF58297.1"
FT                   /translation="MRGLLKPLQAVPEFIGLIRGLENNFRQQAVFGLSGSQTSYLYAGL
FT                   AGVAAPLPVLVVTPGEREACQMADEIAGLLPGAAVKLFPVWQLLPFQIIAHSKEVEAQR
FT                   LQVLESLVRGERAVVIAPAEAVLRRLVPPQIFGRAALRLATGERAGRDDLIRRLLAMGY
FT                   ERVGLVEGRGQFCLRGGILDVFPMTAHRPVRIEFFDDEVDSIRRFNAATQRSEEKIDEV
FT                   EIGAARELIVEDKAWENFRRALKKEYRAQALKLEKAGETGAARQLAEKFAETAEGACGY
FT                   FNGIENFLPYFYREVITILDYLPAGAPVIVDDPVRVKEMIDSIQRERMETYSDLLSRGR
FT                   VLPSQFLAYAGWSDIQGGLSRHPVIYSSLLPRQPDFVRPQQTFSLPWKAMPSFLGNLKM
FT                   LAEEIRHWRKSGYATVILVSSHHRAQQILSSLKDHGVDAFYASSPEGHVRSGNVLVAVG
FT                   SLSGGFELPDCRLAVVTERDIYGQFRRVKRERKRVGRMAPFVDLRVGDYVVHANHGIGQ
FT                   YLGVVPLTIGGHSQEKGITLLGSK"
FT   CDS_pept        110995..112773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0117"
FT                   /product="hypothetical protein"
FT                   /note="containing SrmB, superfamily II DNA and RNA
FT                   helicases (COG0513) and TRCF domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58298"
FT                   /db_xref="GOA:A5D637"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="UniProtKB/TrEMBL:A5D637"
FT                   /protein_id="BAF58298.1"
FT                   /translation="MRGHAFGPDTVWQKELEEAFPYEETPDQLRAVEEVKADMERPRPM
FT                   DRLLCGDVGYGKTEVALRAAFKAVMDGKQVAILVPTTILAQQHYTTFRERLARFPVNIE
FT                   VLSRFRTAREQRQVLQGLEQGTVDIVIGTHRLLQDDVRFKALGLLVVDEEQRFGVAHKE
FT                   RLKMIRKDVDVLTLTATPIPRTLHMSLIGVRDTSILETPPEDRYPVQTYVLEEDPVLIR
FT                   EAIRREMNRGGQVFFVYNRIMDLDQVALWLQELVPEARIAVAHGQMKEDELEQVMLDFI
FT                   DRRYDVLVCTTIIENGLDISNVNTLLVKDANMMGLAQLYQLRGRVGRSNRLAHAYFTFR
FT                   KDRVLGEAAEKRLAAIREFTELGSGFKIAMRDLEIRGAGNILGAEQHGHIAAVGFDLYC
FT                   RLLEEAIREARGIDTVQPVETSIELPVEAYIPDSYVPDVNQKVEIYKRIAGLVSLDELS
FT                   DLAEELVDRFGDLPPAVENLLAVAKVKVLAGRFKIKAISLLPGQLRLLFAPGHPLTGEV
FT                   LVALSEKYRNMVKFNNAGDEFEIKLKVAGGCQREPASLLGRLERFLLDLEGREDHLSAA
FT                   SGAGSAPVQKIPPSFA"
FT   CDS_pept        112829..113803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SurA"
FT                   /locus_tag="PTH_0118"
FT                   /product="parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58299"
FT                   /db_xref="GOA:A5D638"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A5D638"
FT                   /protein_id="BAF58299.1"
FT                   /translation="MGKSTRQFIAAAVFLVIVAVLSGCSSRAVATVNGEKITAGELSQR
FT                   LEEIKSNLEKQGFDFSGDKGKAFMESLRQETLEQMINTRLMLQEAKKLGPLTPEQVQEI
FT                   IKPLKEQFSSAEEYQDFLAQIKMSEEEAAYILNLQEQVTGDVAPPAEADIKKYYDEHLE
FT                   EFSRPEQLQVRHILFFVDGGDKGYPVQHTDAEAREMAEEAIAQLKAGKDFAELAREKSE
FT                   DSGTRADGGLYTFSRDEAVKEFADAAYALKVGEYTADPVKTEYGYHIIKLEKKIPARQD
FT                   PFEEVRQDIAGLLLEQARQEKFGEFMQQAKDRAEIVNKLAGKE"
FT   CDS_pept        113948..114508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AbrB"
FT                   /locus_tag="PTH_0119"
FT                   /product="regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58300"
FT                   /db_xref="GOA:A5D639"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A5D639"
FT                   /protein_id="BAF58300.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDREGEVI
FT                   LKKYSPIGELGDFAKEYADSLYEALGHITCIADRDIIIAVSGAPKKEFLNKPVGAAVEK
FT                   AMEERKAVVINNPGEDPFCKDCMIVEDGECKYSSEVIAPIIAEGDPIGAVILASKEPNV
FT                   KMGEMELKLAETAAGFLAKQMEQ"
FT   CDS_pept        114514..116262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0120"
FT                   /product="conserved protein"
FT                   /note="containing tetrapyrrole methyltransferase domain and
FT                   MazG-like (predicted pyrophosphatase) domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58301"
FT                   /db_xref="GOA:A5D640"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5D640"
FT                   /protein_id="BAF58301.1"
FT                   /translation="MACEGHFPLLFSFLGAGFPGLFCTNETCFFERRLSAVMPLQARIT
FT                   IAGLGAGSPGEITLGVWEALKFSPLTFFRTERHPVVRWLREKGISFSTFDYIYEEEQSF
FT                   QQVYRRIAEKVLEAARRGQVLYAVPGHPLVAEESVHLIVEQAEQDGLSVHILPAASFLD
FT                   ALCTALRLDPGRGLQVVDGLTLDRRRPSPGMAAVVTQVYSPLVASDVKLSLLEIYPAGH
FT                   PVTVVRGAGIPGEERIRTVPLFELDRLDGIDHLTSVFVPPLAPQAEVAGDGGQASGGRE
FT                   GPEEPQEVEVIRTCEKSILDPAEDGVEEGCPAPDGDGGCRFPLDPLVDIMARLRGENGC
FT                   PWDREQDHRTLKPYLLEEAYEVIEALDEEDMYKTCEELGDLLLQIVFHAQIAAENRHFD
FT                   INDVIAGISEKMIRRHPHVFGSARVRDSGEVIRNWERIKAKEKGRRESILAGVPAFLPA
FT                   LVRAEKLQEKAAEAGFDWPDYRGALEKVREELDEIGAVVSAGNKAQIEKEVGDLIFSVV
FT                   NLARLLGVNPEAALTGACGKFVRRFQHIEEMARAAGRDLSLCTLTELDEWWEEAKELEN
FT                   QEKNKG"
FT   CDS_pept        116343..116618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HimA"
FT                   /locus_tag="PTH_0121"
FT                   /product="bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58302"
FT                   /db_xref="GOA:A5D641"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A5D641"
FT                   /protein_id="BAF58302.1"
FT                   /translation="MNKAELISNVAEKTELTKKDAEKAISAFLDTVGEALARGDKVQLV
FT                   GFGTFEIRERAARKGRNPQTGEEINIAAARVPVFKAGKALRDAVLK"
FT   CDS_pept        116686..116940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0122"
FT                   /product="ribosome-associated heat shock protein"
FT                   /note="implicated in the recycling of the 50S subunit (S4
FT                   paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58303"
FT                   /db_xref="GOA:A5D642"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A5D642"
FT                   /protein_id="BAF58303.1"
FT                   /translation="MRLDKFLKVSRVIKRRTLAKEVCDRGQVEVNGRPAKAGTEIKPGD
FT                   VLAINFGHRLLRLEILSVQENVPAKLAAELYRVVEDRVT"
FT   CDS_pept        116991..117935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SpoIID"
FT                   /locus_tag="PTH_0123"
FT                   /product="sporulation protein and related proteins,
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58304"
FT                   /db_xref="GOA:A5D643"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:A5D643"
FT                   /protein_id="BAF58304.1"
FT                   /translation="MSRYPLAKTALILLAACLLTAGCAKRPAPAPKPALQEEPTISLYD
FT                   NKTGEKKNIKIEEYIQGVVAAEMDTKWPVNALAAQAILARTFTMENIKAGRVRQLHGTD
FT                   ASTSVEEFQAYEPSKINDNVRQAVERTRGEVITHGDGFIHAWFSACDGGISATAEEGLA
FT                   YTREPTPYVKGGVQDGCLSITEPQNRAWEARIPAEQVRAAVKKITGQDPGPLTSASIVK
FT                   KGPSGRAEQIKIGNATVGGPALRLALGSEKMRSTLLSEIRVEGGRVVFKGKGFGHGVGM
FT                   CQWGARLMAEQGKSPEDIINFYFKDIKIERQWK"
FT   CDS_pept        118293..118565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58305"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:A5D644"
FT                   /protein_id="BAF58305.1"
FT                   /translation="MVEQAAHSISINGRKQLVLEGVRHVGSFDESEIVLETSMGALILK
FT                   GEGLHITHLNLETGSFAAEGFFNSVQYVESREKGKGKSLLKRILK"
FT   CDS_pept        118596..119168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0125"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58306"
FT                   /db_xref="GOA:A5D645"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A5D645"
FT                   /protein_id="BAF58306.1"
FT                   /translation="MQGVVFLESLAGQVKSFAATVAAGAAAGFCYDYYRAVRKAFRLKK
FT                   AGSLLGDALFWLAVTAVVFLMLLWGNWGEVRLYVFIGLGLGALAYFRLLGSTARRLMHY
FT                   KFFLLFKAWKLLTRAVLLLWAATLFPFRLLALILSYPLKCLRGPSVKARSRLKSAFHRV
FT                   AAKGAGPAGRLKARFSRLAFWKRNKQI"
FT   CDS_pept        119312..120244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0126"
FT                   /product="predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58307"
FT                   /db_xref="GOA:A5D646"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A5D646"
FT                   /protein_id="BAF58307.1"
FT                   /translation="MIRGASTQAERVSGINLPLKFYLKLIISAGLLAWVLSRVPLPSLW
FT                   NAVNGCGWPWIVLSFAVVNACMLVSALKWQLLLNAQHIRLSFTRVLSFYYVGLFANNFL
FT                   PSSIGGDAMRIYDAARASGKAGEAAASVVMERLLASLALAFTAAVAVMLRPDYRGNGLF
FT                   LWLTGGIAVFCLAATVILFAWPFNENGPVGRWLCRLSRYKKEPQVLFGVMLLSFLFQGL
FT                   LVVSNIFIFKAFGVDIPLPVHFFYIPLIMAATMLPASVNGIGIREGMYAMLYGLAGVEP
FT                   ATAVACSLLFWALVTVASLAGGIILAARK"
FT   CDS_pept        120258..120710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0127"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58308"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A5D611"
FT                   /protein_id="BAF58308.1"
FT                   /translation="MQDLYEEVRSRAGRYFDEGYNCAQAVALSNIEALKGRADGVRQLA
FT                   AGFGRGMNAGCACGAVCGGILAIGCLLAGPETKGFDETVEEAAAELHRRFAAEFGLVCC
FT                   KGLRKKLSPFKNARCRNITVTAAAITLDLLLARKKPSPAPVGVHAL"
FT   CDS_pept        complement(120678..121370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0128"
FT                   /product="predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58309"
FT                   /db_xref="GOA:A5D612"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D612"
FT                   /protein_id="BAF58309.1"
FT                   /translation="MASDLKISVIIPTYNEAATIGRTTGHLKARRDVHEIIVVDGGSTD
FT                   GTPALAGKGVQLLRAPRGRASQMNAGARAAAGDVLLFLHSDTSLPDDFSRQIELALSDR
FT                   QVAGGAFKVKFDQPGLFFALTALGSNLRASLTGIYFGDQAIFARREAFFEAGGYPPIEL
FT                   MEDWEFSRRLRQVGKTVLLPGPVTTSARRWLIYGRWRTTWLMHKIKILYILGVSPSRLK
FT                   SMYTDRRR"
FT   CDS_pept        121470..122138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0129"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58310"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D613"
FT                   /protein_id="BAF58310.1"
FT                   /translation="MDRPALVIMSRVPSPEGKSRLSGILTPEQRELLQWAFLLDTLDKV
FT                   RTVQGAVAFIAAAPADRLEELRRAVGGKAEVVLQPAGDLGGRMLAVSRHIFNLGYSPVV
FT                   LIGADVPALPPACLSRAIELLGRYQMVFGPSPDGGYYLAGARHPEERIFKDIDWGSGSV
FT                   LEKTLAVCKRCGLTWCLLEPLEDVDRPADLLELAGRVKRGQFAPGAEPFRTIKFIKENF
FT                   "
FT   CDS_pept        complement(121566..122516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58311"
FT                   /db_xref="UniProtKB/TrEMBL:A5D614"
FT                   /protein_id="BAF58311.1"
FT                   /translation="MAHIDLQRLKTEFVADIFHLHAVHQGGSPSDSGSHMDCFRHLLLV
FT                   RTLLQGILSVGLYAVRALQSMGHGKGYKRFLPRAQGPLFEHSTVISHKLFPQMRGFFTH
FT                   RGKPGQVGRVVITVHRRFLLFFLKIFFYKFNCPERLRTGRKLASLDPSGQLEKVCRAVN
FT                   VLQRLQQAPGQAAPFTDGKGLFQDAPAAPVNIFKDPFLRMPRAGQVIAAVRRRAKNHLV
FT                   PAQQLNCPAKTGRRQGRDIRSYQDNRRIAKVKYMPAYCQHAPAQIARRLENNFRFASNG
FT                   PPQLLQAVCRGSGNKGYCPLHGPDLVQRVQQEGPL"
FT   CDS_pept        122160..122492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0130"
FT                   /product="Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58312"
FT                   /db_xref="GOA:A5D615"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR026445"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A5D615"
FT                   /protein_id="BAF58312.1"
FT                   /translation="MDSYYNPADLARFATVGEEAPHLWEKFMAYYSAVFEEGALSAREK
FT                   ALIALAVAHALQCPYCIEAYTQDALEKGSNQEQMTEAVHVAAAIRGGAALVHGVQMKNV
FT                   CNKLGF"
FT   CDS_pept        122508..123557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0131"
FT                   /product="predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58313"
FT                   /db_xref="GOA:A5D616"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024521"
FT                   /db_xref="InterPro:IPR026351"
FT                   /db_xref="UniProtKB/TrEMBL:A5D616"
FT                   /protein_id="BAF58313.1"
FT                   /translation="MSHGLKRQRQLPGGAATQLYRLRNIGRLVPFKQRMIKAGLFPLKS
FT                   TGISVLQVNIGRVCNLSCRHCHVEAGPDRTELMSRETILSCLEALAGADIPVLDITGGA
FT                   PELNPHLPWLIEEAARLGRRVMVRTNLTVLDADEFAHLAEFYAFHRVEVVASLPYYLEK
FT                   NTDRLRGRGVFEVSVKVLRRLNRLGYGRENRLQLNLVYNPGGAFLPPGQHAIEQEFRRE
FT                   LLRRYGIVFNRLFTITNVPVGRFLDFLQASGNLERYMERLAGLFNPAAAARVMCRDQVS
FT                   VGWDGRLYDCDFNQMLGLTCSPEAPGRISEFDRAALQNRRIVMENHCYACTAGAGSSCG
FT                   GALAGGGKA"
FT   CDS_pept        123588..124310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0133"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58314"
FT                   /db_xref="GOA:A5D617"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A5D617"
FT                   /protein_id="BAF58314.1"
FT                   /translation="MKEFNRTAWLKAGILAVLAALYFFVEPLQAAVKRVVFILSTVDVA
FT                   AVKHYILSFGIWAPVASFTLMVFQSVMAPLPAFVITFANAALFGWARGAVLSWSSAMCG
FT                   AAVCYWIARFYGRSAVERLTSKLALEEVDRFFERYGKYAIIVARLLPFVSFDVVSYAAG
FT                   LTSIGFWEFFWATGLGQLPATLVYSYVGDMLVGSVRTFVFGLLTLFSLGIVAAAARKFY
FT                   RDRHNRQPARVAESPGEK"
FT   CDS_pept        124313..124681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0134"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58315"
FT                   /db_xref="GOA:A5D618"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A5D618"
FT                   /protein_id="BAF58315.1"
FT                   /translation="MPFGPMSRKFQKEQRILGNSFWGGLPAFFLSVAGFVAGSLYAYAA
FT                   GLVLGLIPSNLGWFRAERVESFISGYGHYAALLFYAIPFPPLGLVSYLAGFLALDIKKF
FT                   LLACIIGQILGYFWCLRL"
FT   CDS_pept        124806..125768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SseA"
FT                   /locus_tag="PTH_0135"
FT                   /product="rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58316"
FT                   /db_xref="GOA:A5D619"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A5D619"
FT                   /protein_id="BAF58316.1"
FT                   /translation="MNRLLRMSKNRRIFVYLAVIGVLLFLVLVAAGCGGKTAGTAPPKE
FT                   VKPLDKEMEPYYVDVAWLKENLSKVVVLDARSEKEYNEGHIPGAINVTWQSLSNMTPKQ
FT                   GEVGWGVVLPQEELAKKIGSFGIDGSKPVIIYNDPKGLGEEGRVLWMLRIAGLKDSRML
FT                   NGGFPAWKAGGGEISKEVPAVKPVDFKITSPDNSLLATTDYIRNNMSKIKLVDARSIEE
FT                   YTGKTNHGEKALGHIPGAISIPYNNAYNSDGTIKSIAELKEIFSKAGLDPSDDIVVYCT
FT                   VGIRSGFLTEILRMCGYEKAKNYNASFSEWAGLGLPVEK"
FT   CDS_pept        complement(125991..126203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58317"
FT                   /db_xref="GOA:A5D620"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A5D620"
FT                   /protein_id="BAF58317.1"
FT                   /translation="MNSVKIISTDESAVRKALKTLADGLKKRPEVLAVYLCGSRAKGNY
FT                   TPYSDVDLLIVVEEDGRKPHDRVPL"
FT   CDS_pept        complement(126172..126564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0137"
FT                   /product="uncharacterized conserved protein"
FT                   /note="related to C-terminal domain of eukaryotic
FT                   chaperone, SACSIN"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58318"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:A5D621"
FT                   /protein_id="BAF58318.1"
FT                   /translation="MPERSKDWMRQAEADLRHAVNSHRAGDFEWACFAAQHAAEKAVKA
FT                   LFQKLHLDACGHTVSILLSNLPAGISVPGHLIDKAKVIDKHYIPARYPNGFEAGAPVDF
FT                   YTSGEAETAVRIAGEIIEFCKNHLDR"
FT   CDS_pept        complement(126887..127156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58319"
FT                   /db_xref="UniProtKB/TrEMBL:A5D622"
FT                   /protein_id="BAF58319.1"
FT                   /translation="MKLTRQNIAHKLIDYLFHRITLAELVNWAEMSMMEADFEDKDYET
FT                   LRDIISRLGLADVKAFGISWEDIEDFLHRLGYRVDLKITEVQAV"
FT   CDS_pept        127564..128328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58320"
FT                   /db_xref="GOA:A5D623"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D623"
FT                   /protein_id="BAF58320.1"
FT                   /translation="MQRLWHQEWLTRKEKAGEVNNAQNLVHLEVIYKGDKEQFVNVLQH
FT                   VFQGTGIRRDRLEKVARYYQDGIEILRALDARERFLSFGFTEKEWLKFYERAREQEKLL
FT                   GLYRVPDTLEIKYGGQSISRLSLGQRASALLILLLSFENMPVIVDQPEDDLDSQTIYHG
FT                   LIKELVKLKRKRQIIFATHNPNIPVLGDCEQVAVFSYGDSAFCRNRAIFMPRKCRWKKA
FT                   VCWIWIWIFLKSFIRSAPVNPLIPWKSRLMSC"
FT   CDS_pept        128178..128945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58321"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A5D624"
FT                   /protein_id="BAF58321.1"
FT                   /translation="MQESGNLYAEEMPVEESSMLDLDLDFFKEFYQKRAGESIDSLEIT
FT                   LDVLLTNMRLLKDGKCTLAGLLLFGKNPEERRPAFIIKAISFTGNDPAGVLYRDSRDLT
FT                   GNIARLFLSGMAFLKNNLRMVQGEQGFNSVGCLEIPEVALEEALINAILHRNYFLASNI
FT                   RLFVFDDRVEIISPGSLPNTLRVETIKHGIHVERNPIMASLVRDIKEIPYRGAGTGIQR
FT                   IIRACKEAGIRVEFINNEEGEQFKVIFYRDKMV"
FT   CDS_pept        complement(129045..129155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58322"
FT                   /db_xref="UniProtKB/TrEMBL:A5D625"
FT                   /protein_id="BAF58322.1"
FT                   /translation="MIIQHILSFSSKVIHFQRFGEALNYVQALLDSKKFY"
FT   CDS_pept        129193..135408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0142"
FT                   /product="hypothetical protein"
FT                   /note="containing predicted ATPase (COG3899), FhlA, FOG:
FT                   GAF domain (COG2203), S_TKc, serine/threonine protein
FT                   kinases, catalytic domain, His Kinase A (phosphoacceptor),
FT                   HATPase_c, Histidine kinase-like ATPase, REC, signal
FT                   receiver domain, and ArcB, FOG: HPt domain (COG2198)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58323"
FT                   /db_xref="GOA:A5D5Z4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z4"
FT                   /protein_id="BAF58323.1"
FT                   /translation="MFIASNYRIIEQLHKKNSVVYRARRNADGRPVILKILNRRYPPPE
FT                   EAARFKREYEIIRGLPVEGVVEAYAFEKDQGYLIMVLEDFGGTSLDLLLPSMKMDLNTF
FT                   LSLAVKVAGTLDMIHRQGVVHRDINPSHIVWNPETGRVKIIDFGLAAVLPGDSREVYTA
FT                   GLLEGTLAYMSPEQTGRMNRAVDYRTDLYSLGVTLYETATNRLPFVAGDALEMVHSHIA
FT                   RAPVPPHEVNPEIPEMVSRIILKLMAKTAEERYQSAAGLQADLQRCLDRYEATGRVDVF
FT                   EAGCRDLSGRLKVPQKLYGREKEMKELLAGLDRAGTGLAEMILVAGRAGVGKTALVQEM
FT                   LKCVGRKRGYFISGKFEQFRHNVPYASLVQALQKLVRQILAESEERIASWREKLLKALG
FT                   PNGQIIIELIPELELITGPQPPARDLPPGESQNRFRLVFQNFLRTFAAGEHPLVIFFDD
FT                   LQWADAASLQQLKHLVSGAEMKHLLLIGAYRDNEVADGHPLPQVIEEIKSAGTAVRLIG
FT                   LGPIDPAATGRMLAEALGCEEAAARPLAGLVYRKSAGNPFYARQFLQKIYEEGLLFFDR
FT                   REHCWKWDAGRVLQLETGDGVIDLLIGRIRKLPEKTREVLKVSACIGRAFDLKTLTVVC
FT                   GQSPGRTAEDLLPALRAGVVVAGGGFSPADGAAREPDEHAGPEGPFAFCEFAHDRVQQA
FT                   VYSLLSGAEKKAIHRRVGLALLRETEPEHLERKIFEIADHLNNGRELIAGRDESLRLAA
FT                   YNLSAARKAKLSVAFEAALHYLEAGRSCLPEGAWKDCYRLAFDLHLELCQCLYLCRKEE
FT                   AAEQVFRMLLDRAGTRADRSQVFAMKAVICTETIRYPEAVRFGLMGLKELGFFLPERPG
FT                   NYFLLKESLGVRWRLALKKNKALPELPQIKNPRLEKIMDQMAGLLPVTSLTNPRLFTAL
FT                   ILKMLKISLKHGNTRHSTIVYACYGLISAIRGNMRIAGEMQEVSLMLTGRYGDHPVKSP
FT                   VYYSVASFLSHWTEPLQKTLQHAAAAHQCALEFGNFFYAGADLARITEIRLILGEPLPR
FT                   VYEECASSLEFTRRFKLENLARFFAMARMFIEDMQETSPFFFAADEAERLGEQVKANRN
FT                   GPMIINYYLLKIQSLYHHGRYAEALDVFREIDKNSVSSVLAMVIFTEYVFWHSLVITAA
FT                   YGQLVEEQKGRCRKILRENRRKLKKWADSCPRNFLQKYCLVAAETARLAGRPAEAMELY
FT                   DRAIFWAKENEFVRDEALGNELAARFWLAAGKADIAALYAGRALRGYRYWGAKRKVRRL
FT                   SEEFSHLSAHPEAGLIPVLDKMQAIVSAESARAAASELDLASIIKLSQVLSGEIVLPEL
FT                   LKKTMRIILENAGAQRGFFIAESGGELRIEAEAHAGGGGAAGSLQPSGGEGAPQEQQVF
FT                   LQSVPLAGAKHLSAAVVQYVARTGEYVVLHDAAQEGAFARDEYIQKNSPKSVICLPVTG
FT                   KGKPAGILYLENNLSAATFTPDRVEVLRLLSTQIAISIENARLYASLEESRNQIAGWSQ
FT                   FLEQTVAARTRELQETNELLKQAKEAADAANRAKGKFLAVMSHEIRTTLNGLIGMAELL
FT                   LDTPLNGEQQEYVSAVRECADSLLSVVNDLLDFSRIEEGRLVLETVSFNPASLVEKSVA
FT                   LVEPGARQKSLLLKYHIAPDVPGTLQGDPIRLRQVLLNLLGNAVKFTERGEISLSAFVE
FT                   GREPDSLTVRFEVQDTGIGIPEEARSMLFRPFTQAGPSSAGRYGGAGLGLSICKRLVEL
FT                   MGGRIGFESEEGRGSTFWFSVPFAAGKSMDAPSGASPAPVRPLTPKWQPGPILVAEDFA
FT                   INQKLIQAQLRKLGLAADVAGNGREAVEAFSRNSYALVLMDCRMPVMDGFEATRAIRSL
FT                   EALRGRRTPIIATTAAAMPGEREKCLSAGMDDYLTKPVRMEDLQRVLSRWLPAPELPLA
FT                   GESGNLPRPGKEALQLPGLTAVNGDRLGELLNTTGEDVHFLCRLIRAFLRDMPEKLKSL
FT                   RSALRQGDAATARLQAHGMKSSSSILGAALFADLCREAEELAAGGVTGGADKLVARLEA
FT                   EYERVVKDFETILESQLPLR"
FT   CDS_pept        complement(135483..136184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OmpR"
FT                   /locus_tag="PTH_0143"
FT                   /product="response regulator"
FT                   /note="consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58324"
FT                   /db_xref="GOA:A5D5Z5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z5"
FT                   /protein_id="BAF58324.1"
FT                   /translation="MAGELILVVDDEEVVRELVRHCLVREGFKVITTADAYGAFDLIAR
FT                   LKPDLIILDILLPGLDGIEFCRKLRMKNEVPVIFLSAKGDSSDIILGLGVGGDDYIVKP
FT                   FVPGELVARVKARLRRLKPGEETAAGREPKMLKYRGLEIDLEGHAVLVDGSAVALAPKE
FT                   FEILALLAKNPNRVFKNEQLLDLIWQSKDFADNRTLMVHISRLRKKIEKDPNNPAYIQT
FT                   VRGVGYKFSAF"
FT   CDS_pept        136468..136683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58325"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z6"
FT                   /protein_id="BAF58325.1"
FT                   /translation="MNLLLSVKNILSVHPPLEQHCSGVARLTGKVVSCLNLANRNEIVF
FT                   AAYMHDIGKSAWPRELFFKYPLQPYD"
FT   CDS_pept        136768..137037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58326"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z7"
FT                   /protein_id="BAF58326.1"
FT                   /translation="MRGHHERPGGKGYPDGLVKPSLELLIVAACDTYDAITRDKEYPTG
FT                   EALPGRFALEQVARFAPVRVVDALAKAAECLREPLNRPRPRVFR"
FT   CDS_pept        complement(137150..137605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0146"
FT                   /product="Mn-containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58327"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z8"
FT                   /protein_id="BAF58327.1"
FT                   /translation="MYLSPHVPYQLVNCIKGLLTDIGTEELAHWEIVGTMIYKLVKGVP
FT                   AQQLREAGLGAYFAEHDRAVYPADAAGVPWTAAYIQSQGDPVADLHEDLAAEQKARATY
FT                   ERLIQLTDDPGVKDTLRFLREREVVHFQRFGEALNDVQAVLDSKKYY"
FT   CDS_pept        137678..138793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0147"
FT                   /product="predicted ATPase"
FT                   /note="AAA+ superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58328"
FT                   /db_xref="GOA:A5D5Z9"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z9"
FT                   /protein_id="BAF58328.1"
FT                   /translation="MHFPLGGPVPAEDIVGRDDFITSLETRLAEGQSVMLAGPRRIGKT
FT                   SLAFEVLRRLKKKGFYVGYVDFFRASSKRSIAESIINSCLENRTGIRKTLNAVWDRAKL
FT                   LAGSAKIAVKVEDLELSIGFPKKEMDDETFLEFALNLPELLAEKDGKRMVMVFDEFQDA
FT                   GQIAGLDIYKVMRSHFQHQNKVSYLFLGSKESMMQSLFAGKKHAFYRFATVLPIPQIPE
FT                   EDWMSYIARKFNERGIEVTSDYVLREIVQLAGGHPQDTMLICTEAYYTLLEANERRLSS
FT                   EIVRIAYERALITLTPVFDEILDEVGKKPLVREVLRRLAIGETVYKDKNNPNNIKRAVD
FT                   LLSMSAIIEKEGRGKYRFVEPMLKEYILRNY"
FT   CDS_pept        138923..140425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0148"
FT                   /product="hypothetical protein"
FT                   /note="containing TPR Domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58329"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5D600"
FT                   /protein_id="BAF58329.1"
FT                   /translation="MPDRNITEHSNQLHQLLVSVSRHFYVQKNGMLKYQEKPVEVNIKN
FT                   YPKSKKEHLVYYILRDHFSGSFVFEVTTTNFLIPLADFLYYGWSNGTEEKYLWGMPDFL
FT                   YVPRLISSPELLAGLKRLGVEVLNPPSGFASGIRIVRDIEDQINFYVLVNTVDHRPENI
FT                   ARHKEKIYEYMLNLNFGDNKFKKWLDNLPAGHPKKTPEYKDFVKCFAAASGRAAGIPVV
FT                   NPSPADEFTGLKKYVEKTVENEVFSSSNREFSAEKLRRAQELIYDAWEAESRQRRLYLA
FT                   RRALKISPYCADAYVLLAEESRDPQEVRELYEKGVQAGRLSLGDLFFKKNAGKFWLILE
FT                   TRPYMRALAGLADSLWKTGQRQQAIGHYKEMLRLNPNDNQGIRYILAACLLEEEMDDDL
FT                   GALLNQYEGDISCFMHYNRALWSFRTSGGSNEQSDAYLAEALESNSHVPAYLLGKKKIP
FT                   YCLPDYYALGSEEEAVIYAERAKKAWQKTPAALVWLARHLPE"
FT   CDS_pept        140730..142373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0149"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58330"
FT                   /db_xref="GOA:A5D1X0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A5D1X0"
FT                   /protein_id="BAF58330.1"
FT                   /translation="MFIKLTKTKNYQYVQLVQSYRENGVVKHKVLFNLGRLDEIENNPS
FT                   FQRLGKRLLELSKAREVSSLANFSEAQIKNWGYVVYQKIWNQFDLPNLLRKISAQRKVQ
FT                   FDLNNAAFLMAVQHLLEPRSKLGTYTHQHRYASLPNVSLNHLYRSLDLLWEHKELLEVE
FT                   IFKKNHHLFNMQVDVVFYDVTTFSFASVEADSLRNFGFSKDGKFNEVQVVLGLLIDCEG
FT                   RPIGYELFPGNTFDGKTLEKALVKLEERFGLRRVIIVADRGINSKLNLKRIVDRGYSYI
FT                   FAARIKNMKKEITDEILSENGYQEINDGEEVIRYKVIEYLNEFTAEGQKYQLPEKLIVT
FT                   YSSRRAEKDRADRERLIAKAQNLLESKAKIQASNKRGGKKYLKEIDCTGTWILDEEAIA
FT                   REEQFDGYYGIQTSEKEMSARDILAAYHNLWRIEESFRVMKSTLEVRPVFHWTERRIKG
FT                   HFVICFLAFLLERTLEFKLRQAGENASPEAIREALNSLNFAEVEIGGNAYFIKTQSMEL
FT                   SKKILRLMRIAPPGNITSVEEFATRQQNRQ"
FT   CDS_pept        142724..143203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58331"
FT                   /db_xref="UniProtKB/TrEMBL:A5D602"
FT                   /protein_id="BAF58331.1"
FT                   /translation="MEQYYLREIPACVKDFCWVAAGVAPRFLGQAVPIPGDCGESIGIT
FT                   QIPDPEKIRELIGHQPDLGDLYVGTIHSFCYKLLQEYVPGYRGFDVLDEGKRYAFISSI
FT                   RGNLNYTQLKNWLESSGAKKPYGITTQTWVLNMLIRLPMVRVNSKEYFDLQKASV"
FT   CDS_pept        143282..145144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Mod"
FT                   /locus_tag="PTH_0151"
FT                   /product="adenine specific DNA methylase Mod"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58332"
FT                   /db_xref="GOA:A5D603"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5D603"
FT                   /protein_id="BAF58332.1"
FT                   /translation="MKKLKMETKDLIQENIEKLAEIFPGVITEERDEKGNPIKAVDFEL
FT                   LKQELSDRVVEGDRERYQLTWPGKKEAMFLANMPINKTLRPVKEESVDWENTGNIYIEG
FT                   DNLEALKILQESYLNKIKCIYIDPPYNTGKDFIYKDNFKQSRIEYLAESGQVDGDGNRL
FT                   FQNTESNGRFHSDWLSMMYPRLKLARNLLREDGVIFISIDDNEVHNLRKICDEVFGERN
FT                   FVATIIWQRAFSPVNLKRTFSENHDFIICYSKNKDIIEIKGLKRTDEAESRYSNPDNDP
FT                   RGPWTSTDLSVGPVVAEKVYPITTPSGKVIYPPNGRCWVLTKERFEEFLSDNRIWFGRD
FT                   GNNAPRLKKFKSEVKERITPMTLWLRDEVGDSQEATRELKKIFDEKTYIDYPKPVRLLK
FT                   RLLELTTENNDIILDFFSGSATTAHAVMQLNAEDEGNRKYIMVQLPEPCPEDSEAYKAG
FT                   FKNISEIGKERIRRAAKKIKEETGADIDYGFRVFKVDSSNMKDVYYRPEELSQQDLFGM
FT                   VSNIKEDRTGEDLLIQVMLEWGLELSLSMEKRDILGKEVHFVAGNSLVACFDEGVSEEL
FT                   VREIAREKPLRVVFRDSSFADDAARINVEELFKMLSPTTEIRVI"
FT   CDS_pept        145159..148185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0152"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58333"
FT                   /db_xref="GOA:A5D604"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D604"
FT                   /protein_id="BAF58333.1"
FT                   /translation="MKLKFKIQQFQTEAVNAVADCFAGQPNGQSLFTLDIGQLNSGPQL
FT                   GISYEVTGFRNRPIELTPEEVFENIKKVQVRGGLKISPKLEGKYNLTVEMETGTGKTYV
FT                   YIKTMFELFKRYGWGKYIVVVPSIAIREGVKKSFEITEEHFMEQYGRKARYFIYNSRQL
FT                   HKIDQFASDPGINVMIINTQAFNARGKDARRIYMELDEFQSRMPIDVIAQTNPIMIIDE
FT                   PQSVEGTKTVEALKLFKPLFTVRYSATHRYEYNKVYRLDALDAYNKKLVKKINVKGINV
FT                   KGTTGTDGYLYLEGVDISQKHYPLARLEFEKKTRSGIKRELRRVSVNDNLYELSGHLEQ
FT                   YKGYVVSEINGGKNTIEFANGISLSAGDVLGDVNELTLRRIQIRETIKSHLEKERDLFY
FT                   RGIKVLSLFFIDEVAKYRQYDKNGNKLNGEYAQIFEEEYRILVEEYLRNAGEKDRYADY
FT                   LRQIDAEKTHNGYFAIDKQGRMTDPKVKARETDSEDEDAYNLIMKDKERLLSFSEPTRF
FT                   IFSHSALKEGWDNPNVFQICTLKHSDSTIKKRQEVGRGLRLCVNQDGERIDDSVPGIDV
FT                   HQVNVLSIVASESYDAFARELQREIAETLSDRPRKADVQFFLDNVLTNEREEKIRIDER
FT                   LARKLYQTFVKNNYIDEEDNLTEDYYQAIEKGAVVLPEELKEHKHAVIKLVSTIYSESA
FT                   SPLVHNERNKNVELKLNDNFYKEEFQKLWKKINVKTAYTVKFDTEELVDKCINALDTRL
FT                   RIADISYQIKDGVLEVIDSKEQLERGEGFVLKEAETGKVDGKVTSGVRYDLAGKLMVET
FT                   GLTRKTIVKILTGIKRETFDLFKKNPEGFILKVARIINEEKATTIIERITYDPLKETYD
FT                   TDIFTQNTLKGMLGENALPVSKHIYNYVITDSHTESKFARDLDASREVCVYAKLPRGFF
FT                   IPTPVGNYNPDWAIVFEENKVKHVYFIAETKGSMNSLELRKIEEAKIHCAKKHFEKISN
FT                   NSVKYGVVENYEKLLEMVS"
FT   CDS_pept        148258..149361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58334"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A5D605"
FT                   /protein_id="BAF58334.1"
FT                   /translation="MVQRVIDTGVEEEDITGSESIKQPYDPGRINVVRQEMTVFQVLRK
FT                   IKNKEINLEPDFQRNLVWDETRQSRLIESILIRIPLPSFYMDAINDDEWLIIDGLQRLS
FT                   TLDRYVNEEKFALQGLEFLEELKDKKFSQLPRSYQRRIEETPLFLYIIRPETPSEAKFT
FT                   IFRRINTGGMVLTAQEIRHCLYRGKSTELLKELASSPEFRKATSNSVSPARMDDRECVI
FT                   RFFAFYLTPYYEYQKRDFDYFLGDTMVKINQMPDNKITQISKAFKDAMAKAEAVFGENA
FT                   FRKPKGKDQRARNPINKALFEAWSVCLQKYPLDVLVKNKEKINKRFIYYMNNDPEFVNS
FT                   ISQGTGEVKKVHKRFEIIEKIIREVIN"
FT   CDS_pept        149358..150449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0154"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58335"
FT                   /db_xref="InterPro:IPR014592"
FT                   /db_xref="InterPro:IPR022532"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A5D606"
FT                   /protein_id="BAF58335.1"
FT                   /translation="MIAYIRLQRFKCFLDQIVQFAPLSILCGTNNTGKSTVIQALLFLR
FT                   QSAMTGNFAKADLPLNGPLVHMGTARDLFCQWAEEDNIQISVAFSDLPDRILTCKLAYR
FT                   REDHDALSMKLMESPSDLPSSSLFADRFFYLGAERMGPQLVYPVSEDSLETMHVGFRGE
FT                   YTAHCLHQFGNKKIKLPQLKHSPEDHSIELLFQVEEWLKDMLPGGIMINPDRITQADIL
FT                   QVSFRDSERNTDYLRPTSIGFGISYCLPIIVAGLMAEKDNLLIVENPEAHLHPQAQSRM
FT                   GIFLSKLAAAGVQVILETHSDHLLNGVRIAVKKGYIDEKYVSINFFERDYNIVRPAIDA
FT                   YGRIDLWPDGFFDQAEKDLGELI"
FT   CDS_pept        150449..151393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0155"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58336"
FT                   /db_xref="UniProtKB/TrEMBL:A5D607"
FT                   /protein_id="BAF58336.1"
FT                   /translation="MNIFLNELSFCGQASNKYQGAQLMSDMLKVLKILQQISNKPIATS
FT                   SILWEKKIGPQYSVRDYIFDRSIDQAVRNYFQIITTKGPYIECLFSQSLDKHKCYLQNE
FT                   NILDVSWTSVAAAFFFDGILASLKGAPQFASETINVFCCLKGAEQQEADIINQYNPDQA
FT                   ESFVRNFLRQNLNSWENLWHSRSALFPEITFCEEVKGQLQSSNYSHSVLQKIIRHLDCM
FT                   NKYMKAIRSGKIKAPNYTQMGIEASQESEITLKHYGHLRTFKCPDGKKRVFSWHSKIKG
FT                   KVNLRIYFYPPDKENEHFLIGYIGRHLPIWTEK"
FT   CDS_pept        151541..152683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0156"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58337"
FT                   /db_xref="InterPro:IPR025639"
FT                   /db_xref="UniProtKB/TrEMBL:A5D608"
FT                   /protein_id="BAF58337.1"
FT                   /translation="MEADQIRDLIVNNLTLQGFLLKDGKILPPENLGKENIRSLHQMAV
FT                   KHKIERGKKELWRKEPHFLKKIASGKEVVPEQISPRLVEVLPDSEEELLFRYISLHWSI
FT                   PVSSGYGRRLRFLVCDEQNDKLIGIIGLGDPVFSLAARDQWVGWDRETRRYRLKYVMDA
FT                   FVLGAVPPYSFLLGGKLVAMLAASNEVRAAFGRKYSGAKSVISGEEFDGRLAMLTTASA
FT                   LGRSSIYNRLKYCERHLYKSVGFTRGSGEFHFFNGLYNAIFAYAAQHSTPTAKQESWGN
FT                   GFRNRREVIRKCLQSLGLSADWLYHGVAREIFVVPLAENTREFLRGEDLDLVAYDQPAA
FT                   ALASYFRERWLLPRAGRDRRYREFDASSYCLWGRGESDDE"
FT   CDS_pept        152673..153821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0157"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58338"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:A5D609"
FT                   /protein_id="BAF58338.1"
FT                   /translation="MTNEQTPFVDLPAALVEEVMEQTAAVGELLLKTFRKMKNNQDQYR
FT                   RRLIEKGIIRHESSLGYPPLPTTCGTDGSYAVERLLSADLVAAAAVAVEGLTPPSEKRY
FT                   WEQPHHISYVKSEVHHPDTATILRALMLGSELLLAEKAPHDLVMIDGTLTMPVIYFNQA
FT                   LNKAPETPELSCAKDFLDNAVNYLKAYLAILNNKRSDRNYVGLPKYSSRREIGKAMGWP
FT                   VHHDDRGLLTILLEAGEFTKPLPMEQPDQPWHFNTARLAAEIKRAVDEIAEEVIYSLQN
FT                   LYVFYYKPHDWIPALRCEVAQNLAVNNYRLATVIQGIKHQCACAGMFEPYPLYLADRSV
FT                   KALARAIPAFRQVTTQQISEKYEGDIGEIFFAMHGYRSESGV"
FT   CDS_pept        153827..155578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0158"
FT                   /product="predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58339"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D610"
FT                   /protein_id="BAF58339.1"
FT                   /translation="MPLKLNELIDSTEKLGVVGSPSSTSKLALDILGAAVTRKLVGELA
FT                   LFRFIQDSSPHFALGQITEVQLRNVWHEDPTMRSLIRQRGKVDAVSERQDTHLGQLVVS
FT                   AVFKQGGLAGYEPSILGTVPSTGTPIHIVTDEILEEILSPYKEQIFYLGHVYGSQPKLP
FT                   LWFKHFDRGPDGAGEAYHLGIFGKTGSGKSVLAKMILLAYCRYPRMALLVIDPQGEFSK
FT                   DMRPGGAGGEFPLPVGDLARKLGKRCFVITVKSLILDRWELFEQILYESLFFERLTIPK
FT                   GENRELACSVLAEKLQKAKVKLADLYTRQSFAKAWDFLKDDKVQKNFYRSETPRARFNN
FT                   TIEESDADEFYREYWLPVAELFREDREKARSVEKALSWLLKADEENRPILVVNLSKEQT
FT                   SGIFWNDKIQSLVIKRVLDGLTQTAEHFYQEGQSLNTLVVIDEAHRLAPREIPKEDDAA
FT                   RAVRNVLVDAARTTRKYGLGWLFISQTLSSLHSEILQQLRIFFFGFGLGLGQEFQSLRQ
FT                   LVGSSGTALDLYQLFRDPHSAFDVASRQYSFMTIGPVSPLSFSGSPLFFNAFNTVSAFL
FT                   KANALET"
FT   CDS_pept        complement(156068..157543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0159"
FT                   /product="hypothetical protein"
FT                   /note="containing PinR, site-specific recombinases, DNA
FT                   invertase Pin homologs (COG1961)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58340"
FT                   /db_xref="GOA:A5D5X5"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X5"
FT                   /protein_id="BAF58340.1"
FT                   /translation="MSNTVACYIRVSTDEQAEQGISIPAQKSRLLAFCRSQGWNIYGFY
FT                   IDDGYSGKDLDRPAMRRLIGDTGAKKFDTVLVLKLDRLSRRQKDVLFLLEDVFEPGGVG
FT                   FKSVTESFDTTTPFGKAALGMMAVFAQLERETIVERVRMAKKESAKQGRFMGGPAPYGY
FT                   RHNFETKRLEVDEVQAGTVRWIYDRYLSGAPNYRHIAEELEHTGVPGPTNEKWNKAFVR
FT                   KILTNPVYAGLIRHRENLYPGRHDPIVSPEKWQEVQKLIKSRGAVRAAAAVHTGLLSGI
FT                   IWCGECGARMRVKNVWQNHPNTNPKKVTRYYVCYSQDRAGGHMVRNPTCRCGYKHGGAV
FT                   EEQVLRELFCYSYDRRLLRRALEEALAAADNRAFLRELAQARKDLAATEKKLERWYDAF
FT                   EKGALEGDQLTERVKGLHQRKAYLRGQIAEMESRLKEGKERQTSVEEMMGILQDFPRIW
FT                   ENATAEERREIVVNTVKAVKVYSNNRVEVDFNL"
FT   CDS_pept        158077..158505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58341"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X6"
FT                   /protein_id="BAF58341.1"
FT                   /translation="MAAGSESWLRSMSYTRQLRKKFRSLKRSLTALPAGLSLWLRKYGL
FT                   KAGNVCLYPTPGHPLGSPAIILFDDVPGGAGHVRRLARKGTFKEVLRASLNRLQRCECG
FT                   GAEGNASCYGCLRHYRNQFCHDELNRGLAIKFLSEILA"
FT   CDS_pept        complement(159115..159336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58342"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X7"
FT                   /protein_id="BAF58342.1"
FT                   /translation="MIHMPGPQGNFQEIIKDLPGLTLEQLNQLIEEANRIKNEKMKKNH
FT                   NPLLNIIGIAENCPEDGAKNHDKYVYGR"
FT   CDS_pept        159641..160648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58343"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X8"
FT                   /protein_id="BAF58343.1"
FT                   /translation="MSTIFGRPTGLFFSYDAIFERHDLTTLQKLVYIYFCRRANNNGQS
FT                   TPSYDDIAKDCGCHRSSAIEAVNTLGKMGLVVKHRRKRHNGSDTSNMYVVFPPGSPFDG
FT                   NREVINDNGKAIPKKPSSFEGSSQTTPGRVVQDDPRGVVSGDPQKEYRSVVVVDQQPGG
FT                   EKISDGETESSSVEDSAAFALPASGEQESCSRADQAGPAEKSTWEKIREDVRAVAGVDI
FT                   SVSFAKEIEKNYPPEKVSVVLEELDRQLAQGVEIRGVGAWLRYALENDIQPDQPVTRPK
FT                   TKTIRLKDDNNRTPRARPEVRPEPGISYRRTPEQEQKRKEFIKSLYVGYKPGGN"
FT   CDS_pept        161014..162057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58344"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X9"
FT                   /protein_id="BAF58344.1"
FT                   /translation="MYRQMITRVPVVGVDGKPLMPTTPRRARLLIRDGLAKRRRNKLGL
FT                   FYVQMLRPVGTETQPMALAVDPGAKYDGISIASHKQIELKAMVFLPVGVPEKMETRRNL
FT                   RRARRFRNTPRRPARFDNRRRKGYWLAPTQRSKVECRLKVVRELCKVFPVWLIVTEDVR
FT                   FNHARSRNGKYFSTVEIGKALTYFEYKKLAELKLVKVSDTDAWRERFGLVKYTERKWEQ
FT                   TPETHANDAVAMLMGITGCEKAVTPFYVWRKLQYARRSLHRQHFQKGSKRPLFGGASNG
FT                   TFFRKGDWVEAEKAGVKYRGWVCGLPTETTKLVGVADADGKRIGQFSPKKVRLLARSTG
FT                   FSWITAA"
FT   CDS_pept        complement(162190..162417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0164"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58345"
FT                   /db_xref="GOA:A5D5Y0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y0"
FT                   /protein_id="BAF58345.1"
FT                   /translation="MFSKKIFAKRLSFLITKNKLSKQAVANAINVSRPAVSQFANGENL
FT                   PSVEKLIALADFFDVSLDYLVGRSDDPRRH"
FT   CDS_pept        162807..163256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58346"
FT                   /db_xref="GOA:A5D5Y1"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y1"
FT                   /protein_id="BAF58346.1"
FT                   /translation="MSSNQAATKKRGRPKKNIDLVRVLELERAGKTDQEIAGELGVSVR
FT                   TFRSFRKKHGIAPAAGWGGARRGAGRKEFSGGSHDESDAYMERQQAIDARVNSIDAGLR
FT                   AGRFNLTFDQWLKWAGSVFKYSKERGVYTSEEGLGIPAVIRFYIG"
FT   CDS_pept        163322..163666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58347"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y2"
FT                   /protein_id="BAF58347.1"
FT                   /translation="MRLYHIGRLRCYLGVKSCKNFKEAGTVVKSAVRIDAALLAGHCAG
FT                   VEQYTGVDKCLVDFALRFMDRPAERRRGFLALAEKEFGGFPDEIRFAAIGFIRDLCDAA
FT                   DKREGEWRGA"
FT   CDS_pept        163626..164045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58348"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y3"
FT                   /protein_id="BAF58348.1"
FT                   /translation="MRRTKGRVNGVALNMAFEEKIRELGRAVHPEVVKALPKELCVDPV
FT                   DVLGEARTWCAPVNDPDYGAEYLALVEKLEMLEERVLGLLPAGDKKILDELENVLFEIQ
FT                   GLALKIAFRHGLRDGFRLASFVMGAGKEGGIDSRA"
FT   CDS_pept        complement(164552..165718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58349"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y4"
FT                   /protein_id="BAF58349.1"
FT                   /translation="MFKARLLLDIGHHFVNCLAVELLAQDIRGVGPLALQVAFGQVDAE
FT                   KQLAIMRSPRPKFIKILRKFQFRLLRDLVPGPRGEGFARRLLLHRLHRLANQVFHRRAH
FT                   VRPRLARRPAYHSLGRLVPVNLVPQSLCHEPSRQHGPARVNQHGGNVDSLRCTVAHYLS
FT                   LADGHAQSCLNAFQRCGLGGVVPGDVAVVHPQGVAQEAHRDESPVILHERGNIHFHAGG
FT                   LAVNDVIGHPDLEYHGLDQLLVFVHVNLLVGGIRPATHCNNSKQGHQRHQPLEFASHVK
FT                   YLLLKSVLSPSCYLGNIFYCPGHFLPAEAKYVRLRGNYLPWACPLNLTIPQTGYIIKLK
FT                   LSPLRYVGILTEGRRYRLTLSGLSLGPLEPLQRFQGFSATCAGQSCGR"
FT   CDS_pept        164882..165817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0168"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58350"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y5"
FT                   /protein_id="BAF58350.1"
FT                   /translation="MRSKFKRLVALVALLAVVAVGGGAYAADQKVDVYENQKLVKSVVF
FT                   KIGVPYYVVDGQTPGVKMDVAPFVQNDRTFVPVRFLGNALGVDNSNIAWDDATQTATLK
FT                   GVKATLSMAIGKAQVVSNGAAKAIDVAPMLVDPGRTMLPARFVAEGLGYQVDWDEATQT
FT                   VICWPAGEPRPDVSAAVEYLVSQAVQPVQQQPAGETFTTRAGYQIPKETKLKLPQYLDE
FT                   LGPGAPHNCELLFGIDLTKGDLESQWADAAYILGQKLDSQTVDEVMAYVKQKTGFKQEL
FT                   NYKTWESNEKKIGVISNWGSRGVQITVWYK"
FT   CDS_pept        165838..167682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0170"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58351"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y6"
FT                   /protein_id="BAF58351.1"
FT                   /translation="MLKRLFAVAAVFFLLIAALPAFAGQLFDAQTAINDALDNSDYYLD
FT                   VSKNGHPINYVSIPILSNYLKGGGYYGCLVYGDPHGDYKDGQYRYLGYTLDGEDYTNVA
FT                   FPPDASHTGYFEDQQWIIWPWADSDVTANYTIEFNNNLDGTNRYAQNIRQGILVYYTDP
FT                   NNANNYQVKGIAPETLDFWDNIHQYIHVLAPPTKWAWGIGRMFRYGSGGQINYITVPLM
FT                   PDALIEPPAEDNLKAVSLDLGIPPGQLAEPGTQYRARAEFQNESARALTEVPVAVLHGD
FT                   YQATLHDEKGQPLPKKMVGGKEVQVADFGPGESRTFWCDWHPFNQARDGLTAIINRDEI
FT                   GKVHLETTYEDNIITKETVVDFKDLSVQILEYAKEAYAGNPVTVKAKVINSTGRMVVTK
FT                   LVWKVNGSVVKEVPNFDIISEYDDAVTFDMPGAAAEVTVEVNPDRNAPPNEASWDNNAD
FT                   SCSVKLLREKLPDEDSRLKVSIDAPSFVNYKENFTFRVTVSAYVPPPPPLSDFEPPTVS
FT                   VTTTTSGGKLTWLYNYVDGSMENYSFEEQFNDSFTAYGGRWTTETYTYTQRGCGIKGQE
FT                   HDIIIEATAKMEGRTARDVKKVRVAAMPILPVGQQLTQ"
FT   CDS_pept        167731..168174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0171"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58352"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y7"
FT                   /protein_id="BAF58352.1"
FT                   /translation="MKKIIAALLVLAFGALSPFSAYAGEVQGDYDYIVKVLFDDSGPKG
FT                   ETYFLPLRATCEKYGYKVEWDGINQMAVVTKGTAEKLTDGNGNNIEAVIFRPGASVVEM
FT                   VDESKAKIDEVPAGREAILSERNGRMYINEMFLKYFGLKAVVK"
FT   CDS_pept        168287..168505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58353"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y8"
FT                   /protein_id="BAF58353.1"
FT                   /translation="MVNSKEIVKALIDRLNDVQVEALRVIIESMIWPEVKVTPEEAEAI
FT                   AQGEAEVEAGLGVKAEDVWRELGLSDD"
FT   CDS_pept        168591..169085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58354"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Y9"
FT                   /protein_id="BAF58354.1"
FT                   /translation="MYLSRVLGKPSTTRNFQAARLFLSHMLSNRVCRIIGSRRDEAAFR
FT                   LKLAFRGIIFVYEPERNEVYTIYPDKKSKERFEMCVRIPADFSVSEQVKRILGKGTWDK
FT                   LFRYEWPVVTAKAKPNRPTSILRVKAGNWLVDLDMVERKISDASQFGGPPKDHELENDF
FT                   D"
FT   CDS_pept        169156..169455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58355"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z0"
FT                   /protein_id="BAF58355.1"
FT                   /translation="MGKVELSETAIGFPREAGHHVKPGFTWPSGGKTANQVCRKPPHRL
FT                   DVENCKRPGLLQQFKNPGGTTVPACDLGRVLKEIFLSERKGVRPQRFKGTGVAA"
FT   CDS_pept        169463..169702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58356"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z1"
FT                   /protein_id="BAF58356.1"
FT                   /translation="MRPDRCAAGRKEGLQPPRRAFGVFAAAVLRARRNPTTGAGVQPAP
FT                   PVLMGRQRRAEGTGVDPGSASVPDITTGRITKED"
FT   CDS_pept        169749..170192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58357"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z2"
FT                   /protein_id="BAF58357.1"
FT                   /translation="MSAFCACRGPPGKSPEGTLRTQISKERSVRRLYDGKERWKAEMRW
FT                   IRRAQEKIAFSRHFLRRLKARRIKMGDIESVVKAGEIIQGHAPGAYERNQDPVRVIIGP
FT                   GADGRTLHLVVALKKKSIKLVTAYYPDPEIWEEDLRTLKRRKR"
FT   CDS_pept        170619..170765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58358"
FT                   /db_xref="GOA:A5D5Z3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Z3"
FT                   /protein_id="BAF58358.1"
FT                   /translation="MMNKVILIGRLTRDPELRYTPKGTPVGKFMLAVYEAIKKGQIHGE
FT                   VVA"
FT   CDS_pept        171821..172933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0178"
FT                   /product="hypothetical protein"
FT                   /note="containing partial XerD (COG4974), site-specific
FT                   recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58359"
FT                   /db_xref="GOA:A5D5V9"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V9"
FT                   /protein_id="BAF58359.1"
FT                   /translation="MSKKDDPLEIRNVSIYHANTYEKVRTVGMSFAKWLSEKRNTPVFR
FT                   MVTVSAEDINNYVEKRLDQYKRGEITAATLQTDISCLKKIENLVNHYYGKVDWDIPTER
FT                   SARREKWGLPKRERDKTTVQRGPAYTKKQADRIVMEVEKRYGRLAADALRFCRATGCRL
FT                   ESLVDMKEKGVRIERINIEAGTVSLLEKGGKWRTVKYDQRYDNFMRELKSRAESSGRKG
FT                   PLFACFGTGEMSGDPDYSQLTNDQLRTIKKSAARRLEAMVKEIAAENGFHGRGIHGFRK
FT                   EFAVRRHSEYIQEIKELVRAGDWKGLSERFKVSEQKARDMVASWIKAGEDKKERRRVSR
FT                   AMDNAARLRLSKDLGHNRLDVTFAYVPRKK"
FT   CDS_pept        complement(173547..174515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0179"
FT                   /product="hypothetical protein"
FT                   /note="containing HTH_3, Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58360"
FT                   /db_xref="GOA:A5D5W0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W0"
FT                   /protein_id="BAF58360.1"
FT                   /translation="MVIPIGLCLKLVREESGLTLREAAEKIGVSAAFLYNFEEFKTCSN
FT                   PFMQVKNNPLGIAFEEFFLDNLKNIKTPLLKKYIKKLLDSKSIETNLFQDCFYHSILSF
FT                   LEFSLVQTIGNYGASYGGLFYILRDLLMFYTDSKDKNIVAVGSINNIFTSFFLKETFNS
FT                   QWGKKRTKRRKNIYKYDDIIFTPKEDKSIIGYLESKEGNNDFIGRAFYEDRFVSLLFYL
FT                   LLEKISFSFFIKDTSDHEQKAWDYYNKTVEDIRGRINDNSINILLEPEVYCVLDWRNTP
FT                   PFRDIFVLDTRFGKVSICCRSLVGGYHYDMFLSWGDILDYS"
FT   CDS_pept        175027..175893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58361"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W1"
FT                   /protein_id="BAF58361.1"
FT                   /translation="MAEYDLIIKALAERYMDKIAAFIRGVEVSVEQIEDKDKEAVAVQR
FT                   TSDALVKVREDGYEYLMLVEFQARPDRKMARRLLEYTAMHHRRYEKPVYPVVINLTGSG
FT                   RRDERYIVECLDLTVIDFSYRQINLEDIAGRDLLYRGPVGLLPLAPLMRQEETPEAVLE
FT                   KCASRFESEVQGEEERATLYLALGVLAALKIQKGLVQKILEVSKMENSPFFDGIREEWE
FT                   ARGRGEGIVESILEALEENTGQRPAGLKESLSAVKDGELLKKILRRAVKARTLEDFELA
FT                   LKELMPN"
FT   CDS_pept        176168..177763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PinR"
FT                   /locus_tag="PTH_0181"
FT                   /product="site-specific recombinases"
FT                   /note="DNA invertase Pin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58362"
FT                   /db_xref="GOA:A5D5W2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W2"
FT                   /protein_id="BAF58362.1"
FT                   /translation="MDEEYMPAHIQGRKLDVLDDPSKTIDQKGIDVGGYIRISTKKDSQ
FT                   KTSIENQEKLLKQWADVNGYNLYRCYTDVKTGKYMYLRNEVQQMLEDLKEGKIRGVVSK
FT                   EIARTSRDIMDVLDLKRKIVSLGGFFKAIKENYDSRTDDDEFLLVLYGALAQKEQKTTA
FT                   SRVKVTQLIKAKEGKTNVPLPAFGYMLSEDRQRLVRNPETYPHYRFMVERFINGWGQLK
FT                   IAKYLNKNGILSRRGCKWSTSAIKTILTNPVYLGVTIYNTTTLIRDHEGKQKRVMRPRD
FT                   EWIIRYNTHEPLITEEEFKKIQAILQERSEKDCKEWTCERKYLGSTLLRCAVCGGKIYG
FT                   SRFMSKKKGAGYFYRYICRGVNGNCNSPAKYWDMEKVDWNIRELFRTLFGDKEKLFDYI
FT                   QKEPGILNEDTSEFLKERDALINKVVHIDRAMKKQQSAFENDAITMDEYKTRLAELRAE
FT                   KNEALARIGKLDAKLLRHDSVMDRLKKVLNRVSDKIERIHELPTEEVAEYLDAVFESLY
FT                   LGEDGTIVDVEFKD"
FT   CDS_pept        complement(177753..177872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58363"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W3"
FT                   /protein_id="BAF58363.1"
FT                   /translation="MWIYEKKLEYPVRVFKTDIGMAKYLLAQYGGPYFLFFSL"
FT   CDS_pept        complement(177888..178148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58364"
FT                   /db_xref="InterPro:IPR016571"
FT                   /db_xref="InterPro:IPR024207"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W4"
FT                   /protein_id="BAF58364.1"
FT                   /translation="MDERLAMLKEIQELEFAAVELNLFLDTHPQDQTALRDYQAVSEKL
FT                   LAARKRYEEMCGPLTATWPGAASHRQWLWIQEPWPWEIEYV"
FT   CDS_pept        complement(178170..178430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58365"
FT                   /db_xref="InterPro:IPR020256"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W5"
FT                   /protein_id="BAF58365.1"
FT                   /translation="MFRKSQHPFFARPAAAVRENDKKEQSTAEEIKTEAIAPGVHAEGF
FT                   YPPARLARAYVIWQKYGPTFSPAEALEKGTLFPDLYSPYPF"
FT   CDS_pept        complement(178586..179182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0185"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58366"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W6"
FT                   /protein_id="BAF58366.1"
FT                   /translation="MKRSAALLLLGALLPAALLLANGFRDSAPETVYSPANLIRLHVVA
FT                   NSDSAADQELKRKVRDEIVRSVAPEFAAAENIGSARLVARANLDRIKEIALREIKAEGK
FT                   NYPVSVELASFSFPTKHYGPFVLPAGDYEAVRVVIGSGGGSNWWCVLFPPLCFADMSRE
FT                   VATQSPAAAGKDPASGEDCNTVELRFKILDLLKRL"
FT   CDS_pept        179496..180875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0186"
FT                   /product="hypothetical membrane protein"
FT                   /note="SLH, S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58367"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W7"
FT                   /protein_id="BAF58367.1"
FT                   /translation="MFRKGFIALLLTVVLVLGTAAASQAAPGKKANWKFKFHGARKAVQ
FT                   LTDIQSHWAAQPIQTLFSYGIITGYSDLTFRPNIPVTKYEAIMMIARASGFDGTSEADL
FT                   AWDGVPEWMAACLDFAVSEGILTEEEAEYLNGWAPAKRYEVAVWAARAMGLEPDGRFSF
FT                   QDLGEIPSFARPYVGGMFKCGYMIGYPGNFFQPNKPVTRAEMAVVIYRIMMEDTIDGED
FT                   RDDQGGSDTGGEPAVKSLEPADGSGGVDVETAELTVRFNVAVEAVEDLESVREGITVRN
FT                   LTDGEVVEVDDVSIAGDTLTIELGEPLENGKTYRVTIDGGLIEAEESGANFGGIGSGRW
FT                   EFSTGGDFKIVGLNPADGADDVDGEDTAVLKAEFSGDIRVIPGKTLLDAVKVYNLSDDE
FT                   DVDVDMVEIDGDTLVITLEDPLESGDTFEVTIEGGYLEEEDTGRNFEGLEGGEWRFTTA
FT                   G"
FT   CDS_pept        181053..181289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CsgD"
FT                   /locus_tag="PTH_0187"
FT                   /product="DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58368"
FT                   /db_xref="GOA:A5D5W8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W8"
FT                   /protein_id="BAF58368.1"
FT                   /translation="MKIEIRGVERLSFRERQVVALKEMGYSTDRIAKQLGLSPSTVSTL
FT                   YNRARTKGYEVVIVIPGHNLALFGPDEEEEGKE"
FT   CDS_pept        181286..181705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0188"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58369"
FT                   /db_xref="GOA:A5D5W9"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5W9"
FT                   /protein_id="BAF58369.1"
FT                   /translation="MTRPLRKEQEIVFLPVEREVPERRTARRRSFNFSRSRLPALVALL
FT                   LLGYLAITFSSQFSRLSVLQKNVDSIQQEVQELKQKNAALREELQMVQSDAYIEKTARE
FT                   KLGLVKPGETRVVPVPPGTQLKELETPSKSNIVGD"
FT   CDS_pept        181815..182195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VacB"
FT                   /locus_tag="PTH_0189"
FT                   /product="predicted RNA binding protein"
FT                   /note="contains ribosomal protein S1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58370"
FT                   /db_xref="GOA:A5D5X0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X0"
FT                   /protein_id="BAF58370.1"
FT                   /translation="MPIEVGSVLEGVVTGITNFGAFIELPGGETGLVHISEIAEVYVKD
FT                   VHDFLKTNDKVTVKVISIDPKGKIGLSIKQVNPSRSQKKRFQVSFEEKLARFLKESEER
FT                   QQFLKRNTDSKRGGRGSGRKME"
FT   CDS_pept        182285..183166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0190"
FT                   /product="hypothetical protein"
FT                   /note="partial GppA (COG0248), Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58371"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X1"
FT                   /protein_id="BAF58371.1"
FT                   /translation="MKRVAAIDIGTNSVRLLVAERDGDRLKAVEAGLATTRLGEGIGSG
FT                   MLLPQAMERTVDAVEGFCRTAMHLQAGRITVAATSAVRDALNRDEFVQMVRQRTGLKVR
FT                   ILSGEEEAALTYRGVLAGLPVEPRATAVVDVGGGSTELIWPREGGLRLVSVNVGAVRMT
FT                   EAGMDVRKAAALLKPFLEEIKGMPVKCLVGVGGTVTTLAAVDQELAVYDPVRVHGYCLT
FT                   APKIEKILAKLEEMTVEERRRVPGLQPERADIIVAGVAIVKAVMEGTGAGRMLVSEYDI
FT                   LYGLVLEEVEIK"
FT   CDS_pept        183242..185731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0191"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing PTC1 (COG0631), serine/threonine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58372"
FT                   /db_xref="GOA:A5D5X2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X2"
FT                   /protein_id="BAF58372.1"
FT                   /translation="MDSLFENIEIYPYKRSRNGKKAQGAAAGAKGAGKPPALFRAKAVQ
FT                   AVTPEVLAACFAGFFLGRAVLLGELLPFGTSFAVAALRVFGRSGLAAIPAVVLGLITVS
FT                   GGASLAGSIATVICASLLTGAVPRDAKRPWLALAALVLAVTIVVKASFTAFTAPSAYNY
FT                   FTVLFEAVFAALLTPAMIYGISALKKRGIVSPFSGEEVFCILLVFGGLVAGTGDLKYWV
FT                   ISVKGVLSRLTIMLAAFVGGTGIGAAAGAVVGIIPGLVYTAAPAAAGAYSFAGLLAGAC
FT                   RGFGKAGVATGFILGNIILSVYIAAQEDIIAVLTETAVASLLFLLFPSLVIENLKVSVG
FT                   LAGEEVKERQGDKPDYRDILEDRVKSWARVFGELSRAFEQASSTAGQSREEQCLQRMLN
FT                   QIGEKVCCDCAFYRTCWDREFYKTYQGLIDLLALLEIYGKVTPDNLSDDIKRRCSRTKE
FT                   LAITVSCLYESYNLNRYWSRRLVESREIVSEQLKGISEVIAGLPGDLEFEAAAGEMGPA
FT                   LRKKLKDVGAQIESLSVYRRRDGGVEVALAHLPCGGRMECRNVILPLLSSMLEHPLYAA
FT                   TTACTVREEDSSCHLIFYPRLSYRLVLGAAGTGKSGSFVSGDSYAFFHLKGGRFGLALS
FT                   DGMGTGPQAALESGTTVSLLRRLLESGFGQDVAIKTVNSVLILRSPGESFATVDLTVVD
FT                   LNTGQADLVKIGAAPTFIIRGGKAAQVRAGSLPAGIIEDIEVVSLRRALEPGDVLVMVT
FT                   DGILDAYHGPGDREEWLAEVLLQIGNVPPQEMAELILKLAQTAAGGPSRVPDDMTVVVA
FT                   RLEIQKDMKKNKTGPVV"
FT   CDS_pept        186215..187141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0192"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58373"
FT                   /db_xref="GOA:A5D5X3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X3"
FT                   /protein_id="BAF58373.1"
FT                   /translation="MAACIFFFLMIVSAGFFLCEVFKRCRYVKLGRAENRFDRPFERWR
FT                   YFFTHALGQRKVFDYPVFGVFHLFIMWGFLVLLAGMPNMIAEGLYRARIPHVGDNPAYL
FT                   LLKDLFIAFVITGIAGSLVRRTVRKPDWLKNTPAAFVILLLILVVVTTEVLFHGSQFAL
FT                   GEGADFAGAAPLAYASSRLFAGMSEGALLTARALFWWIHFLAVFSLFFIIPRSKHLHMV
FT                   FAPFNIYWRSLEPKGSLKKIRLEGENAKIYGAGKLEDFTWKQLFEAYACVKCGRCDGAC
FT                   PAHQSGEPVKPKRFNGRLRKHNSRQFE"
FT   CDS_pept        187257..189458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0193"
FT                   /product="hypothetical protein"
FT                   /note="containing SLH, S-layer homology domain."
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58374"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5X4"
FT                   /protein_id="BAF58374.1"
FT                   /translation="MTSRALPALNVTAGATINSAPVQITVTVPAGTTVSAPAGWDGTIN
FT                   MPTVQTATQELAGAVASSGTVSAVIEIGYGDVPLTFSQPVRILIPGQAGKGVGYYRDGI
FT                   FTKINPISGDSAAALGANSDGYVSVGSDLVVWTKHFTQFVTYTPTGSGGTGGGGGSSGG
FT                   DIQAPTWPNKTFKTATKAGQTVILEWYSATDNVGVTKYRIYHGTEQIGEVDGNTTKFTY
FT                   TAPSGSGTGSLPYSVQAGDAAGNWSTDGPSVTLGGSNLPLIVEYGVYRYDPGSNTTPPT
FT                   PVGSVLTSGKLTGVPTTFSSNTAIGIRFATNVATSTYFSSNQAAFRLLDASGNSVSIRV
FT                   DRSGDGTPSDVNRNYLFVIPQVALKSGSSYKIIIGPDLTSNNGMSAGVQQEIEFTTAGS
FT                   AESPGVSGPVTTSGPTITTGSASVDPSTGATVGLGDNARIVIPANALKGTSSVTVTVKE
FT                   VTSPPAVPSGYKIAGKVYEFTVGDQAGYTFNTKVGITLSFDPSALSSGETPAIFYYDEA
FT                   KGQWVNLGGTVSGNTITVEVDHLTKFAVFVVKKTAAPVVQPGTLTDIVGHWAEADIKKL
FT                   VGLGAVSGYPDGTFKPDSTITRAEFATVLVKAFKLDLRTARLFKDTAGHWARDYISTAA
FT                   VFGIVNGYDADTFGPDDLISREQMAAMIVRAVKLELINEETKFADRADISEWARSAVAT
FT                   AVKNGIIKGYTDNTFRPQGNATRAEAVTVIVNTLRLQIH"
FT   CDS_pept        189636..190514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0194"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58375"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5U3"
FT                   /protein_id="BAF58375.1"
FT                   /translation="MAEYDLIIKVLVERYMDKIASFVRGVPVAVEQIEDKDKEAVAVQR
FT                   TSDALVKVREDGYEYLMLVEFQARPDRKMARRLLEYTAMHHCRHEKPVYPVIINLTGGS
FT                   LQDGWYTFECLDLTVVNFNYRQINLQDIAGRELLYRGPVGLLPLAPLMSHDEPPEKVLD
FT                   KCARRLQSEVEAEDDRALLYLALAALASLKYPKDLILRVLEVSRLENIPLFDGIREEWE
FT                   AKGRIEGKNEGKIEGMVEMLFDLVEARFGEVPDELRNRLVVLKGHEEIKRAMRKAISAE
FT                   TIEEYMARLEH"
FT   CDS_pept        191164..191652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58376"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5U4"
FT                   /protein_id="BAF58376.1"
FT                   /translation="MVTSLQPFTPYYFRVTAVNGSVEGGFSPDVLATTPADTAAPAWPD
FT                   NSALTALPSGGEVVLSWPAASDNVSVTGYQVYLDTTQLTTVSGTTYTVTGLSTGSYNFS
FT                   VIAVDAAGNTSPPLTASVTIDTVPPTTGSASVDPAVGATVGLGDNARIVIPPLSVSRP"
FT   CDS_pept        191885..192946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BenE"
FT                   /locus_tag="PTH_0196"
FT                   /product="Uncharacterized protein"
FT                   /note="involved in benzoate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58377"
FT                   /db_xref="GOA:A5D5U5"
FT                   /db_xref="InterPro:IPR031563"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5U5"
FT                   /protein_id="BAF58377.1"
FT                   /translation="MPFAMGYIMIMKIEPLGLLVTLGILLICSGLYYRTPIPIQPMKAI
FT                   GSAAITQAAVITPGMVWGAGLFTGIFWLTMGLTGALDIISRIVTKPVVRGIVLGLGFSF
FT                   IMEGIKMMKSDFIAAIIALAITFMLLNSKRVPAMFVLIIFGFIAALVRNPDLFKELSGI
FT                   RFDFQLPHFVLGQITWSDFVKGTLILGIPQVPLTLGNAVIAITAENNMLFPERPVTERK
FT                   IAVSQGVINLISPLFGGIPMCHGAGGMAGHVRFGARTGGALIILGVVLLVTGLCFSSSI
FT                   LLIFKIFPLSILGVILFFAGLELAASAHDAGREKSDSYILLVTAGFAIWNMGAGFIAGI
FT                   IMQELLKRKVFKI"
FT   CDS_pept        193295..194716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MesJ"
FT                   /locus_tag="PTH_0197"
FT                   /product="predicted ATPase"
FT                   /note="PP-loop superfamily implicated in cell cycle
FT                   control"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58378"
FT                   /db_xref="GOA:A5D5U6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5U6"
FT                   /protein_id="BAF58378.1"
FT                   /translation="MSLLHKVRENICRHRMVERGCKVLVAVSGGPDSVALLHALYLLKE
FT                   ELEISLHVAHLNHMFRGAESEAEALFVADMARRYGLPATVEARDVPAYQKQSGLSAQAA
FT                   AREVRFRFFSEAAGKAGASRVALAHHADDQAETILINFLRGAGITGLKGISPVREGFYI
FT                   RPLLTVRRAEIERYCKEMKLPYCRDSSNLKAVYTRNRVRLELIPLLEKEYNPALVPTLL
FT                   RLGEICREEDAYLAEQAVKAFQAVLREKVSGRVVLRLDAFKQMPPAIRRRVVQQAWRSL
FT                   TGAEENLAFQHVEAVLDLIQKGGTGSSVVLPGSVSAIRSYGTVELVEKMTGRAVPYYVY
FT                   PLKVPGATFIPELGCTIYAELYPRVKAGDPASLPATEALLDFDKLPAQIFVRRRRAGDV
FT                   FCPFGLTSEMKLKDFFIKQKVPREERDRIPLVGTPDEIVWVGGVRTGEKWKVDQNTARV
FT                   LHLRLVCNLEGEAGF"
FT   CDS_pept        194845..196674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HflB"
FT                   /locus_tag="PTH_0198"
FT                   /product="ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58379"
FT                   /db_xref="GOA:A5D5U7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5U7"
FT                   /protein_id="BAF58379.1"
FT                   /translation="MNKVVKNLSIYLLIVLVIIAMIKYTAPAKNVPLSMTYSKFYEDLN
FT                   QGQIKKVVIQSENLTNIITGEKKDGTKFETKGPAADAELYSLLKEKKVEWQSELPPQPG
FT                   WWTSLLTTLLPIILFVVLFFFLMQQTQGGGNRVMSFGKSRARLHTDDKRKVTFADVAGA
FT                   DEVKEELEEIVEFLKNPKKFQELGAKIPKGVLLFGPPGTGKTLLARAVAGEAGVPFFSI
FT                   SGSDFVEMFVGVGASRVRDLFDQAKKNSPCIVFVDEIDAVGRQRGAGLGGGHDEREQTL
FT                   NQLLVEMDGFSPNEGIIILAATNRPDILDPALLRPGRFDRQVVVDAPDVNGRKEILKVH
FT                   MRGKPIDESVNLEVLARRTPGFTGADLANLTNEAALLAARQNRKKITMADLENSIERVI
FT                   AGPEKKSKVISEKEKWLVCYHEAGHAVVGYLLPNTDPVHKVSIIPRGRAGGYTLLLPKE
FT                   DRYYATKSQLLDQVTMLLAGRVAEQVVLKEISTGAQNDLERSTDIVRKMVMEYGMSDLG
FT                   PMTYGRKQDTPFLGRDLARDRNYSEEVANAIDVEVRQTIDRSYNKAKELLEQHMETLHL
FT                   VARTLFEKETIEAEEFAELMKKAGEIERQDRVK"
FT   CDS_pept        196757..197206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Ndk"
FT                   /locus_tag="PTH_0199"
FT                   /product="nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58380"
FT                   /db_xref="GOA:A5D5U8"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5U8"
FT                   /protein_id="BAF58380.1"
FT                   /translation="MERTYLMIKPDGVQRGLVGEIIARFEKRGFKIVGLKMIRIGRELA
FT                   EKHYGEHKGKPFFEPLVGYITSSPVVAMVIEGKNAVGAAREMMGATDPLKAAPGTIRGT
FT                   YGIDIGRNVIHGSDSPASAQREIALFFSADELMEYGLELDRWVYE"
FT   CDS_pept        197245..199005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MIS1"
FT                   /locus_tag="PTH_0200"
FT                   /product="formyltetrahydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58381"
FT                   /db_xref="GOA:A5D5U9"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5U9"
FT                   /protein_id="BAF58381.1"
FT                   /translation="MAFDATRMKDFEIAEAAEANMPSPEEWRERLGLEKSEVIPYGRIC
FT                   KLDFMKIAERLKNRPDGKYIEITAITPTPLGEGKTTTTLGLVEGLGRRGLNVGAAIRQP
FT                   SGGPTMNIKGTAAGGGNALAIPMTEFSLGLTGDINDIMNAHNLAMVALNARMQHERNYS
FT                   DEELARRNLRRLDIDPTSVAMRWVIDFCAQGLRRIIMGIGGRMDGYLMESGFDIAVSSE
FT                   LMAILAVATSLKDLRDRIGKIIVAYDRKGNPVTTSDLEVAGAMCAYMRNAINPTLISTV
FT                   EYQPVLVHAGPFANIAIGQSSIIADRVGLKMFDYHVTESGFAADIGFEKFWNVKCRLSG
FT                   FVPNVSVITTTIRALKMHGGGPAVVPGRPLPEEYMKENLELLERGIPNLLHHISIVKKS
FT                   GVKPVVCINAFSTDTREEIAMVRRYAEQAGARCALSEHWLKGGEGALELADAVIDACNE
FT                   KVDFKYLYPQEMPLRQKVEVIAREVYGADGVSWTPEAEAKAKRFESDPAFDGFATIMVK
FT                   THLSLSHDPYLKGVPKGWVLPVRDVLVYAGAGFLCPVAGSVSMMPGTGSDPAYRRIDVD
FT                   VNTGKVLGLF"
FT   CDS_pept        199330..201240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0201"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing methyl-accepting chemotaxis protein
FT                   (COG0840) and Cache domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58382"
FT                   /db_xref="GOA:A5D5V0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V0"
FT                   /protein_id="BAF58382.1"
FT                   /translation="MVGKVTGSLRLRMTILFGLVVLIGCLVLALVSEFKSTAALEGEAK
FT                   EAMLKVARQAAETVDSQVRARVYVLEVLANNSIIRGVSAGREAALEEKLSVLREAQKAA
FT                   EGLGFKEFTVVDREGNGNISNGGKVYVADREYFKTALSGKLCITSTLISKADNSVVFSY
FT                   NLPIRHHATGEITGVLTGIVDGAKFSELIGAVTYGRTGHALAVDGAGKIIAHKDAERVR
FT                   AQENIVEQAASNKDLASLAAVVAKMAKGEEGVEGYVLQGQNMLIAYAPVKTTGWSVAVT
FT                   APVNEVLERAAGLKWAMLAVSLAIIVLALVLTYVMAKTVAEPLSQAVNYLGQLAEGNFT
FT                   SRVQEKHLKRNDEIGRLAQAVDRMWTSLREMFLTIREDAQNLAANSEELAASAEEVSAT
FT                   VEEVASTTGEVASMAEKSLENASRTAEESRNVVAVAESGGATVGKTIEKINSIAASAAR
FT                   MGESVQNLGELSARIGNITDVITGIADQTNLLALNAAIEAARAGEQGRGFAVVAEEVRK
FT                   LAEQSADAAKEIGQLIGQIQSGVEAAVKAMEYGSAEVKDGVELASQAGAALRDIIGAVN
FT                   KNIGLMEEIIQGARQASEGMQQLSASNEQVTSTIQQVAGATQQLAEIASRLQASVNRFK
FT                   I"
FT   CDS_pept        201551..203140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0202"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing HAMP (Histidine kinases, Adenylyl
FT                   cyclases, methyl binding proteins, Phosphatases) and MA,
FT                   methyl-accepting chemotaxis-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58383"
FT                   /db_xref="GOA:A5D5V1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V1"
FT                   /protein_id="BAF58383.1"
FT                   /translation="MKLKVGAKMLAGFLIVLAFLLAVGVTSALFMRSIAKDVETINTIK
FT                   KELGFQKGIDNNFNIAVSGLRGLIAYGTEKYKDEYKNAMSQVIEMEKSLLEISSPEKKA
FT                   TVQKLIELTTAYDESTPKELFPAIEKLRRASGEKEVEEAKNEIAAVAGKWQPVTYQIKE
FT                   IVNGFISNNDKLYQEKFENINKNIVRSIYVSLIMTVTALFLGIGLSILITGSIKKPIHL
FT                   MMEGAKRFAEGDFTTPIEVKSADELGSLAGSLNGMAEQLKAHINEIIANAQILASNSEE
FT                   LAASAEEVSATVEEVASTTGEVASMAEKSLENASRTAEESRNVVAVAESGGATVGKTIE
FT                   KINSIAASAARMGESVQNLGELSARIGNITDVITGIADQTNLLALNAAIEAARAGEQGR
FT                   GFAVVAEEVRKLAEQSADAAKEIGQLIGQIQSGVEAAVKAMEYGSAEVKDGVELASQAG
FT                   AALRDIIGAVNKNIGLMEEIIQGARQASEGMQQLSASNEQVTSTIQQVAGATQQLAEIA
FT                   GRLQASVNRFKI"
FT   CDS_pept        203956..205155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0203"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing FolP Dihydropteroate synthase and related
FT                   enzyme (COG0294)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58384"
FT                   /db_xref="GOA:A5D5V2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V2"
FT                   /protein_id="BAF58384.1"
FT                   /translation="MGIRVYSIIAENMEEAHRLIASVGADRAGCDWMAPKAVHRLVMLD
FT                   GVRPEQANIIKQEMLAKGGEAAVSRGVVDHSVAETRVLLMGTLRQYGAFLAKLKCQPFG
FT                   LAALAGRIKEVLDGQEGYRPYDLDCRGKTLRLGERTLVMGILNVTPDSFSDGGRFCEPG
FT                   QALERAWQMVSEGADIIDVGGESTRPGYIPVEAGEELARVVPVLKRLAAEIPVPLSIDT
FT                   TKASVARQAMEAGAHIINDQWALRADPGLAAVAAEYGAPLVMMHNQNGTRYRDLTGDMV
FT                   EYFQESIAAAEKAGVDRAKIIVDPGFGFGKTPEQNLEMLRRLKELRCLGRPILVGTSRK
FT                   STIGKVLDLPVDQRVEGTAATVAVAIVNGADIVRVHDVKEMARVVKMTDAIIRGNTGAV
FT                   "
FT   CDS_pept        205164..205622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FolB"
FT                   /locus_tag="PTH_0204"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58385"
FT                   /db_xref="GOA:A5D5V3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V3"
FT                   /protein_id="BAF58385.1"
FT                   /translation="MPGTGRQVASAKYKERCGCFMDKLIIEGMEFYGYHGVLPEERALG
FT                   QRFVVDVELYLDLRPAGESDSLEHTVNYAGVFELVRSIVCGRPYRLIESVAEAIASAVL
FT                   DRFQVAEAVVRVKKPFAPVPGRFSWMAVEIRRQGGGFSGRTQGGGRDA"
FT   CDS_pept        complement(205237..205962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58386"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V4"
FT                   /protein_id="BAF58386.1"
FT                   /translation="MRDRQGRSIYFLVTVNKQVKVDQARAPADGAHPPEPSFDVQQEGK
FT                   QFVRPKAGLHLGHGVEKPVLPGVAQRGGPVKRRHSLHPHAGGSLQHFQRPFDIGLLVAH
FT                   VAAQPDICSPKHRGLRPASSRKNLRPAFLFPRPSRKTGRARVQKAFSRAPPLQPPESDP
FT                   ARRKLLPRPPTRSGGKGARKQLTAPAQRRRRNLRYAPDCPTLRPGAGPGKAPRQPQSVA
FT                   PGRAPPAAPRGSRKIPCLQ"
FT   CDS_pept        205615..206106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FolK"
FT                   /locus_tag="PTH_0205"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58387"
FT                   /db_xref="GOA:A5D5V5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V5"
FT                   /protein_id="BAF58387.1"
FT                   /translation="MLRTAYIGLGSNMGDKKANIERALEMLKASAGVRVKRVASLYRTA
FT                   PLGYTRQDWFLNTVAEVETGLGPHELLALLLDIERRLGRVRTVRWGPRLIDLDLLVYGD
FT                   EEIDTPALTVPHPRMGERAFVMVPLAELVPDLTVPGRGRAAELAEKLAGEQKICRFAVN
FT                   "
FT   CDS_pept        complement(206338..207399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiH"
FT                   /locus_tag="PTH_0207"
FT                   /product="thiamine biosynthesis enzyme ThiH and related
FT                   uncharacterized enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58388"
FT                   /db_xref="GOA:A5D5V6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V6"
FT                   /protein_id="BAF58388.1"
FT                   /translation="MTGAIASKVLEGKRITEEEGLCLLTGADLLTLGYLADRVRRRLHP
FT                   HRRVTFAADRNINYTNVCVTGCAFCAFYRPPGHPEAYVLSRAEIFKKIEETLAAGGTQI
FT                   LMQGGLHPDLDLDYFEDLFRAIKQRYPVQIHSLSPVEIDYLARTSGLPLETVIRRLAAA
FT                   GLDSLPGGGAEILADRVRKLISPRKIGAGRWLEVMKEAHLAGLKGTATMMFGSVETPAE
FT                   RIAHLEAIRRLQDETGGFTAFIPWSYQPGNTALGGRAASAADYLRTLAVARIYLDNVPN
FT                   LQVSWVTQGTKIAQIALAFGANDFGSTMLEENVVRATGVSFKASLAELVHNIREAGFQP
FT                   AQRDNLYNIIRLF"
FT   CDS_pept        complement(207368..208228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0208"
FT                   /product="predicted periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58389"
FT                   /db_xref="GOA:A5D5V7"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V7"
FT                   /protein_id="BAF58389.1"
FT                   /translation="MERPRLGRVSYINCLPVFHAIEEGLVEVPARLCAHHPSQLNAMFR
FT                   EGLLEVTAVSSIEYARQQESCLILPGLSIASDGPVRSVALLSRLPAERLAGRRISLTPY
FT                   SATSVVLLKVLLQRFCGVKALFFTRPPGSPAWWGEPDASLVIGDEALMEVNRAGSLHVY
FT                   DLGEEWKRWTGRPMVFALWVARPDFARRQPRQLAAIWKGMISSKKWGQEHHEELVARAK
FT                   SLTSLPEAVLSDYFRCLKFDLNWDHLDGLMYFYRCAAECGLAEPSAVLNIWGKEDDRCY
FT                   RIQSA"
FT   CDS_pept        complement(208230..209342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiH"
FT                   /locus_tag="PTH_0209"
FT                   /product="thiamine biosynthesis enzyme ThiH and related
FT                   uncharacterized enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58390"
FT                   /db_xref="GOA:A5D5V8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5V8"
FT                   /protein_id="BAF58390.1"
FT                   /translation="MVHNLEEGPLAGVARKVLDGRRLSREDGIRLWESDDLPAIGLLSD
FT                   YARRRKVGNDVFFINNAHINHTNVCRNLCELCAFGKKPGDRGAYTLSIEEIAARAEKLR
FT                   GLGITEVHIVGGLNESLPFSYYEEMLRTVKEILPEVHIQAFDAVEIDFLGEISGLDLEE
FT                   VLLRLKEAGLGSLPGGGAEIFNPAVRKRICSKKIGPERWLEVHEKAHRLGFRSNATMLY
FT                   GHLESIEDRVDHLIALRELQDRTGGFLAFIPLAFHPKNTSFEHLPGTTGMMDLKALAIA
FT                   RLMLDNFDHIKAFWIMITPKVAQVSLSFGVDDLDGTVREERIAHEAGAETAQYQPPEAF
FT                   LQMIREAGRTPVERDTLYNVIRRYGPERSL"
FT   CDS_pept        complement(209332..210210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Pnp"
FT                   /locus_tag="PTH_0210"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58391"
FT                   /db_xref="GOA:A5D5S4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5S4"
FT                   /protein_id="BAF58391.1"
FT                   /translation="MRSSAAEVPRADIGFIGGSGTFSLSFPEDLNRTGTEILGSGLIFR
FT                   TPFGESPPLKLFTTGGRRPRTVLAAKMHGRIPGIPWGEASRRLFWVFREAGVQKIIAEG
FT                   GVGSVNRLLDPRDIVVPDDYIDFSMRRDTSIGEEHLLVMRQPICPSLRLTLVEAAAGSP
FT                   SGRVFSRGVYLVTDGRHFESPAEVALFRQWGADVVGQSLCPEVYLAREIGACYAGIYLV
FT                   VNYGEGTVKPWEYRVLKDIFFEDAVPFGSIIMQALESVNLEAECACRGLRKPTLLRPEN
FT                   IGLKRRRPDGA"
FT   CDS_pept        complement(210203..210814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AcrR"
FT                   /locus_tag="PTH_0211"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58392"
FT                   /db_xref="GOA:A5D5S5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5S5"
FT                   /protein_id="BAF58392.1"
FT                   /translation="MAYRRTEKVGKKLEEKLKAILQAAQVVFAEHGYHGTSIKEVARRA
FT                   GVATGTIYLYLRNKEALFAAVVDEIYETVISKIAERRKGAFGIREKLKASMEAAIEALG
FT                   RHRELAKVVLLQTAGSNPAFGEQLADLLGRLAELVEEDIREAMETGLIPPQDSRIAAAA
FT                   FIGTFYNVVLSWLRKGYPASLEEAAGPLVEYNLRGLGFHA"
FT   CDS_pept        210932..211951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SplB"
FT                   /locus_tag="PTH_0212"
FT                   /product="DNA repair photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58393"
FT                   /db_xref="GOA:A5D5S6"
FT                   /db_xref="InterPro:IPR023897"
FT                   /db_xref="InterPro:IPR034559"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5S6"
FT                   /protein_id="BAF58393.1"
FT                   /translation="MAFKPARVIFEQDALKYPLGEKLYRFFRDKGTDVSFAASHNRVSA
FT                   IPGRTRSEKYFEAKRTLVVGVRRTTAFETCKPSAHFQLPLATSCPGKCEYCYLLTNLGK
FT                   KPYVRIYVNIEEILSAARGYIEDRKPQVTVFEGAATSDPVPVEPYTGALARAVEFFGGQ
FT                   EYGRFRFVTKFTEVDTLLDVPHNGHTRFRFSINTPEVIRRFEHATPPLAERLAAAWKVA
FT                   AAGYPLGFLVAPIILYDGWRDSYRDLFKTAAAGLNGKVYDLTFEFITHRFTKRAKGTIL
FT                   EVFPSTRLDLDEEARAFKFGQFGYGKYVYPKELFSDAKIYFEGLAGEYFPGSKVEYFV"
FT   CDS_pept        212176..213261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0213"
FT                   /product="hypothetical protein"
FT                   /note="containing partial XerD (COG4974), site-specific
FT                   recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58394"
FT                   /db_xref="GOA:A5CZD6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5CZD6"
FT                   /protein_id="BAF58394.1"
FT                   /translation="MLVDSDGEPVLPVMRFIKFKDNSGAARNSLRAYCQHLKLFFEFLE
FT                   QEELDYRKINIDEMAAFLRWLQNPYGNLKVIPVTPVTSPRGPATVNTVISTVLNFYDYL
FT                   MRHEDYSVQLSERLKKTIPGSRRGFKDFLYHINKDKEYPAKILKVKVRRSRPKTIPKEQ
FT                   VGKLIDACSNLRDKFLIQLLWESSMRIGEALALWLEDFEPDGQKIHIRDRGELPNLAEI
FT                   KTICSPRTVDVSPDLINLFFDYVAEFHTDEVDTNHIFIKLSGKNQYQPMEYQDVASLFR
FT                   RLKAKTGIDVSPHILRHSSLTELRRAGWKPEHLRKRAGHAHVQTTMQIYLHPSDEDLRK
FT                   DWEKAEEKMRLKRQQKEGSEH"
FT   CDS_pept        213258..215228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XerD"
FT                   /locus_tag="PTH_0214"
FT                   /product="site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58395"
FT                   /db_xref="GOA:A5D2D5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5D2D5"
FT                   /protein_id="BAF58395.1"
FT                   /translation="MSTVYRPAPTPAKLQEIEETLTGCWKEDVWDITDPIFDEFRSERW
FT                   TLPNKIIDFSRLQPGIKEEVKFFFVHRLREHTLRLQTAVVYGFCFARFADFLERAYPRI
FT                   RSFTYLEIERVMTRWRSYLVEQGVSVSKKGRLSSTQYETLLQQVYQFMVNFYDEREEFE
FT                   KNVWDMRKIPGAKYTQNKAHYLLSFTDIPLPFRPLAKRYLKVRVGIRSYAQCATDLMAL
FT                   RLFLRFIHKQYPDWKDLKSLSRKDMENYLLWYRSYTEGWQKRHYEYLVSLRNFLDYIQQ
FT                   AGYPEAPEKPYVSLLFKEDFPKLAKRSEEDIKFIPEGVLRQLEENLDQLTPPEYIPVIV
FT                   ILRATGWRSSDILNLRYDNCLDRTAQGWWLCGDILKTQVLNHRVPITDEVATVVQAVVD
FT                   EVEEKSTPENNPKKLLFVRLDGKRRGRPPMGSSIRRALNILAQKCSIVDDQGRLFHFGN
FT                   HAFRHTKGVELINNGMNLVHVQKWMAHASPEMTLRYARILDTTMRKSWEEATKNGLFRI
FT                   DPTGKPVKIDPSDVENEGLIEWEYIRYNLDAVRTPLGYCLKPHKVECKHQLNPCLTCRN
FT                   LCITPDFIPQFEAEIREVKAVIERGKAQGRTIWVEKNEVILGRYEAILTVLKEGHTHHL
FT                   AGKKGREYVGEERLNVRQTPA"
FT   CDS_pept        215206..215595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58396"
FT                   /db_xref="UniProtKB/TrEMBL:A5D2D6"
FT                   /protein_id="BAF58396.1"
FT                   /translation="MSGKHQRNTEGMKKHARRKSEETVKKVDEAIQRLIKAGEKINFNS
FT                   VSLEARVSKSYLYTHQEIKERIENLRKQQEAVPSPKHIKREMTDASKDIIIAAKNKRIK
FT                   ELEAENKRLKEELKILQGKLYESLE"
FT   CDS_pept        216298..217974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Mod"
FT                   /locus_tag="PTH_0216"
FT                   /product="adenine specific DNA methylase Mod"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58397"
FT                   /db_xref="GOA:A5D5T0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5T0"
FT                   /protein_id="BAF58397.1"
FT                   /translation="MATLNFKGKAFVQNYHLMVKYHQLVPKKEKSLTDKVSLNDNLIIH
FT                   GDNLKALKALLPNYAGKVKCIYIDPPYNTGNEKWVYNDNVNSPMMQEWLGKVVDREDLT
FT                   RHDKWLCMMMPRLKLLRELLREDGVIFVSIDDNEVHHLRMLMDEVFGDQNFIACIVVQL
FT                   NPRGRTLDRFLAKTHEYILLYAKDVTKDNAVNLIQKEGIVLKTYNKQDEKGIYRELELR
FT                   NRNPVFNRENRPNLFYPLYVNSETGQVSLTRDKKHSIEVLPKNSRGIDGCWTWGREKVA
FT                   SNISKLVGRQASTGAWRIYRKDYLYDESGDVTVTKSKALWVEKNINNENGKEVCNEIFL
FT                   KCPFDFPKSPELVKRCIKLGSGNTDIVLDSFAGSGTTAHAVLELNKEDGGNRKFILVEC
FT                   EDYADEITAERVRRVIKGVPGAKEQKLREGLGGTFSYFELGDPIEMESILEGDNLPGYL
FT                   ELARYIFYTATGEEFDPEKVDMERSFIGESRDYEVYLFYKPDVEYLKSTALTLDVAKRL
FT                   GQYKGKRRLVFAPTKYLDAEHLLEYKIDYCQLPFEIYRLRD"
FT   CDS_pept        217979..220495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0217"
FT                   /product="hypothetical protein"
FT                   /note="containing COG1061, SSL2, DNA or RNA helicases of
FT                   superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58398"
FT                   /db_xref="GOA:A5D5T1"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5T1"
FT                   /protein_id="BAF58398.1"
FT                   /translation="MELKEYQKKALEQVKRYLEALAEYKAKNEKAIQIDPDLSINFPLK
FT                   AWEKVVRTPYLSKKNGLGEYLPDFYLKIPTGGGKTLLACHTIDLINRVYLRKQTGIVLW
FT                   IVPTTQIYRQTLANLKNREHPYRQVLDIASGGRTLILEKTDRFTPIDVEESLVVMLLML
FT                   PSASRQNKEVLKVFKDSGGFAEFFPPDDDRDGHEKILKQFPNLDYFGDENNFWGRIVKT
FT                   SLGNVLRILRPVIIIDEGHKAYSNIAQETIRGFNPAIIVELSATPPKYANILVSITGQE
FT                   LNREEMIKLDLHITNKASPDWKDTMLAAVEKRNVLELKAKEYGANTGEYIRPICLVQVE
FT                   RTGREQRGTRFIHAEDVKEYLIKQCGIREEEIAIKSSEKDDIEGIDLLSKGCPVRYIIT
FT                   RQALQEGWDCAFAYVLAILTNPASQLSITQLVGRILRQPGARKTKVKELDESYVFCYRQ
FT                   RAKEVLDGVKAGFEAEGLGDLTGRVSVEEGDEESTEATKERFVSYRERFKKFEGRVYLP
FT                   KFVIQESDGWREVNYEMDILSRIDWSKVNLQELIDIPLTEMKANEEEVTVGLSADKEKV
FT                   IEEKERIAREGGLEIDTVFVTRQILDIVPNPWTAYDISKKVIDLFLAKYGEKTVANNLV
FT                   FIVEELRKHLAGERDRLAEQVFRTLVKQKILCFFLLSGQGGYKLPSRIRVRKTSKSLVR
FT                   YDNTPIQQSLFDFVPEEEFNETEKAVAIYLDEQEKLLWWYRNLSRQDYYIQGWKKHKIY
FT                   PDFIFAEANAERRDDYNKVYVIETKGLHLKNEDTYYKKNVFDFCNRLGQQKDWRELDLE
FT                   FDDKKIEFQVIYEDEWKAKINKIFEI"
FT   CDS_pept        220551..220946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0218"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58399"
FT                   /db_xref="GOA:A5D5T2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5T2"
FT                   /protein_id="BAF58399.1"
FT                   /translation="MDEVLKFLTDNPVFYIATVDGGRPRVRPFGFVMKYEGKLWFCTNN
FT                   QKNVYKQLRENPYFELCTASPDRKWLRLKGRAVFNSTPQAKAKALEVMPELKAMYSADD
FT                   PIFEVFYVEEGEATFYSLTGETRTVKL"
FT   CDS_pept        221263..222225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0219"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58400"
FT                   /db_xref="GOA:A5D5T3"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5T3"
FT                   /protein_id="BAF58400.1"
FT                   /translation="MTKPSIAVVGAGKVGSALALLLSRQGYRVAGVASRSISSALSVAL
FT                   QVNAAASDRPEMVTPGAEVVFITTPDRVIARVAGEIAERGGFKPGQVVFHTSGAHSADE
FT                   VGAARRAGAFAASLHPLQSFADVKTAMENLPGSYFALEGDGQALAVAEQIVRDLGGRSF
FT                   FIAAEDKPLYHAAACIASNYLVSLLHFATGLYGRFGLSREEAFRALLPLIEGTLRNTGR
FT                   AGPARALTGPVARGDGPTLEGHLEALKEVGRQELELYCKLGLYTVTVALEKGSISAGQA
FT                   RELEKIFKEADLNGPGESNNRHDQADEGRGQAGNHAYGI"
FT   CDS_pept        222143..222979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PanB"
FT                   /locus_tag="PTH_0220"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58401"
FT                   /db_xref="GOA:A5D5T4"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5T4"
FT                   /protein_id="BAF58401.1"
FT                   /translation="MDQEKVTTATIKQMKAEGRPVTMLTAYDYPMARMVDEAGIDMILV
FT                   GDSLGNVVLGYDSTLPVTMEDMLHHVKAVCRGVSRAMVVADMPFLSYQVSVEEAVRNAG
FT                   RFLKETGAQAVKLEGGQEVAGAVRAIVNAGIPVVGHLGLTPQSIHQLGGFKVQGREERA
FT                   ARKLLSDARALEEAGAFCIVLECVPAPLAKVVTEKLQAVIIGIGAGPYCDGQVLVTHDL
FT                   LGLYPKFTPRFVKKYLNLHENIAAALKQYKEEVEERTFPGPEHSFGMSEEVLKKLY"
FT   CDS_pept        223085..223933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PanC"
FT                   /locus_tag="PTH_0221"
FT                   /product="panthothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58402"
FT                   /db_xref="GOA:A5D5T5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5T5"
FT                   /protein_id="BAF58402.1"
FT                   /translation="MLVCNTISEIRAFVREARSKGRSIGFVPTMGYLHEGHLELMRRAK
FT                   ERCDTVVISIFVNPTQFGPNEDYDRYPRDLERDARLAGQVGVDAIFNPSVEEMYPAGYC
FT                   TYVDVERLTGKLCGLSRPGHFRGVCTVVTKLFNIVKPDYAFFGQKDAQQALVIKRMAAD
FT                   LNMDLEVITVPTVREADGLAMSSRNVYLDPEQRRAALVLSRSLEKAGEAFRAGERDASK
FT                   LRQMVLDMIKAEPLANIDYVEIYSYPELEPLDQINGPALLALAVKIGQTRLIDNAILGQ
FT                   L"
FT   CDS_pept        224036..224434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PanD"
FT                   /locus_tag="PTH_0222"
FT                   /product="aspartate 1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58403"
FT                   /db_xref="GOA:A5D5T6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5T6"
FT                   /protein_id="BAF58403.1"
FT                   /translation="MFLTMLKSKIHRATVTESNLNYMGSITIDEELMEAADILPNEKVQ
FT                   VVNNNNGARFETYVIKGPRGSGVICLNGAAARLVQPGDLVIIISYAIMDAGEARTYRPA
FT                   VVMVDGRNKIVEVRQGEAHGPAGADTCP"
FT   CDS_pept        224689..226272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NadB"
FT                   /locus_tag="PTH_0223"
FT                   /product="aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58404"
FT                   /db_xref="GOA:A5D5T7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5T7"
FT                   /protein_id="BAF58404.1"
FT                   /translation="MPERYMLNFDTRNLPQEEDEYIILGSGIAGLYTSLAASQAGGSVT
FT                   VLTKQTMMDTGTDKAQGGIAAALGDTDSPALHREDTLVAGAGLCDAEAVNALVSEGPDR
FT                   VRELIKLGAIFDCDNEGLCLTREGAHSRRRILHASGDATGAEIQRVLTKRVLEDDRVKV
FT                   LENHYVVDLLVRENVCYGVLAYDRLARTLKVFRGKVVVLATGGVGRLFEHNTNPEIATG
FT                   DGVAIAFRAGAEVMDMEFIQFHPTVLNLPGAPRFLITEAVRGEGAYLRNSRGQRFMPRY
FT                   HDLAELAPRDVVVRAILKEMAETGSNKVYLDLTHLDPEVIKARFPNITRTCAEYNLDIT
FT                   VVPIPVAPAAHYMMGGVKTNLVGETSIKGLYACGEVACPGVHGANRLASNSLLEGLVFG
FT                   GRIVEETRRFLKDYRLRYPEFACDWLLEPVKMDFASLRKELEVLMGQKVGPVRSGAGLK
FT                   EALEFFDRWSFLSRHQVEGVEEMEVKNMLQVGELVAEAALARRESRGGHYRVDYPDTHR
FT                   RWQKHIIFRR"
FT   CDS_pept        226273..226404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58405"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5T8"
FT                   /protein_id="BAF58405.1"
FT                   /translation="MLPCKQKIHMKERTGARRRLIYKEQDNIDFACGRQYTGVEKYI"
FT   CDS_pept        226435..227502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0225"
FT                   /product="hypothetical protein"
FT                   /note="containing Phage_integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58406"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5T9"
FT                   /protein_id="BAF58406.1"
FT                   /translation="MKAGKLRTPGLFLVICVAALLLLTAGCSLWGGEEEAVNPLVIKPE
FT                   DFGIFLFESSEEIYRANVKDPQMWARLREYADRDPEYAAHYKWLYDTYVRWDEYRRSQL
FT                   KEIMEEYLPQPMSERLIKKGKQTAGLNEVIEFIRTDRFFAKKRSTLVDFYAWYGANYAL
FT                   PHYEQVRPLLQRKADIAAGMVEKGFDIVGFMEKESGIKLKERPGTIELLLNMRMIGASG
FT                   FYRDRDSLTTIQWGIGPEKIWAVPFHELSHSFFATFTRGWYFKYLAWKMKKDEKLMERF
FT                   KEDVPYTWEGWIEENLAEGFSRYISVRKGITRDVGEGIYVFDKEYAEALVSGFNPKNTS
FT                   LKDFTIKFLKQKYNI"
FT   CDS_pept        complement(227479..228315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58407"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5U0"
FT                   /protein_id="BAF58407.1"
FT                   /translation="MGEGAGRNQVDPCCGHGPDVFFADPAGGLHQGAPVNQGHGLLHGR
FT                   RVHVVQHDDVGPGLQGLFYPSQVLHFNLNPGRVGSAPPRRLHRRPDPAGRFDVVVLDQH
FT                   GIVKAEAVIVPAAHPDRVFFKHPEARRGFSGIHQAGLFPGNQFNQPRRPGGNAGQALQE
FT                   IQGQALAGQDRPRPAGQFGQHLAALYPLAVAHQGPELNERVQAQKNPLRHRQPCHHSVL
FT                   LGQYVTAGNGVRRHNAVGGKIAGAYILSQAALDQPVQLNLVQLHVAIPLLYVVFLF"
FT   CDS_pept        227518..228363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NadC"
FT                   /locus_tag="PTH_0226"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58408"
FT                   /db_xref="GOA:A5D5U1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5U1"
FT                   /protein_id="BAF58408.1"
FT                   /translation="MELNQIELNRLIERCLREDIGTGDLTTNSIVPPDAVSGGYILAKE
FT                   DGVVAGLPVAEGVFLRLDPFVEFRALVRDGERIKSGQVLAELTGRARAILTGERLALNF
FT                   LQRLSGIATRTARLVELIAGEKARLVDTRKTTPGLRMLEKYAVRVGGGYNHRFGLYDAV
FT                   LIKDNHIKAAGGIRAAVEAARRGAPHTARIEVEVEDLAGVEEALQAGADIIMLDNMDPA
FT                   AMKEAVALINGRALVEASGRISEENIRAVAAAGVDLISAGALTHSVKSLDISLELRGQA
FT                   "
FT   CDS_pept        228496..229698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NifS"
FT                   /locus_tag="PTH_0228"
FT                   /product="cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58409"
FT                   /db_xref="GOA:A5D5U2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5U2"
FT                   /protein_id="BAF58409.1"
FT                   /translation="MRRIYFDHSATTPVHPEVAEAMYRFLTGDNFGNPSSIHYFGLQAR
FT                   KAVTEAREKVAQAIGASPSEIVFTSGGTEADNMAIHGAAVANRKRGNHVITSAVEHHAV
FT                   LDAVKNLGKQGFEITILPVDEYGMVRVEDVEKAITDKTTLITIMHANNEVGTIMPVAEI
FT                   GKLARERGIVFHVDAVQSFGKIPVNVDELGADLLSVSGHKIYGPKGVGALYVRKGTPWR
FT                   QTLVFGGGQERRRRAGTENVPGIVGLGKAAELALANMEEENRKLTALRDRLIEGVLNRF
FT                   EDVILTGHPEKRLPNHASFCFKYIEGESLLLSLDMKGIAVSSGSACTSGSLEPSYVLLA
FT                   MGIPYELAHGSLRVTMGKDNTEEDVDYFLEVMGPVVERIRAISPLTGKTGEPSLGTAVA
FT                   R"
FT   CDS_pept        229751..230674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NadA"
FT                   /locus_tag="PTH_0229"
FT                   /product="quinolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58410"
FT                   /db_xref="GOA:A5D5Q5"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Q5"
FT                   /protein_id="BAF58410.1"
FT                   /translation="MPVQEDVLELAKEIARLKRERNAVILAHFYQRPEVQDVADFIGDS
FT                   LALSRQAAGTGADVIIFCGVHFMAESASILSPDKIVVLPDEEAGCPMADMVDAVQLVQK
FT                   KQEMPDATVVCYVNTSAEVKAESDIACTSANAVRVVASLPEDRPILFVPDKNLGQYIIS
FT                   RTGREMTLWDGYCSTHDRLTPEDIFKAKAEHPEALVLVHPECRPEVVALADSVSSTAGM
FT                   IRFARESSAREFIICTEKGILHQLRKQCPDKQFYLASDKLVCPNMKKTTLDKVYRALVD
FT                   LEPRVTVQEDVRERANRCLERMLAVR"
FT   CDS_pept        230763..231077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0230"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58411"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Q6"
FT                   /protein_id="BAF58411.1"
FT                   /translation="MAKKWYITTALVGVLALAVLAPGALAAVTGNQVDSVRLNKMFDEH
FT                   KQWVIQAVENGEITPEQGEAWNQHFDQMKEFHAKSGLDCHDSSGEMMGGPAGHAQCNSY
FT                   "
FT   CDS_pept        231295..233757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ZntA"
FT                   /locus_tag="PTH_0231"
FT                   /product="cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58412"
FT                   /db_xref="GOA:A5D5Q7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Q7"
FT                   /protein_id="BAF58412.1"
FT                   /translation="MKGVEAAAVGAKPEGLKKLTVKIAGMSCAACASRVEKALSKIPGV
FT                   EDARVNFAAETATVDYHPELVSPATIFDKIKETGYRPVMGRAELKLSGMSCAACAARIE
FT                   NGLNKLPGVARAAVNFATEKAIVEFDPAEIDVPRIKKAVADIGYRAYEVDDRTTAGLER
FT                   EEREREIRRQKSLVIFSGILSAPLVVYMLAMVFNLHHKIPAFFLNPYFQFALATPVQFI
FT                   AGANFYKEAYVALRGRSANMSVLVALGTTAAYLYSAAATFFGGRIGVSEVYYETGAIII
FT                   TLVLLGKTLETIAKGRTSEAIKKLIGLQARNARVIRNGQEIEIPVEEVEVGDLVVVRPG
FT                   EKIPVDGVVKEGYSTVDESMLTGESVPVDKKAGDEVIGATINKLGTFKFEATKVGKDTA
FT                   LAQIIKIVEEAQGSKAPIQRMADVISAYFVPAVVAAALITFFAWYYFGAPGNFTRSLLN
FT                   FTAVLVIACPCALGLATPTSIMVGTGKGAENGILIKSGEYLEKAHKLTAVILDKTGTIT
FT                   KGEPALTDLIPAPEYSGCENALLQIAGSAEKNSEHPLAQAVVNYAAGKGVVLKDPQQFK
FT                   AIPGHGVAAELEGRKVLLGTRKLMKDNNIDISGLLADVEKLEEEGKTVMFMAVDGRMAA
FT                   VIGVADIIKENSREAIAQLKEMDLEVWMLTGDNRRTARAIARQVGIENVLAEVLPGEKA
FT                   QQVEELRKQGKVVGMVGDGINDAPALAAADVGFAIGTGADVAIEAADITLMRGDLRGIV
FT                   TAIRLSRATIKNIKQNLFWALIYNTVGIPVAALGLLNPVIAGAAMAFSSVSVVTNALRL
FT                   RRFKTGLI"
FT   CDS_pept        complement(233780..234163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArsR"
FT                   /locus_tag="PTH_0232"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58413"
FT                   /db_xref="GOA:A5D5Q8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Q8"
FT                   /protein_id="BAF58413.1"
FT                   /translation="MPEKNSEQNDVCEVFCVNKEKVERLKDEVESTKGLALLFKALADD
FT                   TRVKIAYALSREELCVCDVAAIIGSNIATASHHLRFLRNLGLATQRKEGKFVYYSIGNK
FT                   YIGALIETALEHATREKPGILNR"
FT   CDS_pept        complement(234179..236212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ZntA"
FT                   /locus_tag="PTH_0233"
FT                   /product="cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58414"
FT                   /db_xref="GOA:A5D5Q9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Q9"
FT                   /protein_id="BAF58414.1"
FT                   /translation="MTRLPGVEKAELNFGAAKLAVLGKVDPRLVVEESKNHGVAATMEG
FT                   APETKVFGRVFISAASGLLLLAGWAFDTFIQLPVAATGLYLAAMLSGGFATARKALLSL
FT                   RRLDFNMNVLMTVAVAGAAAIGEWREGAVVAFLYSVSEALESFTIDRARQSIRSLMEIA
FT                   PKTARVRRDGREEELPVEEIRPGDVLIVRPGEKIAMDGKVLSGYSAVNQAAITGESIPV
FT                   EKTAGDEVFAGTLNQHGVLEVEVTRLVNDTTIAKIINMVEEAQAQRAPSQAFVDKFAKY
FT                   YTPAVIALAAGIITFPPLFSGQPWYPWIYRGLALLVVACPCALVVSTPVAIVSAIGNAA
FT                   RNGVLIKGGVYLEEAGALSVVAFDKTGTLTKGAPEVTDIITVKNVSERELLKAAASVEK
FT                   MSEHPLARAIVHKAAEEGIGLEAVSNFEALVGKGARADLNGREVVVGSPRLLEENKADL
FT                   SSLQGALSRIQSEGKTAVLVGVDGEPAGVLAVADNVRQASAYTVWRLKAMGIKRTVMLT
FT                   GDNAATAGAIAKKVGVDEFMAELLPQDKVAAVNRLLKKYGKVAMVGDGVNDAPALATAT
FT                   VGIAMGGAGTDIALETADIVLMADDLCKLPFAVGLSRAALRVIKQNISFSVIVKLAAVL
FT                   LVFPGWLTLWLAILADMGASVLVTLNGIRLMGIKPEKQANEK"
FT   CDS_pept        236543..236998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0234"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58415"
FT                   /db_xref="GOA:A5D5R0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5R0"
FT                   /protein_id="BAF58415.1"
FT                   /translation="MKFSTRARYGLRAMVDLAQNYASNEPIPLFQVAERQGISEGYLEQ
FT                   LMTYLRKGGLVRSVRGAQGGYLLAREPSRITAGEIIRCLEGPLSPTDCVSEDDPEFCDR
FT                   ADACVTRLLWERVRESVASVLDNTSLEDLCKNADKIRLSREANMYFI"
FT   CDS_pept        237394..238440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TauA"
FT                   /locus_tag="PTH_0235"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58416"
FT                   /db_xref="GOA:A5D5R1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5R1"
FT                   /protein_id="BAF58416.1"
FT                   /translation="MKIKIAFKVAAVVLLAAAFLAAAAGCGNKKEEDKARPVVKVGYFP
FT                   NMTHAQALVGLSDGTFQKALGDNVTIEEHTFNAGPAEIEALLAGQIDLGYIGPVPAING
FT                   FVTSKGELKIVAGAADAGVVLVARKGSNIKSVSDLNGKKVAVPQIGNTQDISLRHLLSE
FT                   AGLKDAAKGGTVTIVPADNPDILTLISRGEVDAALVPEPWGSRIVKQAGASIVLDAGEV
FT                   WRGGKYTTAVVIASNKFLKEHPDLVQKWLEAHVDLTERINRDKNSAKTVVNSQIEKLTK
FT                   KSLPEDVLNSSFERIVVTYNPETESVREFVKLSVENGYIKGNPDIAGLFSLDLLNKVLE
FT                   QKGLQPLQ"
FT   CDS_pept        238551..239387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TauB"
FT                   /locus_tag="PTH_0236"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58417"
FT                   /db_xref="GOA:A5D5R2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5R2"
FT                   /protein_id="BAF58417.1"
FT                   /translation="MLRIVGAGKIFNTNNGNTKALEDVNLTVARGEFVSLVGPSGCGKS
FT                   TILNIIAGLERASSGKVLKEGREITGAGPDRVVMFQEPALFPWLRVIDNVEYGMKIAGI
FT                   PKRERREKALHYLKMVHLTRFASSYIHELSGGMRQRVALARALAMDSDILLMDEPFAAL
FT                   DSQTRSILHGELQQIWEATRKTIIFVTHNVEEAVLLADRVAVMAANPGRIKREFEIKLP
FT                   RPRDMENVEFVYLVGQIMKELKDEVEKVARSEFDSGWSLKKSTFLLSPDSNLGGSI"
FT   CDS_pept        239299..240078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TauC"
FT                   /locus_tag="PTH_0237"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systemM permease component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58418"
FT                   /db_xref="GOA:A5D5R3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5R3"
FT                   /protein_id="BAF58418.1"
FT                   /translation="MPGQNSTAAGLLKRALFYLALIAIWEGVFRAGLWPEYLFPSPVGV
FT                   LQNLVTGFQDSTFLIAIGASMKRVVVGYSISLAVGLSLGLLIVSSRYLDETLSPLLLGL
FT                   QTLPSICWLPLAILWFGLGEDSIIFVIAIGSIFSVTMGTLSGIKNVPPIYMRVAKTMGA
FT                   KGLKAYTTVVIPAAFPAIIGGMKQGWSFAWRALMAGELLSPKDGLGYVLTIGRDLHDMN
FT                   QVVGVMIIIIIIGLIIDKFIFGRIEHSIRSRWGLTGA"
FT   CDS_pept        240120..240746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CysC"
FT                   /locus_tag="PTH_0238"
FT                   /product="adenylylsulfate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58419"
FT                   /db_xref="GOA:A5D5R4"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5R4"
FT                   /protein_id="BAF58419.1"
FT                   /translation="MAVQKASNIVWHEGSVSKKDRERFLGQKGVVVWFTGLSGSGKSTV
FT                   AREVEARLLKLGCLSYVLDGDNIRFGLNNNLGFSPEDRAENIRRVSHVARLFADAGIIT
FT                   LTAFISPYRADREAARALLGPGEFIEIYVRCSLEECEKRDAKGLYKKARAGEIKEFTGI
FT                   SAPYEEPLSPELVLETERETPQESAEKVIRFLADRGIISKGVCRH"
FT   CDS_pept        240743..242425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SdhA"
FT                   /locus_tag="PTH_0239"
FT                   /product="succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58420"
FT                   /db_xref="GOA:A5D5R5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5R5"
FT                   /protein_id="BAF58420.1"
FT                   /translation="MNAGRVKIERKSADIVIVGGGTAGCFAAVTIKEMCPSADVLVVEK
FT                   AHVKRSGCLAAGVNAINAYLGPGETPESYLDYVKRDSAGLVREDLVLSIGQRLNRVTEK
FT                   LESWGLPFLKDESGRYKFRGKRSVEINGEHIKPVIASALRRSGAGILNRAVATNYVVKD
FT                   GRAAGVFAFSAREEKFYVISAKAVICAAGGAAGIYRPNNGGPARHKMWYCPFNVGTGFA
FT                   MGLRAGAEMTTFEMRFIALRIKDVLSPTGTVVQGVKARQINALGEEYLNRYGSDSTPVR
FT                   LYATVEENKAGRGPCYLDLTGLPDSDNSRLKEAYLNMSPGIVLKWADEGVEPNGKPLEI
FT                   CGSEPYVVGGHGQAGYWVDSRRRTTLEGLFAAGDAAGGAPKKYVSGCLAEGEIAALAAL
FT                   EYIRGIEVPAAGDQEVAAELGRVFEPLGRQKGAAPDDYEERLQKIMDEYAGGISANYEL
FT                   SGPKLLIARELLRELQDEISANISAGDMHELVKAHEVIDRALVARVLVEHLLYRKETRW
FT                   RSYQERVDYPVRDDRRWLVFVNSVYDGETKNIRIIERPWKGLG"
FT   CDS_pept        242427..242759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0240"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58421"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5R6"
FT                   /protein_id="BAF58421.1"
FT                   /translation="MAVRVNRSLCNGCGDMAEPMCVAVCPGDLLYRDESNRCAVRDWRD
FT                   CWDCAACVKECPRQAIEMFLPVQIGGRGSTLTARSGRGRITWKLTRPDGKEEIFEIINQ
FT                   TFNEVK"
FT   CDS_pept        242763..243914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MET3"
FT                   /locus_tag="PTH_0241"
FT                   /product="ATP sulfurylase"
FT                   /note="sulfate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58422"
FT                   /db_xref="GOA:A5D5R7"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5R7"
FT                   /protein_id="BAF58422.1"
FT                   /translation="MAVKPHGGTLIDRVLKGPAREEALKRAKELPRLFLDRWEASDLEL
FT                   IANGAFSPLAGFMNKADYENVVDNMRLADGTVWTIPIVLGVASGEAGSLAPGREAALCA
FT                   EDGELLGLIKVEEIYDYDRRREAEKVYKTTDEAHPGVKRVYERAQYLLGGEISLISRRR
FT                   PGQFPEMYLDPSETRRIFAEKGWKRVAAFQTRNPIHRAHEYLLKCALEICDGLFVNPLV
FT                   GETKSDDVPAAVRVECYNVLLSRYFPADRVFLSAFPAAMRYAGPREAVFHAIVRKNYGA
FT                   THFIVGRDHAGVGSYYGAYDAQLIFDNFEPEELGITPLFFEHAFYCRTCGGMASRKTCP
FT                   HGGEDRVFLSGTRVREMLSAGEMPPEEFTRREVAEVLVRYYAK"
FT   CDS_pept        243998..244849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DsrA"
FT                   /locus_tag="PTH_0242"
FT                   /product="dissimilatory sulfite reductase (desulfoviridin),
FT                   alpha and beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58423"
FT                   /db_xref="GOA:A5D5R8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5R8"
FT                   /protein_id="BAF58423.1"
FT                   /translation="MAVDYNQLKKGGFIKQKQKDYFIVRFRSIAGNLTSDQLRHLAYLA
FT                   DKYGRGYVHITTRQGAEISWVNINDHMEMNQEIKALGLNTGTCGPRIRTVVACPGSEIC
FT                   GCGLMNTRETAVQLDREFFGRQMPAKVKIAVSGCPNCCARPRENDIGLVGAVEPVLCEE
FT                   KCVGCGLCQKVCPRQAISMAEGKPYIHRSRCLLEGNCISSCPADAWQEKRKGYLLYIGG
FT                   KVISKLHLGQEAALFIQESEVTQAVQKALMAFVALGQEGERMRNTVARIGIKAFAKEMD
FT                   KL"
FT   CDS_pept        244900..245139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SirA"
FT                   /locus_tag="PTH_0243"
FT                   /product="predicted redox protein"
FT                   /note="regulator of disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58424"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5R9"
FT                   /protein_id="BAF58424.1"
FT                   /translation="MKSIKIDDTLDITDVVCPVTFAKTLLKLEDMQEGQILEVILNDGE
FT                   PIQNVPKSLKNEGHKIILVEKIGDKYRMLVERGE"
FT   CDS_pept        245170..245985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiF"
FT                   /locus_tag="PTH_0244"
FT                   /product="dinucleotide-utilizing enzymes"
FT                   /note="involved in molybdopterin and thiamine biosynthesis
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58425"
FT                   /db_xref="GOA:A5D5S0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5S0"
FT                   /protein_id="BAF58425.1"
FT                   /translation="MQLTFTEEQVVRYSRHIILTEVGSRGQKKINAGRVLIIGAGGLGS
FT                   PVAFYLAAAGVGTLGIIDDDVVDLSNLQRQILHFTEDVGRPKVDSAKEKLLALNPDCNV
FT                   VSYRERLMAHNILDIIKQYDIIVDGTDNFPTRFLANDACIMAKKPFVYGGVLRFFGQVM
FT                   TIVPGKGPCFRCIFSEPPPPGAVPTCSEVGILGVLPGTIGLIQATEVLKYLLGIGNLLV
FT                   GRLMMYDALLMEFRDVQVKRNPDCPVCGDNPTIIDLVDYETPVCSIQRR"
FT   CDS_pept        245879..246952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0245"
FT                   /product="hypothetical protein"
FT                   /note="containing OmpR response regulator consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain (COG0745)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58426"
FT                   /db_xref="GOA:A5D5S1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5S1"
FT                   /protein_id="BAF58426.1"
FT                   /translation="MSRLRETPTVLFAGTTQLSSTWLITKHQYVAYKEGKAVKKQPVNI
FT                   STLDSGRKGTAEPLVSTNWQIWPRRWKNRGKPYVLAVKLKESGIPILAIETDYGQEDTG
FT                   QLKTRIEAFFCQIENGGTAVEKTKILVVDDERKIREVVRMYLENEGFAVGEATDGREAL
FT                   NLLTGGKWDLLILDLMMPGVDGWSVCREVRKTTALPIIMLTARDAEVDRIVGLELGADD
FT                   YVVKPFSPRELVARVKAVLRRSQIAPPAAQDGKPVVLNYPGLSINPESRLVLVNEQPVN
FT                   LTPKEYDMLYLMARSPSRTFTREELIESVWGYDYFGDTRTVDTHVNRLRDKLQKASGYR
FT                   SYISTVWGVGYKFEVDK"
FT   CDS_pept        246949..248412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0246"
FT                   /product="hypothetical protein"
FT                   /note="containing BaeS signal transduction histidine kinase
FT                   (COG0642)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58427"
FT                   /db_xref="GOA:A5D5S2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5S2"
FT                   /protein_id="BAF58427.1"
FT                   /translation="MSIISRSIVVKFWLTMVLIVMIILFFSGLVQTRELKKLYYNQQME
FT                   QLIKEGEHISINFAGNRLYPLTGILKTMADMLSANIMIVDSEGYIKECQGMGINMSGGG
FT                   GERINVAGHHGMPWKEQDLESVKQGRTITYRGPNSFFDKDIISVAVPVYEGQQVTGAVM
FT                   LSAPLAPIEGRILDLQKITLYTGIAGIILATILSLFFSRTLSRPLLNMNMIARAMAGGD
FT                   YSRQVEVKSKDEIGILAESLNSLSLRLQDKVAALERLDQTRREFVANVSHELRTPLSIM
FT                   LGYTEALIDGLAHSDTDRQKYLNNIHEEILRLRRLVTELLDLSRMEAGQVNAEMHETDV
FT                   AAVAGRVFDKFQAVAAKKGVELRNSLPSVLHPVLANPDRLEQVFINLLDNAIRVTPAGG
FT                   VVEMTAYELKNELRVSISDEGHGIPPEEQPLVWERFYKVDKSRTRTGEGTGLGLAIVKK
FT                   IVEAHGGSVEIASMPEKGSTFSFTIPKKL"
FT   CDS_pept        248815..249747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CysK"
FT                   /locus_tag="PTH_0247"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58428"
FT                   /db_xref="GOA:A5D5S3"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5S3"
FT                   /protein_id="BAF58428.1"
FT                   /translation="MAKIANNLTDLIGRTPLLKLNRVTAGLGAEVVAKLESFNPAGSVK
FT                   DRIGYSMIKDAEEKGLLNKDSVIIEPTSGNTGIALAFVAAAKGYKLILTMPDTMSVERR
FT                   NLLKAYGAELVLTPGADGMKGAIRKAEELAAQIPNAFMPQQFKNPANPEIHRVTTAEEI
FT                   WEDTDGRVDIVVGGVGTGGTITGVGEVIKKRKPDFKIVAVEPFDSPVLSGGKPGPHKIQ
FT                   GIGAGFVPDVLNLDIVDEIFKVKNEEAFETGQRLAREEGLLVGISSGAAAFAALQVAKR
FT                   PENKGKLIVVILPDTGERYLSTALFQEQK"
FT   CDS_pept        249753..249938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58429"
FT                   /db_xref="GOA:A5D5N9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N9"
FT                   /protein_id="BAF58429.1"
FT                   /translation="MSDKALAAARFLETSLCGGREQLKEKQFDALLAAINGMMIGGYLT
FT                   TPGNEVREKKSECGGE"
FT   CDS_pept        250477..251535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BioB"
FT                   /locus_tag="PTH_0249"
FT                   /product="biotin synthase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58430"
FT                   /db_xref="GOA:A5D5P0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5P0"
FT                   /protein_id="BAF58430.1"
FT                   /translation="MLQKIFNKIDCEQGLNKEDLVTLLKLENQEDLDVLFSKADKIRQK
FT                   YVGDEVHLRGLIEFSNYCRKNCYYCGIRRGNKKLKRYRMSIEEIVDCAVQAERLGYRTV
FT                   VLQSGEDMYYTADKLIDLIRRIKERCDVAITLSIGERPREEYERLYEAGADRFLIRFET
FT                   SNPELYRKLHPDSDYYERMRILSWLREIGYQVGSGIMIGLPGQTVEDLADDILKFEELE
FT                   LDMVGVGPYICHDGTPLAGNPNGTVEMTFKVIALTRIVTRYANIPATTALATLRQEDGR
FT                   EKALQLGANVVMPNVTPVKYRAMYELYPAKVCIGEGAEQCRECIYGRIFSIGRPISKGY
FT                   GHSFYPTKKVCS"
FT   CDS_pept        251943..253202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MET2"
FT                   /locus_tag="PTH_0250"
FT                   /product="homoserine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58431"
FT                   /db_xref="GOA:A5D5P1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5P1"
FT                   /protein_id="BAF58431.1"
FT                   /translation="MRPSFKAVRRGGLEMSDPLNVLTKKTPRQFDQAGSPRSVGWTRAH
FT                   RVRLADEKNPLPLDCGKTIAPVDVEYEIYGKLNRARDNAILICHALSGDAHAAGWSADA
FT                   GRLGRPWLKNRPGWWDVMIGPGKAFDTDKYCVICSNILGSCYGTTGPSSIDPETGRPYG
FT                   LRFPVVTVGDWVRLQERLISHLGIDRLLAVAGGSLGGQQALEWALAYPDRVESAIIIAS
FT                   AARLSDQGLAFNVVARNAIMTDPNFKDGDYYGGPTPGRGLEVARMLGHITYLSETSMEN
FT                   KFGRRFCNGEGPGFHLGVDFEVEGYLRHQGKAFVERFDANSYLYITRAMDYYDASAWGE
FT                   GDLDKACRRIESRLLLVSFSSDWLYSPAHTKELALALGRARKRVSYANIESSYGHDAFL
FT                   LEVEKLSHLVRCFLGEGVAE"
FT   CDS_pept        253199..253807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0251"
FT                   /product="hypothetical protein"
FT                   /note="containing partial UbiE (COG2226), methylase
FT                   involved in ubiquinone/menaquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58432"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5P2"
FT                   /protein_id="BAF58432.1"
FT                   /translation="MNRNGGHRFDHEFIYEIVPGGASVLDLGCGDGELLARLIEDKKVQ
FT                   GLGIEKDIDQVAKAISRRVPVLHTDLDLGLAGFPDNFFDFVILEKTLQVVNKPLLVLEE
FT                   MLRVGGVGVISFPNFSHWNVVASLILTGRMPVTPALPYHWYDTPNIHLFTVKDFLDWAR
FT                   TNNVAVEQGLAWVNGKVVPLNEEEDIFAEEVLFVISRNS"
FT   CDS_pept        253897..254706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0252"
FT                   /product="ATP-utilizing enzymes"
FT                   /note="PP-loop superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58433"
FT                   /db_xref="GOA:A5D5P3"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5P3"
FT                   /protein_id="BAF58433.1"
FT                   /translation="MKDLEQKYEHLKEIIKSYGSVLVAFSGGVDSTFVLKAAVDALKEK
FT                   AVAVTITGELYPPGETEEAARLARFLGAEHIIIENRDLDNPTFASNPPDRCYHCKKNEY
FT                   GEILKVARERGFNAVIDGLNADDLSDYRPGIRAGQELGVHSPLKDVGLTKEEIRALSRN
FT                   FGLPTADKPSNPCLASRFPYGTQITSEGLRQVGAAEVILRKMGIPQVRVRHHGNLARIE
FT                   VPEEYLQFVAERAAEVDRSLKGLGYTYVALDLLGYRAGSMNEALRLT"
FT   CDS_pept        254775..256055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MET17"
FT                   /locus_tag="PTH_0253"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58434"
FT                   /db_xref="GOA:A5D5P4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5P4"
FT                   /protein_id="BAF58434.1"
FT                   /translation="MTTRIKGFETRAIHAGQQVDPATGARAVPIYQTTSYVFRDSDHAA
FT                   RLFALQEAGNIYNRIMNPTVDVFEQRMAALENGLAGLATASGQAAEFLAIANIAGAGDE
FT                   IVSANSLYGGTYNLFNATLRRLGIDVVFVDPCDPENFRRAITPRTRALYAESSGNPKLD
FT                   VIDFQAVADIAHEAGIPFIVDNTVPSPYLCQPLEHGADIVVHSATKFIGGHGTSIGGVI
FT                   VDGGKFDWSNGKFPQFTEPDPTYHGVVYTEAFGPAAFIAKARVQLMRDLGPCLSPFNAF
FT                   LLLQGLETLPLRMERHSRNALAVAKYLEQHPKVAWVNYPGLPGHPSHELARRYYRNGFG
FT                   ALVTFGVKGGREQALRFIDALQIFSLLANIGDAKSLVIHPASTTHQQLTPEEQLATGVT
FT                   EDMIRLSVGLETIDDLLEDLEQALNKA"
FT   CDS_pept        256329..256598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0254"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58435"
FT                   /db_xref="GOA:A5D5P5"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5P5"
FT                   /protein_id="BAF58435.1"
FT                   /translation="MSMTHYMELLATNQPWNLIIYMAIPVILAETLVATEFFVVYTHQA
FT                   TGKLRTFNKWIGIILGFYFLDILRCKLSSCGKGVFYIAETQKLT"
FT   CDS_pept        256660..257637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BirA"
FT                   /locus_tag="PTH_0255"
FT                   /product="biotin-(acetyl-CoA carboxylase) ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58436"
FT                   /db_xref="GOA:A5D5P6"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5P6"
FT                   /protein_id="BAF58436.1"
FT                   /translation="MKEAILRLLKEARPDYLSGEEICKSLDVSRTAVWKHIQALREEGY
FT                   EIEARPKAGYLLTGVPDRLFPEEIRHGLAAQLFGREIFYRDSVPSTNDLAKEMARRGAG
FT                   EGAVVVAEEQTAGKGRLGRGWHTPRYKGLCFSLILYPPVVPSEAAQVTMLAAVAVASAI
FT                   RDVAGVPAGIKWPNDILVNSKKICGILTELSAEMDKINYLVTGIGINVNQDLDDFPGEL
FT                   RSVATSVKIEAGRAMPRLKLLQACLAEFEKWYAVWLGQGFSPVLARWKEMSVSLHCPVR
FT                   ISTLKECWDGWAEDVDQDGALLLRLSDGSLKRLVSGEVTLRLGT"
FT   CDS_pept        257847..258425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0256"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing BioY uncharacterized conserved protein
FT                   (COG1268)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58437"
FT                   /db_xref="GOA:A5D5P7"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5P7"
FT                   /protein_id="BAF58437.1"
FT                   /translation="MSRFSTRDITVTALFAALAVVAAMLVRYAGAIVPFSLLPFVAMLA
FT                   GGIIGARLGALSIIVYIFLGLAGLPVFANPPYGGPAYVLQPTFGFLIGFAGAAYVIGTL
FT                   LKNREQGGFIRYFLSMAAGLAVIYLIGLPYLYAVLTFYLGKTISVGELMMIGFTPFIAL
FT                   DLVKAAAAALLARAVYRRVNAIAAADSTK"
FT   CDS_pept        258600..258935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58438"
FT                   /db_xref="InterPro:IPR019657"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5P8"
FT                   /protein_id="BAF58438.1"
FT                   /translation="MQKTKNIVTIPEKGGPRMYRLVNVMEILVKETIEEILRSAKNVCG
FT                   CERCLLDIAAIALNKLPTLYVVTEEGEVLLRTTSLRQQAKVDIIRAVTEAIDIVGQKPH
FT                   HPQKRQS"
FT   CDS_pept        259022..259792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0258"
FT                   /product="putative transcriptional regulator"
FT                   /note="homolog of Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58439"
FT                   /db_xref="GOA:A5D5P9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5P9"
FT                   /protein_id="BAF58439.1"
FT                   /translation="MILVFDVGNTNIVLGVFSGSRLVANWRLSTDRYRTSDEYGIMLRE
FT                   LFAFSGLEMKQIKAVVVSTVVPPLTFTLERLCQKYFNLTPLVVGPGIKTGLSIKIDNPR
FT                   EVGADRIVNAVAGYEQYGGPLVIVDFGTATTFCAVSARGEYLGGAIAPGISISTEALFA
FT                   RAAKLPRVEVVKPLSVIGRNTVASMQAGIFYGFVGQVDEIVKRMKKELGENTRVIATGG
FT                   LAGLIAQESATIEQVDPFLTLKGLRLIYERNAQR"
FT   CDS_pept        259789..260763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0259"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58440"
FT                   /db_xref="GOA:A5D5Q0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Q0"
FT                   /protein_id="BAF58440.1"
FT                   /translation="MRIGSVVLGNPVIAAPMAGITDKAFRILAREFGCGLVCTEMVSDQ
FT                   ALLHGNPKTCSLLDVAGEAGPVSVQIFGSNAACMAEAAGIAESRGAGIIDINMGCPTPK
FT                   IVKNGEGAALMREPEKAARIVRAVVERVKVPVTVKMRKGWDDNSPNAVELARLAAEAGA
FT                   AAVTVHGRTRSQLYAGKADWEIIAAVKRAVDVPVIGNGDVWTPQDALAMLEQTGCDGVM
FT                   IGRAALGNPWIFRRTVHFLKTGELLPGPTPAEKAAMALRHLDLLVEFKGEKVAVWEMRK
FT                   HAAWYMKGLRGAARLREQVNRAGSPGEIREILSGLAVLETTMI"
FT   CDS_pept        260928..261452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58441"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Q1"
FT                   /protein_id="BAF58441.1"
FT                   /translation="MDLIRLGEKIISRSRINQMVDKIIDLRASGLSQTEVAARLGVDRT
FT                   LVCRLENLGEVRKGRRLAVVGFPILNKKELQDALEQEGVDFIFLMSEAERWDFISQKSG
FT                   VELFDTIMDLIAKAHSFDQMLVIGSGHRIKILEAVLDKEVVGFEIGESPIQEDKYVEPG
FT                   KIIELVRAIKD"
FT   CDS_pept        261463..262554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0261"
FT                   /product="predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58442"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Q2"
FT                   /protein_id="BAF58442.1"
FT                   /translation="MQNFAFIIHPMNAEDIARKFKFTRYMPEKVLERAFAMLPSMNVAH
FT                   ITGVRSPYEEAEGWFIACPLTARLMMSLPAPYVLKKVIQGGRIAEKLGARILGLGAFTK
FT                   VVADAGVTIAKNLNIPVTTGNSYTVATAIEATREAARLMGHDLKRSSVVIMGATGSIGR
FT                   VCAMIVAREARDMTLVARSEGKLEELASRILYNTGLAVKITSDSKKALRSADIVITVTS
FT                   AVDTVIEPEDLKAGAVVCDVARPRDVSRRVAEVRDDVLVIEGGVVEVPGDVEFNLNFGF
FT                   PPGTAYACMAEAMVLALEKRYESYTLGRELTIEQVEEIDGLARKHGFKIGGFRSFGRAL
FT                   SLEEIEQIKRRAQKAQPAKAAAK"
FT   CDS_pept        262834..263310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GreA"
FT                   /locus_tag="PTH_0262"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58443"
FT                   /db_xref="GOA:A5D5Q3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5Q3"
FT                   /protein_id="BAF58443.1"
FT                   /translation="MKEKEVILTVNGLKKLESELELLKSVKRREVAERIKQAIEFGDIT
FT                   ENSEYEDAKNEQAFIEGRILTLEKMLRNAKIIDDENIGTEVVSIGSTVLLKDLECGDEY
FT                   KYTIVGSAEADPGANKISNESPVGRAILGQPKGSVVEVTVPAGQLKYQIIDILR"
FT   CDS_pept        263334..264854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LysU"
FT                   /locus_tag="PTH_0263"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="class II"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58444"
FT                   /db_xref="GOA:A5D5Q4"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5Q4"
FT                   /protein_id="BAF58444.1"
FT                   /translation="MAQKKKEELSDLIEASGREEDLNELMRVRREKLAELRDKGIEPYG
FT                   GRFERTHTARYILDNFVEMENRPVVIAGRIMSRRGMGKATFAHIQDGTGQIQIYVRLND
FT                   VGPESYELFGRLDIGDIIGVQGSVFKTRMGEITVAAESFKILSKSLRPLPEKWHGLRDV
FT                   ELRYRQRYVDLIVNPEVKEVFETRSKIIRACRNFLDGKGFLEVETPMMQVIPGGAAARP
FT                   FITHHNALDMDLYLRIAPELYLKRLLVGGFEKVYEINRNFRNEGISTKHNPEFTMLELY
FT                   QAYADYTDMMNLTEELISAVAVEALGTTKIEYQGTEIDLAPPWPRIPMLETIKVHAGLD
FT                   FGALKSAEEAFKAVEQAGIGLELDPSDSWGTIVNKVFEEVVEPKLIQPTFVVDYPVEIS
FT                   PLAKRKAEDPELTYRFELFIYGREIANAFSELNDPIDQKGRFLKQVEKRKAGDEEAHMM
FT                   DEDYINALEYGMPPAGGLGIGIDRLVMLLTNSASIRDVILFPLMKPRE"
FT   rRNA            265400..266925
FT                   /locus_tag="PTH_r001"
FT                   /product="16S rRNA"
FT   tRNA            267134..267210
FT                   /locus_tag="PTH_t007"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:267168..267170,aa:Ile,seq:gat)"
FT                   /note="codon recognized: ATC"
FT   tRNA            267320..267394
FT                   /locus_tag="PTH_t008"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:267352..267354,aa:Ala,seq:tgc)"
FT                   /note="codon recognized: GCA"
FT   rRNA            267447..270929
FT                   /locus_tag="PTH_r002"
FT                   /product="23S rRNA"
FT   rRNA            271060..271174
FT                   /locus_tag="PTH_r003"
FT                   /product="5S rRNA"
FT   CDS_pept        complement(271253..274036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0264"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing uncharacterized protein family (UPF0169)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58445"
FT                   /db_xref="GOA:A5D5M3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5M3"
FT                   /protein_id="BAF58445.1"
FT                   /translation="MNWLAGKNKEKLKDKILFLFCLMNSAGCSLAKMSKTNNLAGVIIM
FT                   NKFKSLAIISVLSVLATAAFVAWGFALHPRELWAAEQSAAALEGPEAAQVAGSLSELKE
FT                   RLWKASGLKETYDILEFFNRLPGPDAAAAQVLLDYLKEAPRTDVWKITDALVNLMTDDQ
FT                   VAQLARESGAYPEANFTSYLAPVLAARAGNAAVLADAILNLQKTPASGYYRKLVETAWQ
FT                   KVFADPGEAARWLDEVYSRLTDPLARENLVSAVNDTACELAGDKRAAAVSWLWQAQEQE
FT                   KNTAARFQQLLNLYLLGEARALGQIKELYGGLASAEEKVDIVREAANAARWRLTGAARD
FT                   AVVNWLWQAAEKDPLPFSRQQCLAALVNLGEKGALERLVSDIDENGLSVLEEGGRALSP
FT                   ALDWQLLQEAGEKYPQSYLARGIKAYEEVRGEPYFEMERRKQQGNWDVYFYGDEQYDPE
FT                   REIPGWEKFLAEFPGHPGADDAAYRLARCYEIEGRWTDALNTLRKALSLPDGDIRYHAA
FT                   GRLVYVLDVRMTYDQLKELSQAREQSKKLDPSLKPLVDYSLAVKELRRDNYRQTAGMLE
FT                   EFLKQYQDFGENQGALPFNQLNYQLKYDFRSSVKKQQAAVEELAALEVQWKKSGNPADL
FT                   YRLAAAIFHDQTLYYNHLWSGWRQSYNWQGYINATGRGRAPVEMASFAREMINYNHCLP
FT                   YFQQVYRDPSSSPELKARALYSAGLCYTGLDEWGVDAYLAFTPSEIREKIISIYQQFIR
FT                   EYPGSSMADDALLALGAYTGDAGYLQKIVEDYPQGDMLEKAKNLMEEMKSPYYTNRPDS
FT                   LYGWPLPFKALSLDDASVPGEVSAWAAGNRAQPFTGVKTAGGWSYLLVTAGEKPTAGYS
FT                   VEIISISDDGRGRLKVNYRIAAPQPGIAAAQVLTYPYALARIPATAAAVEFAEIKN"
FT   CDS_pept        complement(274017..275147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0265"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58446"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5M4"
FT                   /protein_id="BAF58446.1"
FT                   /translation="MRNKLIAAALVTVLLAAVLTAAALAEVSPVQLVVNGRVIETDVPP
FT                   QLVNGRTIAPVRQVVEALGAEVKWDERTRQVWIYSPELDSLQRQITLLQKALAPATPRD
FT                   AVGKWAKGLKERNGALQFAVLAPELQEQSHSDLESRGWVTGVSSPWVERFEIIKETQAG
FT                   SAREYEVRFYWATSTGPAGDSTTKVTVRQYGENWYVSQIQNDGFIAEQLKMQAREYLTQ
FT                   KYRQHYRIDRIEITPLAMNIAGSRAEAEFKTTVWHAIACATPAEWPPQKGRIKYLEENR
FT                   QNLTPEQIRKIEERIDFWNKELQGYIDKPIEVNEFLKFTADLDGMGVIKKDTVEIFYED
FT                   PIGKYLPVKKEDWPAFKTAEELEKLGYEEMRELVGR"
FT   CDS_pept        complement(275376..276971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0266"
FT                   /product="regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58447"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5M5"
FT                   /protein_id="BAF58447.1"
FT                   /translation="MTVTVSHLCKLPVFSGGLNIVAGRGGLNRQVNHVTVMEAPDFAEW
FT                   VNGNEFILSTLYSFRNDIDLIVNVVRQLAEKKIAALAVKINRFINEIPPVIISLADEYD
FT                   LPLFAVKREVKFREVISAISTEIINRQLRIIKDVNNRYEELLSHILKGDSIATFVNMLG
FT                   SDLKCSCLCISLSGEVLASHLDKNNLPENFVDNALKAIGELKKNKTVHTRLNDFYLFPC
FT                   LAQNKVMGYVVVAHPGEMDDRAFLLTRQMVSFLSIKLLEKHLMIETEQRMLASLVDEVL
FT                   FRESSDEATLRDRVKLLGLKPQEYHFVLLLAFRHEISDDILQISIRQWVSRLRNLFPES
FT                   AVFLKGNEIIGIVSLPGKSPLLDPNSIKRNLLNLMNEGIAKPQGEVDLGYSFAVKEICR
FT                   LKECYEQARKAISIGRAFKPQNNVFFYGEFLKEALILRGIGSHEYNLLIKQLIDPLKKY
FT                   DQKYNTELWPTLEKCLLVSSLEKVAQDLHIHISTLRYRLQRIYEITGVDYFTVQGKFLL
FT                   NLAYIAEKLNAGQA"
FT   CDS_pept        277243..279168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0267"
FT                   /product="hypothetical protein"
FT                   /note="containing NemA, NADH:flavin oxidoreductases, Old
FT                   Yellow Enzyme family (COG1902) and TrxB, thioredoxin
FT                   reductase (COG0492)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58448"
FT                   /db_xref="GOA:A5D5M6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5M6"
FT                   /protein_id="BAF58448.1"
FT                   /translation="MKFYRLFQPVKINSVELRNRIVMPPMVTNFGYADNTVSGRLVAYH
FT                   AARAKGGFGLNIVENFAVHPLGKAFSAVLGLWDDRFIPGCRGLTEAVHRHGGKIFAQIY
FT                   HAGAQTTENVIGVQPVAPSAVPHPVMGTLPRQLNVEEIEEIVESFGRAARRAREAGFDG
FT                   VEVHGSHGYLVSEFMSAYTNRRTDEYGGDLLGRMRFPVEIIRSIRRHAGRDYPVTIRIA
FT                   GDERVSDGRTIEETRVAARLLEEAGYDALHVTTATTATMHYIAPPYYLPPALNVEYAEK
FT                   IKKCVSIPVITTGCIYDPHFAESILAEGRADLVGMGRASIADPELPCKVAAGLLEDIRP
FT                   CTGCLQGCIGSLYYGRPITCMANPEVGREEEAVLKPALQAKKVLVVGGGPAGLEAARVA
FT                   ARRGHKVILCEKSGSLGGQLKIAAMPPHKQRMAHLVKYLVNQVKKAGVEIRLATEVDLK
FT                   LVREISPDTVVVATGGEPFIPAIPGAEGKNVVSAWDVLGGRAGVGGKVLVIGGGSVGCE
FT                   TADFLAVQGKAVDLVEKLDKVGHDMVERVRYFLMQRLLSAKVGIYTEANVLEITGDGVK
FT                   VERRGVMQELSGYDSIVLALGTRPVNSLVEELSKSKVNYVVIGDAKKPGNALEAIGQAA
FT                   EAGRAI"
FT   CDS_pept        279244..279894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AtoD"
FT                   /locus_tag="PTH_0268"
FT                   /product="acyl CoA:acetate/3-ketoacid CoA transferase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58449"
FT                   /db_xref="GOA:A5D5M7"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5M7"
FT                   /protein_id="BAF58449.1"
FT                   /translation="MVKIMNADEAIKFVKSGQRVMIGGFGMVGTPDQLIEALSRAEVKD
FT                   LVIIGNDLGAANKGIGKVLLQGKIKKAVGSYFTPNPDAARLYSEGKLEVELIPQGNYAE
FT                   AIRAGGVGLGPFYTPTGAGTIYARNKETRIFDGKEYILEHPIRGDVALIRAHRADRLGN
FT                   LVYRKAGRNFNPLMAMAADICIAEVDEIVEAGELSPEEIVTPFIFVDILVPRS"
FT   CDS_pept        279910..280572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AtoA"
FT                   /locus_tag="PTH_0269"
FT                   /product="acyl CoA:acetate/3-ketoacid CoA transferase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58450"
FT                   /db_xref="GOA:A5D5M8"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5M8"
FT                   /protein_id="BAF58450.1"
FT                   /translation="MSKDSKVTIAKRAAMELKDGWIVNLGVGIPTLAVNYLPPGRRVFI
FT                   QSENGILGVGPMPAPEEADPDIINAGRQPVTIIPGGSFFDSALSFGMIRGGHLDATIIG
FT                   ALEVSERGDIANWILPGKDVLGMGGAMDLVVGAKKVIVATQHVAKSGKPKILPECTLPL
FT                   TAPSAAHMIITEYAVFSFQDGVLVLDEIAPDITLDGLKEITPAKYEVSPELKVMEVC"
FT   CDS_pept        280576..281772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PaaJ"
FT                   /locus_tag="PTH_0270"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58451"
FT                   /db_xref="GOA:A5D5M9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5M9"
FT                   /protein_id="BAF58451.1"
FT                   /translation="MANAVIVGGVRTAIGRIGGTLKNVQAEELAAHVIGEILKRTEVEG
FT                   REVDEVILGQAKQSCDAPNIARVSSLMAGLPIEVPAYTVHRQCGSGLQALINAAQQIRL
FT                   DESGIIVAGGVESMSTAPYYLRFARYGYGAGNGEILDPNTESQPRSQPESCYGRLTMGM
FT                   TAENLAVKYSISRAEQDEFALWSQEKAWAAIESGRFRPEITPFTVDSGKGKSTVFDTDE
FT                   HPRKTSLEALSKLKPAFKENGTVTAGNSSGRNDGAAAVVMMAEEKARERGLFPYFRVVS
FT                   YAASAVSPEIMGIGPVYATRRALDRAGLRLEDIDLIELNEAFAAQSLAVLRELQPDRER
FT                   VNVNGGAIALGHPLGMSGARLVVTLIHEMVRRDSRYGLATLCIAGGQGLAMIVEKVKN"
FT   CDS_pept        complement(281669..282889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58452"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N0"
FT                   /protein_id="BAF58452.1"
FT                   /translation="MEWPIVPAPIMASVFTRFIKSASLEFENGLEHFFVKSVYKSLNTF
FT                   LKWIGIDQGPYLHQAARNQAERLFVIFPGGRVTSLNLDFAAHQGGKVDFSTAPVNAHQS
FT                   NAAAFFDQPEGVGQSFNRAGTLKDHIGPFLTGYAGKTGQQVLLTDIDGLKAQFLGYRQA
FT                   VLSILPGSDHNHFGRPQQAGPLSGHQPNNAGPEHSHHVVRPDAAVVEHGMETYRARLGQ
FT                   GGLVKREVFRNMVHQLLRYGNKLGHASVHVQPRHQVAVADIGPAPAAVRANPAIAVGFP
FT                   QHAVARFEKGHLRPHRLYVAAVLVPQNNRHLHKLVAFGILVGMQVAAADGRALHPDQHL
FT                   VPRRPGLRHRPEVNRTGPPLFLDNCPQFIVPPFSFLPSRQSWPGPGRRQCKEWPGRNGC
FT                   PAGPFRE"
FT   CDS_pept        281789..282820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Tdh"
FT                   /locus_tag="PTH_0271"
FT                   /product="threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58453"
FT                   /db_xref="GOA:A5D5N1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N1"
FT                   /protein_id="BAF58453.1"
FT                   /translation="MRAIVKEERRPGAVNLRSVPEPRPAGDEVLIRVQSAAVCGSDLHA
FT                   YEYPKSYEFMKVPVILGHEYSGYVEAVGPQVTLFKPGDRVLGESNRYCGVCPNCRRGRT
FT                   NICDSNLMTGLHVDGGMAEFIAVPQKLVHHIPENLSFDEATLAQPCSVSFHAVFDNSGI
FT                   RPNDMVAVFGPGIVGLMAAQGARLLGAAEVVVIGTGEDAQNRLPVAQKLGFKTINIGEQ
FT                   DLLAGFAGITGKERADVVLECSGAVKALADAFRLVKKGGSITLVGIYGSGAEINFAPLV
FT                   RGEIQIKTSYTATWENYEQSLSLISRGLVQVRPLIDTYPFEEGVQAFVDALNKKVLKPV
FT                   LKL"
FT   CDS_pept        282834..283793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FadB"
FT                   /locus_tag="PTH_0272"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58454"
FT                   /db_xref="GOA:A5D5N2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N2"
FT                   /protein_id="BAF58454.1"
FT                   /translation="MNRVKTLAIIGAGTMGHSIAAAALQHGVSVRLIDVSAPALETARR
FT                   KIQSYLASAAGKGGGKGGAVPGHLAGVLETCMEMAAGVTGADMVIEAVPEKLDLKKEIF
FT                   AQLDKLCPPSVILATNTSGLPITAIASAAARPERVLGTHFYMPAYLIPLVEVVCSDYTS
FT                   PDVAGDTVAFLQSIGRKPVLVKKDIPGFIGNRLQHAIAREAISLLQKGIASAQDIDTVA
FT                   RYTLGLRFAHTGPLEQRDLNGLDVHLDVAEYLYQSLENCTQPLAILREKVESGCLGLKT
FT                   GRGFYDWEGRTREEVTARKNEQMSKVLELMLSWEKESG"
FT   CDS_pept        283827..284726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AtoE"
FT                   /locus_tag="PTH_0274"
FT                   /product="short chain fatty acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58455"
FT                   /db_xref="GOA:A5D5N3"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N3"
FT                   /protein_id="BAF58455.1"
FT                   /translation="MFMEALTRFFTALMRKYLPDPFVFAIILTFLTMVLAIFLEGKGLV
FT                   DVISYWGGGFWNLLAFTTQMAVILAMGYVLAKTPLVEKILDYLVSLIKTPRAAIAVATL
FT                   VGAVGSYLNWGFGLIIGALVARKFAEKIRGIHYPLIMASAYSGFCLYGLGITGTIPMLI
FT                   ATKGHFLEKEMGIIPLDQTIFSAPILVLSVITLITLPIVNMLAMPRNKENIIELDPTVF
FT                   AFEEKAKAPAGPAGQPLTLAERMNNSYILGWLIGLMGIAYLVKYFAKGGGLDLNIVNFI
FT                   IIFVGILLLGTPSRYIGV"
FT   CDS_pept        284756..285169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AtoE"
FT                   /locus_tag="PTH_0275"
FT                   /product="short chain fatty acids transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58456"
FT                   /db_xref="GOA:A5D5N4"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N4"
FT                   /protein_id="BAF58456.1"
FT                   /translation="MLQYPFYAGIMAIMAGSGLVNTIAKWFVDISTPQTLPFWGLISSF
FT                   VINFFAPSAGGHWAIQGPFMVEAAKNLNADMAKTAMSVMMGNAWNDLVQPFWLLPTLAI
FT                   SRLQLRDIMGYTVLDAIWVCIVFSVGILIWGYM"
FT   CDS_pept        285225..285905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0276"
FT                   /product="predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58457"
FT                   /db_xref="GOA:A5D5N5"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N5"
FT                   /protein_id="BAF58457.1"
FT                   /translation="MRIVDLTVKLVDGTQSFPTHPKVTVIDFVTHSFSAPRYKPPCRGY
FT                   ASKLVMLSDHAGTHLDAPFHFYEDGLTIDQVDLSTTFGEAVLLDVSDKPADLPVSADML
FT                   EQAAAKAGVEVRPGDIVLLHVWPGEWNGPGFHHCKALDESAGNWLAEKKIKALGLDLAN
FT                   ADVNENMQRPVHLNLLGKGIGIIENLTNLKEIREKRFYFFAIPLKIAGLSGSPVRAFAV
FT                   EGWR"
FT   CDS_pept        complement(285995..286660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0277"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58458"
FT                   /db_xref="GOA:A5D5N6"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N6"
FT                   /protein_id="BAF58458.1"
FT                   /translation="MHNLILKDFMLQKKLMLFGFVYILFMVFALQNALQKIGDSMFAMC
FT                   VFALSYMMIITSCAYDDKNKTDVMLNSLPLSRTEIVFARYLSAAVFFAVTVVVYMAVVF
FT                   LSNIAGTPFKVFPPTAESFTGTVVAVSLLTGIYFPLYFKMGYIKSRYVNFILFFGFFFG
FT                   ISALGDMLRKGDTNLNNLNDFIGNYTDVQIMACSLIFSALFMTASFALSLKFYRGREF"
FT   CDS_pept        complement(286642..287520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CcmA"
FT                   /locus_tag="PTH_0278"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58459"
FT                   /db_xref="GOA:A5D5N7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N7"
FT                   /protein_id="BAF58459.1"
FT                   /translation="MAPVLEVSNLQKNFKGFSLNNVGFELEQGYIMGFIGPNGAGKSTT
FT                   IKLIMNLLKRDGGEIKIFGLDNIRHEKEIKNRIGFVYDENHFYEELTPLEMKRVIAPFY
FT                   RNWDEEAFQRYIREFELPAKKKIKDLSKGMKTKFSLAVALSHHADLLIMDEPTSGLDPV
FT                   VRSELLEILSSLLQDETKAVFFSTHITSDLDKIADYVTLIDNGEIVLSAPKDDLVDNYG
FT                   LVKGPRELLDGDTRKYFIGIKESEFGFEALAADKKQVRMLFRDMVVIEKPALEDIMLYC
FT                   TRRKNKCTTSS"
FT   CDS_pept        complement(287522..287896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0279"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58460"
FT                   /db_xref="GOA:A5D5N8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5N8"
FT                   /protein_id="BAF58460.1"
FT                   /translation="MNIIISNSSQQPIYEQIAAQIKNLIIRGELAGGELLPSIRNLARE
FT                   LHISVITTKRAYEELEKEGFIFTVPGKGSYVAAHNKELLREARLRIVEEKLYEAVLAAR
FT                   SAGLTKEELREMLELLYEEG"
FT   tRNA            288112..288186
FT                   /locus_tag="PTH_t009"
FT                   /product="tRNA-Asn"
FT                   /anticodon="(pos:288144..288146,aa:Asn,seq:gtt)"
FT                   /note="codon recognized: AAC"
FT   CDS_pept        288344..288805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CtsR"
FT                   /locus_tag="PTH_0280"
FT                   /product="transcriptional repressor of class III stress
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58461"
FT                   /db_xref="GOA:A5D5K5"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5K5"
FT                   /protein_id="BAF58461.1"
FT                   /translation="MSNISDLVEHYLKKLLADSPHNYIEVQRSELALRFNCVPSQINYV
FT                   LATRFSTGQGYIVESRRGGGGFIRIVKIPFNQQAQLILDLCEIIGDSISQTEAEGLIKR
FT                   LQEENLITRREARMMQAAIGRDTLRLVLPARDRLRALILKGMVTAVLRD"
FT   CDS_pept        288860..289387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0281"
FT                   /product="Uncharacterized protein"
FT                   /note="with conserved CXXC pairs"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58462"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5K6"
FT                   /protein_id="BAF58462.1"
FT                   /translation="MLCERCGQRPATVHFTEITNGHKRETHLCEVCAGEIQPQGFGFPP
FT                   QLFLHNFLAGILNQELGGGNFGWPESAGNKCEKCGLAESQFAKQGLLGCGDCYPYFEEK
FT                   LLPLFRRIHGNTRHTGKVPARTGGRARLVKEIENLKRLLKEAVSREEFERAAQLRDSIR
FT                   QLERGLEEGGGA"
FT   CDS_pept        289387..290457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0282"
FT                   /product="argininekinase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58463"
FT                   /db_xref="GOA:A5D5K7"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5K7"
FT                   /protein_id="BAF58463.1"
FT                   /translation="MTLRETVNNAHSHWMDADGPESEIIISSRVRVARNLAGIPFPHLL
FT                   NKENSEKVIHAVRLAISNKEASELLGGLELSSLGELSPLERQILVDKHLISPDLLNDFQ
FT                   RKAVVLREDEVVSIMVNEEDHLRIQCILPGLQLKEAWDVVNRVDDGLEKTLDYAFSEKV
FT                   GYLTSCPTNVGTGMRASVMIHLPGLKLAKQLAGVLNAINKLGLTVRGLYGEGTEALGDL
FT                   FQISNQITLGQSEEEIINNLISIARQILAQEQAARRNLYKDRREVIEDRVFRAFGALKY
FT                   ARILSSEEAMRLFSDLRLGVEMKIISGIPVRLLNELMVKIRPAFITKMAGRELTPYQRD
FT                   IFRAGLIRREFANLPV"
FT   CDS_pept        290485..292917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ClpA"
FT                   /locus_tag="PTH_0283"
FT                   /product="ATPase with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58464"
FT                   /db_xref="GOA:A5D5K8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5K8"
FT                   /protein_id="BAF58464.1"
FT                   /translation="MFGRFTERAQKVLMFAQEEAKSASYPYVGTEHLLLGLIREGEGVA
FT                   ARALASLGVDADKVRTAVAQMVEPAKGQPPVELVLTPRAKRVLELSVDEARRMGHNYVG
FT                   TEHLLLGLIREGEGVAAQILNAFGADYRKVRTIVAQLHGGQAQPAGQVPGKFKGGQTPT
FT                   LDQFGRDLTALAREDKLDPVVGREKEIERVIQVLSRRTKNNPVLIGEPGVGKTAIAEGL
FT                   AQRIVAGNVPEILANKRVVTLDMGSLVAGTKYRGEFEERLKKVIEEIRQAGNIIMFIDE
FT                   LHTLVGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIEKDAALERRFQPITV
FT                   VEPTVEETIQILRGLRDKYEAHHRVRITDAALEAAAKLSSRYITDRFLPDKAIDLVDEA
FT                   GSRVRLQAFVPPPDLKELEKKLEVLQKEKEAAVNGQEFEKAAELRDQEQKVRAELESLR
FT                   ESWKQRQGGTELVVDEEDIAHIVSSWTGIPVKKLAEEESERLLKMEEVLHQRVVGQDEA
FT                   IRAVSRAIRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEVLFGSEDAMVRIDMS
FT                   EYMEKFAVSRLVGAPPGYVGYEEGGQLTEAVRRRPYTVVLLDEIEKAHPDVFNILLQVM
FT                   EDGRLTDAKGRTVDFRNTVIIMTSNVGIQTIKREATLGFRTGDQKEKGYEAMKSKVMEE
FT                   LRRTFRPEFLNRVDEIIVFHALTPEHIREIVDLMLKEVAARMKENEIEIEVTDAAKDLL
FT                   AKEGFDEAYGARPLRRAVQRMVEDRLSEDFLKGVFKRGDRVQIDSDGSGLTILKISS"
FT   CDS_pept        complement(292891..293796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0284"
FT                   /product="transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58465"
FT                   /db_xref="GOA:A5D5K9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5K9"
FT                   /protein_id="BAF58465.1"
FT                   /translation="MPRRLRIHERGAFYHVTSRGNNKEQVFFSDEDYSTYTFLMKKYSL
FT                   KYCTEIHAYALMPNHIHLLARVDSMPLQKFMQGLQQSYAQIFNKRYDRVGHVFQGRYNA
FT                   HLISNEQYLLQVFKYIHLNPVRAGLADDPKTYRWSSLNDYTAADKNSFIETGFMKKLLI
FT                   EYGISLNKADFSLIPDLAPEELQELPQKAGPANREIAAIAEKNRPTLIELAGAIEDLTG
FT                   ISLKAIKTSAKDRATVLARYLFIYGACRLCGFRVVDTAQFLDKNIVSVSIALNKMDEQI
FT                   KEDSALKKMAQELTGNFKNR"
FT   CDS_pept        293974..295326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Sms"
FT                   /locus_tag="PTH_0285"
FT                   /product="predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58466"
FT                   /db_xref="GOA:A5D5L0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5L0"
FT                   /protein_id="BAF58466.1"
FT                   /translation="MRVRSKFCCQECGHQSTRWLGRCPGCGAWNSFVEEFGGRQGAPGP
FT                   GPAGGDVPRPVTEVPVSEEERFPTGFGEVDRVLGGGVVPGSLVLVGGDPGIGKSTLMLQ
FT                   VACRLSLDMRVLYVSGEESPRQVRLRAGRLGTLSSGLFLVSETDIDVVERHLRELAPPV
FT                   AIIDSIQTMYKADVASAPGSVGQVRECAAQLMRLAKTTGMSVFLVGHVTKEGVLAGPRV
FT                   LEHMVDAVLYLEGDRHHFFRILRGVKNRFGSTNEIGIFEMQGTGLVEVANPSALFLVCH
FT                   SREDVPGSAVVASLEGTRPLLVEIQALVSPAGYGIPRRMTTGVDYNRVAMIAAVLEKRL
FT                   GLNLSGYDIYVNAVGGVKLDEPAADLAIACALASSFRDVPVDSGMALAGEVGLTGELRP
FT                   VTGVEKRVREAFKLGFSRFLLSGVSISPAMEEPGLVAADTLAEALELALKI"
FT   CDS_pept        295337..296413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0286"
FT                   /product="predicted nucleic acid-binding protein"
FT                   /note="contains the HHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58467"
FT                   /db_xref="GOA:A5D5L1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5L1"
FT                   /protein_id="BAF58467.1"
FT                   /translation="MREEKVDGNLLKVLRSLAPGTHLREGLENILRAKAGALIVIGDTP
FT                   EVMEIAEGGFAINADFTPSSLYELAKMDGAIILSKDAKKILAANTQLVPNQNIPSAETG
FT                   IRHRTAERVAKQTGALVIAISQRRGVITIYKGASKYVLRDIGVILSKANQAIQTLEKYR
FT                   TVLDKVLVELSVLEFEEVVTLFDVAKAIQRVEMVLRVVKEIERYTSELGAEGRLITMQM
FT                   EELVANVESEGLLVIQDYATTIGEKTPSSILGVIGSWPAEDILDLSLIARALGYPGSAS
FT                   ILEQHVSPRGYRILEKIPRLPLPVIDNLVKTFGTLNRILVATIEELDDVEGIGEVRARS
FT                   IKEGLNRYREQLLQERHG"
FT   CDS_pept        296600..297076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0287"
FT                   /product="transcriptional regulator"
FT                   /note="similar to M. xanthus CarD"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58468"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5L2"
FT                   /protein_id="BAF58468.1"
FT                   /translation="MFKIGDKVVYPMHGAGVIEAIEEKEVLGEKRQYYILRLPVGDMKV
FT                   MIPITSGEEVGLRGVIDREGVQRVFHILRQQSSAMSPNWNRRYRANLEKIKSGNIYEVA
FT                   EVVRNLVKRDREKGLSSGERKMLESARQILLSELVLATELEEEKAQSLLDGAFA"
FT   CDS_pept        297224..298366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0288"
FT                   /product="integral membrane protein"
FT                   /note="PIN domain superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58469"
FT                   /db_xref="GOA:A5D5L3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5L3"
FT                   /protein_id="BAF58469.1"
FT                   /translation="MIKRIVYGVLICGFTAFGFTLGLKLMENGWVVFLANLPHELKLGL
FT                   IGLLTLTGLVAGILLSPLLMRGAVRLTVLIEQYLQKTPTQDLVMGSVGLIIGLIIANLM
FT                   GSILSFMGILGKLLWILITLLLAYLGLSIGIKKREELLALFASFPRFGRERGTLKSEAR
FT                   AGNYKILDTSVIIDGRISDLCESGFIEGVLLVPAFVLEELRHIADSPDLLKRNRGRRGL
FT                   DILNKMRKDLDTKVQIYDNNRGLEDAAEVDTKLVKLAQKLNAKIITNDFNLNKVAELHG
FT                   VKVLNINELANAVKPVVLPGEEMTVHVVKDGKEIGQGVAYLDDGTMIVVDGGRRYMNQT
FT                   VTVMVTSVLQTSAGRMIFAKPKLDRRTEGQAPYGEVNVIG"
FT   CDS_pept        298359..299075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IspD"
FT                   /locus_tag="PTH_0289"
FT                   /product="4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58470"
FT                   /db_xref="GOA:A5D5L4"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5L4"
FT                   /protein_id="BAF58470.1"
FT                   /translation="MDKVAAVVAAAGRGSRMGTETRKQYLSLAGLPVVGHVLRAMEASS
FT                   AVKSVVTVVAPGEENYFRLTVVERLGIRKVAAIVPGGEERQDSVYNGLLALAPDTGIVV
FT                   VHDGARPLLSPGDINAVVQAAAAYGAATLAVPVKDTVKMAGRDGFVLRTLSREHLWLVQ
FT                   TPQAFRYDIIMNAHRQARQKKYAATDDAGLVELLGRPVKIVAGSYENIKITTPEDLTVA
FT                   EAVIKARQGRLAEAGG"
FT   CDS_pept        299081..299569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IspF"
FT                   /locus_tag="PTH_0290"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58471"
FT                   /db_xref="GOA:A5D5L5"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5L5"
FT                   /protein_id="BAF58471.1"
FT                   /translation="MRVGFGYDVHKLVEGRPLVLGGVSIPFVKGLLGHSDADVLAHAVM
FT                   DALLGAAGAGDIGRHFPDNDGRYKGISSMKLLARVGDILSRQGLAVVNIDSVVVAQGPK
FT                   LSPFIEEMQKRMAGALQIQPSQVSVKATTTEGLGFAGKGEGIAAYAVALVHKTGQAAT"
FT   CDS_pept        complement(299138..299614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58472"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5L6"
FT                   /protein_id="BAF58472.1"
FT                   /translation="MAARNKGSSRQGDYGLGCGLACLMHQGDCVCGNALAFPGEAKPLG
FT                   GGCLHADLRRLDLQRAGHSFLHLFYKRRKLRPLGHDHRIDIYNCQPLPGQDISHPGKQF
FT                   HAANAFIPAVVVRKMPADIPRPGRAEKGVHNGMGQHVRVRVPQKPFDKRNTYAA"
FT   CDS_pept        complement(299566..299859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58473"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5L7"
FT                   /protein_id="BAF58473.1"
FT                   /translation="MMDHGDFEEIERLLEKCCDGCLLTRMHCKTCRIEKLRGITGEFSK
FT                   PEAGEIILIYADELKVLLNLAGKSPRAGSSEVEVIEKWRREIKEAAGREITA"
FT   CDS_pept        300113..301555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GlnS"
FT                   /locus_tag="PTH_0293"
FT                   /product="glutamyl-and glutaminyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58474"
FT                   /db_xref="GOA:A5D5L8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5L8"
FT                   /protein_id="BAF58474.1"
FT                   /translation="MVRVRFAPSPTGPLHIGGARSALFNWLFARRYGGKFIVRIEDTDL
FT                   ERSSRQSEENILAALRWLGLDWDEGVDAGGPCEPYRQTERLHLYRHYAEILLQSGAAYR
FT                   CYCTEEELAAEREALMEKGETPRYLGRCRDLTPQERARLEAEGRKAAVRFRVPRDRVIQ
FT                   VKDLVRGDVSFECNGMGDFIIMKSDGIPTYNFAVVVDDHTMAISHVIRAEEHLPNTPRQ
FT                   ILLYQALGWDTPEFAHVSLILGKDRSKMSKRHGATAVEQYREKGYLPEAVVNFLALLGW
FT                   SPGGENEVLSIEELKQQFSLEKVSKSPAVFDLDKLNWLNGYYIRQSSLERVAELAVPFL
FT                   EKAGYIRAPLSPEEFERVKMMVASVRKYLNCMEEVIDHVKIYFTDNFNNLDEDAREVMA
FT                   GQQVPAVLAALKDKVASGGKLTGAAARAALKEVGKELGVKGQQIFMPVRVAVSGNTHGP
FT                   DLDQIMAILGKDEVVKRLSRWV"
FT   CDS_pept        301578..302312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CysE"
FT                   /locus_tag="PTH_0294"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58475"
FT                   /db_xref="GOA:A5D5L9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5L9"
FT                   /protein_id="BAF58475.1"
FT                   /translation="MFSRLRKDIQAVMERDPAAKSVLEVLLCYPGLHAVLLHRVAHAFY
FT                   RRGWFLIARLISHFSRFLTGIEIHPGAKIGEGLFIDHGSGVVIGETAEIGNNVTIYQGV
FT                   TLGGTGKEKGKRHPTIGNNVVISAGAKILGSFTVGDNSKIGAGSVVLKAVPPDSTVVGV
FT                   PGKVVARNGRKVAPEGIPEIDLRHDLLPDPVAEALICMHGIIERLEKRVRYLEEQNSQL
FT                   AGLHREELSNCKERCFLADGNI"
FT   CDS_pept        302299..303753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CysS"
FT                   /locus_tag="PTH_0295"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58476"
FT                   /db_xref="GOA:A5D5M0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5M0"
FT                   /protein_id="BAF58476.1"
FT                   /translation="MEIYNTLTRRKENFQPREPGRVCMYVCGPTTYNYIHLGNARPLVF
FT                   FDTVRRYLIHKGYEVLFVQNFTDVDDKIINRAQEEGDDPLALARRYIGEYFKDADALNV
FT                   RRADRHPLVSEHIPDIIKMVDELVKKGAAYVVDGNVYFEVRKFAGYGKLSGRTLEDMQA
FT                   GARVEVDPRKRDPLDFALWKAAKPGEPCWDSPWGPGRPGWHIECSAMSLKYLGTNFDIH
FT                   GGGYDLIFPHHENEIAQSEAATGQPFVRYWMHNGFITVNEEKMSKSLGNFFLVRDILAK
FT                   FPPELVRFFLLSTHYRSPLDFDGEKMAAAGRGLERIKTSLRLLYEALERPVSEGVQAVC
FT                   SRDPFDEIRASFEAAMDDDFNTALAIGAVFDLAREANTAVQRTGPAVSGQDRQILQYAL
FT                   DLFNEFNEVLGIFKVDGASGRLLIDGAAGDDSGLVEGLINLILEVRQEARKRKDWSTAD
FT                   RIRDGLKELGILLEDTPQGVRWKKQG"
FT   CDS_pept        complement(302317..303765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58477"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5M1"
FT                   /protein_id="BAF58477.1"
FT                   /translation="MAAILSLLLPADSLGGVFQQYAQFLQPVPDPVGGAPVLPLAGFLA
FT                   HFQDQVDQPFHQPGVIPRGAVNEKPAAGPVHLKNAQHFIEFVKQIQGVLQDLPVLPGHR
FT                   RSRPLDGRICLPGQVENGANGQGGVEVVVHGGFKRGPDLVKGVPAAHRLHALRHGPFQR
FT                   LVEKPQAGFDPFQAPSCSGHFFAVKVQRAAVVGGKQKKAHQFRRELRQYVAHQEEVAER
FT                   LGHLLFVYGNKAVVHPVTHERLTGSRLALGNFVFVVGENKVVPPAVDVKVGSQVFQRHC
FT                   RTFDVPARPAGPPGAVPAGLTRLCRLPEGKVQGVALARIHLDPGPGLHVFQGAAGKLAV
FT                   PGKLAHLEVNVAVHHIGRALFHQFIHHFNDVGDVLRHQWVPVRPAHVQGVRIFKIFADV
FT                   PAGKRKGVIPLLLRPVDDLVVHVGKVLDEQDLIALMDQVAPHGVKKHQGAGVAQVDVII
FT                   RCGAADVHADPARFARLEVLFAPG"
FT   CDS_pept        303756..304172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0296"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58478"
FT                   /db_xref="GOA:A5D5M2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5M2"
FT                   /protein_id="BAF58478.1"
FT                   /translation="MLPISGKSKVEKPGDLPALVLAYVGDAVYELAVRSSLVNAGLVRV
FT                   NRLHDEAVKYVNAGAQARLLRLLEGILTEEEAEVVRRGRNARSPHAPRGAGVVEYRHST
FT                   ALECLIGYLYLKGDTDRLAEIMSLLLKAAGESNN"
FT   CDS_pept        304204..304941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="THY1"
FT                   /locus_tag="PTH_0298"
FT                   /product="predicted alternative thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58479"
FT                   /db_xref="GOA:A5D5J6"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5J6"
FT                   /protein_id="BAF58479.1"
FT                   /translation="MGARKMAVTLLRYTPDPQEIIAMGAKLCYSPAGIEELKHGIEGKN
FT                   QAPFLEKLLDSGHLSPVEHASFTFGIEGVSRSLLAQLTRHRIASYSVKSQRFVPETGAA
FT                   EEDGVFGYIIPPRIEALGREYVEIFKSQMAQIQKWYDFWREKLGGGESSNEDARFVLPN
FT                   AAETKVLVTMNARELLHFFSLRCCNRAQWEIRALAVEMLRLVRAVAPVIFKDAGPGCVR
FT                   GSCHEGRMSCGRAQEVRERFKNL"
FT   CDS_pept        304938..305723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SpoU"
FT                   /locus_tag="PTH_0299"
FT                   /product="rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58480"
FT                   /db_xref="GOA:A5D5J7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5J7"
FT                   /protein_id="BAF58480.1"
FT                   /translation="MTHMNLNLKKKGRNRLEDIIAGRNPVREALRANRPINKLLIAEGA
FT                   LTGSLREIYDLARERKIPVQRVERQHLSKLVPEASHQGVVALAAVREYVDVDDILAGVA
FT                   PGEDPFLILLDEVHDPHNLGAILRTADAAGAHGIIIPRRRSAPLSRTVARSSAGAVEYV
FT                   PVARVANIARTIELLKGKGLWVAGADPDGREVYWDARLDGPVALVIGGEGKGLGRLVKE
FT                   KCDVLVRLPMSGRVNSLNASVAAALLSYEVVRQRRKVLK"
FT   CDS_pept        305723..306235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0300"
FT                   /product="predicted RNA binding protein"
FT                   /note="containing a PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58481"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5J8"
FT                   /protein_id="BAF58481.1"
FT                   /translation="MKEFLVVDGYNIIHAWPEFEKLRDARLEHARSKLVSVLANYSPLS
FT                   GQKIFVVFDAHQVKNYAEKTEIVDGIAVIYTRQGETADAFIERLVGDLLKEGPVYVATS
FT                   DWAEQSVVFGRGAYRLTPEELRRQVNRTRIEHEKHCKQDTPADGYLENRLLDRVRSKFE
FT                   KWRRGKK"
FT   CDS_pept        306448..307092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpoE"
FT                   /locus_tag="PTH_0301"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58482"
FT                   /db_xref="GOA:A5D5J9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5J9"
FT                   /protein_id="BAF58482.1"
FT                   /translation="MSLQAQKEVPNEYQVLVDEEIVEFAREGDDAALEYLINKYKNFVR
FT                   AKARSYFLIGADREDIIQEGMIGLYKAIRDFRLDKLSSFRAFAELCITRQIITAIKTAT
FT                   RQKHIPLNSYVSLNKPIYDEDSDRTLLDIISGSKITDPEELIISREEFDDIEEKMGEIL
FT                   SSLEWKVLMSYLEGKSYQEIAEDLKRHVKSIDNALQRVKRKLERYLEKREA"
FT   tRNA            307354..307429
FT                   /locus_tag="PTH_t010"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:307387..307389,aa:Thr,seq:tgt)"
FT                   /note="codon recognized: ACA"
FT   tRNA            307540..307624
FT                   /locus_tag="PTH_t011"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:307574..307576,aa:Tyr,seq:gta)"
FT                   /note="codon recognized: TAC"
FT   tRNA            307649..307724
FT                   /locus_tag="PTH_t012"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:307682..307684,aa:Met,seq:cat)"
FT                   /note="codon recognized: ATG"
FT   tRNA            307729..307804
FT                   /locus_tag="PTH_t013"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:307762..307764,aa:Thr,seq:ggt)"
FT                   /note="codon recognized: ACC"
FT   tRNA            307823..307899
FT                   /locus_tag="PTH_t014"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:307857..307859,aa:Met,seq:cat)"
FT                   /note="codon recognized: ATG"
FT   CDS_pept        308200..309402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TufB"
FT                   /locus_tag="PTH_0302"
FT                   /product="GTPase-translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58483"
FT                   /db_xref="GOA:A5D5K0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5K0"
FT                   /protein_id="BAF58483.1"
FT                   /translation="MAKQKFERTKPHVNIGTIGHVDHGKTTLTAAITMVLATVGKAQVK
FT                   KYDEIDNAPEERERGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPYIVVYLNKADMVDDPELLELVDMEVRELLSTYEF
FT                   PGDEIPIITGSALKAMECACGKRECEWCKSIWELMDAVDEYIPTPQRAVDKPFLMPVED
FT                   VFSITGRGTVATGRIERGQVKVGDEVEIVGLQDKPRKTVVTGVEMFRKILDVGVAGDNV
FT                   GCLLRGVDRKEIERGQVLAKPGSIKPHKSFSAEVYVLTKEEGGRHTPFFNGYRPQFYFR
FT                   TTDVTGVVKLPEGVEMVMPGDNVRIDIDLITPIAIEEGLRFAIREGGRTVGAGVVTGIR
FT                   E"
FT   CDS_pept        309577..309735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpmG"
FT                   /locus_tag="PTH_0303"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58484"
FT                   /db_xref="GOA:A5D5K1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5K1"
FT                   /protein_id="BAF58484.1"
FT                   /translation="MAPVRVGVTLACTECKRRNYTTTKNKKNDPNRIEMKKYCRFCQTH
FT                   TLHKETR"
FT   CDS_pept        309945..310340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0304"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing preprotein translocase subunit SecE
FT                   (COG0690)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58485"
FT                   /db_xref="GOA:A5D5K2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5K2"
FT                   /protein_id="BAF58485.1"
FT                   /translation="MVLTKKQANSGKKDQGKKGKEQDKREQNAKKDADSKAARKETALS
FT                   KEKKEVTRKEPAKREVTAKKERVNYVEQLQKFFRGSLSELKKVHWPNRRETIIYTSVVM
FT                   VAVVVVGVLIWVFDSVLSTILKLIMTR"
FT   CDS_pept        310394..310921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NusG"
FT                   /locus_tag="PTH_0305"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58486"
FT                   /db_xref="GOA:A5D5K3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5K3"
FT                   /protein_id="BAF58486.1"
FT                   /translation="MEKKWYVVHTYSGYENKVKANLEKRIDSMNMEDKIFRILVPMEDE
FT                   VEIKDGKKKVSKRKIFPGYVLVEMIMTDDSWYVVRNTPGVTGFVGSGSRPIPLNDAEAR
FT                   QIIRQMGVEEPRTRVDFTVGENIRVISGPFENFIGQIEEINMEKSKVKVMISMFGRETP
FT                   VELDFTQVEKII"
FT   CDS_pept        310942..311370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplK"
FT                   /locus_tag="PTH_0306"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58487"
FT                   /db_xref="GOA:A5D5K4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5K4"
FT                   /protein_id="BAF58487.1"
FT                   /translation="MAKRVAAIVKLQVPAGKATPAPPVGPALGQHGVNIMAFVKEYNER
FT                   TAAQAGLIIPVEITVYEDRSFTFVTKTPPAAVLLKKAAGLETASGEPNKKKVAKLPRSK
FT                   VKEIAELKMPDLNAASIEAAMRMIEGTARSMGIDIVEG"
FT   CDS_pept        311444..312142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplA"
FT                   /locus_tag="PTH_0307"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58488"
FT                   /db_xref="GOA:A5D5H7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5H7"
FT                   /protein_id="BAF58488.1"
FT                   /translation="MPKHGKKLTEALKQVDRSVLYDPAEAFELLKKVAPAKFDETVEVA
FT                   VRLGVDPRHADQQVRGAVVLPHGTGKTRTVLVFAKGDKAREAEEAGADFVGAEDMVARI
FT                   QQEGWLGFDVAIATPDMMGMVGKLGRILGPRGLMPNPKTGTVTFDIARAVKEVKAGKIE
FT                   YRVDKAGIIHAPIGKVSFSTEKLVENLRTLIEALIRAKPAAAKGQYLKGISVSSTMGPG
FT                   IKVNTQKVTA"
FT   CDS_pept        312372..312899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplJ"
FT                   /locus_tag="PTH_0308"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58489"
FT                   /db_xref="GOA:A5D5H8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5H8"
FT                   /protein_id="BAF58489.1"
FT                   /translation="MPITRAEKEAIIQELKEKFKEARVAVLADYRGLNVAEATRLRRRL
FT                   REAGCEFKVAKNTLTGLAARQAGLEGLDPYLEGPIAIAFGVDPVAPAKVLSDFIRETRK
FT                   MEIKAGVLEGTIIDARRVRDLADLPPREVLLARVLGGMQAPLYGFAGALQGTLRKFIYA
FT                   LEAIRKQKAGEA"
FT   CDS_pept        312935..313324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplL"
FT                   /locus_tag="PTH_0309"
FT                   /product="ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58490"
FT                   /db_xref="GOA:A5D5H9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5H9"
FT                   /protein_id="BAF58490.1"
FT                   /translation="MSKVQEILEAVKGLTVLELSELVKAFEEEFGVSAAAPVAVAAAPG
FT                   AAAAPAAPAAAEEEQTEFDVILTAVGDKKVNVIKVVREITGLGLKEAKDLVDGAPKPVK
FT                   EKVSKEEAAAIKAKLTEAGATVEVK"
FT   CDS_pept        complement(313422..314864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0310"
FT                   /product="HD-GYP domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58491"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5I0"
FT                   /protein_id="BAF58491.1"
FT                   /translation="MESGFAELAVLYEISTWEFPGSEEKLFRELVDKASRLFGSRRVVL
FT                   IRNCTGGRKCYSWGLGNLAPVNCQDYIEQRRTRPDVYIRELGENGSLGSIYLEKRKGFK
FT                   PCELRLLDILAKRAGELLRLYYREFQLQYISTHDVLTGLYNRSYFEEELRRLEKSDSYP
FT                   VSIILCDLDNLKLVNDALGHERGDELLRCAAGAISKAVKERGVAARIGGDEFVVLLPRT
FT                   SRIEAEEIAQKIIEAVEEANTKNPDLLFRFSIGMATADGAGCSLWDLCKEADDMMYRDK
FT                   LARGKNYRGAVIQVLKAALAAKDFVAEGHTERVKQFACLLGEAAGLSWAEMDSLQLLAD
FT                   IHDIGKLGVPEHILLKKGPLSSREWEEIKRHPEIGYRIALSSPELAPLAELIRQHHEWW
FT                   NGEGYPQGLRGEQIHILSRIVAIADAYDAMTSSRPYRKAFSSEEALAEIKRAAGTQFDP
FT                   ILAKIFLQVVERSRGKALSKST"
FT   CDS_pept        complement(314869..315999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0311"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58492"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5I1"
FT                   /protein_id="BAF58492.1"
FT                   /translation="MRAGAGWSLLQESKEAGREAARLALRELEQPAVLFVFTTSCYKQE
FT                   EVLAGVLDETGDVPLVGACGAGIITPAGIFNEGIAVLALAGDRIKAATAITWFDDGDPW
FT                   DVGKRLGKKLLAGSRASSGLVAVFPDGLASGITEMLQGLYDIMGPGFKYAGGGTGDNLR
FT                   FIQTYQLTEKCVASSAVAAAIISGCVFGISVEHGWKPMGPPLVITRARGKVVHELDARP
FT                   AFTVYAERLGGVELEKMPKMGLEHPLGMPNAMGRFVIRDPMQVLPDGAIELATEVPSRA
FT                   VAYLMHAKHSDLIEVTQRVAAASLSKINSPAFALLFNCVSRSLLLKDSELEHKIYREVF
FT                   GALPFAGLLTFGEVAAYNDVPIFHNKTLVAAVGGAF"
FT   CDS_pept        316518..320192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpoB"
FT                   /locus_tag="PTH_0312"
FT                   /product="DNA-directed RNA polymerase, beta subunit/140 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58493"
FT                   /db_xref="GOA:A5D5I2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5I2"
FT                   /protein_id="BAF58493.1"
FT                   /translation="MAYPEKVGARVRYNFGRLREVLDLPNLIEVQRNSYKWFLEEGLRE
FT                   VFQDISPIQDFTGNLVLEFLDYTLGEPKYTVEECKERDVTYAAPLRVKVRLINKETGEV
FT                   KEQDVFMGDFPLMTEKGTFIINGAERVIVSQLVRSPGVYFDETIDPSGKKLYTATIIPN
FT                   RGAWLEFETDVNDHIFVRIDRTRKIPATVLVRALGYGTKAQVAELFNEDKNILETLARD
FT                   NTDSEEEALVEIYKRLRPGEPPTVDSARSLLTSLFFDPKRYDLANVGRYKIQKKLKHGV
FT                   LYRYGPNPDGKTVFDPYLKKEVPQKREFIRELTKEDIIETIRYLLKLMNGEGQVDDIDH
FT                   LGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQDVDVITPQVLINIRPVVAAIKEFF
FT                   GSSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPE
FT                   GPNIGLIGSLSTYARINEFGFIETPYRKVDKENRRVTDEIVYLTADEEEGYVIAQANAP
FT                   LDEEGRFIEPRVNARSPEIVVVPADRVDYMDVSPKQVFSIATALIPFLEHDDANRALMG
FT                   ANMQRQAVPLLKAQAPLVGTGIEYKAARDSGVVVIAKESGTVEKVTSTHIEIRNDRGYL
FT                   DRYKLLKFTRSNQGTCVNQKPIVKKGERVEAGQVIADGPSTDYGELALGRNVLVAFMPW
FT                   EGYNYEDAILVSEKTVKEDYFTSIHIEEYECDARDTKLGPEEITRDIPNVGEEILKDLD
FT                   DRGIIRVGAEVRPGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLRVPHGES
FT                   GKVVDVKVFSRDNGDELPPGVNQLVRVYIAQKRKISEGDKMAGRHGNKGVIARILPEED
FT                   MPFLPDGTPIEIVLNPLGVPSRMNIGQVLEAHLGWAAKVLGYYVSTPVFNGASEESIFE
FT                   ALKEAAFKESGLRSFMEKAGLNEEELIGAVETAEKRAGSREALIKEVEGAESSGETIMA
FT                   AIERTGLTAGMVNRLEEAGMTKKEILGAMKKLLFARSGKMTLYDGRTGEPFDSPITVGY
FT                   VYMLKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQ
FT                   EILTVKSDDVVGRVKTYEAIVKGENVPEPGVPESFKVLIKELQSLGLDVKVLSEDDQEI
FT                   EIREVEEDIGETAKELGIDLQEGELPEVEEADYSEDVEDEDMFNEEFFNEDFDLEDDE"
FT   CDS_pept        320285..323797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpoC"
FT                   /locus_tag="PTH_0313"
FT                   /product="DNA-directed RNA polymerase, beta' subunit/160 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58494"
FT                   /db_xref="GOA:A5D5I3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR012756"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5I3"
FT                   /protein_id="BAF58494.1"
FT                   /translation="MLDLNNFDRIRIGLASPDQIRAWSSGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPTRDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERLGHIELAAPVSHI
FT                   WYFKGIPSRMGLLLDMSPRALEKVLYFVSYIVTDPGDTGLIKKQLLTETEYRDCRERYG
FT                   NAFKASMGAEAIKKLLEEINLEELARELRQELKEVTGQRKIRAIRRLEVVEAFRKSGNR
FT                   PEWMILEVIPVISPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIV
FT                   RNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELHLHQCGLPKEMALELFKPFVMKRLVNDGYAHNIKSAKRMVERVRPEVWE
FT                   VLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRAIQIHPMVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLSSNNILNPKDGRPVAIPTQDMVLGIYYLTVEKQGVPGEGKAFK
FT                   DPEEAVMAYYNNAVSLHAAVKVRMPGMGRIETTVGRIIFNEVIPRELGYYNQVIDKKVL
FT                   SKIVDDCYRKLGFSATSKLLDGIKKLGFTFATRAGVTIGIQDITIPARKKEILKEAEQQ
FT                   VEKVEQQYRRGLITEEERYRKVIGIWNDATKEVTDALIETLDKFNPVYMMANSGARGNI
FT                   QQIRQLAGMRGLMADPSGRIIDLPIKANFREGLTVLEYFISTHGARKGLADTALRTADS
FT                   GYLTRRLVDVAQDVIVREVDCGTGQGIEVTEIKDGNEVIEKLEDRIIGRVALEDVKHPE
FT                   TGEILAFAGEEITESEAAKIVAAGIKKVKIRSVLTCRTRYGVCIKCYGRNLATGRQVDI
FT                   GEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRVEELFEARRPKGQAIIAEA
FT                   DGTVEVREVKGRREIEVTAEDGTKSVYQVPYGARLKVRDGDRVYAGDELTEGSVNPHDL
FT                   LKIKGVQGVQIYLLQEVQRVYRLQGVDINDKHIEVMIRQMLRKVKVDEPGDTDLLPGGL
FT                   IDIFEFEDENRRIKNLGGEPATAKPVLLGITKASLATDSFLSAASFQETTRVLTEAAIK
FT                   GKLDLLLGLKENVIIGKLVPAGTGMSRYRNISVVAESEPGEENGEPGGERLYGMDELYG
FT                   ETAN"
FT   CDS_pept        323912..324163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RPL8A"
FT                   /locus_tag="PTH_0314"
FT                   /product="ribosomal protein HS6-type"
FT                   /note="S12/L30/L7a"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58495"
FT                   /db_xref="GOA:A5D5I4"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5I4"
FT                   /protein_id="BAF58495.1"
FT                   /translation="MAYERLLSARKKTVGTKQTLKAIERGQAKVVYVAQNADRHVIEPV
FT                   LSLCAAKNIPVIQVDSMLALGKACHIDVGCAAAAVTEE"
FT   CDS_pept        324184..324558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsL"
FT                   /locus_tag="PTH_0315"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58496"
FT                   /db_xref="GOA:A5D5I5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5I5"
FT                   /protein_id="BAF58496.1"
FT                   /translation="MPTISQLIRKGREEAVKKSAAPALKECPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDS
FT                   AGVQNRNRGRSKYGTKRPKK"
FT   CDS_pept        324600..325070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsG"
FT                   /locus_tag="PTH_0316"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58497"
FT                   /db_xref="GOA:A5D5I6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5I6"
FT                   /protein_id="BAF58497.1"
FT                   /translation="MPRRGAVPKREVLPDPVYQSKVLTKLINQVMLKGKKSLAESIVYG
FT                   AMDIIKEKTGKNPLEVFETAMKNVMPVLEVKARRVGGANYQVPVEVRHDRRQTLAIRWL
FT                   TNYARERAGKSMKEKLANEIMDAAAGTGGAVKKKEDTHKMAEANKAFAHYRW"
FT   CDS_pept        325087..327165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FusA"
FT                   /locus_tag="PTH_0317"
FT                   /product="translation elongation factors"
FT                   /note="GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58498"
FT                   /db_xref="GOA:A5D5I7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5I7"
FT                   /protein_id="BAF58498.1"
FT                   /translation="MARQFPLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHE
FT                   GTATMDWMAQEQERGITITSAATSCRWRDCQINIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VFCSVGGVEPQSETVWRQADKYGVPRIAYINKMDRVGADFHRGIQMIRERLGANPVAIQ
FT                   LPIGVEDGFCGVVDLVRNRAIIYTDDLGTTSEETEIPPELAGEAAAFRERLIEAVAEFD
FT                   ESLMEKYLENGELTEEEIKEGLRRATLAVKIVPVLCGSSFKNKGVQPLLDAIVDYLPAP
FT                   TDIPAIRGVNPVSGAGEVREARDDEPFSALAFKIMTDPYVGKLTFFRVYSGRLKSGSYV
FT                   YNSTRNRRERVGRILRMHANHREDIEEVCAGDIVAAVGLKTTTTGDTLCDEKEPVILES
FT                   MEFPEPVIQVAIEPKTKADQEKMGVALQKLAEEDPTFRVSTDPETGQTLISGMGELHLE
FT                   IIVDRMMREFKVEANVGRPQVAYKETVRKKARAEGKFIRQTGGRGQYGHVVLEVEPREP
FT                   GSGYLFTSKIIGGVIPKEYIPAVDAGAKEAMENGVLAGFPVIDVGVTLLDGSYHEVDSS
FT                   EMAFKIAGSIGFKDAARRADPVLLEPVMKVEVVVNEEYMGDVIGDLNSRRGRIEEMEAR
FT                   NGMQVIHAYVPLAEMFGYATDLRSRTQGRGNYTMQFSHYAQVPDNIAEGIIARRVGR"
FT   CDS_pept        327354..328556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TufB"
FT                   /locus_tag="PTH_0318"
FT                   /product="GTPase-translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58499"
FT                   /db_xref="GOA:A5D5I8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5I8"
FT                   /protein_id="BAF58499.1"
FT                   /translation="MAKQKFERTKPHVNIGTIGHVDHGKTTLTAAITMVLATVGKAQVK
FT                   KYDKIDNAPEERERGITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPYIVVYLNKADMVDDPELLELVDMEVRELLSTYEF
FT                   PGDEIPIITGSALKAMECACGKRECEWCKSIWELMDAVDEYIPTPQRAVDKPFLMPVED
FT                   VFSITGRGTVATGRIERGQVKVGDEVEIVGLQDKPRKTVVTGVEMFRKILDVGVAGDNV
FT                   GCLLRGVDRKEIERGQVLAKPGSIKPHKSFSAEVYVLTKEEGGRHTPFFNGYRPQFYFR
FT                   TTDVTGVVKLPEGVEMVMPGDNVRIDIDLITPIAIEEGLRFAIREGGRTVGAGVVTGIR
FT                   E"
FT   CDS_pept        328644..328952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsJ"
FT                   /locus_tag="PTH_0319"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58500"
FT                   /db_xref="GOA:A5D5I9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5I9"
FT                   /protein_id="BAF58500.1"
FT                   /translation="MKSQKIRIRLKAFDHHMLDQSAQKIVETARRTGASVAGPVPLPTE
FT                   KSIYTILRSPHVNKDSREQFEMRTHKRLIDILEPNPKTVDALMRLDLPAGVDIEIKL"
FT   CDS_pept        329048..329680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplC"
FT                   /locus_tag="PTH_0320"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58501"
FT                   /db_xref="GOA:A5D5J0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5J0"
FT                   /protein_id="BAF58501.1"
FT                   /translation="MPKGLLGKKVGMTQIFTDTGLAVPVTVIEAGPCIVVQKKTPEKDG
FT                   YSAIQLGFGAKKERSFNKPMLGHFLAARVRPLRYLREVRVENPETYQVGQEIKADIFAP
FT                   GEKVDVVGTTKGRGFAGGIKRHGFHRGPMAHGSKYHRRPGSLGAKGPARVFKGRRLPGH
FT                   LGMERVTVQNLEVVKVDADRNLLAVKGAVPGPKGGLVLIKQAAKARG"
FT   CDS_pept        329710..330330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplD"
FT                   /locus_tag="PTH_0321"
FT                   /product="ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58502"
FT                   /db_xref="GOA:A5D5J1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5J1"
FT                   /protein_id="BAF58502.1"
FT                   /translation="MPTVALYNTNGEQVGELALKDEIFGVEVHEPVLHDAVVMHLANRR
FT                   LGTHDTKTRSEVRGGGRKPWRQKGTGRARHGSIRSPLWRGGGIIFGPHPRDYSYSLPRK
FT                   VRRLALKSALSAKVNSGDILVLDELKLDQPKTKEMARILNNLKVDDALLVTAEKDEAVE
FT                   RSARNIPNIKPVQAALLNVYDILAYDKLVMTRDAVARVEEVFA"
FT   CDS_pept        330330..330617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplW"
FT                   /locus_tag="PTH_0322"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58503"
FT                   /db_xref="GOA:A5D5J2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5J2"
FT                   /protein_id="BAF58503.1"
FT                   /translation="MKDPRDILRKPVVTEKSTSLLQDNKYTFIVDPRANKTEIKEAVEK
FT                   IFKVKVEKVNTMRVKGRIKRVRNIPGKTPDYKKAIVKLRQGDKIELFEGM"
FT   CDS_pept        330648..331472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplB"
FT                   /locus_tag="PTH_0323"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58504"
FT                   /db_xref="GOA:A5D5J3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5J3"
FT                   /protein_id="BAF58504.1"
FT                   /translation="MAIKKFKPTSPGRRFVTVSDFEEITRTEPEKSLVEPLKKSGGRNA
FT                   QGRITVRHRGGGHKRLYRIIDFKRDKDGIPAKVASIEYDPNRSARIALLHYADGEKRYI
FT                   IAPAGLEVGQTVVSGPDADIKAGNCLPLKNIPVGTMIHNIELYPNGGGKLVRSAGASAQ
FT                   LMAKEGKYANIRMPSGEMRLLLQECRATIGQVGNVEHENITIGKAGRKRWLGIRPTVRG
FT                   VVMNPVDHPHGGGEGRSPIGRNPVTPWGKPALGARTRKKKPGDRLIVKRRAR"
FT   CDS_pept        331587..331871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsS"
FT                   /locus_tag="PTH_0324"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58505"
FT                   /db_xref="GOA:A5D5J4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5J4"
FT                   /protein_id="BAF58505.1"
FT                   /translation="MSRSLKKGPYCDARLLAKIEKMNETGEKRVIKTWSRASTIFPQMV
FT                   GHTIAVHDGRKHVPVYITEDMVGHKLGEFAPTRIFRGHGAHTERSTALK"
FT   CDS_pept        331894..332235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplV"
FT                   /locus_tag="PTH_0325"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58506"
FT                   /db_xref="GOA:A5D5J5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5J5"
FT                   /protein_id="BAF58506.1"
FT                   /translation="MEAKAVARYIRISPRKVRQVVDLIRGKKLNEALAILRYTPKRASA
FT                   VVAKVVRSAAANAENNLQMDRDELFIKACYVDQGPTYKRYMPRAFGRADVMRKRTSHIT
FT                   VVVSDKKEG"
FT   CDS_pept        332242..332937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsC"
FT                   /locus_tag="PTH_0326"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58507"
FT                   /db_xref="GOA:A5D5G1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5G1"
FT                   /protein_id="BAF58507.1"
FT                   /translation="MGQKVNPKGLRIGIIRDWEGKWYADKRNYAALLHEDIKIRKFIKE
FT                   KLFAAGISRIQIERAANRVKVSIHTAKPGIVIGRGGAEVENLRKQLENLTGKQVSVNIV
FT                   EIKVPELDAQLVAENVAAQLEKRIAFRRAMKQVVSRSMKMGAKGIKVACGGRLAGAEIA
FT                   RTEWYSEGKVPLHTLRADIDYGFAEANTTYGKIGVKVWIYRGEVLPEAKTPAKTAARGG
FT                   KEAPGEGGE"
FT   CDS_pept        332943..333377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplP"
FT                   /locus_tag="PTH_0327"
FT                   /product="ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58508"
FT                   /db_xref="GOA:A5D5G2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5G2"
FT                   /protein_id="BAF58508.1"
FT                   /translation="MLIPKRVKYRKQHRGRPGGGMAKGGKEINFGEYGLMALEPAWITN
FT                   RQIEAARIAMTRHIKRGGKVWIRIFPDKPITAKPAETRMGSGKGTPEYWVAVVKPGRIM
FT                   FELAGVTEEVAREAMRLASHKLPIKTKFVKRGEVGEVNEG"
FT   CDS_pept        333367..333570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpmC"
FT                   /locus_tag="PTH_0328"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58509"
FT                   /db_xref="GOA:A5D5G3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5G3"
FT                   /protein_id="BAF58509.1"
FT                   /translation="MKAKELRELTDAELNKKLSDSKEELFKLRFQLATGQLDNPMKLQE
FT                   VRRRIARVKTIIRERELGIRRA"
FT   CDS_pept        333614..333877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsQ"
FT                   /locus_tag="PTH_0329"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58510"
FT                   /db_xref="GOA:A5D5G4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5G4"
FT                   /protein_id="BAF58510.1"
FT                   /translation="MEGRGIRKTLTGRVVSNKMDKTVVVAVETLVRHPLYQRTIRRTKK
FT                   FKAHDEENACRIGDKVKMMETRPLSKEKRWRVVEILERTKQI"
FT   CDS_pept        333928..334296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplN"
FT                   /locus_tag="PTH_0330"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58511"
FT                   /db_xref="GOA:A5D5G5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5G5"
FT                   /protein_id="BAF58511.1"
FT                   /translation="MIQVQSILNVADNTGARRLMCIRVLGGALRRYASVGDIIVCSVKE
FT                   ATPGGVVKKGDVVRAVVVRTKKEVRRPDGSYIKFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELRDRDFMKIVSLAPEVI"
FT   CDS_pept        334311..334634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplX"
FT                   /locus_tag="PTH_0331"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58512"
FT                   /db_xref="GOA:A5D5G6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5G6"
FT                   /protein_id="BAF58512.1"
FT                   /translation="MARTKVHVRKGDTVLVITGKNAGKKGKVISVIPAKSRVVVEGVNV
FT                   VKRHTKPTRKMPQGGIVEKEAPIHSSNVMLFCGKCNSPTRVGKKFLEDGEKVRVCKRCG
FT                   ETI"
FT   CDS_pept        334743..335291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplE"
FT                   /locus_tag="PTH_0332"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58513"
FT                   /db_xref="GOA:A5D5G7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5G7"
FT                   /protein_id="BAF58513.1"
FT                   /translation="MQVARLKDKYKNEVVPAMMQKFGYKNPMQVPRLEKVVVNMGLGEA
FT                   IQNSKIIDAAVNDLMTITGQRPVVTKAKRSIAAFKLRAGMSIGAKVTLRGERMYEFVDK
FT                   LINVALPRVRDFRGISPKSFDGRGNYSLGVREQLIFPEIEYDKIDKVRGMDIIFVTTAK
FT                   TDEEARELLKLMGMPFRAA"
FT   CDS_pept        335636..336034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsH"
FT                   /locus_tag="PTH_0333"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58514"
FT                   /db_xref="GOA:A5D5G8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5G8"
FT                   /protein_id="BAF58514.1"
FT                   /translation="MVMTDPIADFLTRIRNANTVYHEKVEAPASKVKKAIANILKDEGF
FT                   VKDCEFIDDGKQGIIRIYLKYGPNKERVITGLKRISKPGLRVYARKDQVPKVLGGLGIA
FT                   IISTSKGIMTDKKARKEGLGGEVICYVW"
FT   CDS_pept        336151..336699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplF"
FT                   /locus_tag="PTH_0334"
FT                   /product="ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58515"
FT                   /db_xref="GOA:A5D5G9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5G9"
FT                   /protein_id="BAF58515.1"
FT                   /translation="MSRIGRQPITVPAGVEVEIDGSTVKVKGPKGQLVKEMHRDMIIKY
FT                   EDGRLIVERPANDKLHKSLHGLTRTLLNNMVVGVTAGFQKNLELVGVGYRASKQGNKLV
FT                   LAVGYSHPVEIEPEAGLEIEVPAPTKISIKGVDKEKVGALAAAIRAVRQPEPYKGKGIK
FT                   YEGEKIRRKVGKAGGKGKK"
FT   CDS_pept        336719..337087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplR"
FT                   /locus_tag="PTH_0335"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58516"
FT                   /db_xref="GOA:A5D5H0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5H0"
FT                   /protein_id="BAF58516.1"
FT                   /translation="MLKKPDRNALRDKRRRRVRKKIRGTAERPRLNVFRSLQNIYAQII
FT                   DDDRGVTLVSASTLAPELKGKLPSGGNTAAAAAVGELLAKKAIEAGIKRVVFDRAGYVY
FT                   HGRVKALAEAARAGGLEF"
FT   CDS_pept        337108..337608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsE"
FT                   /locus_tag="PTH_0336"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58517"
FT                   /db_xref="GOA:A5D5H1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5H1"
FT                   /protein_id="BAF58517.1"
FT                   /translation="MARIDASKLETTEKVVFINRVAKVVKGGRRFSFSALMVVGDGNGH
FT                   VGAGLGKAGEVPEAIRKGIEDAKKNMIKVPLAGTTIPHEVIGEFGAGKVLLKPAAPGTG
FT                   VIAGGPVRAILELAGVRDILTKSLGSNNANNMVRATIEALKSLKTPEEVARLRGKPVEE
FT                   LLG"
FT   CDS_pept        complement(337605..338204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58518"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5H2"
FT                   /protein_id="BAF58518.1"
FT                   /translation="MLLKAWAWTVSDFSRLPFPSIFTPSPVFLITRAASRASGVTVVPF
FT                   SKRFSFSMLTAMISFLNLLVNPRFGMRRCSGIWPPSKPGRTPPPERAFCPLWPRPAVLP
FT                   MPEPIPWPLRVGFVLAPGAGFSSCSFTCPTSSGFLDFKQVRDLIDHSPDLGGVFLDYGT
FT                   VRPGQAQRAHGNALAFRAPDQAFDQGYLQLGHCLPS"
FT   CDS_pept        337620..337799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpmD"
FT                   /locus_tag="PTH_0337"
FT                   /product="ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58519"
FT                   /db_xref="GOA:A5D5H3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5H3"
FT                   /protein_id="BAF58519.1"
FT                   /translation="MAKLKITLVKSLIGRPESQRVTVRTLGLTRTNSSVIKEDTPQIRG
FT                   MINKVAHLLKVEEA"
FT   CDS_pept        337813..338253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplO"
FT                   /locus_tag="PTH_0338"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58520"
FT                   /db_xref="GOA:A5D5H4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5H4"
FT                   /protein_id="BAF58520.1"
FT                   /translation="MKLHELKPAPGARTKPTRRGQGIGSGMGKTAGRGHKGQKARSGGG
FT                   VRPGFEGGQMPLQRRMPKRGFTNRFKKEIIAVNIEKLNRFENGTTVTPEALLAARVIKK
FT                   TGDGVKILGNGNLEKSLTVQAHAFSSTARQKIEAAGGRAEVI"
FT   CDS_pept        338254..339513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SecY"
FT                   /locus_tag="PTH_0340"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58521"
FT                   /db_xref="GOA:A5D5H5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5H5"
FT                   /protein_id="BAF58521.1"
FT                   /translation="MLESLKNALKVSELKAKLLYTLGMIFIFRLGAHVPVPGVNPDKFA
FT                   ELVSSGLIFGFFDVISGGALKNFSVFAMSITPYINASIIMQLLTVVIPHLERLAKEGEE
FT                   GRKKITEYTRYLTVLLAFIQGLGMVVGVKGSLVQPGPLTYVMTALTITAGTTFLMWVGE
FT                   QITEKGIGNGISLLIFAGIVSRVPQGVARVIEYLNAGTINILSIIALVVIGALVIAGVV
FT                   AVQEGQRRIPVQYAKRVVGRRIYGGQTTHLPLRVNQAGVIPVIFASSLLMFPETLARWF
FT                   SNTAAANFYVRYFGWGTAAHTIFYALLIIAFTYFYTAVIMNPADVADNIKKYGGFIPGL
FT                   RPGRPTAEYISRIMSRVTLFGAIFLALIAILPNFVLLATRIPNIYFGGTALLIVVGVAL
FT                   DTMKQVEAHLLMRSYQGFIK"
FT   CDS_pept        339522..340268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Map"
FT                   /locus_tag="PTH_0341"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58522"
FT                   /db_xref="GOA:A5D5H6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5H6"
FT                   /protein_id="BAF58522.1"
FT                   /translation="MITCKSERELAYMRDAGRVVARTLAELSKAVDVGVPTIELDRLAE
FT                   DFILKSGARPAFKGLYGFPYTICASVNEEVVHGFPSLRRLANGDIISIDVGAEINGYYG
FT                   DSAVTLPVGDVSSEALNLLKATEESLYKGIEQARAGNRLSDISHAVQTCAEGYGYSVVR
FT                   DYVGHGIGSKPHEEPQVPNFGRPGRGPRLKAGMTLAIEPMINMGTYEVRTLSNNWTVVT
FT                   LDEKLSAHFEHTIVITGGEPEILTRT"
FT   CDS_pept        340408..340686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RPL14A"
FT                   /locus_tag="PTH_0342"
FT                   /product="ribosomal protein L14E/L6E/L27E"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58523"
FT                   /db_xref="GOA:A5D5E2"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5E2"
FT                   /protein_id="BAF58523.1"
FT                   /translation="MSIDMIQIGHLVCSVQGRDSGRFYLVVGIEGESRVLVADGEGRKV
FT                   ENPKRKNIKHLKIYGTVAGLVADKARNGRKITNADVRKELKSLVESL"
FT   CDS_pept        340724..340942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="InfA"
FT                   /locus_tag="PTH_0343"
FT                   /product="translation initiation factor 1"
FT                   /note="IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58524"
FT                   /db_xref="GOA:A5D5E3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5E3"
FT                   /protein_id="BAF58524.1"
FT                   /translation="MSKQDVIEVEGTVIEPLPNAMFRVELQNGHKVLAHVSGKIRMNFI
FT                   RILAGDRVMVELSPYDLTRGRIVYRYK"
FT   CDS_pept        341068..341181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpmJ"
FT                   /locus_tag="PTH_0344"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58525"
FT                   /db_xref="GOA:A5D5E4"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5E4"
FT                   /protein_id="BAF58525.1"
FT                   /translation="MKVRPSVKPICEKCKIIRRKGRIMVICENPKHKQAQG"
FT   CDS_pept        341206..341577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsM"
FT                   /locus_tag="PTH_0345"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58526"
FT                   /db_xref="GOA:A5D5E5"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5E5"
FT                   /protein_id="BAF58526.1"
FT                   /translation="MARIAGVDLPRDKRVEIALTYIYGIGKPTSQKILAQSGVNPDTRV
FT                   RNLTEEEINKLRDIIEKNYKVEGDLRREVALNIKRLIEIGCYRGLRHRRGLPVRGQRTK
FT                   TNARTRKGPRKTVGVRRKK"
FT   CDS_pept        341596..341985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsK"
FT                   /locus_tag="PTH_0346"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58527"
FT                   /db_xref="GOA:A5D5E6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5E6"
FT                   /protein_id="BAF58527.1"
FT                   /translation="MARRVTRAKKRERKNIVSGVAHIKSTFNNTIVTITDTKGNTISWS
FT                   SAGQVGFKGSRKSTPFAAQMAAESAAREAMEHGLKEVEVMVKGPGAGREAAIRSLQAAG
FT                   LEVNLIKDVTPIPHNGCRPPKRRRV"
FT   CDS_pept        complement(341722..342600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58528"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5E7"
FT                   /protein_id="BAF58528.1"
FT                   /translation="MLLDGSVDLIPRRQGCNSRPGLVGLVFKPRRGGAVGRPLQQFLNP
FT                   GRFLALVPHGNDIAGLDQVRGDVNPPAVYGKVAVPDQLPGFVPGSPQAQAVNNVVQAPL
FT                   QKPKQVFTGDAGLPFGLFKVPAELAFQNAVNPAGLLLLAKLQAVLGNLLPALAVLPRRV
FT                   RPAVYGALGGVAPVAFQVKLQSLPAAEPANRSCVSCQIHCTSLNSPALGRPAAVVGNGG
FT                   YVFDQVYLQACRLQRPDGRLAARAGPFNHHFHFLQAVLHGLPGGAFGRHLGGKGGALAG
FT                   AFKAHLPRAGP"
FT   CDS_pept        342001..342627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsD"
FT                   /locus_tag="PTH_0347"
FT                   /product="ribosomal protein S4 and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58529"
FT                   /db_xref="GOA:A5D5E8"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5E8"
FT                   /protein_id="BAF58529.1"
FT                   /translation="MARYTGSVCRLCRREGLKLYLKGDRCYTPKCAIDRRSYAPGQHGQ
FT                   GRKKVSEYGLQLREKQKARRIYGILESQFRRYFEKAERQPGITGENLLRLLERRLDNVI
FT                   YRLGLGASRNEARQLVRHGHFTVNGRRVNIPSYLVKPGDVIAVRDQSKESPRIKELLER
FT                   AADRTPPAWLEYEADQARARVAALPARDQIDAPVQEHLIVELYSR"
FT   CDS_pept        342686..343633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpoA"
FT                   /locus_tag="PTH_0349"
FT                   /product="DNA-directed RNA polymerase, alpha subunit/40 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58530"
FT                   /db_xref="GOA:A5D5E9"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5E9"
FT                   /protein_id="BAF58530.1"
FT                   /translation="MLEIEKPKIEIVEMSDDNTYGKFVVEPLERGYGITLGNSLRRILL
FT                   SSLPGAAVTSVKIDGVLHEFSTIPGVVEDVTDIILNLKNLCLKIYGDEEKVLRVEASTE
FT                   GVVKAKDIIHDADVEIMNPDLTIATLAENARLYMEITVAKGRGYVSAERNKKGDHIIGV
FT                   IPVDSVFTPVRKVNYTVENTRVGQITDYDKLTLEVWTDGSIRPDEATSLSAKILSEHLR
FT                   LFIGLTETVSDVEIMVEKEEEHKDRVLEMTIEELDLSVRSYNCLKRAGINTVEELIQRN
FT                   EEDMMKVRNLGKKSLEEVINKLHELGLSLRKDDD"
FT   CDS_pept        343649..343987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplQ"
FT                   /locus_tag="PTH_0350"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58531"
FT                   /db_xref="GOA:A5D5F0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5F0"
FT                   /protein_id="BAF58531.1"
FT                   /translation="MGYQKLGVNTGHRKAMLRNLVTALFRDERINTTEARAREVRSIAE
FT                   KLVTDAKQGDLAARRRALAYIYEEDVVRKLFDNIAPKYAGRQGGYTRIVKAGCRRGDAA
FT                   GMVILELV"
FT   CDS_pept        344013..344846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CbiO"
FT                   /locus_tag="PTH_0351"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58532"
FT                   /db_xref="GOA:A5D5F1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5F1"
FT                   /protein_id="BAF58532.1"
FT                   /translation="MIEVEDLTCIYNLGRPGERQALCGVSLTVQKGEFLAVVGPNGSGK
FT                   STLAKHFNALLRPTAGRVAVGGLDTRQAENLWEIRRMVGMVFQNPDNQIVSSVVEEDVA
FT                   FGPENLGLPPREVRDRVEEALNLTGLAGYRKHAPHLLSGGQKQRLAIAGVLAMRPSCLV
FT                   LDEPGAMLDPAGRRELIDTLCRLNRDEGVTVVLVTHFMEEAARADRIIVMSGGRVVLEG
FT                   TAPKVFAKAELLEELGLEIPGAARIARGLRKRGFLVPDGILAARDLVSYVCSYSR"
FT   CDS_pept        complement(344408..345598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58533"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5F2"
FT                   /protein_id="BAF58533.1"
FT                   /translation="MHEAGRKGHVEAQPAQFPDLPENPARRPVHGQAPPVQHDYPPGPA
FT                   GRFLHVVGHQHHRGALPAPELFDAVHQLPPAPRVQAGRGLVQDQHLRPHGQHARNGHPP
FT                   LHAVAQGKGGQPAHRLRVQAGQAQRLRRPLPGLVPAQSQVFQAEGHFRENRFFENLLLG
FT                   LLENQPYLAPYFPAGLLFGKVGAADPHLSRGGSQGAVEVLDQGGLPGARGPDHCNELAP
FT                   GNFQGNAVQGDNLEWSTGGVNVGEVFRFNYRLYEHTYDTRSRAARMPSGTKKPRFLKPR
FT                   AILAAPGISRPSSSSSSAFANTFGAVPSRTTLPPDITMILSARAASSIKWVTRTTVTPS
FT                   SRFSLQRVSMSSRRPAGSSMAPGSSRTRQEGRMASTPAMASRCFCPPERRWGACFR"
FT   CDS_pept        344828..345688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CbiO"
FT                   /locus_tag="PTH_0352"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58534"
FT                   /db_xref="GOA:A5D5F3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5F3"
FT                   /protein_id="BAF58534.1"
FT                   /translation="MFIQPVIKTENLTHVYSPGTPFQVVSLDGISLEIAGGEFVAVIGA
FT                   TGSGKSTLVQHFNGTLAPTAGKVWVCGADLSEKKARREIWRKVGLVFQQPEQQIFEETV
FT                   FAEVAFGLKNLGLGRDEARQRAAEALRLAGLDPEAVGGLSPFSLSDGMKRRVAVASVLA
FT                   MRPQVLILDEPTAGLDPRGRRELMDRIEEFRSRQGATVVLVTHDMEEAARRAGRVIVLH
FT                   RGRLAMDGPPRRVFGQVRELRGLGLDVPFPARLMHELKAAGRQVRTDVLTEDEAEEEIA
FT                   GLLSR"
FT   CDS_pept        345720..346514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CbiQ"
FT                   /locus_tag="PTH_0354"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58535"
FT                   /db_xref="GOA:A5D5F4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5F4"
FT                   /protein_id="BAF58535.1"
FT                   /translation="MFGGVTFGQFIPKDSLLHRLDPRAKTACLLAAVLSVLAASGWPGM
FT                   AAVLGLTMAAAALSGLKARFFLGTLRSLRVLLAVAFLAQALLTPGEALFGLGPLKVTRE
FT                   GLAAGADIFLRLSLLILLASLLTYTTSPIRLAAGLESLLSPFRRVGLPAHELAMMMTIA
FT                   MRFVPTLLQEAEVIIKAQRSRGAGFAARSGPAGWAAGMLPLFVPLFAGALRRAEDLAVA
FT                   MEARCYRGGANRTRMMELKLSRADFAALAVSLTVLAAVIYLR"
FT   CDS_pept        346558..347379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TruA"
FT                   /locus_tag="PTH_0355"
FT                   /product="pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58536"
FT                   /db_xref="GOA:A5D5F5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5F5"
FT                   /protein_id="BAF58536.1"
FT                   /translation="MSLANDLRSAGVKILRIIKPDPEAAMRNIKVTIAYDGTNYYGFQE
FT                   QRGTKFRTVQEVIEERLSRLAGEQIRVIGAGRTDAGVHARGQVINFNPGNWPIPPERVA
FT                   YALNSLLPRDIAALESVEVPPSFHARFSAVAKTYRYTIYNARVHSPFLRLYSYHVPRRL
FT                   DVEAMQAGAALLIGRHDFSAFRALGTPVKSTVRTMLEACVSREGDLVYIDLKADGFLYH
FT                   MARMIAGTLIRVGLGKIPPGEVAAILKSRDSLRGGPTAPARGLCLEKIEYT"
FT   CDS_pept        347466..347900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RplM"
FT                   /locus_tag="PTH_0356"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58537"
FT                   /db_xref="GOA:A5D5F6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5F6"
FT                   /protein_id="BAF58537.1"
FT                   /translation="MKTFMAKPQDIKNRKWYVLDAEGKVLGRLAAEAARILRGKHKPDF
FT                   TPHVDTGDHVIVINAEKVVLTGKKLRDKKYIRHSGYPGGLKVMNYEKLMKTRPELAVEK
FT                   AIVGMLPHNRLGSRMAKKLKVYRGPEHPHQAQKPEPWQAL"
FT   CDS_pept        347919..348311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpsI"
FT                   /locus_tag="PTH_0357"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58538"
FT                   /db_xref="GOA:A5D5F7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D5F7"
FT                   /protein_id="BAF58538.1"
FT                   /translation="MAKVMFYGTGRRKNAIARVFAMPGEGRIIINNRPLSEYFGRKTLE
FT                   TIVRQPLDLTGTASRFDIMAKVQGGGISGQAGAIKLGIARALIQADPNLRPVLKKAGFL
FT                   TRDPRMKERRKYGLKKARRAPQYSKR"
FT   CDS_pept        348408..348860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0358"
FT                   /product="predicted nucleotidyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58539"
FT                   /db_xref="GOA:A5D5F8"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5F8"
FT                   /protein_id="BAF58539.1"
FT                   /translation="MENYSGTVNKMKGIPFLPFLAEYFSKKPEVIAAYIFGSYAEGVNR
FT                   PDSDVDIAVLLVHLPADTLKYRLDVMDDTRKLAGRNTEVIVLNEAPRLLQFQVIQKGKV
FT                   IYEKDADKRALFEMSAAGRYYDYKRYFDYHARQLVERIKGGGLGAR"
FT   CDS_pept        348947..349225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58540"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5F9"
FT                   /protein_id="BAF58540.1"
FT                   /translation="MEILQEVARVLEVQHEFLARESLRMYLEKELRNIEAAIFKIVTRH
FT                   GVKSLFELDDKLKQGKIKEEDIIDDFMELDFLESKKDKILRALEKLQ"
FT   CDS_pept        349654..350520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58541"
FT                   /db_xref="GOA:A5D5G0"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5G0"
FT                   /protein_id="BAF58541.1"
FT                   /translation="MERLLFVFLLTAFINLINTLTRSSRLSGVRTNSLATAISLFGVVY
FT                   LAASFANTLQAPLLASTVEHIIDDAYNRALLIAPDATATAVYRQALADLNGKLRFVMLG
FT                   ATAGTVAGILLIPSFVTSFSNAIKAFGRTGSVFSLAPLLFFSLLKPRGGILTVRMSSLK
FT                   TLKEILTRRMTTPSSFLFWNLASYSLWTANVLSGLYAGALYPEYRSTAVLMASIVGNAA
FT                   IVVNVMMVDPVLARVTDAVAAGEQDEIELKQIIFYLALSNLLGTLLSQAVFEPVACGLQ
FT                   YLTRLIT"
FT   CDS_pept        complement(350513..351412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58542"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5C3"
FT                   /protein_id="BAF58542.1"
FT                   /translation="MLFCHDIQFEKFFSRRESFSGKGRGRLGRGFFAGKVFNGAGEYGP
FT                   GRLALVGGVLQELFFLFVGYKAYLYYYGGHGCVPGDVKIYFVYPAAGAFENPGKLFLDE
FT                   PGGLLAFGRAGLDEGLGAAPAGGGKAVHVDAEVEVGLVVVGQGHPPAQVLPLFCRQPNG
FT                   AGVAQVGVGLPGHQHHRPRLPQIGRQAPADGKGDVLFQGAALPHHARVVTAVAGVHHDH
FT                   PAGQRGRQGCHGLPAGPFLQKPGEKQRQYRQNRQGRQMALPDPVRPDYRRKQKNPPLSL
FT                   YLLILCRRRPEYETRGIT"
FT   CDS_pept        350591..351373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AmiC"
FT                   /locus_tag="PTH_0361"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58543"
FT                   /db_xref="GOA:A5D5C4"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5C4"
FT                   /protein_id="BAF58543.1"
FT                   /translation="MFSPVIRAYRIRKRHLAALAVLAVLALFFSRLLQERAGRQAVAAL
FT                   APALAGRVIVVDPGHGGYDPGVVGKSGALEKDIALSVGRRLAANLGQAGAMVLMTREAD
FT                   TDLSDPGTVGLTAKKREDLSRRVALANDNKADLYLSIHVNSFTSPRRRGAQTFVQPGSA
FT                   ESKKAARFIQEELARVLEGTGRRINEVDFYVTRNATMPAVIVEIGFITNEEEEKLLQDP
FT                   AYQSKAAWAVFAGTVKYFAGKESSPQPPPPFSGKTFAP"
FT   CDS_pept        351553..351795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0363"
FT                   /product="hypothetical regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58544"
FT                   /db_xref="GOA:A5D5C5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5C5"
FT                   /protein_id="BAF58544.1"
FT                   /translation="MEVVRLSSKGQLVLPKNIRDRLSLKQGLELKVELIGGKIVLEPVC
FT                   QEARADWRCWRGSLRGERALEEHLEEHRQEVVHDD"
FT   CDS_pept        351785..352198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0364"
FT                   /product="predicted nucleic acid-binding protein"
FT                   /note="contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58545"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5C6"
FT                   /protein_id="BAF58545.1"
FT                   /translation="MMIRIFDAFAVLCWMQEEPGSSYVNHLMEEAEKGTVKIYISAINA
FT                   GEIYYRLIKSGKAREAASFLSDVKNKVFPWEVVAATNTRVWEAAKLKGEYRLSYADAFA
FT                   VALAKEKGGKIVTRDPEIIAALSCDDFLLDQIP"
FT   CDS_pept        352386..352565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0365"
FT                   /product="transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58546"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5C7"
FT                   /protein_id="BAF58546.1"
FT                   /translation="MEEKIALEGLPTLFTDEQRAIERMKKEYTKQSEELYAEIGRLTTQ
FT                   LAWLKKKCGLATEP"
FT   CDS_pept        352543..353106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58547"
FT                   /db_xref="GOA:A5D0Z6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5D0Z6"
FT                   /protein_id="BAF58547.1"
FT                   /translation="MVSQLSREERIALVEWINPELPITTQADLLGLNRSSLYYKPVAPS
FT                   PEEIALKHRIDEIYTVHPYYGSRRITAQLRREGFLVNRKAVQRHMREMGFAAISPGPNL
FT                   SKRRQDHLVYPYLLRGVVIQQPNQVWGIDITYIRMLKGWLYLTAVLDWYSRYVVSWELS
FT                   DTLAVDFVCAAVGQALSLAKTDHE"
FT   CDS_pept        353057..353380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58548"
FT                   /db_xref="GOA:A5D5C9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5C9"
FT                   /protein_id="BAF58548.1"
FT                   /translation="MLLSAKPYLWPKQIMNSDQGSQFTSPQYIQLLKEAGVQISMDSRG
FT                   RAQDNIFTERLWRTIKYEDVYLHEYQSPREARRRLSEYLTFYNHKRLHQALAYRTPAEI
FT                   YHP"
FT   CDS_pept        353686..354198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58549"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D0"
FT                   /protein_id="BAF58549.1"
FT                   /translation="MAVFSYDHERDEPDSFELGFSFLDVLRFRFFKLELKKLSWRNYIH
FT                   SDNPIAAALLSKMGFGAGERVRVKVEFMRMLVRLKLDPARMELIAGFFETYLILNHQEE
FT                   EEFYRELDRIDQKEALAIMQVTTSWHEKGKIEGKIEGFGRPGGLVPLGFLRCMRQRVRR
FT                   FGLKGRS"
FT   CDS_pept        354280..354699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0369"
FT                   /product="hypothetical protein"
FT                   /note="containing HisB (COG0131),
FT                   imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58550"
FT                   /db_xref="GOA:A5D5D1"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D1"
FT                   /protein_id="BAF58550.1"
FT                   /translation="MPVYWREILPRFPGAAAIIEVKCSQALVDEVVRLGGRPFFYKTGH
FT                   SLIKAKMKEVGAVFTGEMSGHMFFADEYYGYDDAFYATGRLLRILSNTKEPLSRLLESV
FT                   PRYYSTAETRVCPAPTGRSLALLARWWSISGSVMK"
FT   CDS_pept        354624..354887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0370"
FT                   /product="hypothetical protein"
FT                   /note="containing PGM_PMM_IV,
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58551"
FT                   /db_xref="GOA:A5D5D2"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D2"
FT                   /protein_id="BAF58551.1"
FT                   /translation="MPCADREKFSIVSALVEHFRERYEVIDVDGARVLFEEGWGLVRAS
FT                   NTQPVLVARCEARTKEGLDRICGIMKEALRKFPEVGDFEWEF"
FT   CDS_pept        355273..355788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58552"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D3"
FT                   /protein_id="BAF58552.1"
FT                   /translation="MSMPKFLKADVERGFILAYYELVKGCAVSLDLPEENIVPVVAFAH
FT                   KPGELYGMDFSSAYHFAEKEKLSTRVRRVRKKVEGLQNYAEFAENQMQMKYRVAYEIWC
FT                   FMPPNKLVTETVAKAGEEGLPVELVGVEEVNERIRQVALLEPLDREVIYENAFLWAASL
FT                   MRRAGAWK"
FT   CDS_pept        355842..355964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58553"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D4"
FT                   /protein_id="BAF58553.1"
FT                   /translation="MLEVIEVQLGEYLAEDDIVCLRGRFWAGVKKQKLKRQVSF"
FT   CDS_pept        356011..356307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58554"
FT                   /db_xref="GOA:A5D5D5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D5"
FT                   /protein_id="BAF58554.1"
FT                   /translation="MDVKTIKVGRRGTVVIPAGLRKEYGLEEGALVIAEPRPEGILLRP
FT                   AVALSVEIYTPERKAQFLLNNALTAEDYAWAVSEVKKLDLDPEKIPHERPGNI"
FT   CDS_pept        356731..357507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Uma2"
FT                   /locus_tag="PTH_0374"
FT                   /product="Uncharacterized protein conserved in
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58555"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D6"
FT                   /protein_id="BAF58555.1"
FT                   /translation="MMLLLGHTGITLALVRGLIFKAGGVRRFDLRGKCGWRLLIRTFSA
FT                   GTIYAEWLFEALMEGVWDMDASCREPGLAYKAIPEKAVYTYEDYCRLPEGAPYELIGGK
FT                   LVMTPSPGKKHQIILKRLLKLLDNYVEDKDAGEVLCVPRDVCLAPTEVYQPDILFVAKD
FT                   RLEISAEDKVNGAPDMIAEILSPSNAYYDLRKKFKAYEKYGVREYWIVDPEEASIEVYE
FT                   LADGKFRLAAQKEKSGIVSSVVLPGFTIKLEDIFPS"
FT   CDS_pept        357734..358012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58556"
FT                   /db_xref="GOA:A5D5D7"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D7"
FT                   /protein_id="BAF58556.1"
FT                   /translation="MFSIEGKIEYYVEIFHKKGSDKGKPGESRGHKARGLKRKPGQPAA
FT                   GSFIFCLEPSEGGPGLSLAEVIPFALVCGLIGIAGMVWQAKLQGRKK"
FT   CDS_pept        358044..358880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0376"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58557"
FT                   /db_xref="GOA:A5D5D8"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="InterPro:IPR014495"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D8"
FT                   /protein_id="BAF58557.1"
FT                   /translation="MKIEIKNEFLWVLLFSLLLAALIIFNASGPLRVALGLPFVLFFPG
FT                   YTLIAPVSGQGGPGRHRAGGLSFGLSIAVVPLLGLALNYTPWGIRLYPILLTLLAFTAA
FT                   MSAVALYRRNKLPCEERFIISVNIDTPKWGELSRLDKILTVALAGAIIFAAGSLYYVVT
FT                   TPKTGEKFTEFYILGPGGKAEGYPRDMKINEEKAVIMGIVNHEYRPVSYTAEVRAGGET
FT                   VKRLGPFELAHEEKREETVGFSVYRPGENQKVEFLLFKDGEGEPYRSLHLWVNAYE"
FT   CDS_pept        358873..359685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0377"
FT                   /product="predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58558"
FT                   /db_xref="GOA:A5D5D9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5D9"
FT                   /protein_id="BAF58558.1"
FT                   /translation="MSKAQALRQDPGRFLKTFSAFKDHIFLWLYAAGITAAEIVTAYYN
FT                   PVSGIACHAVLLLALLAHAALAYRQPVNMVYMALALAPMIRITSLSMPLLGVPPMYWYF
FT                   IISLPLFAAAVSVMRLAGFKRQEVGLIAGNLPLQALVAFLGVPLGLVEYLILKPAPLVP
FT                   SLAFQHVWLPALILLTGTGFLEELIFRGVMQRAAEECLGRWYGAIYISFVFGVLHITHR
FT                   SPLDLLFVFGVALLFSTAVALFRSIAGVTFAHGLTNIGLYIVWPHILK"
FT   CDS_pept        359902..361107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixC"
FT                   /locus_tag="PTH_0378"
FT                   /product="dehydrogenases"
FT                   /note="flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58559"
FT                   /db_xref="GOA:A5D5E0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5E0"
FT                   /protein_id="BAF58559.1"
FT                   /translation="MNYDVIVIGGGPAGCKTAGLIAGKGYRVLVAEEHPRIGTPVQCAG
FT                   LVSPRTLKAAGMPDGVIINEIKGVYVHSPGGETLAVRCKDAAAFVIDRAGFDRKLAERA
FT                   QSAGAEILTGVKAGLGKLLAEKIIVKLKSSRGESSARARLVIGADGANSRVARRINAPR
FT                   SGEVVRMFAAEVQLKCPEEDMAHIFLGREIAPGWFGWLIPVDGRRARAGIGVCGVDKHP
FT                   REYFYRLAEARRDIFKDMKVICYTGGAVPIGLPPRIYGDRILLVGDAACQTKPISGGGL
FT                   YLGMRGAELCAKVATKALSREDLSAERLSEYQRRWEKEMAGETQTALRHRRVFLTMSDR
FT                   EMDALIRFFNRPLWQYVISRYGDIDYPSLLSGKLSLARPWAEKFLKHRFKKALDSRAAV
FT                   EA"
FT   CDS_pept        361497..362510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MviM"
FT                   /locus_tag="PTH_0379"
FT                   /product="predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58560"
FT                   /db_xref="GOA:A5D5E1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5E1"
FT                   /protein_id="BAF58560.1"
FT                   /translation="MNVGVVGVGTMGRNHVRVYSELKDVEKIFVFDVNKEAARKIKDHF
FT                   GEGVVVSDSIASLLNNVEALSICTSTEYHYEIVQRAIEKGVSFLVEKPLTLTLKEGESL
FT                   LGLVNGNIIAGVGHIERFNPIMKEIKNLIKNPRYIEIKRHNPASARIDDADVVFDLMIH
FT                   DIDLVWNYFINDISSCELYSVWDKDLCKAIARFGNCTVSLSASRIACKKVRAIYIEDED
FT                   FSVDGDFMTQEVYIYRKPQKYGQNSQRYVQENIIEKVLVNKVEPLKEELRTFVDCVKRQ
FT                   EHFPVTLEQAVASLRIAEEILEKGIRREYDILQAPVGHRGERRNWRRHKNLALRAR"
FT   CDS_pept        362425..362997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0380"
FT                   /product="carbonic anhydrases/acetyltransferases"
FT                   /note="isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58561"
FT                   /db_xref="GOA:A5D5A7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A7"
FT                   /protein_id="BAF58561.1"
FT                   /translation="MTFYKHPSAIVESEEIGEGTKIWHFAHVREKAVIGNNCNIGKGVY
FT                   IDAGVEIGHNVKIQNFVSVYHGVKIEDDVFIGPSVTFTNDLYPRAFIWSEDKVGHTIVK
FT                   KGASIGANATIVCGVTIGEYAMVGAGSVTTKDVPPFGLYYGNPAKLAGFVCYCGKKLEK
FT                   LIEEGKGESLYECECGKRVKIKGEWNQ"
FT   CDS_pept        362994..364178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="WecC"
FT                   /locus_tag="PTH_0381"
FT                   /product="UDP-N-acetyl-D-mannosaminuronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58562"
FT                   /db_xref="GOA:A5D5A8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A8"
FT                   /protein_id="BAF58562.1"
FT                   /translation="MKIAVIGLGRAGLPLAGVIADSGLEVVGVDIDKNRCELVNEGLNP
FT                   IPEEKGLGELLRKYGGKSLKATACYKEAKECNVYIVITPLLIDGDYNPDFRNIESSFRE
FT                   VGKILKRGDLVVLETTVPPKTTEILAKKWLEEESGLKFGEFHLAHSPERIMTGCSVSRL
FT                   REFPKIVGGVNEESGRKALEIYKNFIPNIRLVSSARVAEFIKVIEGCYRDANIALANEL
FT                   FKIAQDLELDYYEAREFANHEYCHLHLPSTGVGGHCIPIYPWFLIKEMEKKGRFNQARL
FT                   LRASREINDEMAFYWMEKIVFQCLKLNKPLNKIKICVKGITFREGVKQLYHSRNLALAR
FT                   GLMEKGLDVYVYDEMFSKEELEQMGLRPLKPEEADIVFDCFRLSFMEKRTCQRS"
FT   CDS_pept        364182..364958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="WcaA"
FT                   /locus_tag="PTH_0382"
FT                   /product="glycosyltransferases"
FT                   /note="involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58563"
FT                   /db_xref="GOA:A5D5A9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A9"
FT                   /protein_id="BAF58563.1"
FT                   /translation="MYKGKKIAVVVPAYNERELITQVITTVPDFVDRIYAVNDASTDDT
FT                   GEILSKLAEKISRLTVIHHEKNGGVGAAIISGHKMALKDEMDVVAIMAGDGQMDPAILD
FT                   KIINPVVEGRADFAKGDRLSIARHRESMSAWRTFGNFLLTFLTRIASGYWHMVDPQNGY
FT                   TAISREFLQRLDLDKIEKGFAFENDLLVKLNVLGARLVDVPHPAIYGKEHSKIRYHKYI
FT                   VNTSWVLLKLFLWRLKAKYLDRIIFWKHCGKSFAKM"
FT   CDS_pept        364980..366062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0383"
FT                   /product="Uncharacterized protein conserved in archaea"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58564"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5B0"
FT                   /protein_id="BAF58564.1"
FT                   /translation="MRIAFFINTPAQAHTWRYIIENLIEDGHQVKILARNYDSAPVLLD
FT                   KYGFDYEIYIEPGRYRHLRSLQIIPHVWHGYRLAIRFKPHIIIGFGIIEALTSFFLKKP
FT                   CLVFTDSEPVPLQNYLNKLFSSVVLTPDCFNGDFGNKHIRIPGYKELAYLHPNYFQPDP
FT                   GILNELGLGDKEKYIILRFNAFDAVHDIGRRGFSLSDKYKLVRELEKYARVFIRSEKKL
FT                   PIDLEAYNLPISFDHIHHALYYAQLLVTDTQTMTTEAAILGTPAVRCNNFIGPDDMGNF
FT                   IELEQKYGLIYNYREPDKAIEKAVELIQRPSLKEEWQQKREVLLKDKIDITAFMVWFIE
FT                   IYPKSYKDIKQNPGLQYSFR"
FT   CDS_pept        366069..367130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="WecB"
FT                   /locus_tag="PTH_0384"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58565"
FT                   /db_xref="GOA:A5D5B1"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5B1"
FT                   /protein_id="BAF58565.1"
FT                   /translation="MKIATIVGARPQFIKMAPVSREIRKKFKELIIHTGQHYDYEMDRI
FT                   FFEELDIPKPDCHLGVGSGTHGYQTGTMLKKIEEILIQEKPDLVLVYGDTNSTLAGALA
FT                   GAKLGIKVAHVEAGLRSFDRSMPEEVNRVLTDHCSDFLFCPTETAVKNLHREGINDGVY
FT                   LTGDVMVDSLLHNKEIAESRSGILDELGLKSKEYIVATIHRASNTDRKENLESIVNAFC
FT                   EMEEIIVFPVHPRTKKYLKKYGLFDKLRASVKLIKPLGYLDFLKLMNHAKKIITDSGGI
FT                   QKEAYILKIPCVTLRENTEWIETVEDGWNMLVAIDKDNIIRAIHQFQPSSVKHKERFGS
FT                   GGAAGKIAKYLAE"
FT   CDS_pept        367147..368334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58566"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5B2"
FT                   /protein_id="BAF58566.1"
FT                   /translation="MDFNLVVKDSIDRLFRWVKNENYLGWDPYDALNSNLVKKITRGNP
FT                   YLEILSIQFNRYCPINLRPILQINKGLDLKGIALFAQAYAKLYKSTQEQLYKDELIKCI
FT                   SFIKEKSLKSKYNFHCWASHYFPYTSLDKSGLTKVEPDIIGTSQSIIALIGAYKILGDD
FT                   SLKEIALDACNFIITQLIDKYEDNYFVKYTLTDDHKVVINASAQGLEAMCEVLLIDYKR
FT                   EIVEICESIVHFLIRVQNKDGSWDYSIYKNGKTRVQLDFHQGYIIDGLLAFYNLSQNKN
FT                   SLYSYIEKGIKFYREVLFLEDGQSYYRYPVRFPIDIHNQAQGIITFTKASNFNANNKAF
FT                   AKRIADWTLSCMQDRAGYFYYQKYRLFTNKIPYMRWGQAWMMLALSTLLESNGPL"
FT   CDS_pept        368392..369798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PaaK"
FT                   /locus_tag="PTH_0386"
FT                   /product="coenzyme F390 synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58567"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5B3"
FT                   /protein_id="BAF58567.1"
FT                   /translation="MNKRIMNFYYKCPRFLQTLGINIFETREKLLRSSRSFRKWLRLLI
FT                   EKEKWSKKDIEEYQNKHLREILLYAYHNVPFYYDLYNKHKIDVSKINNVKDLSYLPIIS
FT                   RNDIIKAGELIKSIRPGKYIIRHTSGTIGQPLEIRCSYNLAILNKANAYLRDQWAGYRG
FT                   QRVARFVGDTPIGDCNDPFLYRLSYIMNRAIYPSYCLSFNNLSCILESMRMLNVKLIQC
FT                   YPSTGYMIAKFLEMNNSYFPLDAILYSSEPMYDYQREVIEERFKAKVFGYYGQAEGVIS
FT                   ACECEEGQYHLTMVDGIMEIIKDNKKVPDGEKGFTVVTSLHNFAMPLIRYALNDYTGYK
FT                   LEKCKCGRNTPIIYPVETKVEDFLITPDGRIISPSLLTFPLKHAKNIVESQIIQTTPKD
FT                   IIIKIVRGKNFNKKDEEMLLLAFKEIVGRNIEIKIMYTEYIHQTSAYKKRFVINELGRD
FT                   CIEKTINTGN"
FT   CDS_pept        369770..370894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RfaG"
FT                   /locus_tag="PTH_0387"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58568"
FT                   /db_xref="GOA:A5D5B4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5B4"
FT                   /protein_id="BAF58568.1"
FT                   /translation="MKKQLIRVTKVKVLMIGPKPPPYGGVATFLKSFIKQSSIQEGYEV
FT                   NIYQTGKRNATTPFIIQLILEIILILKFIFFRRYHRYDIYHIHTASYYSFLRNIPYVYV
FT                   AKNFSNGKVILHIHGAEFDKFYGKACGWIKYLITKTLNISDSIIVTSKSWINKIESICG
FT                   VRKDIYSIPNGFDPNKFQSISQQETRLKLGLPRDKKILINIGHLEEYKGQKYLIEAIAD
FT                   VVKWRSDFQVYIIGSGSLQEKLYKLISDLKLENFIIFAGGNKPHDEIPYWLNSCDLFIL
FT                   PSIAEGNPTVMFECLGCGKPFVGTKVGGVPDIVISEEYGLLCEPANSKDLAEKILYGLT
FT                   KEWDSKKIIKYAEQFTWENIARKVVEVYENTLKT"
FT   CDS_pept        complement(370957..372438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58569"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5B5"
FT                   /protein_id="BAF58569.1"
FT                   /translation="MYRRPTGQMVIEDFVLPFEGKLDANNRWVKLAKIIPWEQIENEYA
FT                   DLFPSNTGTVAKPLRMALGALIIKERCGYTDRETVEQITENPYLQYFIGLEKYQIEPPF
FT                   DPSLMVHFRKRLDQKIIKKINELICQSEKHKEQKDKDPKDKDPKDKDPGNPSGSGNFEV
FT                   WKPEVNKGKLLLDATCAPADIRYPTDLSLLNEAREKTEKMIDTLYNQELGLARKPRTYR
FT                   KRARKDYLKFARQRKPHVKAIRKAIGKQLGYLRRNLGTIDFLLKRDGHGNLSARQSREL
FT                   ETIRILYAQQREMYQTRTHRIDDRIVSISQPHVRPIVRGKARAETEFGAKVAISMVDGY
FT                   AFIDHLSWDSFNESLGLKQAVEDYKKRYGHYPEAVLADQLYRTRENLSFCRKHGIRLSG
FT                   PPLGRPLLDGRQEKKIARQDMRERNAIEGGFGVCKRRYGLARIMARLKETAESVIALQF
FT                   LVMNLEHRLRLLFCHFICAILKTYKDQNYTVYAVI"
FT   CDS_pept        complement(372615..374012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58570"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:A5CYT3"
FT                   /protein_id="BAF58570.1"
FT                   /translation="MNSILPEQYEIEKQFNSRVDNFLSRHEIGKILRRSNFQKEKGFSC
FT                   LELFKFIFLLVFNGKNLYRTLQSEAEPGRPEKDAIYRFLNSFRYNWRKFLLILSSSVIN
FT                   ETIEPLTSRNWKNVLVLDDSLYSRNRSKAVELLARVKDHVENKYVRGFRMLTLGWSDGN
FT                   TFLPVAFSLLSSENERNRLCGIDPRIDKRTTGYKRRVESIKKSTEVMFDLLRQAREYGV
FT                   QARYLLFDSWFAFPSIICRVREQHLLHVICMLKSMKRVLYTYKGEKVTLDTLYKELLKK
FT                   PGKAKILASALVQIGIDSEGNPVPARIVFIRDRNRSKKWLALLSTDLELTDEEIIRIYG
FT                   KRWSIEVFFKTTKSFLNLAREFQGRTYDSMVAHTTIVFCRYIMLALENRESKDPRTLGD
FT                   LFYVCCDELQDISFAEAFQLLLAMLKNTLRKFLAITDGALQELVNNFISCLPSFLKGRL
FT                   KLSPCES"
FT   CDS_pept        374634..375797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RfaG"
FT                   /locus_tag="PTH_0390"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58571"
FT                   /db_xref="GOA:A5D5B7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5B7"
FT                   /protein_id="BAF58571.1"
FT                   /translation="MRVVLAMPYSNSPLWGVQNVAYNLVQGFTRLYKELERNDIEITVL
FT                   SNVGRTLKPQEVFSQCPQLRIVSYRQLPPITFLGDIHQTLLAKKYFHATLSSADIVHSH
FT                   DVTFSLPIAKMFKDKPILHTCHGLFWNEKEYLNSLYQRFSYNTMTIRSKLLARLKNVKF
FT                   VAISNYVAEEIKRELRILDDRVHISHNPLSEDFFNIEKREIPGLIFYPVRLIPRKNHLP
FT                   LIEALGILKRKGPSHFTLALAGGVEDREYFNKIIQLVKKYGLENNVTFLGKLSKKEILE
FT                   YYSRASIVILTSHEETFSLTVAEAMATGTPVVASPVGIVPEIVTDWKTGFNINSNDPED
FT                   IADKIAILLDDDNLRKKMGDNAKIVANDFKSENIAQSLISLWKKVIY"
FT   CDS_pept        375776..377575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0391"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58572"
FT                   /db_xref="GOA:A5D5B8"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5B8"
FT                   /protein_id="BAF58572.1"
FT                   /translation="MEKGDILSRTRLFIDLIILLILGNMFMIYEYTLLPLNLSFIYYSL
FT                   VVAISIVIVDILRISSKVKNTTLMMMCIVLFYFSLKRGFISVLPDPLIGKLDTYCIYQV
FT                   AKSIIDLSHIQSIEYYTGAASANSTMPIAPIFSAIASITTGISLPVIQKNIGSILSGIL
FT                   LPVVLYLTYKPLQSLTGFVEGKIAWVLLLSSPWLLGFLTWGHYAAYSTIFVSILVFILL
FT                   IKYNEICGKYSNMNNMSLSLLWIIVSVVLAFTHTYMAIILLFVYLTWLIILYIYMRFSD
FT                   SGNAVISNFANTFSIYMVFVLTHLIWISAQFYGFIFMINYMIETLKFGAPSRGILYYGT
FT                   PQASPLVAIVLKYLGLFSLLLLSAVAILICVLYYKRIKHVTVHLLLYLSFLIISVVVIL
FT                   PYILDPKYGTDLFNRFFYLWYLGIAPFIGICYVRFYSERSVKKRIPKIFFEICMIFVII
FT                   LGLLSATTPDFQDWGSPIVSGEDIRLNLSEWIAAGEFSDNINSDTCYGLRMGVFTIGLF
FT                   KRMNYIQISPSVSNQNALVPPEHFEKINEYLKEKYCYLTKSIVMYPDISKYIIDKTSFE
FT                   KGTNRYGSNILYSCGDVLLLYFY"
FT   CDS_pept        377819..379285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58573"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5B9"
FT                   /protein_id="BAF58573.1"
FT                   /translation="MYRRPTGQMVIEDFVLPFEGKLDANNRWVKLAKIIPWEQIENEYA
FT                   DLFPSNTGTVAKPLRMALGALIIKERCGYTDRETVEQITENPYLQYFIGLEKYQIEPPF
FT                   DPSLMVHFRKRLDQKIIKKINELICQSEKHKDPKDKDPKDKDPGNPSGSGNFEVWKPEV
FT                   NKGKLLLDATCAPADIRYPTDLSLLNEAREKTEKMIDTLYNQELGLARKPRTYRKRARK
FT                   DYLKFARQRKPHVKAIRKAIGKQLGYLRRNLGTIDFLLKRDGHGNLSARQSRELETIRI
FT                   LYAQQREMYQTRTHRIDDRIVSISQPHVRPIVRGKARAETEFGAKVAISMVDGYAFIDH
FT                   LSWDSFNESLGLKQAVEDYKKRYGHYPEAVLADQLYRTRENLSFCRKHGIRLSGPPLGR
FT                   PPLDSRREKQFAHQDMRERNAVEGGFGVCKRRYGLARIMARLKETAESVIALQFLVMNL
FT                   EHRLRLLFCHFICAILKTYKDQNYTVYAVI"
FT   CDS_pept        379640..380734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="WecE"
FT                   /locus_tag="PTH_0393"
FT                   /product="predicted pyridoxal phosphate-dependent enzyme"
FT                   /note="involved in regulation of cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58574"
FT                   /db_xref="GOA:A5D5C0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5C0"
FT                   /protein_id="BAF58574.1"
FT                   /translation="MIPIAKPVLGNEEIEAVVEVLHSGRLAQGRKVEEFEEAFASYIGT
FT                   RYAVAVNSGTAALHLALLAHGIGEGDEVITTPFSFIATGNAILFTGAKPVFVDIDEKTF
FT                   NLDPDRLEEKITPRTKAILPVHLYGQPCVMDKIMDIAAKHNLAVIEDACQAHGAKYKGQ
FT                   KVGSFGTGCFSFYPTKNMITGEGGMVTTNNKEIAEKLKMLRNHGQKVRYFHEMLGYNLR
FT                   MTDLAAAIGLCQLKKLEDFNAKRRSNAQDLTEGLQDLKGIITPYILSEVKHVFHQYTIR
FT                   VSEKFGISRDTLREELIRLGINTEIYYPLPIHCQPFYRQLGYKEHLPRAEKASREVLSL
FT                   PVHPAVSGTDIQDILDAFGKIISK"
FT   CDS_pept        380752..382026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RfbX"
FT                   /locus_tag="PTH_0394"
FT                   /product="membrane protein"
FT                   /note="involved in the export of O-antigen and teichoic
FT                   acid"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58575"
FT                   /db_xref="GOA:A5D5C1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5C1"
FT                   /protein_id="BAF58575.1"
FT                   /translation="MSTAKLAIPKSLGELKQYLGDPLYKNSFFIVLSRVSNVACGFFFW
FT                   MLAARLYSTEDVGVATALISSLGLVIQFSRLGFDFSLIRFFPLNDRKKVFSTCLVITTI
FT                   SSFGVGIIYILGISLFSPELSFLKEGKYALIFILIAVINSIAAITGSTFVAKRDANYYF
FT                   IQNLFMALRVPFLIPLTFLGCFGIFGANGLAFLLASLFDLLLLYKSTGLDLKVDKKFVR
FT                   ESFKFSSGNYISSMFLSVPTLVLPIMIVNLLGGSEAAKYYIAFSIGNLVLIVPDALSTS
FT                   LFVEGSHGEGLKKNVIKAGLAIYAFLIPAVLFLYFSGGFLLKLFGKDYVDALELLRILS
FT                   LSSFLAAVYSLFAPIQNVRMKVESIIKINLARFLLLLGLCYLFILKFGIVGVGYAWMIT
FT                   YMLLVIVIVYVAKKENWFKFGQMKM"
FT   CDS_pept        382131..382256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0395"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58576"
FT                   /db_xref="GOA:A5D5C2"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5C2"
FT                   /protein_id="BAF58576.1"
FT                   /translation="MLLGMAGLDGIGMAYALAHLVVAVAAAGPLLKRLKEKEATC"
FT   CDS_pept        382541..382819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58577"
FT                   /db_xref="GOA:A5D588"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A5D588"
FT                   /protein_id="BAF58577.1"
FT                   /translation="MLVELKQKSQVTIPSELVKKLKLKPGDKLEIEEKDGCLIITPVEV
FT                   IPRAQMWFYSKEWQADEQKVEQQIREGRVKTAKNKDELFKGLGLDEI"
FT   CDS_pept        382816..383076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RelE"
FT                   /locus_tag="PTH_0397"
FT                   /product="cytotoxic translational repressor"
FT                   /note="toxin-antitoxin stability system"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58578"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A5D589"
FT                   /protein_id="BAF58578.1"
FT                   /translation="MNIYYSELFAEKVRQLPVEVKSILKKKLELMLENPRHPSLRTKKI
FT                   QGQDNIFEASVTMDIRMTWQYTGDGILLRNIGEHDKTLKNP"
FT   CDS_pept        383115..384386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ManB"
FT                   /locus_tag="PTH_0398"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58579"
FT                   /db_xref="GOA:A5D590"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D590"
FT                   /protein_id="BAF58579.1"
FT                   /translation="MREHGGSEVIIGRDNRVSSARLRDDLVRGLVAAGCRVVDVGLVVT
FT                   PMVYFARIHFGIDGAVMITGSHNPPEENGFKISRGAGTIYGEEIQRLRALMEKGKFAEG
FT                   NGAVEERDVAASYLAMLREKIKLGPRRLKVAVDCGNGTASLFAEQLLEGWGCEVVPLYC
FT                   EPDGSFPNHQPDPVKTANLADLRKAVLESGADLGVAYDGDADRIGVVDEKGNIVWGDRL
FT                   MCLYWREILPRFPGAAAIIEVKCSQALVDEVARLGGRPFFYKTGHSLIKAKMKEVGAVF
FT                   TGEMSGHMFFADEYFGYDDAFYATGRLLRILSGAEEPLSRLLESVPQYYSTAETRVPCA
FT                   DREKFRVVAGLVEHFRQRYEVIDVDGARVLFGDGWGLVRASNTQPVLVARCEAKTQEGL
FT                   DRICGIMKEALREYPAVGAFEWEF"
FT   CDS_pept        complement(383667..384794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58580"
FT                   /db_xref="UniProtKB/TrEMBL:A5D591"
FT                   /protein_id="BAF58580.1"
FT                   /translation="MRLPFSLQKPVNAVPDDGPRFFNGACNLWLYYTISGGEFPFFNLR
FT                   ETPQGFFTAVQILRNPSGVPASHRATSTGWVLKTRTRPPPQAAKAPEQRPKPNTRYVIY
FT                   IIRRLFNNIKMIHLLNNTFDIKVTENRPLSLVLKFPLKGPHCRVLPQRFLHDAANAVQS
FT                   FLCFSLAAGHQHRLGVGGPHQAPAVAEQHPGAVHVYHFIALPEMLHQPGHDAKLLPVGA
FT                   GHPGLRRGIILRHALQQPGEGLFRAGQDAQQAPGGVKGVVVPEVLIGKEHVPRHFAGEH
FT                   RPHFLHFGLDQGVAGLVKKRPASQPGHLVHQRLGALHLYDRRRPGKTRQYFPPVQAHQP
FT                   VAPDDIPFFIHHTDAVGVAVVGHPQVGTAFQHGLP"
FT   CDS_pept        384460..384702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0399"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58581"
FT                   /db_xref="GOA:A5D592"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D592"
FT                   /protein_id="BAF58581.1"
FT                   /translation="MLNKRLMIYITYLVLGFGLCSGAFAACGGGLVRVFNTQPVLVARC
FT                   EAGTPEGLRRICTAVKKPWGVSLRLKNGNSPPDMV"
FT   CDS_pept        384878..385096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58582"
FT                   /db_xref="UniProtKB/TrEMBL:A5D593"
FT                   /protein_id="BAF58582.1"
FT                   /translation="MAIDRLVEEIRKLSPKQKEELFRKLGITIPVDEDKLRGGPDDPLS
FT                   ELIGIFKGPGTGSEKYKEDLYGGKRPL"
FT   CDS_pept        385910..386191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58583"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5D594"
FT                   /protein_id="BAF58583.1"
FT                   /translation="MEKIIGVDQLRPRLGEYVDQAEKGEVVIISSRSKPKSVLIGYSFY
FT                   EELKRLAEKARQLELKAILDGMRQRGEEAGITEEDVLAEIEEVRGCGQ"
FT   CDS_pept        386179..386598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0403"
FT                   /product="predicted nucleic acid-binding protein"
FT                   /note="contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58584"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5D595"
FT                   /protein_id="BAF58584.1"
FT                   /translation="MRAVIDTSVLVSGMLSKKSYPARVLDAWVFNRFSPVISPDLAKEY
FT                   AAVLTRAKFDVLGPVEKRLQALERLLSFPWVVIAHPEEKIVVVSADPKDNTVLECAAGG
FT                   KTPWVVSGDKHLLRLGSYKDITIVTAEQFAKVLRL"
FT   CDS_pept        386628..387215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Uma2"
FT                   /locus_tag="PTH_0404"
FT                   /product="Uncharacterized protein conserved in
FT                   cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58585"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A5D596"
FT                   /protein_id="BAF58585.1"
FT                   /translation="MDASCCEPGLAYKAIPEKAVYTYEDYCRLPEGAPYELIGGKLVMT
FT                   PSPGKKHQIILKRLLKLLDNYVEDKDAGEVLCAPRDVCLAPTEVYQPDILFVAKDRLEI
FT                   SAEDKVNGAPDMIAEILSPSNAYYDLRKKFKAYEKYGVREYWIVDPEEASIEVYELADG
FT                   KFRLAAQKEKSGTVSSVVLPGFTIKLEDIFPS"
FT   CDS_pept        complement(387234..387482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D597"
FT                   /protein_id="BAF58586.1"
FT                   /translation="MIHYDLWWNPAVEDQATDRTYRIGQTRTVMVHRLISLGTFEEKIN
FT                   TMMASKRELAGLTVAAGESGLSELSNEELRELFKLEG"
FT   CDS_pept        complement(387548..387970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58587"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D598"
FT                   /protein_id="BAF58587.1"
FT                   /translation="MIYIIRRLFNNIKMIHLLNNTFDIKVTENRPLSWGAAPFMVVSLK
FT                   AGGTGLNLTAATHVIHYDLWWNPAVEDQATDRTYRIGQTRTVMVHRLISLGTFEEKINT
FT                   MMASKRELAGLTVAAGESSLSELSNEELRKLFKLEG"
FT   CDS_pept        387976..388203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0407"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58588"
FT                   /db_xref="GOA:A5D599"
FT                   /db_xref="UniProtKB/TrEMBL:A5D599"
FT                   /protein_id="BAF58588.1"
FT                   /translation="MYWALAFALALSLPAAGAMILLGGWFLHFFGAGYAENGAGVIRYL
FT                   ALAVVPQCVNVRYITVNRVKKRVHLIVEHF"
FT   CDS_pept        389098..390570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0408"
FT                   /product="HD superfamily phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58589"
FT                   /db_xref="GOA:A5D5A0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A0"
FT                   /protein_id="BAF58589.1"
FT                   /translation="MKVYKWINENIYGSIPVTKTEFDLINTKAFQRLRNIKQLGLAHLV
FT                   FPTADHSRFSHSLGVMHIIGRMAAHLRNKYQIFNTKEVDKLRIAGLLHDIGHYPLSHVG
FT                   EKVYQLLTKKEAIITKKRKGNKNEENILHIASTELKQEDVNHEKLGKYVILNREEIKKI
FT                   LERDDFDPNEIAKIINGEHINLAYDQLIHSGLDADRLDYLLRDTTQTGAKYGLVDLDYI
FT                   IRMLSVGRDENDNVWIGIDKRAIHSIEHFLLARYFSYSQVTWHRTIRGFEIMATALFYE
FT                   MAKRGMVYDSFEQLKRIVDTDNWINFNDNYFYQKISEFSNRINNELCNILLFNLNNRRR
FT                   AKLIYEEKDFRNGKAKSHSYAALENLIYKKRDEILKIANEHNIPEDFIFNQELSLKIDK
FT                   IPSSTLLDITDENKKETIMVIDKGKIFPISSLPSSIIHPLSERSLYCLRLYVVDLFIGK
FT                   TLEESNNLFDSFISDFKRLYDNELKFLKEKLP"
FT   CDS_pept        390648..391118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58590"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A1"
FT                   /protein_id="BAF58590.1"
FT                   /translation="MVKLAEALLERKSLKEQIGALKERAIKDARVQEGDQPAERPEYLV
FT                   AEIEKLVIRLEKLVVAINRTNLQARLPDGQTLMEAIAQRDMLKLRHQLAKDLANAAAPE
FT                   RDSWRLTRSEVKFQPTVDVARWRREADALAKAYRELDNTIQAVNWTTELIEE"
FT   CDS_pept        complement(391435..395205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0410"
FT                   /product="hypothetical protein"
FT                   /note="containing COG1061, SSL2, DNA or RNA helicases of
FT                   superfamily II and COG4279, uncharacterized conserved
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58591"
FT                   /db_xref="GOA:A5D5A2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A2"
FT                   /protein_id="BAF58591.1"
FT                   /translation="MPRRKYGKTWWGAAWVEAMEKIDYNTNRLPRGRSYAAGGRVKEIK
FT                   IDPAGKVLARVQGTRPTPYKIEIKFREFSRQEVETAAAIIASDPALAAELSMGRLPEKI
FT                   LELLKKNKILLLPEAWSDIAARCSCPDWANPCKHLAAVYYIMANEIDKDPFILFKLKGI
FT                   DAEGLMQAAGFVSREQSAGSSHAEVISAGAPSFVPYQEFKIAAKEGRAAGSAAETAAER
FT                   GPEGPGEMPEELCALAASRENEAIFALLGESPLFYPGGDFKAVLLRAYKNISRSMEKIE
FT                   LKENGYPFKDTALTLLYPSNAELRKKAPGRGPGRPFWQNFSFFAAPLDAASGKEKSGLL
FT                   TSPAGKKKKLSVPLPEGNRLVLKNKKGVLLPAENVLDLFLSLPLRLPANRTSPWADFLS
FT                   ALAATAQALARSSSFIPVLRGLGTESAKDREPESFYIVYRPLDRSGKLQRVVDYLVSIM
FT                   PPGFVFSQKEKGVLAGPAAVEELLTLALTYIAGRYAGTEPDKGDKVARAFFCGEPYLAQ
FT                   KFEEKQTAKAISDWLGWLNLRPAGVAPVIKIGLPRPGREKFTLRVQVENKKDPLAPVLP
FT                   LREVFLDQKEIFSLPAEYVRREVARQLTVAGEHIPILKKLLSYKGEKAAALSAEALAGF
FT                   LTEGQHICSLLGIRVMLPKELKQIASPRLALAARAVPGKGKSVSYLNLDEILEFSWEVS
FT                   LGGAPVSAEEFRKLAESAAGVVKFRDKYLLLKPEEVSSILAKLSRPAPRLTAMEALRAA
FT                   VTGEAAGAEFNPGPVLQKLADDLGTPADVSLPAGLKADLRPYQVRGFKWLYYNTVRGLG
FT                   SCLADDMGLGKTLQVITLLLKLKEERWLEKPALVVCPTTLIGNWVRECSRFAPSLKAAV
FT                   YHGSGRRLDTRGTDLLITSYGILRRETAKFKKKEWSLVIIDEAQNIKNPESDQTKAVKS
FT                   LAAKCRIAMSGTPVENRLAELWSIFDFINRGYLGSLSEFTGSFAVPIEKYRDPDRIARL
FT                   KKATAPFLLRRLKSDRTIIKDLPPKIVKEENCYLSREQAALYRQVVEQVMEEIEHSEGI
FT                   TRKGLVFKLITSLKQICNHPVHYSKKGKPAKEHSGKAEKALDLLAQIAAAGEKALIFTQ
FT                   YREMGELLVEMIREELQEEALFFHGGLPRQKRDEMVKKFQEDKGAAPFMVVSLKAGGTG
FT                   LNLTAATHVIHYDLWWNPAVEDQATDRTYRIGQTRTVMVHRLISLGTFEEKINTMMASK
FT                   RELAGLTVAAGESSLSELSNEELRKLFKLEG"
FT   CDS_pept        complement(396051..396488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VapC"
FT                   /locus_tag="PTH_0411"
FT                   /product="predicted nucleic acid-binding protein"
FT                   /note="contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58592"
FT                   /db_xref="GOA:A5D5A3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A3"
FT                   /protein_id="BAF58592.1"
FT                   /translation="MNNLLLDTSVLVDHLREYKPATEFLETAFNSGAVVAISAVTEMEL
FT                   YAGKSMENPAIEEDVLKFLKLFKTLPVTSNIARQAGLMLRRYRHQGLTPIDAIIASTAM
FT                   EHNANLITRNIKHFRMVKGIIVFGVPDETNSRPAKGEKKKE"
FT   CDS_pept        complement(396481..396771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AbrB"
FT                   /locus_tag="PTH_0412"
FT                   /product="regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58593"
FT                   /db_xref="GOA:A5D5A4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A4"
FT                   /protein_id="BAF58593.1"
FT                   /translation="MFFMETRISLKGQITLPAEARKKFGIKTGDVLKVRITEDGILVLP
FT                   GKTGLNNNQANALETLRKTSGIWKDMEETGENFVRRLRAEDAERWKVLGIE"
FT   CDS_pept        396935..398122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LolE"
FT                   /locus_tag="PTH_0413"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permeasecomponent"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58594"
FT                   /db_xref="GOA:A5D5A5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A5"
FT                   /protein_id="BAF58594.1"
FT                   /translation="MSLLIFSVQNAFRKKAAAVLAVLGVAFGTALMTFLFSVAAGMEKR
FT                   AERTFSELSGKIVVTGRDAIFGGLFMGMGTPPVPAYYVQAIEGLPHVEKVYAQVSVIMR
FT                   PKNVSYAMPLFGYGGEEAQASGKLPYGSLIEGSLPQNNREIIMGKSLQEYLNLLGAPFA
FT                   VGGVYPFIVMEKGQAKDLELKVVGVYQTGNEVLDGAFSGSEELAREMGKIPAAYVSAIN
FT                   VVVDGVANVEGVARAIQQELAGKKPEVQVVVPREVLNPLKKVLETFGKFLKAVSLVAVL
FT                   AGGLSIMVVMLLSVVGRMKEFGILKALGWTPANIVFMVLVESVVLSLAGSVLGVGLGCA
FT                   GLAAAKAYIAGDIAAFTWRVAASVCLAGVAIGVAAGVYPAWRANGALPAKILREV"
FT   CDS_pept        398152..398808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SalX"
FT                   /locus_tag="PTH_0414"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58595"
FT                   /db_xref="GOA:A5D5A6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D5A6"
FT                   /protein_id="BAF58595.1"
FT                   /translation="MLIAVKNLTKVYGKGPLAVRALDVESLEIKEGEMAAVTGPSGCGK
FT                   TTLLNLIGALDGPTGGEIFFKGERISGRGETALCRFRREKVGFVFQAYHLIPSLSALKN
FT                   VLVPAVPLGGGRVRRARELLRLVGLAGKESRRPGELSGGEQQRVAVARALLLDPELILA
FT                   DEPTGNLDSAAGAEIMELLKSLNRRGKTVIVATHDRRVAESCGRVIRLADGRVVS"
FT   CDS_pept        complement(398829..399506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0415"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58596"
FT                   /db_xref="UniProtKB/TrEMBL:A5D569"
FT                   /protein_id="BAF58596.1"
FT                   /translation="MFKKSVLKAMVLLLFVALAGAALPVQHSPFRPPAAPQEQPAGSGG
FT                   AETGPENRQDPAGGSGGKTAPENRQAPAGSESGTSPGGAGQAPAGAEGGNSGPETARQG
FT                   SSSGGTGSLRGQIEEKYLSRLQSLASGYESRLNGLASAASSELAAAKKADPNADLNPII
FT                   NKYYAAGKALEAECDSQFYSILAEFESELSAHSLPLDTAVRAREAYEARKGARAGQLLS
FT                   GGL"
FT   CDS_pept        complement(399562..399972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0416"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58597"
FT                   /db_xref="GOA:A5D570"
FT                   /db_xref="UniProtKB/TrEMBL:A5D570"
FT                   /protein_id="BAF58597.1"
FT                   /translation="MTGAAHIAAAAVIYKYGRFNRPCLFFLAFASHFLLDATPHYELGL
FT                   PANFLLGAGVLALLFQRARRQKDWGMPAAGLLGELPDANWLFSAGPVWHNIHSFFHFKK
FT                   AFPASWPCLPLEALFLAAAVYLLCGKTQGRAG"
FT   CDS_pept        400330..403758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0417"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing two S-layer homology (SLH) domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58598"
FT                   /db_xref="GOA:A5D571"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A5D571"
FT                   /protein_id="BAF58598.1"
FT                   /translation="MRVKSRQTAVPFLVLCFVLAFAGAAFAAAFSDTGGHWAESRIAEW
FT                   AQKGLVQGYPDGTFRPDGEVTRAEFVALTNRAFGVVKAGAAEAGFADVKPGDWFYEDVM
FT                   AAKAAGYIAGYPDGTFMPDRNITRQEAAVILARLLGLQPDAGRAAGFADGGAVGAWAAG
FT                   SVGAVAKAGLMVGMPDGTFMPLKGTTRAEAVVLLDRAVAYRPAGAIEGSVTLNGSAASG
FT                   ASVRVFAAGGYEVLKEAVTGSDGKFKVELPPGEYDVTAAAAADVAFAGGVKVASSRATG
FT                   VSLALQPAAVISGVLKDRDGSSAVKNTAVLFTANPTFAARTDGEGKFTVPVLPNRTYTV
FT                   RAYDPGKKGAAPEVVKTGLEVGPAGKYDIGTLNAPFEVSAVSGGGGGGGGPSGPIVLTV
FT                   ISAGEYKDPRGYKIASFGTFGPASGTATFTSKLIIDPGDAGTLTLRNISAGEIEVLSGG
FT                   TSSVHTQYVKAGKLVASASGGVKIEAGEGTVITTTEVQGETHIAVAPGALASFGAITIK
FT                   SGAAGKTVAFSGDLSGSTVTVAAGSVTLQADSGVQMGRVVIDAPGEINLTGAGSFGEIE
FT                   VSENAGQGGTPVINVVAGTGVDKLVLSTTVELKGDGIINVPLEVTDPENVQIIVNDQGA
FT                   KDALTNKAKSDAEAAIAAIPSSITLNDEAAVVSARNKVNAVQVLKDKGENLGDLISNLG
FT                   KLEDAESVISALKSIDVGFASGDSAAGVTKNLTLPGTAGGLAVDWQSSDTAVITACGAV
FT                   TRQETDRQVKLTATVTKGSITGTREFTLTVKAVPPEIISFAGEAPDAGNVITVPLANIT
FT                   TTTGIEVSRDCSLALNMEGMGAVRQFDLEAGKVNSIYNILIPGAGEVDLSGLDLNKLAD
FT                   AAGQCPPDTREDILDAVDFAALFDLLSGNPEVKSRIIDETDLDGLMDQIVGDPGVDLDA
FT                   VFDAFDFAGVLNAVRDDGSITSDDIMDAVNFDELAEIINNLADQQLKDRILDAIDIDKL
FT                   LDADTKEELYAAVNFSALFEALSDVDELVKDDIFRTINFTALFDMLSGADAGTVEAVFG
FT                   AVNFTSLFEAVAGAGDDTVSAVVEAALQMADIMRDCGISRNDILDTIDFSSLNKESLYE
FT                   WLSEVDGDGSALTLEAVLTDSAGNTSTYTINIVKQ"
FT   CDS_pept        complement(404123..404500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58599"
FT                   /db_xref="UniProtKB/TrEMBL:A5D572"
FT                   /protein_id="BAF58599.1"
FT                   /translation="MGIPKEELHRLVDRLPEHNLARAKKYLEMLLTISPPDSAAKPRPQ
FT                   NKPFYISPNCPECGTPLVPADVLNGPDTPEDQIWHDEFICPKCLDFIYLDWPESERTAL
FT                   NEGKCQEGGIEWDELKRELDL"
FT   CDS_pept        404787..406163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0419"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing three S-layer homology SLH) domains"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58600"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A5D573"
FT                   /protein_id="BAF58600.1"
FT                   /translation="MFIKAAARFFAIALVAMFCFWGGGPALAQPADIQGHWAENQIGDW
FT                   FARGLIAGYGDGTFRPDNKVTRAEFVVMTNRAFGFNSGIQAPFSDVSPGDWFFGQLCAA
FT                   FTAGYIAGDADGRFRPGDGISRQEVAVVLSRLLKLKMPEGGDAHAAFKDAGSIAEWSRA
FT                   AVSAVVAAGYMAGYPEDRTFRPAEPITRAEAVVVLDRAKKAYEQSLATGGTGVPGAGAV
FT                   SVAVPLADCSMTLGGQALAVDLAGVFSSAGGASLTYSASSSNAGVAAVAVSGSTLTVSA
FT                   VSAGSAVITVTAGDGRGNSATDEFTVTVSAAAPGGGGGGGGAPPAGPGGGETGAPKIER
FT                   ASVVAGGQTLEVEIDESGLNGFIDLSRLDGSTVITEGTISVSEAARLTLSVQVGGETIT
FT                   KVQNLKAGENRLEAMDIIKKYGLSLNLIELFLGDPVVLSGTLEYGSGKAVPVSLTIDLP
FT                   "
FT   CDS_pept        406412..406693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0420"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58601"
FT                   /db_xref="GOA:A5D574"
FT                   /db_xref="UniProtKB/TrEMBL:A5D574"
FT                   /protein_id="BAF58601.1"
FT                   /translation="MISTVTTVTTTTTTTTTASTVTTATSLMAGLGLTATIALIILLIA
FT                   KELAGAAAEGSPRGPGVAGAMDRVLNVGIIPLLMVFVSIVFVKVMSVL"
FT   CDS_pept        406974..407207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58602"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:A5D575"
FT                   /protein_id="BAF58602.1"
FT                   /translation="MNRVPVNKIPAGSVLRLELRVGVDQSGNPVYRNRSFSNVKPGASD
FT                   QDLFDVAGALAALLEYPLNSVSRIDSAHLVQA"
FT   CDS_pept        407267..407500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58603"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:A5D576"
FT                   /protein_id="BAF58603.1"
FT                   /translation="MATTVQSLRMVFRNQAGRNVTITLENPRDNLTAAEIEAAMDLIIA
FT                   RNIFTSSGGDLVAKQDIRLIDTTTNDLYEPPA"
FT   CDS_pept        409710..410078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58604"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="UniProtKB/TrEMBL:A5D577"
FT                   /protein_id="BAF58604.1"
FT                   /translation="MAKLCRCGSIAVEKQVDIERNIGGRRIIFKKVPAFICPNCSERYF
FT                   TSKTIKHMDRLLAKKGNKTEIDFELDPKEQQFLSYFKIFKDRFICPRGATMDMPVSLAD
FT                   LFLVASRLSELKLEQSYK"
FT   CDS_pept        complement(410387..410653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0424"
FT                   /product="hypothetical protein"
FT                   /note="containing Gas vesicle protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58605"
FT                   /db_xref="GOA:A5D578"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:A5D578"
FT                   /protein_id="BAF58605.1"
FT                   /translation="MQQSVKSTNIAEILERVLDKGLVIAGDIKISLADVELLSIKIRLL
FT                   IASVDKAKEMGINWWETDPQLTSPPKPAKKKKKARARPQPAPA"
FT   CDS_pept        complement(410667..411008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0425"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58606"
FT                   /db_xref="GOA:A5D579"
FT                   /db_xref="InterPro:IPR007805"
FT                   /db_xref="UniProtKB/TrEMBL:A5D579"
FT                   /protein_id="BAF58606.1"
FT                   /translation="MLSKACVDPEAVEDFRDEMEQAGRALPDRVGADPDKVEQGLAKLV
FT                   LTIIQLLIRLLEKQAIRRIDRGGLSSEEIDRMGITFMKLENKMEELKKAFGLEGEELNL
FT                   NLGPLGDLM"
FT   CDS_pept        complement(410986..411717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0426"
FT                   /product="hypothetical protein"
FT                   /note="containing Gas vesicle synthesis protein GvpL/GvpF"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58607"
FT                   /db_xref="GOA:A5D580"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:A5D580"
FT                   /protein_id="BAF58607.1"
FT                   /translation="MIYVYGIVPLHPFQTAAAAGRKVYLVPYRDIGAVVSEAAGGQWLP
FT                   GEENYLAHEQVVEAAMAHTTILPMRFGTVLKSEQSVAEMLAGYYKQFKQHLGRLENCVE
FT                   MGLKAIWDLDGVKARFRPQSPKGFGPGPDRPGCAFLEGKRKDMELIDFLAASAREAAAG
FT                   IQKHLADCAEDFTCKLSPTRRLFFTAAYLVKKNRLENFKEAFQLCRSANRSLKFLLSGP
FT                   WPPYSFIKITEGGNFAEQGLR"
FT   CDS_pept        complement(411714..411908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0427"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58608"
FT                   /db_xref="GOA:A5D581"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="UniProtKB/TrEMBL:A5D581"
FT                   /protein_id="BAF58608.1"
FT                   /translation="MNQASSLENLTLLELLDRILGKGVVISGDIIISVAEVDLIYLGLR
FT                   LVLGSIDTIRPAFREGEFS"
FT   CDS_pept        complement(411905..413182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0428"
FT                   /product="hypothetical protein"
FT                   /note="containing Gas vesicle synthesis protein GvpL/GvpF"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58609"
FT                   /db_xref="GOA:A5D582"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:A5D582"
FT                   /protein_id="BAF58609.1"
FT                   /translation="MKDRELFLNLLREAFREKAGRLLPALLGEIWDEAVAGFKNDVKSL
FT                   LREVLEDELRKFMQEKNPAGKKARPAKTAGRRSGQGLAARTGRPVPPAKGKGRSSRRNQ
FT                   APENAPPGPAAKGKSICKEAPAAAPTPARRPEGGPGSAPGPEPQDGPPPQKAYGVYLYC
FT                   ITNAGAEKLSPGVCGVDGNGEIFPLVHQSLCAFASTVSLAEFSQEALERRLQDAAWLQA
FT                   AVEAHENVIEKVMENNPVVPMKFCTVFSSAEKVLDMLQEREKELRQVLDFLKDKEEWGL
FT                   KVYCNRPVLKKLVAEQSENIRKMKAGAGPQPAGAAYFLKKKIDGLIEEETGQAARRCAA
FT                   ECHQALSQIAVLSAENKLLDREITGKSEEMVLNGAYLVSQARLEEFKETAAALEQKYRP
FT                   CGFEFALTGRWPPYNFCLPPERSAEA"
FT   CDS_pept        complement(413184..413444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0429"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing GvpG, Gas vesicle protein G"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58610"
FT                   /db_xref="InterPro:IPR007804"
FT                   /db_xref="UniProtKB/TrEMBL:A5D583"
FT                   /protein_id="BAF58610.1"
FT                   /translation="MFIVDDLFMSPLRFLLFVAREIYKHAEAELTDEQAIARQLLEAQH
FT                   LLDSGEIDQEEYGRIEEKLLDRLRLAREIKASRAEEEAEEE"
FT   CDS_pept        complement(413451..414119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0430"
FT                   /product="hypothetical protein"
FT                   /note="containing GvpL_GvpF, Gas vesicle synthesis protein
FT                   GvpL/GvpF"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58611"
FT                   /db_xref="GOA:A5D584"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:A5D584"
FT                   /protein_id="BAF58611.1"
FT                   /translation="MHTINYRDLAMVVSSTPAVTFDPVKENVMAHQKVISAVMEEFDIM
FT                   PMSFGIVAESAGEIVSLMKRDYARFKSAMARIKGKVELDLKIYWKKEAFKKEITEVNGA
FT                   IAEMGEALSGKEEAAVYFDKISLGRMVEAAAEERRNFYHKEIYDPLQDIADSSLKKEIV
FT                   TPRMVLHAVFLTAREKLSEFDLKVEEFHQKYKDALAIKYTGPWPPYNFVNIRINLTRSR
FT                   "
FT   CDS_pept        complement(414195..416111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SpoVK"
FT                   /locus_tag="PTH_0431"
FT                   /product="ATPase"
FT                   /note="AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58612"
FT                   /db_xref="GOA:A5D585"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A5D585"
FT                   /protein_id="BAF58612.1"
FT                   /translation="MKNKGDSGFGIGDFFKGLGSLIDLAGSLEPDESGEISRSGVFLDK
FT                   KGLKGTYGLNIKIGGESAGGQTLKRGTTRDGPAGPEGGPAPDQNSKGSAAKEFSYRDIG
FT                   GLDKELQKIREMIELPLTHPELFEHLGIEPPRGVLLYGPPGTGKTLIARAVAGETKACF
FT                   IHVNGPEIIHKYYGESEARLREIFQKAAGNRPSIIFLDEIDAVAPKREEVTGEVEKRVV
FT                   AQLLALMDGLKSRGQVIVIGATNLPNAIDPALRRPGRFDREIRVSIPDRKGRREILSIH
FT                   TRGMPVAGDVDLDRLAEITHGFVGADLRALCQEAAMRCVRRVYPLIGAQTGKAAGEFLA
FT                   GIKVEMKDFLEAMKEVEPSATREFLVDVPAVRWEDVGGLKEIKQELRQAVEWPLKYREL
FT                   FETAGISPPRGVILHGPPGTGKTLLARALASEINANFIAVKGPSLLSKWMGESEKAVRE
FT                   LFRKAKQVAPCLVFFDEIDSLVPAREAGHGGAADRVLSQLLTEIDGIEELRGVVLLAAT
FT                   NRIDLIDPALLRPGRFDLHLRLDLPDKEAIVEIFKVHTRKMPLHQNIDLDALADACKGF
FT                   SGADIRQVCHRAAILAMREYIEANKKAAAAPRYRVTMQHFLKSLEFIKNAGRGERLEKS
FT                   KRG"
FT   CDS_pept        complement(416137..417045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0432"
FT                   /product="MoxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58613"
FT                   /db_xref="GOA:A5D586"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013462"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D586"
FT                   /protein_id="BAF58613.1"
FT                   /translation="MPVEPSANFPFNNEVFVETPYLANLTERVMMYLKSGFPVHLSGPS
FT                   GTGKTSLALNIARKLGRPVTLIHGNEDFMITDLVGGNVGYRRKKVIDNFIHNVYSVTES
FT                   LQQQWLDGRITTACRNGHTLIYDEFTRSRPEVNNILLSILEERTLSLPGFGDGGEDLKV
FT                   HPEFKAVFTSNPEEYAGIYKAQIALSDRLITIGLENFDIETETAITSAKSGLDAARAEK
FT                   IVRLVRAFRDSCGQPVVASIRTSIKIARVVSVNGLPMGKDEPAFRQVCADVLHSLVPGP
FT                   ARHGQEKLAGLIGEIIAGIFN"
FT   CDS_pept        complement(417121..417375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58614"
FT                   /db_xref="GOA:A5D587"
FT                   /db_xref="InterPro:IPR008634"
FT                   /db_xref="UniProtKB/TrEMBL:A5D587"
FT                   /protein_id="BAF58614.1"
FT                   /translation="MLIQKVITVVTEFFNEVLKKSGSVIAVAPQQDEGWKVQIEVAEDT
FT                   EYMRKRARDDLMALYEVTVDRELQITSFERLSLRERDVR"
FT   CDS_pept        complement(417391..417690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58615"
FT                   /db_xref="UniProtKB/TrEMBL:A5D550"
FT                   /protein_id="BAF58615.1"
FT                   /translation="MSLTQSAAIIGQELINSLKARLEHLEAMQDEVLQLLAKYNQERQA
FT                   LAGEIKKILADDRLARLEEVGRLLGSFAEDRAGAQKIWQETQEALNSIRTLKKR"
FT   CDS_pept        complement(417789..417998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0435"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing Gas vesicle protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58616"
FT                   /db_xref="GOA:A5D551"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:A5D551"
FT                   /protein_id="BAF58616.1"
FT                   /translation="MRHSIEASSLAEVIDRILDKGIVIDLWARVSLVGIELLAIEARIV
FT                   IAGVETWLKYAEAVGLTKHIPVAA"
FT   CDS_pept        418330..418851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0436"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58617"
FT                   /db_xref="GOA:A5D552"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A5D552"
FT                   /protein_id="BAF58617.1"
FT                   /translation="MPEDLPLKIKTFSARHRQYIVCVLKEIIEYYGSLLLGCAVFGSYA
FT                   RGDNRKNSDLDLLIILKKAPGLSLRIKEFVERIEMKYEHLAQEIYEKDDILCELSPYIL
FT                   SRDEALRLQPLYYDLVQHHLVVYDPEGLIARIINSTAGIMLRSGARKARCGNTWEWYNE
FT                   KACFMGGEEL"
FT   CDS_pept        418848..419258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0437"
FT                   /product="uncharacterized conserved protein"
FT                   /note="related to C-terminal domain of eukaryotic
FT                   chaperone, SACSIN"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58618"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:A5D553"
FT                   /protein_id="BAF58618.1"
FT                   /translation="MKIDELAASYLKKAQVRFKALHFYKENEAYSDVVREAQELVELLL
FT                   KAVLRTVGVEVPKVHDVGRTLEKHCDSLPPAIAGSLNEIKKISKRLRKERELSFYGAED
FT                   FIPTEEYGLDDAETAIKDAEFVLKKVQEAFMK"
FT   CDS_pept        419326..420027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AmiC"
FT                   /locus_tag="PTH_0438"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58619"
FT                   /db_xref="GOA:A5D554"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A5D554"
FT                   /protein_id="BAF58619.1"
FT                   /translation="MLKLVLDPGHGGIDAGAVGNGIKEKDLNLELCRRIAGKLEGYDVE
FT                   VTLTRTADADVDVYRRCELANSLKADYFCSVHANSGGGTGFESYVYTHAGEITESLRGV
FT                   VHEKVAAYFKSAGFPDRGKKRANFVVLRETGMPAVLLENLFLDSPRDAVRLKDSSFLDG
FT                   LAAAVAGGLVAALGIPVKEQAPPPLPWDPAAEIARLKADGLINSDHRPEDPVMWGELAT
FT                   VLNRIISFRRP"
FT   CDS_pept        420110..420391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArsR"
FT                   /locus_tag="PTH_0439"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58620"
FT                   /db_xref="GOA:A5D555"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D555"
FT                   /protein_id="BAF58620.1"
FT                   /translation="MSDPVRYKILMMLARSEDGCCPVPGEAGSRPGLCNCELMARLDMI
FT                   QSRVSYHMKELAKAGLVIEQPRGRWKFYSLNVCALKSYIEDLTRDFGL"
FT   CDS_pept        420442..421263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0440"
FT                   /product="predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58621"
FT                   /db_xref="GOA:A5D556"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5D556"
FT                   /protein_id="BAF58621.1"
FT                   /translation="MEDIREFVRKKYAVAVAGKTGCCGDAGGDCCGGVTAGATCNGAVT
FT                   EDLYSPDELAWLPEEAAAAAFGCGNPSALAELREGEVVLDLGSGAGLDVLLSARRVGPR
FT                   GKVYGLDMTDEMLAAARANQARAGIENVEFLKGYLEEIPLPDNAVDVIISNCVINLTAD
FT                   KDRVLREAFRVLKPGGRLAVSDIVVRRPLPRKVQQSLAAWAGCVAGALQEQEYREKLAA
FT                   AGFVDIGVEITRVYDTKSRAAAALLPGLTDEERRQTGGALASAFVRAKKPC"
FT   CDS_pept        421408..422394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GalE"
FT                   /locus_tag="PTH_0441"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58622"
FT                   /db_xref="GOA:A5D557"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D557"
FT                   /protein_id="BAF58622.1"
FT                   /translation="MNVLVSGGAGYIGSHTVRELIKRNHFVVVLDNLTKWHRAAVQGAE
FT                   LVAGDTADRELLRGLFRKYGIEAVMHFAASSLVGESVRRPSEYYYNNVVKGLSLMDAMV
FT                   EAGVRFLIFSSTAAVYGEPREVPITEAHPANPTNPYGATKLAVEGAMRWYGEAYGLRYA
FT                   SLRYFNAAGADPAGDIGEDHDPETHLIPLVLKTALGLLPRLEVYGTDYPTPDGTCIRDY
FT                   IHVSDLAEAHVLALEALAAGAPSAVYNLGNGSGYSVLEVVRAAEEVTGRPIPVHYGPRR
FT                   AGDPSVLVAGSEKIKADLGWRPRFTSLGDIIGTAWRWHLGHPGGFEK"
FT   CDS_pept        422405..423526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0442"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58623"
FT                   /db_xref="UniProtKB/TrEMBL:A5D558"
FT                   /protein_id="BAF58623.1"
FT                   /translation="MRTFAIAGLILLAGLFACFPGAGGRAGGESRPITTLEGRREALVR
FT                   QAGLEEKEKELVAELLAWDVKIDAARREQERLRQEIPAAERSLAGAEAGLAEARARLEE
FT                   GRDRLGRWVNFLYRYGWVTYLEVVLGAASFGEFVERAQAVMIVIANQAKMLDEVRELTA
FT                   RLQEQVDACERARRELAEKGARLEASLNEMAAARAGREEFLAGLRRESAALAEKIVQAE
FT                   VFWYRSLSSFNSLLSSLDVFPWRDLSPEKITVKGSKVQVEISENEINRVLLDNGGAGLN
FT                   VQISPGLFAISGPASGGSPDFRIEGDFAAEDGKVRFRPAGVYLDGVPVSREVLAFVSSE
FT                   SRLALDPQVYLPGCRLSEVRAEAGRLVLLMALK"
FT   CDS_pept        complement(423775..424869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PerM"
FT                   /locus_tag="PTH_0443"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58624"
FT                   /db_xref="GOA:A5D559"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:A5D559"
FT                   /protein_id="BAF58624.1"
FT                   /translation="MREFYKKHWNAITNVALLAATLVIAAIAFKLVIPYFLPFLLGLIL
FT                   AVAIEPVVGLFQKLKMPRAAATGMAMLVTVGSLAAVAWLTVSKLIVELARFLANAPSHT
FT                   SIMKDQSSLLMQRLQSYAEGFPPEFTHHLNKNAEMLTEMFSEKLSLLAREILGVITGLP
FT                   NQLLLVVIALIAAFFFSKDLPILKKKMLSAIPREYHHKFEIMAGEIYHSSIGFIKAQAI
FT                   LSAITSLVILAGLIILKTEYVVAISLLGGLVSPIPVLGVGTIFIPWIIISLLEGKTFMA
FT                   AGLIILFFAVVVIKHSIEPKVLGENMGIAPLSVLISLYVGYELFGAYGFILGPFVLITY
FT                   NALQKVKAFAWLFREGSGGTAGPD"
FT   CDS_pept        425123..426349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GltD"
FT                   /locus_tag="PTH_0444"
FT                   /product="NADPH-dependent glutamate synthase beta chain and
FT                   related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58625"
FT                   /db_xref="GOA:A5D560"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5D560"
FT                   /protein_id="BAF58625.1"
FT                   /translation="MSELLPPCTNACPVRTDVRGYIAAIARRDYVEACRLIRARNPFPS
FT                   VCAWVCPHPCEEACRRAGVDMPLSIRELKRFAVENAAWSPAVPAPATGKKVAVVGAGPA
FT                   GLTAAYELVLRGHRAVVYERHRSPGGHFFTSLPAYRLPREVLQRDLETILAAGVEVRTG
FT                   VEVGRDVTVTRLRDEYDAVIIGVGLRASKRLDVPGGGLPGVYPALEFLEMANLGERPRV
FT                   SGRVAVVGGGDVAMDAARTALRLGASEVLVICLEEREQMPAHRWEVDEALAEGVTLLPG
FT                   RGPAGIMEQGGRVVGLKVQKVKSVFDPDGRFNPVYEPGSFESVPCDTVITAIGQAPDFR
FT                   FLNGSGLKAGEGGRLVLDGEFFVAGVRGLFCLRRDSRRARPGHCRSSLRPQGGGVGGPL
FT                   FKGRKRAAA"
FT   CDS_pept        426207..427109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0445"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing NapF, ferredoxin (COG1145)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58626"
FT                   /db_xref="GOA:A5D561"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5D561"
FT                   /protein_id="BAF58626.1"
FT                   /translation="MLPVSAASFACGEIAAGPGPAIAAVASGRRAAELVDRYLKGAKGL
FT                   PPEDEGAVIGPLPAKVAGRIPRRARREAAGPPGGKAGVLLVPRPVPAEPDALYEAGRCL
FT                   SCGLGARVDGAKCAACLACLRVCPYGVPVAGRQAVMPVEGCLACGICASVCPAGAIAVE
FT                   KVDMAAGPHLPLDGRLAGKVAVFTCLGACEERLELDALKKNGGQPGLHVIEMPAAGALR
FT                   LEWILNAFENGAAGAAVIACGAGECCHPGGAAYAQGVVARARSILEQAGIAPERLCCLR
FT                   PDGERDAASLLAGFIEGLK"
FT   CDS_pept        complement(427112..427417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MarR"
FT                   /locus_tag="PTH_0446"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58627"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D562"
FT                   /protein_id="BAF58627.1"
FT                   /translation="MDNAGLNPEKLSLPPHSLDVLRVIGERGGMVCSGGCHNIKPGDLH
FT                   CRQIGNALGIGFNTVWDRVGRLNKEGLIAREKDEGGPVRLTVTPRGREILKQAFGG"
FT   CDS_pept        427686..427997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58628"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A5D563"
FT                   /protein_id="BAF58628.1"
FT                   /translation="MNAPGRFEMFYRQVEDVLFCCPKVAEAVVLAVGGLQQAEILKAYI
FT                   VLREGEAATAEEIVRFCAGRLEEFLVPGAVEFRESLPKTPAGKVLRRVLLEEEKNRNR"
FT   CDS_pept        428411..429388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CorA"
FT                   /locus_tag="PTH_0448"
FT                   /product="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58629"
FT                   /db_xref="GOA:A5D564"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:A5D564"
FT                   /protein_id="BAF58629.1"
FT                   /translation="MIKTYLYSHGENRMYHDVELEKKNEFLKHEEDLLWVDLYRFTEEE
FT                   IKYVARIFDFHPLAVEDCMSYSPRAKLDNYEDYYFFVMHALRYDEESEEEIVLVQLNVF
FT                   LGPNFVVTVHNQTLPVLGRMARVSLHSSQYMNKGMEFFLYSIIDGNTDEIFPILERIGV
FT                   RIDELEDEIYEQPSKEITEEFLALKRTILTIRRAVLPQLRVFTSINAGGHPYFDIREEI
FT                   KPYFLDLVDHLERIADSIEGYRDLVDASLATYHSLISARTNQTMRVLTVISTIFIPLTF
FT                   LTGFFGMNVPLPYQNSGMSTFLITAGLIGVSGLMLAAFKKQKWI"
FT   CDS_pept        429786..430946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="DegQ"
FT                   /locus_tag="PTH_0449"
FT                   /product="trypsin-like serine proteases"
FT                   /note="typically periplasmic, contain C-terminal PDZ
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58630"
FT                   /db_xref="GOA:A5D565"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A5D565"
FT                   /protein_id="BAF58630.1"
FT                   /translation="MNRFLRSPYAKTAGAFLAGVLAVAAVLALAGVLHGVPGLSRSGAA
FT                   AIADAQAAELPGLGPNTIADIVSRVGPAVVRIDTTVQGERYVDPFFNDPFFRHFFGDQF
FT                   RIPMQSEERRGLGSGFIVSPDGYILTNEHVIAGADRIEVTVAGRDKPYQARKVGADHDL
FT                   DLAVLKIDAGNDLPTIPLGNSDSVRVGDWVVAIGNPYGLDHTVTVGVISAKGRPVTVED
FT                   RRYKNLLQTDASINPGNSGGPLLNLNGEVVGINTAINAQAQGIGFAIPSSTVKAVFDDL
FT                   VQKGGVSHPWLGVYLQQVTEELASYFGLQDLSGALVASVVSGGPAEKAGLRRGDIIVRY
FT                   NGSAVNNPNDLIELVGGTAVGSQVEIEFIRGGERKTVTAVIEAKRP"
FT   CDS_pept        431086..431763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OmpR"
FT                   /locus_tag="PTH_0450"
FT                   /product="response regulator"
FT                   /note="consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58631"
FT                   /db_xref="GOA:A5D566"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5D566"
FT                   /protein_id="BAF58631.1"
FT                   /translation="MEAKILVIDDDRKITAMLRRCLVFEGFEVQTAAGGEEGLRLAAAW
FT                   KPDLVVLDVLMPGTDGWEVCRRLRAGSSLPILMLTAKDEVADRVKGLDLGADDYLVKPF
FT                   ALEELLARIRALLRRSRQADTAMRPLVYADLTLDHATREVRRGGRPIQLTAREFELLAL
FT                   FMEHPRQVLTRDQIMDRVWGIDYGGESNVLEVYVGMLRQKLEEGGEKRIIHTVRGVGYV
FT                   LKE"
FT   CDS_pept        431792..433207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BaeS"
FT                   /locus_tag="PTH_0451"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58632"
FT                   /db_xref="GOA:A5D567"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5D567"
FT                   /protein_id="BAF58632.1"
FT                   /translation="MSLRLKLTFLYSGVLALTMLVFGLLVYFFMEHNLTAEADRSVAGI
FT                   AEDVVRSTVIVGRFPAPLRQVVIPDVDVFANPNTYIQVVDRSGVVAARSDNLGGQVIPL
FT                   SEETLREVAKGKGFYETVMSGSQSLRVYNRPLLVDGQVVGVLQVARTMGPAEMALKRLR
FT                   ILLFLGGAVALFLTSTLGWLLAGAALRPIGRITETASAIQQGRDLTRRISYSGPKDEVG
FT                   RLAGTLNQMLERLHDAYRNLEDAEAAQRRFVSDASHELRTPLTTIKGNVELLKKMGDAD
FT                   PETRNEALNDIAGEVERMSRLVSDLLVLARADASLKLKKEAVALAPLLAEAARRGSVLA
FT                   GGLTFSAGDFSALGEAEVLGDKDYLMQLLLILIENAVRYTPPGGEVRLEAQAEGDCVEI
FT                   SIIDNGIGIAEKDLPHIFERFYRADKVRFSSGSGLGLAIARWIVEEHGGTIIVKSKEGE
FT                   GSTFTVHLPLRIL"
FT   CDS_pept        complement(433277..434677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArsB"
FT                   /locus_tag="PTH_0452"
FT                   /product="Na+/H+ antiporter NhaD and related arsenite
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58633"
FT                   /db_xref="GOA:A5D568"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A5D568"
FT                   /protein_id="BAF58633.1"
FT                   /translation="MSEQHQVIIATSVFLITYAVIVSEKIHRTVAAFAGAALVVILGII
FT                   TPEKAVHAIDFNTIGLLVGMMIIVGITRQTGIFEYLAVKAAKGSKGEPLKIIGALSLIT
FT                   AVLSALLDNVTAVLLIVPVTFAIARQLEISPLPFLSAEILASNIGGTATLIGDPPNIMI
FT                   GSATGLGFMDFVFNLTPVIVVIYVLTIFLIRLIYRKQLVAREELKANIMKLNEQDEIKD
FT                   AVLLRKCLVVLSLTILGFILHQYVHLESSVIALSGASLLLLLTREDPEHALQVVEWPVI
FT                   FFFIGLFVVVGALEEAGVIEAVARWSLEVTGGNVLPTGMLILWLSAIASAFVDNIPFVA
FT                   TMIPLIQDMGRLGGITDLNLLWWSLSLGACLGGNGTIIGASANVVVVGMAEKRGAHISF
FT                   TGFMKVAFPLMLMSIVLSTGYLLFWYILHTQTAMAVTLSAGAILALVLKQAERFLTKET
FT                   GKNYELLK"
FT   CDS_pept        complement(434913..435143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58634"
FT                   /db_xref="UniProtKB/TrEMBL:A5D531"
FT                   /protein_id="BAF58634.1"
FT                   /translation="MTKVSVDKATEHGDYLEEQITVDNIPDIGDKTGVKFLDNLEQAIA
FT                   ECRKLIADGYRLTGYWTDPDVGIVFNLKKKK"
FT   CDS_pept        435291..436574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArsB"
FT                   /locus_tag="PTH_0454"
FT                   /product="Na+/H+ antiporter NhaD and related arsenite
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58635"
FT                   /db_xref="GOA:A5D532"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A5D532"
FT                   /protein_id="BAF58635.1"
FT                   /translation="MSPSCQITFASAVFLGIYALLIADKIHRTIVALCGAVIMLLAGII
FT                   SQERAVRAIDFNTIGLLVGMMVIVGITRRTGIFEYLAVISAKWAKGEPVKIMLSLATVT
FT                   AVLSAFLDNVTTVLLIVPVTFAIARQLKINPVPFLFAEIIASNIGGTATLIGDPPNIMI
FT                   GSATGLGFMDFVIALTPVVIVVHIANMIWLRVLYKKQLVTTPDLQKNIMNMDEKEEIKD
FT                   PVMLKKSLWIIGLTILGFVLHQYLHLESATIALSGAAFLLLVTRDDPGRALGAVEWPVI
FT                   FFFAGLFVVVGALEEVGVIEYIAKESLKLTGGAMVPTGLLILWLSAIASAFVDNIPFVA
FT                   TMIPLIQDMGRLGGIPDLKPLWWSLSLGACLGGNGTLIGASANVVVAGLAEKRGVIMTF
FT                   MSFTKVAFPMMLMSVAICTGYLLLRYLH"
FT   CDS_pept        complement(436613..437143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58636"
FT                   /db_xref="UniProtKB/TrEMBL:A5D533"
FT                   /protein_id="BAF58636.1"
FT                   /translation="MPVRRRRACLKPKECIQKPESRPDATGYPEPEGILPGNGAKKQFF
FT                   AGKPAPEGYLPVAVVLEIMAREYDDSAQGEALCRAALQVAEEGGVIEHYRARWNSEEPG
FT                   RTGRLSLLLYDRRQCLELIRYHEIKGNLEALRKEKEKLKVIEGRLLLGGVPPAKITEED
FT                   LEELERYIKECGF"
FT   CDS_pept        437349..437750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58637"
FT                   /db_xref="InterPro:IPR016866"
FT                   /db_xref="UniProtKB/TrEMBL:A5D534"
FT                   /protein_id="BAF58637.1"
FT                   /translation="MPEDRLEQIFNMVTELIRIAGNTNAAVEELRKGQEELKQGQERLE
FT                   ARMDRLEDRMDGLEARMDRLEARMDRLEARMDRLEDRMDGLEARMDRLETRTDSIETIA
FT                   RHIQEDQKSMFEVMGEHEVAIRSLRRRPV"
FT   CDS_pept        437907..439289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TrkG"
FT                   /locus_tag="PTH_0457"
FT                   /product="trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58638"
FT                   /db_xref="GOA:A5D535"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A5D535"
FT                   /protein_id="BAF58638.1"
FT                   /translation="MGFVEQEEREIVIKKNSERRLTVGATPPQVLVVGFAAIILAGALL
FT                   LTLPASVRPGGEINFLTSLFTATSAVCVTGLVVVDTGTHWTFFGQLVILTLIQVGGLGF
FT                   MTMATFFAILMGRRIGLRQRLIMQESLNQTSVSGIVRLARHVLVFTFSAELVAATILSV
FT                   RWAADLGWQKGIWYGLFHSISAFNNAGFDLFGEFRSLTGYVEDVTVNLCITTLIILGGI
FT                   GFSVIVDLFRNFRSPGRLSLHTKLTLSVTGILLLAGTVLIYCLELSNSLAPLSPQGKLL
FT                   AAYFQAVTPRTAGYNTLNMAALRSATQFLIVVLMFIGASPGSTGGGIKTTTIGTLAVSI
FT                   WSMARGRTDSVVFKRRLGQEQVYKSLAILFMATTLVITVSLLLSVTESADFLAVLFETT
FT                   SAFGTVGLTMGLTPDLSTAGRLLIILTMFLGRVGPLTVAFALARPRHKFPLRYPEEKIM
FT                   VG"
FT   CDS_pept        439788..441011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivK"
FT                   /locus_tag="PTH_0458"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58639"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5D536"
FT                   /protein_id="BAF58639.1"
FT                   /translation="MKRFRWQFAALSFIIIGLMLIAAGCGGGQGAKKEEVKVGVILPLT
FT                   GSEAMFGEMEKNSFEMALEELKAAGKAAIGGKEIKLLFEDDQGKQDVAKSAAEKLVNQD
FT                   KVVMLTGGYSSACSNVIAGSAQAMNIPFLVVTGSSDDITKKGWQWVFRGAAAPASKYTG
FT                   ALWDMIEKVVKPKNVALIYENTDFGTSSAKAFRADCEKRGINLVFDQAYEHGAIDFKPM
FT                   LANMRSTNPDMIFAVSYVMDAAMITKQMKELDFNVNLFVGGGAGYTMPEFKENAGSASE
FT                   YVASTTLWVPNVAWPGASDYFNKYKQKYGKEPDYHGAQAYATMYIIADALSRAKELTNT
FT                   GIQKALKETDMMTIMGPVKFEDWEGYTNQNKPTTYVVQWQKGKLEVIWPENVKSAGYVY
FT                   PVPKWRER"
FT   CDS_pept        441131..442006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivH"
FT                   /locus_tag="PTH_0459"
FT                   /product="branched-chain amino acid ABC-type transport
FT                   system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58640"
FT                   /db_xref="GOA:A5D537"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5D537"
FT                   /protein_id="BAF58640.1"
FT                   /translation="MVLFGQTVICGILLGGMYALIAIGMTLIMGVMKIINLAHGALVMV
FT                   GMYVTYVCFKEFGIDPYIGMFLAMPVLFFIGCLIQKYMINRLVEVDSILPENQVLLTVG
FT                   IMLVLTESARLIFKSDYRSVATSYSSKVAFLGDMSISVPMLTGFFIAMIFTLILHLFLT
FT                   KTDIGRSIRATAQDRDAAVYMGVNSSRITMITFGIGSALAAAGGSLLLPLFYLFPDIGH
FT                   LFTAKSFIITILGGMGSTMGAAVGGLVLGIAESLGATYISMGYKDIVGLVIFLLVLLFL
FT                   PGGLKSIVKR"
FT   CDS_pept        442014..442970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivM"
FT                   /locus_tag="PTH_0460"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   system, permeasecomponent"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58641"
FT                   /db_xref="GOA:A5D538"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5D538"
FT                   /protein_id="BAF58641.1"
FT                   /translation="MKNKNIVFTLLFALFAVLLPLFVKAPYQMHILILIIIWSVIGTAW
FT                   NLLGGYAGQVSFGHAAFFGLGAYAAGLLKFHYDISPWWGMLLGPVAASVISLPIGLICF
FT                   RLRGPYFALAMLALGEIFRLLFTNLTSFTNGARGILIMPEITGKMFYYYLGLAMLALTL
FT                   LTTYLIVHSKVGYYLVSIREDQDAATSLGIPTTRYKNYALLPSAFFTGLAGAFYMNYVA
FT                   FIDPNIVFNLSNVSVMVILVVMLGGVATTWGPTVGAAMYIFLGELFRTTLGSANVLVFG
FT                   ILVCLIIMFLPNGVVGEINILMKQAAARKKTSLAGGA"
FT   CDS_pept        442972..443691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivG"
FT                   /locus_tag="PTH_0461"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58642"
FT                   /db_xref="GOA:A5D539"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A5D539"
FT                   /protein_id="BAF58642.1"
FT                   /translation="MSYFEVKDITKKFGGLTAVSSLSFTVEKGEIFGIIGPNGSGKTTV
FT                   FNLISRFFPLTAGEIYFKGKRIDQLPAHKICEIGIGRTFQVVKPLRRMTVLENVMAGAF
FT                   LRTNSMGRARHRAEEIIDFCGLTRYKEREAKSLPIPLRKRLEIARALATGPELLLLDET
FT                   CAGLNPKESEEAIELIRKIRDTGITIIIIEHIMKVMMGISDRILAINFGRQIALGKPQE
FT                   VANHPEVIKAYLGDAYA"
FT   CDS_pept        443684..444388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LivF"
FT                   /locus_tag="PTH_0462"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58643"
FT                   /db_xref="GOA:A5D540"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D540"
FT                   /protein_id="BAF58643.1"
FT                   /translation="MLKVQGIDVSYRDIQVLWDVSFEVNEGELVVLLGANGSGKTTTLN
FT                   AISGLLPVKKGTIEFLGQDITKLPGYKVAELGIIHVPEGRRLFPEMTVRENLEMGSLFP
FT                   EAKAKRKETMKKVFELFPVLEERQNQEAGTLSGGQQQMLALGRGLMALPKLLIMDEPSL
FT                   GLAPVLVKQIFEKVKDINGQGVTVLLVEQNVVQSLNLCHRAYVLENGRVILQGSGKELL
FT                   EDPHVKEAYLGM"
FT   CDS_pept        complement(444738..445025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0463"
FT                   /product="Uncharacterized homolog of the cytoplasmic domain
FT                   of flagellar protein FhlB"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58644"
FT                   /db_xref="GOA:A5D541"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A5D541"
FT                   /protein_id="BAF58644.1"
FT                   /translation="MDDLRKEVAAALRYEAGKNGAPVVVAAGRGLKAKKIKEIAEQAGV
FT                   PVYQDEALARTLHDLGIGVEIPPRLYQAVARILVFVAGLDRKAPAGPAGS"
FT   CDS_pept        complement(445039..445638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58645"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:A5D542"
FT                   /protein_id="BAF58645.1"
FT                   /translation="MNINALTGLLLELASQSTSKTTRIAKAEGPPRLPGEAPAAFKSAL
FT                   RAASGAGPAPEQPALQKAGQPADEASQLPPFIPLPLRSELFREARFFARTGGGRAGKAA
FT                   ARAPASDVFICLVTENLGRLWAGLSWRDELLSVRYFTENEAASRMLAENFPELKESLQE
FT                   IGFAEVSLSSLVRGELKAIAEELLPKFQAHLLDRKI"
FT   CDS_pept        445631..445852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0464"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58646"
FT                   /db_xref="UniProtKB/TrEMBL:A5D543"
FT                   /protein_id="BAF58646.1"
FT                   /translation="MFMPFIPAATVLPVYSIGSGSVFLKGQGRLFLGAGQGYFVKGKNL
FT                   TSKKYAFAWKKFSQGKRLSVRCRIWNWQ"
FT   CDS_pept        445837..446529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RhtB"
FT                   /locus_tag="PTH_0466"
FT                   /product="putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58647"
FT                   /db_xref="GOA:A5D544"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A5D544"
FT                   /protein_id="BAF58647.1"
FT                   /translation="MELAMIFSTAFVVGFSGAMMPGPLLTVTVGESARRGFVAGPLLVL
FT                   GHGILELALILALAGGLSSFFKKTGVSHTVAVLGGAFLIYMGYGMARDAFYKRVSLAAA
FT                   GPAGEGCGNPGGAGVEKEALKGAGGVRLHPVLAGVLTSVSNPYWTLWWATVGLGYITLS
FT                   LRSGFAGLASFFTGHILADLVWYSLIAAAVAGGRKFLKEGVYRGVLVVCGVFLIGLGGY
FT                   FLYFGLFT"
FT   CDS_pept        446600..448000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0467"
FT                   /product="hypothetical protein"
FT                   /note="containing AMMECR1 uncharacterized conserved protein
FT                   (COG2078) and uncharacterized conserved protein (COG3885)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58648"
FT                   /db_xref="GOA:A5D545"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:A5D545"
FT                   /protein_id="BAF58648.1"
FT                   /translation="MSVVICGVCPHPPIAVPEVGREESAAVEATQKALVELGRRVRESG
FT                   AETVVIISPHAPVFQDVAGINKTPLLRGDFGSFRAPHVRFELTNDLSLAGEIIRAAGET
FT                   ELPAVELTGEMERRYGISLRLDHGVTVPVYFLRKAGVKLPLVHVSMAIAPPEKLYSFGL
FT                   AVRKAAESLGRRTALLASGDLSHCLSPDAPGGYNPRGREFDEQIARLLACPDVEGIIRM
FT                   DRSLVDQAGECGYRSIVMMLGALDGYEVKAEVLSYEGPFGVGYLTASLLPGAANTERSF
FT                   LAKLRSERRKEVARRRAGESFLVRLARETLESYIKGRPRPEIGEVPDEFKGRAGVFVSI
FT                   KKHGSLRGCIGTIEPVQSSIVEEVAANAISAGVNDPRFQPVGEDELDDLEYSVDVLKPP
FT                   EPVGGLDELDPKRYGVVVRAGRRKGLLLPDLEGIDTAAEQVAIARRKAGIGPDEPVQLE
FT                   RFEVVRYR"
FT   CDS_pept        448026..449036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PflA"
FT                   /locus_tag="PTH_0468"
FT                   /product="pyruvate-formate lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58649"
FT                   /db_xref="GOA:A5D546"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A5D546"
FT                   /protein_id="BAF58649.1"
FT                   /translation="MYEAFYYEKKEQKLAACRLCPKMCTIRDGRSGFCRVRQNRDGTLY
FT                   AANYGKVTSCGLDPIEKKPLYHFYPGSLILSFGTLGCNLRCGFCQNWTIAHGDPDAAEI
FT                   TPEQAVEMALQQTGRGLPNVGIAYTYSEPFMWYEFVWDTARLARKAGLKNVLVTNGYVN
FT                   ETPLRDILPYIDAMNIDVKGFTDGYYRENCAGRLEPVLRTVEICRAGCHVELTTLLVTG
FT                   LNDSAGEIERLVDWVASLDPEIPLHFSRYFPNFEVSLPPTPLKTLKMAQEIALKKLAYV
FT                   YIGNAPELGAGDTYCPSCGEEVISRVGYSTRAVGLDGKKCRSCGKEIRIAGEVTG"
FT   CDS_pept        449141..450127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0469"
FT                   /product="hypothetical protein"
FT                   /note="containing DRG, predicted GTPase (COG1163) and TGS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58650"
FT                   /db_xref="GOA:A5D547"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D547"
FT                   /protein_id="BAF58650.1"
FT                   /translation="MPANLTPQYYEAEEAYKKAVTIEEKIAALEEMLAVIPKHKGTEKM
FT                   QADIKRRLSRLREEGQKKARTGRTDPFFVEKQGAGQVVLLGFPNTGKSSLLAAMTRARP
FT                   KVADYPFTTTLPQAGMMPYQDILIQLVDTPPVAEGMIPAGLSGVLRNADALLLLVDAAS
FT                   DGCLEQVQFCLDFLKEKKILREELSAGRGVTPDRLLVLAARADLPGSQDNIQFIRDFLG
FT                   ESGWGQIEVMPVSAVTGLGLEALREKVFEMLKVIRIYTKVPGKEPDMNTPFILKQGSTV
FT                   VELAEAIHRDLPRLMKAARVWGSARFEGQSVTRDYVLHDRDIVEISR"
FT   CDS_pept        450858..452093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0470"
FT                   /product="glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58651"
FT                   /db_xref="GOA:A5D548"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D548"
FT                   /protein_id="BAF58651.1"
FT                   /translation="MEAIFYATQVFLTLFTFYHFIISLYGFYRRHEECLLPPSSRFAIV
FT                   VAAHNEEKVIGELIRNLNELDYPKELYDVYVVADNCTDSTAKIAREKGAVVFERFNKAE
FT                   RGKPYALEFAFSKIFESGIPYDAVCVFDADNLVDTNFLTVMNAHLLKGEKIIQGYLDTK
FT                   NAGDTWITKSIYVSYILTNRFLQLSKYNLGLTCALGGTGMCLSVDVLKRYGWGMTSLTE
FT                   DLEFQTKALLNGIKVTWAHDARVYDEKPLTLMQSWRQRKRWMQGHTNVAGRYVARLVRE
FT                   GIRTRNFAMIDGAVYLIQPYFLMFTGIGLITNIFMGPDQILDRPVWLVVGFFAQFFYFG
FT                   LGLALERVKPVVYWWLIFYPIFALTWIPVAYVGFAMRKNKEWTHTLHFRNIKHENLPNL
FT                   YLPARANGRRSS"
FT   CDS_pept        complement(452417..453172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CbiO"
FT                   /locus_tag="PTH_0471"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58652"
FT                   /db_xref="GOA:A5D549"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D549"
FT                   /protein_id="BAF58652.1"
FT                   /translation="MTEYAVEAENIKLYYGKRQVLDVEQFRLRYNEVTALIGPNGAGKS
FT                   TLLQVLALLQRPASGKLCILGEEVAPGKELALRRRMAVVFQEPLLLDTTVFNNVAAGLS
FT                   LRGCKKSEIKARVWKWLELFGIESLARRPARLLSGGESQRVSLARAFVLEPEVLFLDEP
FT                   FSYLDHPTRRALTADLGDILQATRISTVMVTHDYNDLPLLADKVAVMLEGKIVQCCTPE
FT                   ELFANPADPAVAALLGMDNGRRKPAATFS"
FT   CDS_pept        453759..455102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PaaK"
FT                   /locus_tag="PTH_0472"
FT                   /product="coenzyme F390 synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58653"
FT                   /db_xref="GOA:A5D512"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5D512"
FT                   /protein_id="BAF58653.1"
FT                   /translation="MLMSANQPLQRERGMMYWEPEYETMPRERLEQLQLERLKNTVKRV
FT                   YRSVPFYREAFKERGLEPGDIKSLEDLKKLPFTTKQDLRDNYPYGLFAVPMGEVVRLHA
FT                   SSGTTGKPSVVGYTRKDIENWADLIARCLVMAGAGREDIIQNAYGYGLFTGGLGIHYGA
FT                   ERLGATVVPVSGGNTARQLMLMQDFGTTILTCTPSYALYLGEEGEAAGINFKKLPLKAG
FT                   VFGAEPWTEKMRAQIESKLDIMALDIYGLSEIMGPGVSMECPAKQGSHIFEDHFIAEII
FT                   DPETGETLPYGQRGELVLTTITKEAIPLIRYRTRDISSLHPEKCACGRTHVRMKRVTGR
FT                   TDDMLIIRGVNVFPSQVESVLLEFGETEPHYLLVVDRKGDLDDLEIWVELSERMFSDEV
FT                   RHLESLENRIRHKILSVLNISARIKFVEPRTIPRSEGKAKRVMDRREM"
FT   CDS_pept        455314..456285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0473"
FT                   /product="hypothetical membrane protein"
FT                   /note="containing Polysacc_deac_1, Polysaccharide
FT                   deacetylase."
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58654"
FT                   /db_xref="GOA:A5D513"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:A5D513"
FT                   /protein_id="BAF58654.1"
FT                   /translation="MEKLKNAKVLLAVLAVLLIGAAGYALKSHPGASEQEAGREQPAAG
FT                   ETASVGGTAYPAPEAGNAAAGNAAGAIGREVKPVRPSAASGLSNERRGWGLKRNSTHQQ
FT                   PEMPSSVSSLLSKYDAYWIGSPGEKAVYLTFDEGYENGYTAKILDILKANEVKAAFFVT
FT                   GHYLKSQPALVRRMVEEGHIVGNHTETHPSLPDLSDGQIEQELRVVEQEFENVTGQKGM
FT                   RYLRPPRGEYSERTLAVTRNLGYHNIFWSLALVDWVPMPGGPQEAYDSVMGNLHNGALI
FT                   LLHAVSKDNTEALDKILKDAKAQGYTFKTLDDLVAGGKGASP"
FT   CDS_pept        456543..457109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NfnB"
FT                   /locus_tag="PTH_0474"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58655"
FT                   /db_xref="GOA:A5D514"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A5D514"
FT                   /protein_id="BAF58655.1"
FT                   /translation="MELIEAIKTRRSVRSYKDEPLPEQTVRELLEAATWAPSSMNNQPW
FT                   AFVVVQDRNYMKDLSDRAKKFLLERMDLFGGRYRRYAGTLSDPAFNIFYNAPVLVLIYG
FT                   NKEVYSYAGDCSMAALNLMLAAWGRGIGSCWIGFATGIGNTHEVKAELNVPEGYELVAP
FT                   VVLGYPAGPAGKGVRGEAKIINWLK"
FT   CDS_pept        457716..458618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58656"
FT                   /db_xref="UniProtKB/TrEMBL:A5D515"
FT                   /protein_id="BAF58656.1"
FT                   /translation="MFRVRNIIAVGMYPYPWHYREIIDTVRLMTSAFNDVNKIFLNPAV
FT                   GFRRAVAEKETLCITWRACRDKDVLVCTPPLELIPSSWGLGKVKDTWSIRTLRTLIEHL
FT                   LGPRWREETVLYVSSGGIPQSYNVIRGLGPKYVIFDILDDNLNFPGITHPAGVENKFVY
FT                   ILQSATVITAVSQFLLDRLQNDYGTTAHYLPNGVDLERFAYRPAYAVPIPELSQLERPL
FT                   FGFVGTLTSWIDFELLVATAQRLERGTLSRPGHPQRCACANTTRTPQSPARRVFGSSTL
FT                   RASSAFPPSIRRTPAAPQL"
FT   CDS_pept        complement(459206..459625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58657"
FT                   /db_xref="InterPro:IPR035424"
FT                   /db_xref="UniProtKB/TrEMBL:A5D516"
FT                   /protein_id="BAF58657.1"
FT                   /translation="MLEELKFTEARGGFSALYSRVFNHYRPVIIRRRQAEEVLVLRADL
FT                   QKLLLEKYRLKPEVIREEDGSVTLALDELELYANGRTVEEAAQELVHDLKFYAQDYLER
FT                   SQLFINAPNRRTHFPYILRVLLCDSDEEIRSLLEI"
FT   CDS_pept        459948..460739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IclR"
FT                   /locus_tag="PTH_0477"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58658"
FT                   /db_xref="GOA:A5D517"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D517"
FT                   /protein_id="BAF58658.1"
FT                   /translation="MVRTVGGKKAAKERHTIQSLERAIMILEYLRRGPTSLSELSRELG
FT                   LHKSTVFGLLQTLAWHNYVHQEEKTGQYSLGYRVLALGSAYLENCDLRKVAVPYLRQLV
FT                   DEYGETVHLVIMDDGQVVYVDKIDSPQSIRMVSRIGRRLPAHCTGVGKAMLAFLPEEKV
FT                   KLIVEKHGLPGFTPNTITTWERLVEELARIRKEGVSFDREEIEEGLCCVAAPVIGYYRQ
FT                   PIGAISVSGPKLRMTEEKMSLIAGSLKEIAAEISRQMGKIF"
FT   CDS_pept        460838..461452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0478"
FT                   /product="hypothetical protein"
FT                   /note="containing ferredoxin (COG1146)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58659"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A5D518"
FT                   /protein_id="BAF58659.1"
FT                   /translation="MRTVTMYPVVDAEKCRGCKICERVCPVLSIKVEAKKAAVALEHCL
FT                   GCANCEQRCPETAITMVRLEQPRLVRQAMDGLDQDAVAGLCRKARLNPKQIICYCTATR
FT                   AEEAAAAILAGARSPEDVSRMTGVRSGCKVECIQPVLRLLRAAGIVPERPAKGYQWYGL
FT                   TPTAWDIPEEVKKKYGKRGFYFDEDRKVLELVVAADERSEG"
FT   CDS_pept        461449..462891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58660"
FT                   /db_xref="UniProtKB/TrEMBL:A5D519"
FT                   /protein_id="BAF58660.1"
FT                   /translation="MMLREAVKPLPPRRSQYGIAPELVRKRAADLPDMVSVLVRDLFPD
FT                   ASPVIFPGERGLEAVREAARLQLEKVDLSMIKPGDSVNVLGSHHGFTLLGGAPYAEMLK
FT                   VIKDVVQERTGCRDIRLRVGVGLRFRESEEYIKSFGLDKYYAGKAAGVAPVDEGVAIET
FT                   EIGTLYGIKKIYDARWIIHAHNSDVREVHFHRQVDRAVKPFGMSYARIETRSTYHQNLG
FT                   PRAANFVARAIFDSPFVQEKFACAVFLTMSPTGVVGVDADNDLYALNDRVTYLGCRDYG
FT                   KMMTLLGEIDEAITILDFPSPVPYVFAAGVIYANFVCANRDLFDLDYPLPPYTWYTEAF
FT                   YGEDGKPLLKDIPPVNPAIKMVVHNYAWGGYPSAFFTEQIPTIMVGREQAELFNQDPQN
FT                   LNYNKHTLLAEDLDGAVAFARKVTGVDKIIAFDGASGALNVSRPLGEYLLAKAPGVARR
FT                   VNEELLPKWLKQRGIDPARFIK"
FT   CDS_pept        462914..463732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NadC"
FT                   /locus_tag="PTH_0480"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58661"
FT                   /db_xref="GOA:A5D520"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A5D520"
FT                   /protein_id="BAF58661.1"
FT                   /translation="MARHIFPDDLRWSIFRDMEKEVFRAEIISTRPTVAAGLDEAVQEA
FT                   ANLELQVQVMVQEGEVVLPGSPILVLAGAPVNLAVAEDRVPGWIGKASGVAAAARFFKT
FT                   ALAGKLQVVCGGWKKLPLPWRTVLRRAVSLGGLATRIAEPPFLYIDKNYIRMFGGIEAA
FT                   LKAVAHLPGKKAVQLRGERGGIAAEAEEAVTGGAHILMADTGRFEDAARLSEFLRERGW
FT                   REKVQLAFSGGITVRDLPLLLEMDLDIIDVGRAVLDAPMADLRFEVRGRA"
FT   CDS_pept        463803..464588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0481"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58662"
FT                   /db_xref="GOA:A5D521"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A5D521"
FT                   /protein_id="BAF58662.1"
FT                   /translation="MVEKRIEEWAKRLLKAEETCVPVEPLTEEWPAVDIPAAYAIQLKV
FT                   LELKRAAGRKVIGMKIGLTSKAMQQMLGVHEPDYGHVLDSMVLLEGEPVRLSGLIQPKV
FT                   EAEIAFVLRDRLCGPGVHAADVLRASAGVMPSLEIIDSRIKDWKIKIQDTIADNASAAA
FT                   IILGGALVPVQGLDLRLVGLTLEKDGHVFATATGAAVLGHPAAAVAWLANAIAPYGLSL
FT                   EPGMVVLSGSLTQAVTVEPGTVIHATFDRLGAVSVKFIE"
FT   CDS_pept        464623..465519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MhpF"
FT                   /locus_tag="PTH_0482"
FT                   /product="acetaldehydede hydrogenase"
FT                   /note="acetylating"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58663"
FT                   /db_xref="GOA:A5D522"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D522"
FT                   /protein_id="BAF58663.1"
FT                   /translation="MKKVKAAIIGPGNIGTDLMYKLLRSNYIEIALMVGIYPQSEGLAR
FT                   ARSLGIETSHEGIGAVLREPDIKIVFDATAAKPHLKHAPLLREAGKIAIDLTPAAVGPY
FT                   MVPVVNIDEHLEADNVNMVTCGGQATVPIVAAINRVAGVRYAEIVASLASKSAGPGTRQ
FT                   NIDEFTETTARALEVVGGAGKGKAIIILNPAEPPIMMHNTIYTLVENPDEELIKSAVFE
FT                   MVKRIQEYVPGYRLQVEPLVEGNKVTTIIEVTGAGDYLPPYAGNLDIMTSAAARAGELM
FT                   AMRLLGVYKPERGDSCA"
FT   CDS_pept        465503..466522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuA"
FT                   /locus_tag="PTH_0483"
FT                   /product="isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58664"
FT                   /db_xref="GOA:A5D523"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D523"
FT                   /protein_id="BAF58664.1"
FT                   /translation="MIAVPEIRIMDTTLRDGMHAMAHQFTPEQMAQVAAALDEAGVDVI
FT                   EVTHGDGLAGSSFQYGFAAATDEEYLEAVAPVLKKAKLAALILPGIGTCRDMRMAVQAG
FT                   VKVFRIATHVTEADISEEHMGLAKEMGAEVVGFLMMSHTVGKEKIAEQAKLMESYGADV
FT                   VYMVDSAGAMIPPEVTEKIGYLKEVLNIPVGFHAHNNLGLAVGNTLAAVAAGATAVDGT
FT                   LRGLGAGAGNTSTEVLVAALKKAGYQVGVDLYKIMDAATVLEPMMRRPQVIDNASIILG
FT                   YAGVYSSFLLHTYRAAERFGLDPRDILMELGRRKVVGGQEDYIVDVAYEMSRNKSRAV"
FT   CDS_pept        466685..467887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="EutG"
FT                   /locus_tag="PTH_0484"
FT                   /product="alcohol dehydrogenase"
FT                   /note="class IV"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58665"
FT                   /db_xref="GOA:A5D524"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A5D524"
FT                   /protein_id="BAF58665.1"
FT                   /translation="MFPTLKVVQYYTPQKKVFGVNAVDNIGVYLKEMGLSGKAIIITDP
FT                   GIAAAGLPERLIKALEKEGFKAAVYDQGKPEPDDISCDQAAEFARKEKGDFVIGFGGGS
FT                   SIDIAKVVAQLLVLPGVTDDYLINTTFPKKGAPIIAVPTTSGTGTECTMYSVITFAKDG
FT                   IKGFFGTPTILPDMALVDPTLTISMPPGVTASTGIDALSHAIETMMARQENPFTDAVAI
FT                   KAIELIAEALPVAVYEGDNLEARVKMSYGSMMAGIAFQDPGIVEGHALAHTLGSVYHVP
FT                   HGVGCAIALPYAMEYNMGHCMEKLARIAVAMGQNTAGMSVRQAAQTAVFAVKQLIEDVK
FT                   LPITWAKYGKKEDIPKLTDMMVESPWITAFYGWSKRKMTREAALELLTRSYEGRLGEAL
FT                   Y"
FT   CDS_pept        467949..468827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0485"
FT                   /product="hypothetical protein"
FT                   /note="containing MoCF_biosynth, Probable molybdopterin
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58666"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A5D525"
FT                   /protein_id="BAF58666.1"
FT                   /translation="MELNLLEKTELWITGVELDRANLNEVAAAVAGVLKLPAESVLVID
FT                   VRDGVVALDILRRKIMAEQIVGKERELLASLAAVSGVRLTPRAAVHARGILGLIAADPE
FT                   QREEILERAGRLAEQVKSTAARRGMVFATGREVQEGLIEDTNSPYLIELFEKNGYRMRF
FT                   GGVLPDDLETITGRLRAAAAEGYGLVVTTGGVGAEDKDFTVEGICRLDPLAETPSILHF
FT                   HAGQGRHVKGGVRIAVGRAGLTTFVALPGPHDEVRLAAPVLLEGLKAGADKKHLAGALA
FT                   GVLREKWRRAF"
FT   CDS_pept        468859..469320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HycB"
FT                   /locus_tag="PTH_0486"
FT                   /product="Fe-S-cluster"
FT                   /note="containing hydrogenase components 2"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58667"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D526"
FT                   /protein_id="BAF58667.1"
FT                   /translation="MSKVLVVDPSKCTGCHRCEMWCSLTKYGEINPSRSNVYVIRREPA
FT                   VDVPVVCVQCGLCVDVCPVEALKRNGKTDAVVVDAESCTGCGTCVKVCPYGVLRIDEET
FT                   DTAAKCDLCGGSPACAGHCPHGAIRYEDAGKAAARRREQWATAIAIKIS"
FT   CDS_pept        469336..471216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0487"
FT                   /product="aldehyde:ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58668"
FT                   /db_xref="GOA:A5D527"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A5D527"
FT                   /protein_id="BAF58668.1"
FT                   /translation="MYGYTGNLLRVNLTSGEIKVEKLDEKELRKYMGCTGYAAKLLYQE
FT                   MPAGVDPLAPEAKVVFATGAVTGTLCPSGGSYEVCYKSPLTGTWNEARSGGAFGPKLKY
FT                   AGFDFLVVEGKAEEPVYLLIKDGRAEIKPAKHLWGLNVEETTDAIINELDDPEVSVAAI
FT                   GQAGENGVLYAALINDRGRAAGRGGIGAVLGSKNLKAVVANGSGGIKVARPKEFAEVID
FT                   KAEQWLKNYPFAAIPEMGTVGLLSGNNAMGMLPTRNFQTGFFENADKVAGEVVNRKYQI
FT                   KRRACYGCSFGCGRYTAVSGGKFATPPMEGPEYETADMLGPICGVDDIEAIIRGNFLCN
FT                   VYGLDTISTGISIGFAMECYERGLLTDRDTDGIPLRWGDAEAVVKLVEKIAHREGIGDL
FT                   LALGVKRMAEKLGPRAEDAAIHVKGLELPAHEPRVESKALAVQYAVSPRGACHMHPNWP
FT                   STWDFQVDCGMKDLGIPWPPTGGMQDESPVKGVAYRYVALQGEISEILGACIFHSWGSE
FT                   GSCLTPQLYAEIMKALTGWDVTAEELVTAAERSWNLKRCFNAREGFDRKDDRLPKRISE
FT                   PIPDGPSAGARVENLDRMLDAYYEAMGWDRSTGLPTAGKLKELGLEFAVG"
FT   CDS_pept        471404..472591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="EutG"
FT                   /locus_tag="PTH_0488"
FT                   /product="alcohol dehydrogenase"
FT                   /note="class IV"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58669"
FT                   /db_xref="GOA:A5D528"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A5D528"
FT                   /protein_id="BAF58669.1"
FT                   /translation="MAGYSKWFRVPRDIVFGWGSLEYLKELEGKRAFIVTDKTMQELGF
FT                   VDKVKSYLAEAGIESAVFNEVEPDPSRQTVKKGARLMEQFQPDLIVGLGGGSSLDAGKG
FT                   MWIFYEYPDAKWEDIFVPFTGVPKLRNKARYVAIPSTSGTATEVTLAAVITNRDVVPNV
FT                   KDFTLSYEVTPDIAICDPELPSTMPPAVTANTGFDVIVHAVEAYVSVNATDVTDPIALR
FT                   SAAMAYKWLPLAFANGGNKEAREKMHTASLMAGFTFTNTALGLVHSTAHQIGAEYGVPH
FT                   GRANAIMLPYVVQYNAPAAAARYADMAQAFGYASTDPFEGTVKFIDAVRKLQKILGIPA
FT                   CLKDAGIKEEDFLKKVDMLTKNAMNDGSTPANPRVPTLAEIKNIFLCAYYGNDVI"
FT   CDS_pept        472663..473523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0489"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58670"
FT                   /db_xref="GOA:A5D529"
FT                   /db_xref="UniProtKB/TrEMBL:A5D529"
FT                   /protein_id="BAF58670.1"
FT                   /translation="MGIEPLMVIGAFGGGILGAAMGPLPAITLWGAVLMIAGLAGVLTG
FT                   SPVMVWDLAFNPLFGAHIVYAGGAAALAYAWSRGAIESGLDILKPLSGLGRADVLLVGG
FT                   IFGVLGTLLERVGTGLALPTDTVALSVVITGWVARLLFDPKWRANRGKGAEGETWWPKG
FT                   SELALLVVLGCGVGLAGGIAAAKIGDALLPFGLALLFLIYLQTGFNGQPWHHIVLVAGL
FT                   AALQGHGSVNAIIWATVLGGVTAIVSSFFSKWWIVRTNSYIDPPVTSIAVGKSIVIALA
FT                   AAGLL"
FT   CDS_pept        473671..475773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0490"
FT                   /product="acyl-CoA synthetase"
FT                   /note="NDP forming"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58671"
FT                   /db_xref="GOA:A5D530"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR014089"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D530"
FT                   /protein_id="BAF58671.1"
FT                   /translation="MSRPSSFTRPKSVAVIGASNKPGKIGCALVSNLIESGYQGRIFPV
FT                   NSREKEILGLPCFPSVADIPEEVETAVFAVPAPKVLDAAAGCGRKGVKNLVVLTAGFKE
FT                   MGREGMELEKKFLGVCKEYGMRMLGPNCVGFLDTHTPINATFLKGFPARGEIAFISQSG
FT                   AMLAAILDWSKSAGIGYSKIYSLGNKADLNEVDCIAEAADDPNTKVILCYIEDVACGPE
FT                   FLRVVSQATRKKPVIILKSGTSQAGAQAASSHTGALAGSDLAYNTAFKRCGVIRVDSMS
FT                   ELFDLAIAFVNQPVPKGRKVAIVTNSGGPGIIATDKVEAHGLTMARFTKDTIEELRLGL
FT                   PPEAGIYNPVDVLGDARADRFKFALEKVLRDENVDGAAVLLCPVAVTQPVETAQALIEL
FT                   NKAFPEKPLIAAYMGGQALAEGVRLLTENRIPCFTMPEPAIAALAGMVKYREMTEKPEI
FT                   EEKAADFRPDQKTVKAVFYDVKKDNRLALLGSEAAEVIAAYGVAAVATELSQSPEEAAA
FT                   IADRIGYPVVLKVASPKILHKTDVGGVITGIRSAGEVKSAYVTIMENVHRYLPRVIPHG
FT                   IEVQKMVPKGVELIVGMTRDVQFGPLIGFGLGGIYVNLLKDVSFRLAHGLTGAEIAEMI
FT                   AETKAYTLIKGYRGENPVDLGAVSEVIRRTAMLAVDFPEIMEIDINPVFAYEHGVAALD
FT                   VKITLS"
FT   CDS_pept        475751..476842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Pta"
FT                   /locus_tag="PTH_0491"
FT                   /product="BioD-like N-terminal domain of
FT                   phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58672"
FT                   /db_xref="GOA:A5D4Z4"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z4"
FT                   /protein_id="BAF58672.1"
FT                   /translation="MSKLPCREVKHVKNLYITGVAGSGKTAIALGIALNLKKEGYRVTY
FT                   FKPVGNRSRLSDTEDNDALLMREILNIDAEARKIAPFLAGTSYLSGLKNREAALENIKE
FT                   AYRAVSQEADTVIIDGAAFPHAGAAYGLDAASLAGLFEASVINVIKLENDLSVDQAVFL
FT                   NNSLASRGLKVIGHIFNNVPRQLLSKTEGVFKPLLEKAGCTTLGIIPVRPEFASPTVSE
FT                   YYEVLGGELLAGEDRLDLLVEEVIIGAMTLESALRYMRRSANKAVIMGGDRADLALATL
FT                   ETSTSALILTGGLYPDVKVISRAAEKGVPVILVHSDTYTTIERISEVSRRIRPGDAAGI
FT                   NIAMENIEKHCDWQSILNSLKEN"
FT   CDS_pept        476867..478267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PutP"
FT                   /locus_tag="PTH_0492"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58673"
FT                   /db_xref="GOA:A5D4Z5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z5"
FT                   /protein_id="BAF58673.1"
FT                   /translation="MELALSGGHVAGFIIAVAGVTALGIYAGRMVGSAQDFSVGGRRAG
FT                   AAVVTGTIMGTLVGGSATIGTAQLAFKYGLCAWWFTLGAGIGCFVLGLGYARRLRAVSL
FT                   VTVPQYLTLTYGSKIGPVSSLLSCSADLFGITSQGLAAVALLASMFNISPYPAVVACAV
FT                   LVLSYVVFGGVWGAGLVGVAKVVLVYLAAVVSGALAYKMAGGWSGLTAVLPPYPWFSFF
FT                   GRGVGVDLAAGFSLVVGVASTQTYIQSIFSARNLAEARKGVLLSGILIPPLGAGGVLVG
FT                   LYMRVNFPETASDQVLPAFIIKFLPPVLAGVMLAALLIVVIGTWAGITLGMSTTLTEDI
FT                   YRRLIRPAAGDREILAVHRVLMLTAGLLSVLMVIGNLNSLIMKWSVMSLALRACALFFP
FT                   LLGALFFPGAVTPLAGTLAALLGSLTGAVWYCMYPGGIDPVYPGLLASLLTLLAVSRFS
FT                   RRASSSAG"
FT   CDS_pept        478545..478799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58674"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z6"
FT                   /protein_id="BAF58674.1"
FT                   /translation="MIVLELYPPLEFKNGERKKCLAGRPEGVSAANLLEEVLQEINSSS
FT                   GLACRPEDMLLVVDGRAAGGDFKVMDGQTVKIMLMAMGG"
FT   CDS_pept        478834..480666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0494"
FT                   /product="aldehyde:ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58675"
FT                   /db_xref="GOA:A5D4Z7"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z7"
FT                   /protein_id="BAF58675.1"
FT                   /translation="MADFEYKVLWLDLERREKRVEKIACRDLRKWVGGSGLGAKTVYEN
FT                   VLPSTDPLDGRNILGFFTGPLTGTMVPSSGRHCVVGRSPLTGIWGEASVGGRWGRMLRR
FT                   SGYDALVLQGRAEKPVYIWINDGEVEIRDAHSLWGLDTYECAPALKELTGEKAEVCAIG
FT                   PAGEKMVKIAGIFTDGEDGRAAARCGLGAVMGAKRVKAVAVHGQRELPVGDPAGLKEDL
FT                   KPVIKRIQERTRVLGQFGTAGLVIPCEQLGDFPVRNWAWGRWEEGALKISGQKMAEELL
FT                   TGRYRCAGCPVGCGRRISITKGPYRGVKGGGPEYETLGLMGGSCLIDDLEAISYANELC
FT                   NRYGIDTIDAGNLIAFAIEAFERGILNEEWTGGLKLRWGDPEVLIEMIRRIAGREGKLG
FT                   SLLAEGFPAVKRSFGGEALEFAAEVKGLGFPAHDPRAYNSIALGYATANRGACHLEAFS
FT                   HIFERNVAMPEIGIHAVEDRFAVEGKGRLVAEAQNLMAVMDSLAACKFLLFGGVGLTEL
FT                   TGWLNRVTGFDYTVEELVRCGERIFNLKRLFNLSCGVGRKDDRLPERILKQKRNAGGAA
FT                   DNLPPLEAMLKEYYSYRGWSDEGVPLPFKIKELF"
FT   CDS_pept        480708..481871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="EutG"
FT                   /locus_tag="PTH_0495"
FT                   /product="alcohol dehydrogenase"
FT                   /note="class IV"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58676"
FT                   /db_xref="GOA:A5D4Z8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z8"
FT                   /protein_id="BAF58676.1"
FT                   /translation="MADYNFSFAVRTKVFFGRGVVFEQLPGAVREMGCKKAVLVSDPGI
FT                   VGTGLADRVKDLLAGGGVAVEVFSEVEPDPGLETVHKAAAFLGRTRPDCLVALGGGSSI
FT                   DVAKGARVIYDNGGKISDYAGVNKVKVKPSLPLMAVPTTAGTGSEVTVFAVLSDWEQNI
FT                   KITVTSEYLAPEAAFVDPLAMVSAPPGITAASGIDALSHAVEAYVSRAASPVSDNLALG
FT                   AVELIGGHLRQAVANGGDLAARTGAALGSLLAGMAFNNAFLGLTHSIGAALSGHVHVSH
FT                   GVAVGLLLPYVMEYNLMAKPDKFARLARAMGEVTEGKSLYRAASLAPRAVKAMVKSIGL
FT                   PVRLKEIGVPEGALAAIAETALKHGMIKFNPRVPSREDILDIVKKAY"
FT   CDS_pept        481893..483239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="UbiD"
FT                   /locus_tag="PTH_0496"
FT                   /product="3-polyprenyl-4-hydroxybenzoate decarboxylase and
FT                   related decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58677"
FT                   /db_xref="GOA:A5D4Z9"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="PDB:6H6V"
FT                   /db_xref="PDB:6H6X"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z9"
FT                   /protein_id="BAF58677.1"
FT                   /translation="MSHSLREWLAFLEGKGKLKRVRKEVDPVFEIAALGKQADGICSLL
FT                   FERVKGYAVPVVTGLAGDRELFAAAMSVPVEGMLEKLAAAVENPVPCRLVSPDGAPVKE
FT                   CIIRENIDLLKMLPIPTHHAGDAGPYITAAILIARDPDSGVRNVSIHRLQVTGPDRLGI
FT                   LILPRHLWHFFGKAERAGRPLEIALAIGVHPAVLLASQATTRLGVDELEIASALLPQPL
FT                   ELVKCETVDVEVPAGAEIVIEGKILPGVREVEGPFGEYPRYYGPAAPRPVVEVTAVTHR
FT                   RQPVYHTIIPASREHLLLGGIAREAVLLQTVRQAVPTVKNVHLTPGGSCRYHAVISIEK
FT                   KHEGEAKNAIFAAFTSSSEVKHVVVVDHEINIFDPEEVEWAVATRCQAGRDVFIVKDAM
FT                   GNRLDPSSRDGVSDKMGIDATIPLNLPGERFERISIPGLDKIKLADYLE"
FT   CDS_pept        483305..483538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiS"
FT                   /locus_tag="PTH_0497"
FT                   /product="sulfur transfer protein"
FT                   /note="involved in thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58678"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A5D500"
FT                   /protein_id="BAF58678.1"
FT                   /translation="MQVKARLLGLLSFDYPAFGKLRPVELSEGATVKDLRERLALPESK
FT                   VHFVSVNGNMVGEDYRLAEGDEVVFFPAASGG"
FT   CDS_pept        483632..484396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiF"
FT                   /locus_tag="PTH_0498"
FT                   /product="dinucleotide-utilizing enzymes"
FT                   /note="involved in molybdopterin and thiamine biosynthesis
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58679"
FT                   /db_xref="GOA:A5D501"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A5D501"
FT                   /protein_id="BAF58679.1"
FT                   /translation="MKDALSSLSGEQRVRYERNILLPGVGVEGQKRLLQSGVLIVGAGG
FT                   LGSPAAYYLAAAGVGRLGLADADAVGLSNLQRQILHRTGDIGRPKAESARDKLAALNPD
FT                   VRIEIVREYLNPDNAEALVGRYDIVVDCTDNFPSRFILNKVCVLQRKPFVYGGVLAFTG
FT                   QAMTVVPGAGPCFRCLYPSEPAPGGPTCSELGVLGAVPGVIGAIQAAEAVKYLLGLGDL
FT                   LVGRLLVYDAASMTFSEVSLKRSPRCPDCSGL"
FT   CDS_pept        complement(484439..484804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0499"
FT                   /product="predicted nucleic acid-binding protein"
FT                   /note="contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58680"
FT                   /db_xref="GOA:A5D502"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5D502"
FT                   /protein_id="BAF58680.1"
FT                   /translation="MILVDSCGWIEFLADGNKAGEYAKFFLKTENIVTPTIVIYEVFKK
FT                   VLRERGEEAAITVAAQMNNTRVIELNESISLLAADLSIKHNLPMADAIVYATAKSLKCR
FT                   VVTSDKHFRDLSDVIFV"
FT   CDS_pept        complement(484801..485010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AbrB"
FT                   /locus_tag="PTH_0500"
FT                   /product="regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58681"
FT                   /db_xref="GOA:A5D503"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A5D503"
FT                   /protein_id="BAF58681.1"
FT                   /translation="MGEVTISSKFQVVIPKEVRKQLCLKVGQKLRVVVKGRTINLIPEI
FT                   PISEMRGFLKGMDISGIREEDERL"
FT   CDS_pept        485374..486417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArgC"
FT                   /locus_tag="PTH_0501"
FT                   /product="acetylglutamate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58682"
FT                   /db_xref="GOA:A5D504"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D504"
FT                   /protein_id="BAF58682.1"
FT                   /translation="MAVKVSIIGATGYTGAELVRILSRHPQAELVALTTQSYAGKKFWE
FT                   VYPHLYGYNQLTCEEMNLPEIMESSDIVFVALPHGHAMPAAREAARRGRKLIDLGADFR
FT                   LKDFRTYEQWYRVEHTARELLAGAVYGLPEVNRREIREAWLVANPGCYPTSAILALAPL
FT                   LKNRLIDTSSIIIDSKSGVSGAGRGLALGSHFSEVNENFKAYNVAVHRHTPEIEQELGR
FT                   IAGEDVAVTFTPHLLPVTRGILSTVYAKLAAPAGEEEIREVYLDYYRGEPFVRVLPAGM
FT                   LPQIKWVAGTNHCDIGLTVDRRTGRVVVLSAIDNLVKGASGQAVQNMNIICGLPEDTGL
FT                   AGPGLYP"
FT   CDS_pept        486494..487702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArgJ"
FT                   /locus_tag="PTH_0502"
FT                   /product="N-acetylglutamate synthase"
FT                   /note="N-acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58683"
FT                   /db_xref="GOA:A5D505"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A5D505"
FT                   /protein_id="BAF58683.1"
FT                   /translation="MTCEFISGGVTAAAGFLAGTACAAIKKKDKRDIAVVYSTVPAAAA
FT                   GVFTLNLVKAAPVLVSMKRVAGGRAQAVVVNSGNANACNGEQGMRDALAMAAEAAGVLG
FT                   IPEEYVLVASTGVIGQKMPMDRVLPGIREAAGRVSAGGGHLAAQAIMTTDTYPKEAAVR
FT                   LELGGKTVTVGGMAKGSGMIHPNMATLLCFFTTDAAISPACLGQALKYAVDRSFNMITV
FT                   DGDTSTNDMAVILANGLAGNEPIEGGGPDYEAFRDALGEVCTRLAVAVARDGEGATRLI
FT                   QVEVLNAATEEDARLAARAVAGSSLVKAAVFGRDANWGRVICAAGYSGASFDPEKVDIF
FT                   LGDVQVARDGGSLDFSEERALEVLGGDTVRIVLDFKTGSCHATAWGCDLSYDYVKINAA
FT                   YRT"
FT   CDS_pept        487750..488637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArgB"
FT                   /locus_tag="PTH_0503"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58684"
FT                   /db_xref="GOA:A5D506"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D506"
FT                   /protein_id="BAF58684.1"
FT                   /translation="MSTPWEKAAVLVEALPYIKKFYGKTIVIKYGGHAMLDDSLKEAVL
FT                   TDAVLMKYVGMHPVIVHGGGPEITEMLKRVGKDSRFVGGLRVTDGETMEIVEMVLVGKI
FT                   NKGIVSRINRIGGLAVGLSGKDAGLFQAVKKYRKVRTPEGREETADIGFVGEISRVNPQ
FT                   IVSTVIAEGYIPVIAPVAVGPEGESYNINADYAAGRLAAALGADKLIILTDVEGIMADR
FT                   SDPGSLISVLRASEVPSLIERGVIDGGMIPKVECCLDALAGGVRTTHILDGRVPHSILL
FT                   EIFTDKGIGTMVEK"
FT   CDS_pept        488698..489894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArgD"
FT                   /locus_tag="PTH_0504"
FT                   /product="ornithine/acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58685"
FT                   /db_xref="GOA:A5D507"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5D507"
FT                   /protein_id="BAF58685.1"
FT                   /translation="MNSKEIIELGDKYLMRNVGRLPLAPVKGEGARLCDADGNEYLDFV
FT                   SGIAVNSLGHCHPAVTGAICRQAKKLIHCSNLYYIELQVLLARLLAENSGLDKAFFCNS
FT                   GAEANEAAIKLARKYAKLKHGPEKVEIITALNSFHGRTLATITATGQPKYQKGFEPLPG
FT                   GFKYVPFNDLDALEQAVGPATCAVMLEPVQGEGGVNVPSRYYLEGVRMLCQEHGALLIF
FT                   DEVQTGLGRTGRFLAWQHFGVKPDILTLAKALGGGFPIGAMLAVEEVAGAFQPGDHAST
FT                   FGGNPLACAAALAAVEEMLRGGVVENAASVGAYMYDKLKALAQKYGFVRDVRGLGLLLG
FT                   MELAVEGKAVVSGCQEKGLLINCVNNNVLRFIPPLTITTAEVDRAVEILDQVMAGVKL"
FT   CDS_pept        489954..493205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CarB"
FT                   /locus_tag="PTH_0505"
FT                   /product="carbamoylphosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58686"
FT                   /db_xref="GOA:A5D508"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D508"
FT                   /protein_id="BAF58686.1"
FT                   /translation="MPRRKDIRKVLVIGSGPIIIGQAAEFDYAGTQACKALREEGVSVV
FT                   LVNSNPATIMTDLDIADQVYIEPLAWDSVAEIIARERPDGLLPTLGGQTGLNIAVELSE
FT                   KGVLQDYGVELLGTPLESIKKAENRELFKNLMLEIGEPVPRSTIAGSVEECLAFAGEIG
FT                   YPVIVRPAYTLGGTGGGIACREQELVEIAGRGLKMSMIGQVLLEQSVAGWKEIEYEVMR
FT                   DGADNCITVCNMENVDPVGIHTGDSIVVAPSQTLSDKEYQLLRSAALRIIRALKVEGGC
FT                   NVQFALDLNSMAYYVIEVNPRVSRSSALASKATGYPIAKVAAKIAVGLTLDEIKNPVTG
FT                   KTYACFEPALDYVVVKIPRWPFDKFGSADRTLGTQMKATGEVMAIDRTFEGALMKAVRS
FT                   LEIGVDGLHLPGSAGWSEMELEEKLSYPNDLRLFAIAEAFNRSWGMREVAQLTTIDYFY
FT                   LSKIRGIVELERELQAAGPRPPRELLRRAKSCGLPDSLIGRLTGLPAREVHALRKEYGI
FT                   LPAFKIVDTCAAEFEAVTPYYYSTYDDEDEVAVSGRPKVLVLGSGPIRIGQGIEFDYCS
FT                   VHSVWGLQQEGIEAVIINNNPETVSTDFDTADKLYFEPLTLEDVLNVIEKEKPLGVIVQ
FT                   FGGQTAINLTAGLAALGVNILGTPVEGIDAAEDRDKFEKLLTGLGIPQSEGRSAVNVEE
FT                   AQAVAEKLGYPVLVRPSYVLGGRAMEIISSKTELVKYMTEAVQVSPRHPVLVDKYIRGK
FT                   EVEVDAIGDGNDLFIPGIMEHIERAGVHSGDSIAVYPPQTLSREEIDKIVEYTLKIGRA
FT                   LKINGLINIQYVVDNGGVYVLEVNPRASRTVPVLSKVTGVPMVQAATRAMLGRSLAELG
FT                   YRPGLGPVGGFIAVKAPVFSFEKLGLVEISLGPEMKSTGEVMGIDRSFPGALYKAMRAA
FT                   GLKVASGGRVVFSVADRDKAEAVSIAGEYAALGYTLHATPGTARALEKAGLEVEVVEIT
FT                   DPVPLIRSGTVGLIINTPTRGKVPGRPGFLLRRTAAEYRVPCLTSLDTARALAMVLRSV
FT                   RWGGEPAPVSMAELFEKEGTANCCLRKKDSKAAIF"
FT   CDS_pept        493163..494104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArgF"
FT                   /locus_tag="PTH_0506"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58687"
FT                   /db_xref="GOA:A5D509"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A5D509"
FT                   /protein_id="BAF58687.1"
FT                   /translation="MLSEKERFKGRHLLSLHDFSPDEIAYILDLAGELKDRQKKNIPHP
FT                   YLRGKMLGMIFQKSSTRTRVSFEVAMYQLGGSAMFLNVNDLQLGRGETIADTARVLSRY
FT                   LDGIMIRTYSHADVEELARHATVPVINGLTDLLHPCQILADLLTVKERKGRLAGLKLAY
FT                   VGDGNNVCHSLLFGCAKTGMHISVASPEGYKPKEEIVRLAEKDAEQTGSRIEILTSPVE
FT                   AVSGADVVVTDVWASMGQEVEQSRRVRVFAPYQVNRQLTGHARPDYIFLHCLPAHRGEE
FT                   VTDEIIDGPHSAVWDEAENRLHVQKAVLALLL"
FT   CDS_pept        494259..495464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArgG"
FT                   /locus_tag="PTH_0507"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58688"
FT                   /db_xref="GOA:A5D510"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D510"
FT                   /protein_id="BAF58688.1"
FT                   /translation="MAKVVLAYSGGLDTSVAIPWLKENYGYEVIAMSADLGQGEELAPL
FT                   REKAIKSGASKIYIEDVRREFVEDYIFPTLKAGAVYEGKYLLGTSMARPLIAKKLVEIA
FT                   RKEGAEAVAHGATGKGNDQVRFELAVKALAPDLKIIAPWREWDIRSREDAVDYASARGI
FT                   PVPVTRERPYSLDRNLWHLSHEGADLEDPGNEPPSDVLLLITPPEKAPDKPAYVKIEFE
FT                   RGVPVKLDGEALDPVTLIERLNKIAGENGVGIADMVENRLVGMKSRGVYETPGGTVLFL
FT                   AHRELELLTLDRATLHFKEIVASRYAELVYDGMWFVPLREALDAFVDVTQRTVTGTVVM
FT                   KLYKGNCTPAGVKSPYSLYDQELSTFGRDEIYNQRDAEGFINLFGLPLKVRALMEKKAG
FT                   LR"
FT   CDS_pept        495825..497261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TyrR"
FT                   /locus_tag="PTH_0508"
FT                   /product="transcriptional regulator"
FT                   /note="aromatic amino acids metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58689"
FT                   /db_xref="GOA:A5D511"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5D511"
FT                   /protein_id="BAF58689.1"
FT                   /translation="MPYGINFSSDEMVDFLIKVLDSDPECFVFVDSEARVIWLNKAYQS
FT                   YLNVKLEEAQGKPVVDVIPNTRLQVVVKTGIPELGKVQNINGRRAIVNRIPLFKDGKII
FT                   VAIGKVLFKTKKEFAELVSKLKEEVDCYKRELNEIYTSKWKFEDIITCSPNLIHVKDLA
FT                   QKVAPVDVNVMILGESGSGKELLAHSIHSASTRSSKPFVCINCAAIPENIMESELFGYE
FT                   PGAFTNAKSNGKLGKLEIANNGTVFLDEIGDMPPFMQAKLLRFLQEGELEKVGSVKPVS
FT                   VNVRVICATNRNIQKMVEDGIFRADLYYRLSSIILKIPPLRERPEDIELLCDHFLKSIT
FT                   EKWAIPLKKIDKEALEILKNYYWPGNVRELQHLLETLCCITDGNIIKAKALPSYLFGQS
FT                   DSAMLKNNELRRISLSNINSDGNNKYICSDVINSKEKELLEEVLRNTGGNKRKAAEMLG
FT                   IHRTTLYYKLRKYNMQYKVN"
FT   CDS_pept        497936..499786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0509"
FT                   /product="aldehyde:ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58690"
FT                   /db_xref="GOA:A5D4X4"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4X4"
FT                   /protein_id="BAF58690.1"
FT                   /translation="MAFGYWGKVLEIDLGSQTTKEVPIKDEVYKKFLGGSGVAAYLLYK
FT                   NYDYTKPALSEENPLIFMTGLLNGTLAPSSARSSVVGKSPLTEIWGESNVGGHWGAEVK
FT                   KTGYDGFILKGVSDKPVAIYINDDKVQFIDARDLWGKDVFEASDLIRSKTDEKARVACI
FT                   GIAGENQVKIASIMMDAPVTRAAGRCGFGALMGYKRVKAIAVKGTKKVELHDKAKLQEF
FT                   TKEFTQVLKTNAAILHDFGTLGTIQGVESEGDLPIKNWTLGSWEEGAYKISGQMLAETV
FT                   QTGHHACHACTIRCGKEAQVTVGPYKGAIGHAPEYETGAAFGSLILNDDLEIIVACNDL
FT                   CNRYGMDTIEAGSTIAMAIEAYEKGLLTDRDTEGIELKWGMKEDLLVVLEKMANNKVGL
FT                   GRLLAQGVKRAADEIGGIAPEFAIHTKGQALAMHDPRAYTTMVADYATCNRGGCHLECL
FT                   GYFSEGGAYPAKCVGFTKPYDPHGYENKAEYAVRLMNFMTVFNALGLCKFIMLGHITPE
FT                   MASQWINAATGWDLTGKDVELAGDRLFNIKRMYNNRLGISRKDDVLPQRLLLHDRQTGA
FT                   AAGSLPYYSRIMKDLYDYRKWTPEGLPSQEKLKELGLDTL"
FT   CDS_pept        500244..501401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="EutG"
FT                   /locus_tag="PTH_0510"
FT                   /product="alcohol dehydrogenase"
FT                   /note="class IV"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58691"
FT                   /db_xref="GOA:A5D4X5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4X5"
FT                   /protein_id="BAF58691.1"
FT                   /translation="MYYDFLNPSVNFFGPGCVSVVGERCKILGGKKALIVCDPFLAKME
FT                   GGPVEQVLGYVQEAGLKTVVFDGVEPNPKDKNVHAGLKVFKEEKCDMIITVGGGSAHDC
FT                   GKGIGIAATHPGDLYKDYAGIEKLTNPLPPIVAVNTTAGTGSEVTRHCVLTNTSTSIKF
FT                   VIVSWRNLPLVSINDPMLMLKKPAGLTAATGMDALTHAVECYVTKAANPVTDALCAQSI
FT                   KLIANNLRQAVANGENLTARENMAYASILAGMAFNNAGLGYVHAMAHQLGGYYDMAHGV
FT                   ANAILLPHVARFNLISNPQKFADIAVFMGENIEGLSVRAAAEKAIDAIVQLSKDVGIPS
FT                   GLAEMGVKEEDFDKMAKTALEDGNAGCNPIVGTHQDIVKLFAAAM"
FT   CDS_pept        501562..502512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58692"
FT                   /db_xref="GOA:A5D4X6"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4X6"
FT                   /protein_id="BAF58692.1"
FT                   /translation="MTSSLLLPIGGISFLHLCIAFVGGLFGAAVGALPAFILCGLFVFI
FT                   GSVLMIAGAGPDFLNTFGFGFTFGPQACFGAAVVAHMYAHKKGLSPGRDITAGLMGTKS
FT                   MDVLLVGGLFGALSVILNWIFITVLPWKWGGMLWTDAVALSITIMGIIGRLMFDSKSGL
FT                   FGKVAEGESRFNPTEKSVLWLPWQMSWKELLVIGFGVGLLSSYFALLLGAEHGGAVIGF
FT                   GISGLSLVFLQFGTKMPVTHHISAIAAGAALASHSLIWGTIFGIISSFAGQFWACLFTV
FT                   HADTYIDPPAAAIFSVTTIMVGLAALGLFTAIPLP"
FT   CDS_pept        502845..504398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0512"
FT                   /product="acyl CoA:acetate/3-ketoacid CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58693"
FT                   /db_xref="GOA:A5D4X7"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4X7"
FT                   /protein_id="BAF58693.1"
FT                   /translation="MAPRFLTAEEAVNLIKDGDTVASVGFLGNVFPEELAVALEERFLK
FT                   TAKPERLTLIYAAAQGDGKERGLNHLAYEGLVKRVIGGHWNLQPKMAKLAIENKIEAYN
FT                   LPQGTISQLFREIAAKRPGVITHVGLKTFVDPRIEGGKLNAVTKEDIVEVITIDGKEKL
FT                   FYRSIPLNVGLIRGTSADQLGNISLEKEANTLEVLSIAQAVRNCGGIVIAQVERVVAAG
FT                   SLDPRLVKVPGILVDVVVVSRPENHHQTFAEVYNPAYSGEVVIPLTELPPAKLDERKVI
FT                   SRRAAFELRPGSVVNLGIGIPEGIASVAAEEGISDFMTLTVEAGPVGGVPAGGLSFGAS
FT                   TNPYCVLDQAYQFDFYDGGGVDIAFLGLAQMDSNGNINVSKFGPRIAGCGGFINITQNA
FT                   KKVVFCGTFKAGGLKVNVGDGKLTIVNEGKSVKLVPKVEQITFSGEYARQQGQKVLYIT
FT                   ERAVFEMTAEGVMLTEIAPGVDLERDVLQQMDFKPLISPSLKTMDKRIFIDAPMGIKNS
FT                   "
FT   CDS_pept        504554..505693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CaiA"
FT                   /locus_tag="PTH_0513"
FT                   /product="acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58694"
FT                   /db_xref="GOA:A5D1D8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5D1D8"
FT                   /protein_id="BAF58694.1"
FT                   /translation="MNFKLTEEQELVRASVREFCQKYVEPIADKVDQEAYFPMETVKKL
FT                   AEQEWTGIPYPVEYGGAGSDYLTYIIVLEELSRACATTGFTLECHTSLASYPIYKYGTE
FT                   EQKKKWLVPMCKGEILGSFALTEPGAGTDAASGQSTAVLVGDEYVLNGTKMFISNAPVA
FT                   GVLVIFASTDKSKGAKGISAFIVPADAPGLQIGKHLNKMGIRGSLTAEVIMKDCRIPKE
FT                   NLLGKEGEGFKIAMSTLDGGRIGIAAQALGIAQAALDESISYSKERVQFGKPISSFQAI
FT                   QWMIANMATDVEAARFLTYYAAWCYDQGRPYSKEAAMARLFASECAARHTNRAVQIHGG
FT                   IGYIKGHKVERLYRDAKITEIYEGTNEVMRMVIAGNLLR"
FT   CDS_pept        505865..506569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Etf"
FT                   /locus_tag="PTH_0514"
FT                   /product="electron transfer flavoprotein"
FT                   /note="ETF"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58695"
FT                   /db_xref="GOA:A5D4X9"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4X9"
FT                   /protein_id="BAF58695.1"
FT                   /translation="MLKIIACFKWVIDEQDIRVDQKSRELIMERVGYKISDYDRNAIEE
FT                   AVRQQEAHGGSVVAVTVGPPGARQSLKDALSRGPERAWFISDPSFAALEPSQTAAILAE
FT                   AIKTKGEFDLIICGEGSSDLYAQQVGPALAQRLGIPCATYVNKVTLEPGEKKLTAERKL
FT                   DDGIETVSIQLPALITVLPDINTPRIPSLKQVLGAAKKPVEEIKKSDLGQDFQPRLETR
FT                   PEMFFAKAFVPG"
FT   CDS_pept        506609..507391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CaiD"
FT                   /locus_tag="PTH_0515"
FT                   /product="enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58696"
FT                   /db_xref="GOA:A5D4Y0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Y0"
FT                   /protein_id="BAF58696.1"
FT                   /translation="MSERFVDLAVENGIAVVTINRPKSLNALSVEVLEQLGQVIKDIEK
FT                   DDKVRAVIITGSGSKAFVAGADIAAMVNMTAKEARDYSIFAHKVFESIEQLPKPVIAAV
FT                   NGYALGGGNELAMACDIRVASSTANFGQPEITLGIIPGFGGTQRLSRLVGKGKAMELIL
FT                   TGKMIDAKTAESIGLVNVVVPPEKLMETAKEIAQKIINFSPLAISFAKEAVNRGIEMTL
FT                   EQGCKYEIELWTDCFTTEDQDIGMTAFLNKQKPTFKGA"
FT   CDS_pept        507552..507884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58697"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Y1"
FT                   /protein_id="BAF58697.1"
FT                   /translation="MQKAFVKLPLRFLKLQWFSCQRYLKDDEFGLSLSMLKKVIFFARG
FT                   VSLSKLVITFVCENRHDVETVTFDLNRCGEIPPEEIWQLLRKGCRCNKCGSDKFTYRTR
FT                   YKEYMR"
FT   CDS_pept        508116..509498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArgH"
FT                   /locus_tag="PTH_0517"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58698"
FT                   /db_xref="GOA:A5D4Y2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D4Y2"
FT                   /protein_id="BAF58698.1"
FT                   /translation="MTKLWGGRFQKETDRLVEDFHSSISFDRRLYKYDIRGSIAHARML
FT                   GKAGIIPPEEARAIADGLQEVLADIEAGRAGFSVEAEDIHMNVEQLLTAKVGEVGKKLH
FT                   TARSRNDQVALDIRMYLKDEIDQITGLLRELQAALLDLAEKHTGTVMPGYTHLQRAQPV
FT                   TLAHHLLAYCQMFRRDEERLADCRRRTDVMPLGAGALAGTTFPLDREYVAEQLGFAAVA
FT                   ENSLDAVSDRDFAVEFAAAASLIMVHLSRFCEEIVLWSSAEFAFIELDDAYSTGSSMMP
FT                   QKKNPDVAELIRGKCGRVFGDLQALLTMLKGLPLAYNKDLQEDKEALFDAVDTVKKCLL
FT                   VFKPMLETMQVKKERMAEAARGGFTNATDLADYLVRKGLPFRQAHEAVGKAVLYCLERG
FT                   RSLDRLSLDELRQFSPLVEEDVYEAIDISRCVEARRVTGGPAPGAVLEAVKKARQRLRE
FT                   RP"
FT   CDS_pept        complement(509560..510744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PheA"
FT                   /locus_tag="PTH_0518"
FT                   /product="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58699"
FT                   /db_xref="GOA:A5D4Y3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Y3"
FT                   /protein_id="BAF58699.1"
FT                   /translation="MHKIGYLGPRGTFSEEAALRHLGERKGETAGCSSIEEIFSGVAEG
FT                   RFDEGIVPVENSTEGSVGAVLDLLAGPFNLAVRGEVLLPVCQSLMVRPGTRLDQVEKVF
FT                   SHSQALAQCSRFLRRELPGALPVECSSTAAAAAKVAGSSRPWAALGPARAAAVYGLQVV
FT                   VPAANDYPDNATRFWVLGREQVPCAAAHGYKTSIIFGLQDRPGALYAVLREFALRGINL
FT                   TRIESRPAKKNLGDYVFFIDFLGSQGQPGVQEVLGGVASLTVGLKILGSYPAWNCAGTD
FT                   ALASGGREASLTLAGLRRELDAVDARIAELLAQRTRLIDRVASLKQNEGNIRDPLREEQ
FT                   ILSRVRQLSLTAGGDTELAEEVWRVILRHSVRRQASRLASGAAGNRQQALPQAP"
FT   CDS_pept        complement(510737..511528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AroA"
FT                   /locus_tag="PTH_0519"
FT                   /product="3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58700"
FT                   /db_xref="GOA:A5D4Y4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Y4"
FT                   /protein_id="BAF58700.1"
FT                   /translation="MVTVKNAVIGNGSLTVIAGPCAVESREQLLAAAHRVRQAGAAILR
FT                   GGAYKPRTSPYSFQGLEAEGLKLLAEASAQTGLATVTEVVDEASLELALEYVDMVQVGA
FT                   RNMQNFHLLRRVGRSGKPVILKRGFSATIEEWLMAAEYIVSEGNEKVVLCERGIRTFEK
FT                   ATRNTLDLSAVPVVKRLSHLPVIVDPSHATGDRSLVAPMARAAVAAGADGLLIEVHPEP
FT                   CKALCDGPQSLPPDEFDALMEELKTVAAAVKRFVREEVLYA"
FT   CDS_pept        512227..512604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0520"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58701"
FT                   /db_xref="GOA:A5D4Y5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Y5"
FT                   /protein_id="BAF58701.1"
FT                   /translation="MEMGAYKNENVCTGHGAGIHVCRFKISFLEEGLKRFKELSHVGDI
FT                   RQKGMMVGIELVEDKKTKKPYPWEDNIGHRVILEARKNGLVIRPLGNVIVLMPVLSMTI
FT                   PELEQVLDITYNAIAKVTGER"
FT   CDS_pept        512607..513572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BioB"
FT                   /locus_tag="PTH_0521"
FT                   /product="biotin synthase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58702"
FT                   /db_xref="GOA:A5D4Y6"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D4Y6"
FT                   /protein_id="BAF58702.1"
FT                   /translation="MFNELVKKIKSGLEITFEEALALGGLDEDRLNELFLAALQVNRHF
FT                   HGNRVDLCSIVNARSGRCSEDCAFCAQSGHYRTEAPVYPLLSKEEILERAREMELRGAR
FT                   RFALVTSGRGISESDFEKVLDIYQMLKEKTGLGLCASLGIIGYDKAVRLKEAGVGMYHH
FT                   NLETCRSYFPHICTTHSFDERVETVKAAKEAGLEVCSGGIIGLGESWRHRVEMAFHLKE
FT                   LGVASVPINILTPVKGTPLWGRPLLEPVEVLRTAAMFRLVLPGALIRLCGGREAALRDL
FT                   QPLALLAGVNALMVGNYLTTSGRRVEDDLQMVADLKLSVM"
FT   CDS_pept        complement(513693..514118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58703"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Y7"
FT                   /protein_id="BAF58703.1"
FT                   /translation="MSKLRYLIHKAIRIELRQIKYLAMLAAAAPDELTRSIILCMIQDE
FT                   AAEAKFWNTVDAAYRGVSIPGEAPYPGPGYCPQPGMPYPGYPPSYPGGGFVPPAGPVMP
FT                   PYPPGGPVTGPGAFPGTAPGILPGIPLSEPENKPGRK"
FT   CDS_pept        complement(514144..514458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58704"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Y8"
FT                   /protein_id="BAF58704.1"
FT                   /translation="MNVRKEDLTGSVMEDMADGMMDGHNPQMLINKLAEGEQMEAALYE
FT                   QIAQAVPSEELRQIILHKARHERRMAERLSKLSHHFGLMPGTPAGPPMPYTAGKGEEKK
FT                   "
FT   CDS_pept        complement(514696..514851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58705"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Y9"
FT                   /protein_id="BAF58705.1"
FT                   /translation="MRGTTLLASKKTRKPLNVPYPARRFNGRQLRPSLLATAFSRQLRG
FT                   DVRPGI"
FT   CDS_pept        515148..516050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvE"
FT                   /locus_tag="PTH_0525"
FT                   /product="branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58706"
FT                   /db_xref="GOA:A5D4Z0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z0"
FT                   /protein_id="BAF58706.1"
FT                   /translation="MIIYLDGEFVPKERAVVSVFDHGLLYGDGVFEGIRAYHNRVFKLR
FT                   EHLDRLYDSARTIALEVPLTKDEMQEIVLETMRRNNLREGYIRLVITRGVGDLGLDPRK
FT                   CKKPTIFCIAASIQLYPDELYEKGLEVITVSTRRNIPSAVNPRVKSLNYLNNIFAKLEA
FT                   NLVGVPEAIMLNNENYVAEATGDNIFIVKNGVLITPPNYVGILEGITRNTVIDIARQRG
FT                   ITVEEKVFTLFDVYTADECFFTGTAAEVIPVVKVDGRPIADGKPGEMTWELIAAFRELT
FT                   KVDGPLIFPEEAAGCYSDK"
FT   CDS_pept        516169..517836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvD"
FT                   /locus_tag="PTH_0526"
FT                   /product="dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58707"
FT                   /db_xref="GOA:A5D4Z1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z1"
FT                   /protein_id="BAF58707.1"
FT                   /translation="MRSDAMKRGVEKAPHRALFKASGYIDREMERPMIGIVNSHNEIVP
FT                   GHIHLNDIAEAVKAGVRMAGGTPVEFPVIAVCDGIAMNHTGMKYSLASRELIADSIEVM
FT                   AEAHPFDGLVFIPSCDKVVPGMLMAAARLNIPAIVVSGGPMLAGRYRGRDISLSNLFEA
FT                   VGMVYAGAMTEEELHEFEEAACPGCGSCAGMFTANSMNCLTEALGMALPGNGTLPAVSA
FT                   ARRRLAKLTGIQIMKLVEEGIRPSDILTAEAFKNGLAVDMALGCSTNTVLHLPAVAAEA
FT                   GVEISLDYVNTISERTPNLCKLSPMGPFFMQDLDEAGGIPAVMAELAGKGLINPGARTV
FT                   TGTVGDNIRGRKVLRRDVIRSVEDPYSPTGGIAVLRGNLAPDGAVVKKAAVAPEMLKHS
FT                   GPARVFDSEEEAVRAISAGKIRKGDVIVIRYEGPKGGPGMREMLTPTAAVAGLGLDKEV
FT                   ALLTDGRFSGATRGASIGHISPEAAEGGVIAIIRDGDIIEIDIPNNSLNVALSEEEIAG
FT                   RFKDWRPPEPRVKKGYLARYARQVTSASTGAVIRKEEL"
FT   CDS_pept        517836..519503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvB"
FT                   /locus_tag="PTH_0527"
FT                   /product="thiamine pyrophosphate-requiring enzymes"
FT                   /note="acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58708"
FT                   /db_xref="GOA:A5D4Z2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z2"
FT                   /protein_id="BAF58708.1"
FT                   /translation="MKGKELSGAQVLIKSLEAANVDTIFGYPGGQALPIYDALYDSEVR
FT                   HILTRHEQGAAHAADGYARATGKPGVCLATSGPGATNLVTGIANAYMDSVPLVAITGQV
FT                   PRRLLGRDSFQEADIVGITMPITKHSYHVEDPSELARVVKEAFHIATTGRPGPVLIDVP
FT                   SDISLAKVEYEEPGELFLPGYRPVLDGDPVQVAAAARAIAESERPLIYAGGGVVTSGAH
FT                   EELLRLAELLMAPVCTTLMGLSGFPGNHPLSLGMLGMHGTKYANFAVCECDLLIAVGAR
FT                   FDDRVTGKLETFAPEARIIHIDIDPAEIGKNVRVDIPIVGDVKRVLSQLLEILRPGLRE
FT                   AWREKIEAWKKEYPLTYCEQGRLKPQAIIREIYRLTEGKARITTEVGQHQMWTAQYYTF
FT                   TRPRSFITSGGLGTMGFGMPAAIGVQVGCPDETVFDIAGDGSIQMNIQELCTAVNYELP
FT                   INVAIINNGFLGMVRQWQEFFYNRRYSQSELRNPDFVKLAEAYGAEGIRVTKKAEVAPA
FT                   LEQAIRSAKPVMIDFVVDREDNVLPMVPPGGSLDKMIG"
FT   CDS_pept        519520..520041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvH"
FT                   /locus_tag="PTH_0528"
FT                   /product="acetolactate synthase"
FT                   /note="small (regulatory) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58709"
FT                   /db_xref="GOA:A5D4Z3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Z3"
FT                   /protein_id="BAF58709.1"
FT                   /translation="MHHTLAILVENNPGVLARVAGLFSRRGFNIDSLAVGRTENPAVSR
FT                   MTVVVEGDDHILEQVTKQLHKLVDVIKINDITRDAYVDRELVMIKVRAEASERAEIMQL
FT                   VDIFRARIVDVGHKTLTIEVTGNEGKINAFEDCLRPFGIKELVRTGKIAMLRGLRSSSK
FT                   SSSHKEEDDD"
FT   CDS_pept        520031..521035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvC"
FT                   /locus_tag="PTH_0529"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58710"
FT                   /db_xref="GOA:A5D4V8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V8"
FT                   /protein_id="BAF58710.1"
FT                   /translation="MMIKMVQVYYDHDADLGLLKEKTIAVIGYGSQGHAQAQNLKDSGL
FT                   DVVVGLRPDSKSWPKAEADGLKVATVPEAASAADIIQILVPDELQARLYREEIEPHLRE
FT                   GKALMFSHGFNIHYGQIVPPPDVDVFMVAPKGPGHTVRRMYLEGKGVPCLLAVHQNYTG
FT                   KAKELGLAYAKGIGGTRAGVFETTFREETETDLFGEQAVLCGGVTELIKAGFDTLVEAG
FT                   YAPEMAYFECLHEMKLIVDLINEGGLSFMRYSISNTAEYGDYMTGKRIITEETRKEMKK
FT                   ILAEIQSGEFAKKWILENQANRPVYNAIARQEKELLIEKVGARLRSMMPWLKK"
FT   CDS_pept        521101..522762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IlvB"
FT                   /locus_tag="PTH_0530"
FT                   /product="thiamine pyrophosphate-requiring enzymes"
FT                   /note="acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58711"
FT                   /db_xref="GOA:A5D4V9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V9"
FT                   /protein_id="BAF58711.1"
FT                   /translation="MEITVAEALFRCLEEEEVELIFGYPGGTILPVYDALHSTSIKHIL
FT                   VRHEQGAAHAADGYARVTGKVGVCMATSGPGATNLITGIANAYMDSVPMVVITGQVPTS
FT                   QVGTDSFQEVDITGITIPITKHNYLVKDPQQLPVVVKKAFHIASTGRPGPVLIDLPKDV
FT                   AQARIKFKYPKSVDLPGYKPTYKGHPAMVRQAARIIMESERPVIYAGGGVRISGAAPEL
FT                   LELSETISAPVTHTLMGLGCFPGDHPLFLGMLGLHGTRYANQAVTECDCLIAVGARFDD
FT                   RVVARISGFAPGARIIHIDIDPAEIGKNVRTHLPIVGDVKTVLRALLPCLQKKDNSRWV
FT                   ERVMQLKEEYPLRYEHDGSLKPQFVMEKLNEYKKDTDIVVTDVGQHQMWAAQYMRFKEP
FT                   RSFLSSGGLGAMGFCLPAAIGAKLGAPERTVILIVGDAGIQMTMQELGTAAEQKLTLKI
FT                   FVINNSRLGMVRQLQEFYCNKRYIAVDLQFNPDFAALGRLYGMEGYTVETPDQLMSLLP
FT                   EVLESPAPVIVDCKVSRDENVLPMVLSGSNINEAIS"
FT   CDS_pept        522783..524300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuA"
FT                   /locus_tag="PTH_0531"
FT                   /product="isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58712"
FT                   /db_xref="GOA:A5D4W0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D4W0"
FT                   /protein_id="BAF58712.1"
FT                   /translation="MSQRVYIFDTTLRDGEQSPGVSLNVGEKVQIARQLAKLGVDIIEA
FT                   GFPITSPGDFKAVSEIARQVKGVTVAALARANFQDIDRAWEAVRHAEQPRIHTFIATSD
FT                   IHLKYKLRMSREEVLDAAVAAVKRARAYTGDVEFSAEDASRSDLDFLCRVLAAAIEAGA
FT                   TVINIPDTVGYAVPEEWGKFINTIYHKVPGIEKVIVSVHCHNDLGMAVANSLAAVMNGA
FT                   RQVEGAINGIGERAGNAAIEEMVMALYTRKDQYNLYTNIKTEEIYRTSKLVSALTGMKV
FT                   QPNKAVVGKNAFAHEAGIHQDGVLKERTTYEIMNPAMVGISKSNLVLGKHSGRHAFRHR
FT                   LEEMGYNLSDEELNSAFERFKKLADKKMEITDEDLEAIIEEEMRLVPHTYTLEYLHISS
FT                   GTTVVPTATVGLKRDGQLMEEAACGNGPVDAICKAIDKITGLNCTMTSWGINAVTAGKD
FT                   ALGDVSLKVTADGEKVYVGRGISTDVLEASAKAYVNAVNKLIWDSQK"
FT   CDS_pept        524374..525636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuC"
FT                   /locus_tag="PTH_0532"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58713"
FT                   /db_xref="GOA:A5D4W1"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4W1"
FT                   /protein_id="BAF58713.1"
FT                   /translation="MAMTITEKILADHAGKKQVEPGELISVKVDLVLGNDITAPVAIKE
FT                   FEKIGVAEVFDRERVALVPDHFTPNKDIKSAEQSKILREFSKKHNLANYFEVGRAGIEH
FT                   CLLPEEGLVGPGDLVIGADSHTCTYGALGAFSTGVGSTDLAAAMALGETWLKVPESIKF
FT                   EYDGEMQPWVGGKDMILHTIGDIGVDGALYKAMEFTGPAVEKLSMDGRFTMCNMAVEAG
FT                   GKNGIIAPDETTRVYVEGRCKRPYRFYRSDPDAKYEKIYRYDAAQIEPQVAFPHLPENS
FT                   RPVSEAGNIEIDQVVIGSCTNGRMEDLREAARVLKGRKVHKNVRLIIFPGTPKIYLQAL
FT                   REGLIETFVEAGGVVSTPTCGPCLGGHSGILARGERCVATTNRNFVGRMGHPESEVYLS
FT                   NPAVAAASAVLGRIGGPWEVD"
FT   CDS_pept        525638..526138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuD"
FT                   /locus_tag="PTH_0533"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58714"
FT                   /db_xref="GOA:A5D4W2"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4W2"
FT                   /protein_id="BAF58714.1"
FT                   /translation="MEIKGKVWKFGPDIDTDAIIPARYLNTSDPEELARHCMEDADPSF
FT                   PARVRPGDVIVAGKNFGCGSSREHAPIAIKAAGVSCVIAASFARIFYRNAFNIGLPIFE
FT                   SPEAAGGIGQGDEVAVDAAAGIITDLTTGKTYRAAPVPPFMRQIIAAGGLINYVAGKVR
FT                   GNA"
FT   CDS_pept        526131..527207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuB"
FT                   /locus_tag="PTH_0534"
FT                   /product="isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58715"
FT                   /db_xref="GOA:A5D4W3"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4W3"
FT                   /protein_id="BAF58715.1"
FT                   /translation="MHKIAVLPGDGIGPEVTAQAVRVLEAVGRRFNRKFQFAEGLVGGA
FT                   ALDRLGHPLPGETMDLCLASDAILFGAVGGPKWDQLPARLRPEAGGILALRKELGLFAN
FT                   LRPVKVFAPLKNATALKPEVVDGVDLLIVRELTGGLYFGRKAREPLAGGGFRVTDELVY
FT                   TTAEIERIARVAFDLARKRRKKVTSVDKANVLESSRHWREVVTAVGQEYPDVVLEHMYV
FT                   DNCAMQLVKNPRQFDVLVTENMFGDILSDQASALGGSLGLLASASIGGKTGLYEPGHGT
FT                   APELAGRQAANPVAAVLSGAMLLRYSLNLEEEAGCIERAVERVFERGFRTADLMEEGRE
FT                   LVDTVRMGDLIIEQIEAG"
FT   CDS_pept        527216..528856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LeuA"
FT                   /locus_tag="PTH_0535"
FT                   /product="isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58716"
FT                   /db_xref="GOA:A5D4W4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4W4"
FT                   /protein_id="BAF58716.1"
FT                   /translation="MPSVKIYDTTLRDGAQAEGISFSVEDKIKIALRLDKMGFHYIEGG
FT                   WPGSNPKDLEFFKKIRHCPLRHARLAAFGSTRKAGAAAENDASVKAIIDSGVQVATIFG
FT                   KSWDFHVFKALGVTLEENLAMIRETVAYLKSRGLEVIYDAEHFFDGCKANPAYALETIR
FT                   AAAESGASAVVLCDTNGGTLPAEVKELVEKARSVLGVPVGIHAHNDGELAVANTLAAVQ
FT                   AGAEQVQGTVNGYGERCGNANLCSVIPNLTLKCGIETIPREKLVHLTDLSHFVSEVANI
FT                   SPNPHQPFVGASAFAHKGGVHVSALLKDSRTYEHISPGEVGNRRRVLVSELSGMSNLLY
FT                   KYKELNLDIERQSPEGKRILEDIKKLESQGFQFEDAEGSFELLVRKTNHGYRDPFILEA
FT                   LRLLVEIKENTPAYSEAIIKMRVGDRVVHTAAEGNGPVNALDNALRKALYDFYPCIGSM
FT                   HLTDYKVRVLEEKDGTGAAVRVHIQTGDGKRSWGTVGVSRNIIEASWQALADSISYGLL
FT                   KGDHLARNGEEEKAVNGKKPAGNGSLQTN"
FT   CDS_pept        528929..529762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0536"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58717"
FT                   /db_xref="GOA:A5D4W5"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4W5"
FT                   /protein_id="BAF58717.1"
FT                   /translation="MEQLWLPSLDYLKDVLKFDLISVVDILIVAFVMYKLTLLIKGTRA
FT                   VQLIKGLAVLVIATAVTSLFNLYTINWLLRQAMTALVVALPVVFQPELRRALEKLGRGK
FT                   FLAHPTLVPGEINWSKIITEITRAAAVLAKNRTGALIVVERETGLVEHIDTGVKIDGIL
FT                   SAEFLVNIFIPKTPLHDGAVIIRGDRVAAAACFLPLSENPYLTSDLGTRHRAGIGITEH
FT                   SDAVAIIISEETGTISLAVEGALTRNLDEAALQGRLIELLNGRSANTLSALWPRR"
FT   CDS_pept        529767..530714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58718"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4W6"
FT                   /protein_id="BAF58718.1"
FT                   /translation="MARINWSNVLIKILSLLLALALWVYVSNEQNPVREKILTVSLERT
FT                   GPAQNFVITGDLPESVKVRVQGTRSQLTNLSAADLKAVINIPERETGDLSLPVQVSAPA
FT                   GLRVVQVTPDEVRVSVDRMTEKSVAVAVSLRGAPAQGFTALAPVCQPGAVTARGPSRVI
FT                   NEISQATAVVDIQAATKDVEQNVPVSVGNLDVTLIPSAVRVTVPVVSALASKTVPVLPQ
FT                   VTGSPAAGYALRRSYAEPESVQIFGAAEVLGAISNIRTEPVDVQGVDGSLSRETGLVVP
FT                   HGVANVYPAKVKVQVEIEKVEAPPQQQPGSRETS"
FT   CDS_pept        530811..532148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ManB"
FT                   /locus_tag="PTH_0538"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58719"
FT                   /db_xref="GOA:A5D4W7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D4W7"
FT                   /protein_id="BAF58719.1"
FT                   /translation="MGVMFGTDGVRGVANRDLSPLLAFKIGRAGAHVLARQSPNAAMVI
FT                   GRDTRISGDMLEAALVAGICSAGVDVLKVGVMPTPAVAYLTRKLEAAAGVVISASHNPV
FT                   DDNGIKFFGATGYKLSDEVEAEIEALVMDECAGVPWPTGGRVGRVRQVGDAADLYVKFA
FT                   CSTAGVDLSGLKIVVDCANGAAYQVAPRVYSRLGAEVVPIFNRPDGININDGCGSTHPE
FT                   ALMEAVVSEKADLGLAHDGDADRVLAVDADGRLVDGDQIMVICARSLHEKGLLANETVV
FT                   VTVMSNLGLHLALRESGIRVVQTKVGDRYVLEELLRNGARFGGEQSGHIIFLDHNTTGD
FT                   GILTALQLLSVIKETGKPLKELAGQMERLPQLLENVRVADKALVMNSPVLAEAIEREER
FT                   LLEGMGRILVRPSGTEPLVRVMAEGKNMGQLKEIVGRLVNIIKEID"
FT   CDS_pept        532587..534416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GlmS"
FT                   /locus_tag="PTH_0539"
FT                   /product="glucosamine 6-phosphate synthetase"
FT                   /note="contains amidotransferase and phosphosugar isomerase
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58720"
FT                   /db_xref="GOA:A5D4W8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4W8"
FT                   /protein_id="BAF58720.1"
FT                   /translation="MCGIVGYIGPKEAVPVLFEGLSRLEYRGYDSAGVAFLEEGGLKVL
FT                   KKEGKLSALGEKLNGCSFCARVGIGHTRWATHGRPSDENAHPHVDCGGRLAVVHNGIIE
FT                   NYLSLKEWLQAEGHVFRSQTDTEVLPHLIEHYYNGDLVGAVLKAVSRLEGSFAIAVISS
FT                   REPDRIVAVRQDSPLVVGLGEGENFLASDIPALLKHTRRVYILDDGEVAVLEPDRVRVM
FT                   DRSGREVGKEARLVNWKADQAEKGGYDHFMLKEIYEQPKALRDTLSGRISADGTRVVLD
FT                   EVSLTPEEIRTLKRIYITACGTAYHAGLVGKYILERLVRLPVEVDIASEFRYRHPIIEP
FT                   GTLVMVISQSGETADTLAALREARRQGARVIAVTNVVGSSVSREADDVIYTWAGPEIAV
FT                   ASTKAYTTQLVAMYLFALYLAAERKTAEPGQIRELLLGLKKLADKAQSILDNTVEIKDF
FT                   AGEFATCKDLFFIGRGLDYAVALEGSLKLKEISYIHAEAYAAGELKHGTLALIEEKVPV
FT                   VALATQVSLFDKMIGNIQEVNARGASVLALAMQGLKEVEKVAGKVVYIPETNPVLAPVL
FT                   TVIPLQLLAYHTAVARGCDVDKPRNLAKSVTVE"
FT   CDS_pept        534510..534764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58721"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4W9"
FT                   /protein_id="BAF58721.1"
FT                   /translation="MPNIKPISDLRNYNEVLRSIEEGSPVFLTKNGRGRYVVMDMQEYE
FT                   KMQAKLKLLTELAKGEKAGRENGWLSIDELETSLGVTNG"
FT   CDS_pept        535148..535600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0541"
FT                   /product="hypothetical protein"
FT                   /note="containing prokaryotic transcription elongation
FT                   factor, GreA/GreB, C-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58722"
FT                   /db_xref="GOA:A5D4X0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4X0"
FT                   /protein_id="BAF58722.1"
FT                   /translation="MVKVALSKTAFEYLVKHLVEIEEGKNKILEKFFPKPSKERNEFEN
FT                   LIENYIQRLDRLIRNASKSKIADNKVPFVTIGSEVEIQNLSEQEVYKYFIVNPFYSEVR
FT                   EGHISFLSPVGKSLLLKKVGDEVEVKAPGGVFRYKIKSIRLRGDIK"
FT   CDS_pept        535797..536489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AzlC"
FT                   /locus_tag="PTH_0542"
FT                   /product="predicted branched-chain amino acid permease"
FT                   /note="azaleucine resistance"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58723"
FT                   /db_xref="GOA:A5D4X1"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4X1"
FT                   /protein_id="BAF58723.1"
FT                   /translation="MQKQELKQGIKDSIPIILGYIPLGIAFGLLANKVGMSVIQATLMS
FT                   VLCFTGAGQYIAIGIMQAGGAVFTIVLANVLVNLRYLLFSTSMVPYLKGKVPTAAGTLL
FT                   SYGLTDETYAVAMNRYQNHAPTASYMAGLNLSSHVGWIASTLLGALLGSYAGNTDRLGL
FT                   GFALPAMYICLLVFMIKRKSDVLVALSSALFCLLIGYLVPATMGNLFNIIIATVAGASL
FT                   GVLIGERD"
FT   CDS_pept        536476..536799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0543"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58724"
FT                   /db_xref="GOA:A5D4X2"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4X2"
FT                   /protein_id="BAF58724.1"
FT                   /translation="MSGTSIWIMIIGVSVVSILPRVLPVALFSRYEFPGLLKRWLSYVA
FT                   PSVLGGLTALSVLAPDGVIDISVYNRHIWAFVPTLLIAVKTRSLFYSLLAGIVAMALLY
FT                   NFV"
FT   CDS_pept        complement(537178..537714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0544"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58725"
FT                   /db_xref="GOA:A5D4X3"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4X3"
FT                   /protein_id="BAF58725.1"
FT                   /translation="MKEIIKKYRFFIALAVINFFLIVFFPAIGRKSLQITWRNTLEMLS
FT                   VLPPVFILLGLLDVWVQRETMIKFMGDNSGFLGVATAFILGSAAAGPLYAAFPIAGVLL
FT                   KKGSKLFNVLVFIGAWSTTKIPMLLFEASAMGWKFMLTRFIIDIPGIALIAYITEKALT
FT                   EKEKLAIYGEALKAG"
FT   CDS_pept        complement(538243..538587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArsR"
FT                   /locus_tag="PTH_0545"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58726"
FT                   /db_xref="GOA:A5D4T9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T9"
FT                   /protein_id="BAF58726.1"
FT                   /translation="MKDFPAVLKAMADETRFQILNILLEHDFCVGALAKKLSISEAAVS
FT                   QHLQILRKAGLVNGEKRGYYTHYWVDREALKQAAEEIRTLAIKTGKRDGCRKGPQTDRN
FT                   HCSKENGKDI"
FT   CDS_pept        538759..540660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0546"
FT                   /product="hypothetical protein"
FT                   /note="containing COG2206, HD-GYP domain and FhlA
FT                   (COG2203), FOG: GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58727"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U0"
FT                   /protein_id="BAF58727.1"
FT                   /translation="MSCAETDFYKSIIWQAPFGYAYHKLLVGAAGEPEDYVFLEVNPAF
FT                   EEMTGLKSESVIGKRVTQVLPGIRSGGFDWVAFYGRVAQAGEKQDFVQYAEDLKRWYRV
FT                   VTFSPKKGFFVTLVQEITELKKRLEHEKLISSISQMALQVRKREEFLSGALRVLGEGTG
FT                   VSRTYLFEMDPKKGTMSNTFEWTAPGITPQKENLQEIPQDEFSWWVDRLKSRETINYKD
FT                   IEDIPDEKTKEILRPQEIKSLLVLPVFLEEDLYGFVGFDECLNYREWSESDVNCLQITA
FT                   RIISDFILLKKFEEQITYLSYHDQLTGLYNRRFMEEEIRRLDTARQLPVSIIMGDINGL
FT                   KLTNDVFGHKVGDYLLKKAARFIRKSCRREDVVARWGGDEFVILLPKTGLKVAEEVVKR
FT                   IENRCALDREAPIRVSIALGYAAKNSAGEDIWRVLKEAEEWMYRKKLLHGKSYRNAVIS
FT                   SLKAALYEKSMETEEHAERLMEIGLKVAKSLGLPAKQLDEMELLSVLHDIGKVAIRENI
FT                   LLKPGPLTEEEWAEMKKHPEIGYRIAQSAPELASVAEYILCHHERWDGKGYPRGIKGED
FT                   IPLLSRILAVADAFDAMTHDRPYQRAMSREEAIAEIKRNAGTQFDPEVVRAFIEVFC"
FT   CDS_pept        541110..542009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0547"
FT                   /product="MoxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58728"
FT                   /db_xref="GOA:A5D4U1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U1"
FT                   /protein_id="BAF58728.1"
FT                   /translation="MNLDGLTVDGLHRSFEEQGYICEKNLAVTVFLALKLNKPLLVEGA
FT                   PGVGKTEIAKVLSRVFDAELIRLQCYEGLDENKALYEWNYQKQLLRIQMQKENIGYEIK
FT                   ERDLFSDEYLLERPLLKAIRSEKPVVLLIDEVDKVEDEFEAFLFEVLSDFQVSIPELGT
FT                   IAARQIPIVVLTSNRERELSDGLKRRCVYLFIDYPTIEKEVRILKVKAPEAGERLSREV
FT                   ARAVNLIRSNKAVGKKPAISESIDWARALVALGAGSLSREAVMQTLNIVLKNKDDIDTV
FT                   VREVGAEALAAYAQKHEN"
FT   CDS_pept        541936..543453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="CoxE"
FT                   /locus_tag="PTH_0548"
FT                   /product="hypothetical protein"
FT                   /note="containing von Willebrand factor type A (vWA)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58729"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U2"
FT                   /protein_id="BAF58729.1"
FT                   /translation="MILTLWCGRLGPRRWPPTPKNMRTDVLALAGQYSSHGAEDGLNNL
FT                   LYGLAEFVHILRRLGVRVSVAEARDAYEALSWIDLMDREQVRGALSVTLVKNRHDREVF
FT                   DLAFDAYFVPPEVRQQRQELKLKTPVCEDGRAGGGGDELVKAIKEDVRDWGRELLELNR
FT                   QAVEKNEKLSIKPGWTKQFRKQLIETIGRMEGGAGGVHPALIARTVEDSVGEWRGREVR
FT                   QAARRGPAPPLNTPDAPAGAAVPDEALPPASGTGRGDLSIIYSDMKKIDDEDLPRAALL
FT                   IKKLSRRMATRISRRYFRSRRRGRLDLRRTIRKNISLGGTLMELKFQSKKKQKPRVVLI
FT                   CDVSGSMARYTIFVIQFIYGLLKVVRGIETFIFSEDLERITPYLKKGEGFARTMYGLVE
FT                   QSAQWGMGTNLHASLAAFLDKHRRLLSPAVYVIIVSDAQTIQARQAAEDLEEIRGRVRD
FT                   VIWLNTMPREEWKRSPATLEFQRHCRMFECSTLDQLNKVLGSQMFIA"
FT   CDS_pept        543474..543893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58730"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U3"
FT                   /protein_id="BAF58730.1"
FT                   /translation="MFEQDMESALDNQKLKEEWVAALLGLMRQLKEWTVEQIKVWQAEA
FT                   GDRVIPNVIELTTERNEQYIGRYYAPMLVITAENCLVEILPAGRFAIGAIGRVDMMSGR
FT                   RSYSFLYSRRKGWVCMENRRPLTKELYLELLNQLA"
FT   CDS_pept        543918..544697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58731"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U4"
FT                   /protein_id="BAF58731.1"
FT                   /translation="MESKIAGAIGMKYSPVAVLWTGEKPEGALQFKEGRWGCVVAMLNA
FT                   SARGRTAVFDRKTFGCLGGGTGLGFGNQYVNFPAGIEYFISTGNKEFCQTEMGRNIVRN
FT                   MPALEHGERYVKNPALAKKFVDSLPYVDVPAEYVVFKPLEKLSEGEVPKVVVFLVNPDQ
FT                   LAALTVLANYARETNENVFVPFGAGCHTVCLIPYREGESENPRAVVGLIDISARKYVEK
FT                   DILSFTVPYKMFLEMESNVEGSFLEMEEWRRVRERNR"
FT   CDS_pept        complement(544737..544949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SirA"
FT                   /locus_tag="PTH_0551"
FT                   /product="predicted redox protein"
FT                   /note="regulator of disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58732"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U5"
FT                   /protein_id="BAF58732.1"
FT                   /translation="MDKTVDARGLLCPEPVLLTKKAIEKEKGGTIRVLVDNNAARENVT
FT                   RLAKSLGWNITITTREDEYEIVLTK"
FT   CDS_pept        complement(544933..546021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58733"
FT                   /db_xref="GOA:A5D4U6"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="InterPro:IPR026366"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U6"
FT                   /protein_id="BAF58733.1"
FT                   /translation="MQNKKILVAAAGGVMGLLAVLLVRYGNPANMGYCIACFLRDISGG
FT                   LKLHRAETVQYMRPEILGLITGAFIAAVYTKEHRAVGGSSSLTRFLLAFVSMIGMLVFL
FT                   GCPVRVALRLAGGDLNAGVGLLGLIAGVFIGVQFLNRGFSLGKSVSQPKVNGYIFPAIA
FT                   IILLILTLSGASFFAASKTGPGSMHAPVIISAAAGLIAGILVQRARFCTVGGIRDFIMF
FT                   GDTHLLIGFLSLLVVAFIGNISVGAFKLGFAGQPIAHTDGVWNFLGMALAGTGSTLIGG
FT                   CPLRQLTAASEGNTDCAVTVFGLIAGAAFAHNFGLAAGPNGVPAAGQAAVLIGLAVVLL
FT                   TGFAGVYRSKSVPGGVGLGQNG"
FT   CDS_pept        complement(546273..546392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58734"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U7"
FT                   /protein_id="BAF58734.1"
FT                   /translation="MGDTELTSVMTRESFEEAGFAQGDEVTALIKAINVVFVK"
FT   CDS_pept        546619..547308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58735"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U8"
FT                   /protein_id="BAF58735.1"
FT                   /translation="MQEAVLAVPQRFGTRWGYDLVVKDEAASVQDYLDAVCRIIREYPL
FT                   SRTRKKAPSCAGCDLCCKERAPLTWIDVLNLRKYLKMDKAALQEFLDLAGYILVDGPAV
FT                   DITLRRTGRGCVFLNRQSRLCSVYPARPLVCQTFFCCPVSRRAAGLRQYVVNAGEDELV
FT                   RQWLLQAGKRGGAPAFHEGYRPKLRLGDWQPNAFTGREHYRQVLLKELCPPRLWQKLYV
FT                   PAGRGGR"
FT   CDS_pept        complement(547311..547652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58736"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4U9"
FT                   /protein_id="BAF58736.1"
FT                   /translation="MGELVCISKPCEKDLPGEAVVPEAALDDGGEPEEPASRAVIPTID
FT                   IYTAKVLFDITQKMVENAVDRRVSLLEKRIEDRDREIMRTIRKIQARMATQENKAKASW
FT                   WQRLLGRGK"
FT   CDS_pept        547795..549498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0556"
FT                   /product="predicted ATPase"
FT                   /note="ABC class"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58737"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V0"
FT                   /protein_id="BAF58737.1"
FT                   /translation="MDRLLQILKRIDGKGYGAYKELAGTYQFADFTLFIDHVQGDPFAS
FT                   PTRIRVRVAGEKAGFPPQLWASKPRRIGLQDYLARQVAVKAKVYCGGVRGTGKSGLLLI
FT                   DAGGQEILERTALVISAGYVEARLSVGLPADGRRIKGALAAKMLTEELAGIVRASLFYK
FT                   RLDAAEVLSFVQLKEDQQFIREELVRRKLVAFVADGAVLPRESGASDRPMKGQAVPFEA
FT                   PPGLAVEMDLPNRGTVRGMGIPEGVTLIVGGGYHGKSTLLKAIERGVYDHIPGDGRELV
FT                   ITRCDAVKIRAEDGRRVEKVDISPFINNLPFGKDTVSFSTEDASGSTSQAANIMEALEI
FT                   GTSLLLLDEDTSATNFMIRDARMQALVAREKEPITPFVDKVKLLYKDKGVSTILVMGGS
FT                   GDYFDVADLVIMMDGYRPHVVTGRARELAGQKPTGRRPEGGAAFGEVRHRVPLKQGFKP
FT                   ERGGRVKVDAKGLSTIIFGTAAIDLSFLEQLVDPGQTRAIADILLYLSRKYFDGQNSLS
FT                   QAIRKLYGEIEEKGLDVVSPFYGKHPGDYAMPRPQEVAGAVNRLRTLMVR"
FT   CDS_pept        complement(549484..550644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixC"
FT                   /locus_tag="PTH_0557"
FT                   /product="dehydrogenases"
FT                   /note="flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58738"
FT                   /db_xref="GOA:A5D4V1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V1"
FT                   /protein_id="BAF58738.1"
FT                   /translation="MKYDVVIAGAGPAGSTLARRLAGAGLEVLVLEKEFMPREKPCGGG
FT                   ITYKAARLLDFPWQDVIEDTVHTAVFSYQGKSEVTVRLKTPLAYMVTRSSFDRMLADRA
FT                   RQAGACLVEGAPVKDIAVENGLVTVAAAGETYHGRLFVGADGVNGRSAMLLGLHHPGET
FT                   GPTLEAEVACPPEVLEQKRGTIRLDCGAVPWGYGWVFPKRDRLSTGVGAFTRKVKELKK
FT                   LLGGFLAREGLGSARILSLRGYPIPSGGRKKRIHSRSALLIGDAAGLVDPFSGEGIYYA
FT                   IKSAHLAAEAILDSRAQPEGAPGLYQSLVDRHVTAELMEARRLARVFYTFPRVAFGLVE
FT                   KNPDIAGQLCQIVCGEGNYSGLKEAAAEVIRAILSRKRTAGSLPHH"
FT   CDS_pept        551221..552432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RfaG"
FT                   /locus_tag="PTH_0558"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58739"
FT                   /db_xref="GOA:A5D4V2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V2"
FT                   /protein_id="BAF58739.1"
FT                   /translation="MRIAQLHWAFPPVIGGVESHLAMLGPAMVKRNCRVSLLTGSAQGA
FT                   AEKEQYGGMYVQRSPLMDLNGLTPEKILEMSGEIRQEINSFIELTRPDLIHAHNMHYFS
FT                   PVHADVLYEIKKERGIPLVLTAHNVWADDDPTWQEMNKRAHIWDAVIAVSNYIKKELVR
FT                   CGYEEDKITVVHHGIDLDRFSPPAERDAEEIKIKYPEFEGRRVIFHPARMSLDKGCHIS
FT                   VKAVSIIRKEFPEVLLVLAGTGKTVDWGSHQHKHVNKIMKMVDELGVKENVFTRFFAWD
FT                   EMPLVYRAAEFCVYPSCFEEPFGLAMLESMASERPIVVSRAGGMPEVVHNGVTGFVVEM
FT                   GSEEELADRCLRLLQDPALCRKMGRQGRIMVERFWTRDIMTEATLAVYQKVGQEKQALW
FT                   ISAM"
FT   CDS_pept        552414..554591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GDB1"
FT                   /locus_tag="PTH_0559"
FT                   /product="glycogen debranching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58740"
FT                   /db_xref="GOA:A5D4V3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V3"
FT                   /protein_id="BAF58740.1"
FT                   /translation="MDICNVTGTDEFRIAPEDVRGSVEVLKEGRMFMNSLPGGEIPGGD
FT                   MGGLGFYYSDTRFLSCLEMTLNGTEPVFLSRTLRDSHFAQVEMTNKEFTSRGMKVPMQT
FT                   VHIRLLRMVKDGFYQRVRIINFNPSVLEINLKFKLGADFADIFEVRGTKRPSRGTRQKP
FT                   VIGRQKAVLNYLGRDKVRRSTAVRFYPAPAAITEEDSYVYANYNLKLVPKKKYYVYLKV
FT                   TPVVDGENTELLPVRSDLGFTRAAQYLIDSYQSWKDQCVQITTDNESFNYMLWVAITDL
FT                   RALSTTYPGAGTVIEAGIPWYAAPFGRDALITAWQTLLVNPAFARETLRFLARYQGQAV
FT                   DPWRDEQPGKILHELRFGEMARAGEIPHTPYYGSVDSTLWFIILLAEYVRWTGDTGFLP
FT                   EMSGPLAKALEWCEKYGDIDGDGYIEYLCRSEKGLANQGWKDSWDGVVDRYGKIPSGPI
FT                   ALVEVQGYYYKALNEAAGIYEYTGDGTRAEELRQKAGRLKNNFLRDFWLERKGFLAYAL
FT                   DGQKNVVDTVVSNPGHCLFTGILPEQQGRRVVKRLMQPDLFSGWGIRTMSNEEVAYNPM
FT                   SYHNGTVWPHDNAIIGYGIGMMGEVVFLKLLVETLFEAAEYFDHMRLPELFCGFTRRGK
FT                   SGPVRYPIACEPQAWAAGSIFLLLRALLGIECRGAEINVRNPRLPGFLRTLRLENIRTC
FT                   CGAAALEFTRRQEKTYCGVIGTEGNVKVIFG"
FT   CDS_pept        554604..556181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OtsA"
FT                   /locus_tag="PTH_0560"
FT                   /product="trehalose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58741"
FT                   /db_xref="GOA:A5D4V4"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V4"
FT                   /protein_id="BAF58741.1"
FT                   /translation="MGSIKPLAAKLNSRLVVVSNRGSCTFVDSPQGIKAVPSVSGLVSA
FT                   VEPVVSQEGGTWVAWGGRCGREGEFAGISVPMPENGQKYVFQEVLLTPEEVTLYYEGFN
FT                   NGCLWPLCHNFVEKSVFNEEEWQAYRKVNEKYAAVLFKCAGPRDLFWVHDYHLAILPAY
FT                   IRRQRPYSRVSLFWHIPFPPAEIFAVMPWAEEMLKGMLEAELIGFHSRKYVRNFLHSAE
FT                   EIAGAEVDYSNETVYWSGRQLKAVAAPIGINWLDFEKLAGEGEVVRKAAQIRQEAGGEY
FT                   LLLGVDRLDYTKGILERLRAIEWLLENYPQYRNRLTFLQIAVPSRTGTAAYQRLKRRIE
FT                   EAVGRINGKYTENYRVPVKYLFRSLSKPDLVAHYLAADMALVTPLKDGLNLVAKEYVAS
FT                   NAGDVGVLLLSPFAGAAGQLKEALTANPYNPREMAARIVQGLEMPVAEKKRRLAALSKV
FT                   IREQDIHWWWRKVRQSWFGDAARGKVAVSPEAVQEVLRHGPVAGLAGRDSGATGSSCFM
FT                   PPEIAAND"
FT   CDS_pept        556093..556884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="OtsB"
FT                   /locus_tag="PTH_0561"
FT                   /product="trehalose-6-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58742"
FT                   /db_xref="GOA:A5D4V5"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V5"
FT                   /protein_id="BAF58742.1"
FT                   /translation="MGRLPAWQEETPEQLAALVLCHPKLLLMTDYDGTLVPLEDRPELA
FT                   LPGAGLLRTLRRLAGKRRITLAVVSGRDVDDLKSMLPVEGIYLAGCHGAEFAYPGGGRY
FT                   AAVDAEKLAPALDLLAGEAARCVANCQGFLLERKKTVFALHYRLADPVTALRVVSDFAA
FT                   AARPLAARYGMELKAGKKVIEVRPRAVHKGEAVRHLMNLNPGCYPVYLGDDSSDEDAFA
FT                   VLRESGTGVLVSEHKRITSASHRLKDPQEVLRFLQILSARS"
FT   CDS_pept        557063..558205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0562"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58743"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V6"
FT                   /protein_id="BAF58743.1"
FT                   /translation="MAFKKVMTALFLILVAAGGLKASCCKAAGKPSLNNELLARAGEIF
FT                   TARARAIITDADPAPALACYDTSGLLGRWALAHEQARLNYIQLWAKKRGVRITEAGSSL
FT                   RIPWLQVQGNTAELVVHQTLQLGYVYPDDPYVNYFGIGTRHWMKLALKDGRWLIQQDFY
FT                   IDGLGENLSSPDPTPADGSALIGVPDKSPPAQGDQPVIYDREGAVRYADEYAGLAWGAG
FT                   NDHNYNPRYRNFNDRGGDCTNFVSQCLGDAQGGKIPMDGIWYYDYRENSGSQAWVRAES
FT                   FGDWLVYSGRGRRIAGGTFPELNQPSAAFPRGAVRELRIGDVIGYGKRAYSEHLAIVVG
FT                   HDSKGYPLVNAHNVDRFHCPWDMGCDKTTFFHLYSIYDKR"
FT   CDS_pept        558394..559206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58744"
FT                   /db_xref="GOA:A5D4V7"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4V7"
FT                   /protein_id="BAF58744.1"
FT                   /translation="MVIRQYCFENNWYYVTEPRAIADLRNRGGNITYLIPFWFGVTEEG
FT                   TLADQSDAETLAFARQLGLPILAIVHNYASRQYGTLIHRLLTTERLRRALVVNILNLLV
FT                   SRGFSGVNIDFEFVPPEDRPFMTLFMAELFQTLKPHGLLASISVPPELRDDPSHPFSGA
FT                   FSYPDLARYSDQVYVLAYDEHVAEPGPIASIGFVRNVLTYALSVIPRYKIRLGMAVYGR
FT                   DWSTRTELPEELSYEEAVARAARFGAAIRYDVEAQESTLLIRKMVSRT"
FT   CDS_pept        559398..559757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0564"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58745"
FT                   /db_xref="GOA:A5D4S2"
FT                   /db_xref="InterPro:IPR019649"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S2"
FT                   /protein_id="BAF58745.1"
FT                   /translation="MAAYVKALSVKFFIALAVTAVLVHVTGIGFTGGLSVALVLTLVTF
FT                   LAADIPFLLLDYRLALVADVILAIPVFWGMARLFTGQYLPAATLAVLALIVAAGEWLFH
FT                   LYALRTRVYTRVKNH"
FT   CDS_pept        559891..560304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0565"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58746"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S3"
FT                   /protein_id="BAF58746.1"
FT                   /translation="MKSHTKYLWFNTKKRREYINITGEVEEAVRESGIREGMVLVSAMH
FT                   ITAGVYVNDAEPGIIQDIDEMLEQIAPYGKPYRHHQTGEDNGDAHLKSILVHHQVIVPV
FT                   TNGKLDLGPWQQVYYAEFDGQRRKRVIIKVMGD"
FT   CDS_pept        560306..560506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58747"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S4"
FT                   /protein_id="BAF58747.1"
FT                   /translation="MYIIDRFEGDWAVIEHNRKTFNLPRSLIPPEAMEGDVIIIKVSVD
FT                   AEATARVKGEVKGLAGRLFKD"
FT   CDS_pept        560543..561451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ComEC"
FT                   /locus_tag="PTH_0567"
FT                   /product="predicted hydrolase"
FT                   /note="metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58748"
FT                   /db_xref="GOA:A5D4S5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S5"
FT                   /protein_id="BAF58748.1"
FT                   /translation="MKKLVVFFLSVALLFSSGCAGLKNLGGKEGLKEEASSAAQGAAGL
FT                   ARRTDTLRVHFLDVGQGDSILVQFPNGRNMLVDAGKNDSASTVISYLKKNRVKKIDYLV
FT                   GTHPHEDHIGSLDAVIKSFEIGEIFMPKAVTGTESFRDVLAAVKNKGLQIKTAKAGVSI
FT                   LEDGNLFAKIIAPCGPEYEGLNNYSAVIKVEYGDVAFLLAGDAEELSEKEILAGGADVK
FT                   AQVLKVGHHGSHSSTSTEFLKAVAPKYAVISAGAGNDYHHPHQVTLDKLSKAGVTVLRT
FT                   DEKGTIVFGTDGKDLAFATTK"
FT   CDS_pept        561748..562521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0568"
FT                   /product="activator of 2-hydroxyglutaryl-CoA dehydratase"
FT                   /note="HSP70-class ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58749"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S6"
FT                   /protein_id="BAF58749.1"
FT                   /translation="MITVGIDVGSITTKAVLLNGSAWRSVIRPTGCSPREAGREALEEL
FT                   LNRAGLARGDVDFIVGTGYGRVSLPFIDRAITEITCHARGAHHLLEGADMVIDVGGQDS
FT                   KVIITDGKGNVVNFAMNDKCAAGTGRFLQVMAAALGADVSELGELSRGAEPVQISSMCT
FT                   VFAESEVISLLAQGVGKERIIAGIHRSVAVRIAAMAERLGKGELILFTGGVARNEGVRE
FT                   FLSRELGREVIALPESQLAGALGAAVLAREILNRK"
FT   CDS_pept        562543..562797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58750"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S7"
FT                   /protein_id="BAF58750.1"
FT                   /translation="MARVQVEFINTCPCCEEHVINIKKAAARYGDEVVVKIYHAGKDFD
FT                   YIKKYGAVSKGTMIINGRKKLDNLSRSIIEKAIEEAVRG"
FT   CDS_pept        562798..563898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0570"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58751"
FT                   /db_xref="GOA:A5D4S8"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S8"
FT                   /protein_id="BAF58751.1"
FT                   /translation="MNFPVLEFLQKVLLTSFDILNGASVWLVASFVLAGALHNLVSPDK
FT                   LQRMLGNRKISSLVKATVSGMLLPICSCGVIPLGLSLYYSGAYLGPTLAFMTATPIINP
FT                   AAVLLAYGLLGPQIATIYLVSGFLVPLLAGVAGNAFAGREIHLPGAEEPVKLVELEAGE
FT                   NVSLAKKLQTGLYWGFMDMGVMVSKYVCIGMLLAGLIIALVPAAYIQQYLGNPGMISLG
FT                   GIALLGAVMYVCAVGHIPFIAALVAGGAAPGLAITFLLAGVATNLPELISIYKLIGRRT
FT                   ILIYSSVLIGSAFAIGYLTNRMLMPGFVPFFDLDRSRQAVGVAGSLIFAAPEPLRYLCA
FT                   AVVLGLGFYSIWPKVKRFFIKLGTAP"
FT   CDS_pept        563895..564368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0571"
FT                   /product="hypothetical membrabe protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58752"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S9"
FT                   /protein_id="BAF58752.1"
FT                   /translation="MKRTVCYGFCIFLLLIIAPGCRPGGETKTGTSAVNGLDKDNQLLQ
FT                   FFVASHPENVVVKCAAADLNADSLEDLVVIYRQGADKCGMLVVLSQPAGYVFTNEVAAP
FT                   VSGQVITFKDIDDKPPLEFIVQGMKGANAGYAIFRVEGTRLEDLFGEGMKDCC"
FT   CDS_pept        564537..565670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TauA"
FT                   /locus_tag="PTH_0572"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58753"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T0"
FT                   /protein_id="BAF58753.1"
FT                   /translation="MRRYLRFVPLFALLVILLAMLAGCGGGTKPAVQNRTAGSGIPEKD
FT                   KDYVVQLGYYDCDHMTGACIAKDAGIFEELGLKVNVTGNGKVPEAMAAGQMDAGYVGNT
FT                   RMMRAFLQGSPIIVGANNHIGGSHYLVVSNSIKTPQELVGKKLSIGTDPEKNNANWITW
FT                   ANQFGIPVEGKNYEVFNMADKDEYFAMCAGKLDGFAACDPWGSMAEYEKTGHVLAASGK
FT                   LPNGEWGECCVFALNKKFASEHPELAKLMILAHTRAIEHMYLKPVRSAEIFAQNYKVPM
FT                   EVALMTIWKKTVAEGRTITWKMDRNYWKNQIDLELGYKTIDAAPNIDEFLQPQYLEECG
FT                   ADDFDIFIKEKVDPVFPVGMSYEEWKKKAYELEGKKA"
FT   CDS_pept        565679..566479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0573"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58754"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T1"
FT                   /protein_id="BAF58754.1"
FT                   /translation="MKKMLAATAAAVLLLFTFFTVFPQREESGGKVKIGTPDDTGGMII
FT                   HYLINEKGFQGAEARDDFEIYPVKDCCSSTSQWALSTGQYNLAVMCPDAAASLIEKDGR
FT                   FEIAGPCLANSDIVVVKPGLTPRKIGVARNRSHQAQIAADIFGKGCAAVPMLPSALPCA
FT                   YEKSAVDGVVVDALRGISMEGEKLSAGGATGHVTYVLVVSKRFKEDPRYREFISLFRES
FT                   VDELNNPDILRKEIGRYKNIELSQEEIETWNRLGIRYIFTTPEM"
FT   CDS_pept        566431..567084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TauC"
FT                   /locus_tag="PTH_0574"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58755"
FT                   /db_xref="GOA:A5D4T2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T2"
FT                   /protein_id="BAF58755.1"
FT                   /translation="MEPVGDKVHIYNSRNVRVMRERIIGAFGRKQALYRMISVAAIFGA
FT                   WQLAANHYHSNFLMPSPWKTMVTFISVVHDPEVVKNLLITLKRVLTGFLYALMIGVPLG
FT                   FLMGYSKAVMNILDPLIDSVRQVPIMAWVPLTIVWFGLGDGPTVFLIAFAGVFPVILNT
FT                   IAGVQNIPKDYYNAARSMGAGPWSIFVNVIVPGSLPDILTGGRIAVGLGWMSVI"
FT   CDS_pept        567124..567261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TauC"
FT                   /locus_tag="PTH_0575"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58756"
FT                   /db_xref="GOA:A5D4T3"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T3"
FT                   /protein_id="BAF58756.1"
FT                   /translation="MVEAQSRMQTDKLMALMIMAALVGYGIDRVIQLFNRSITKWRFVQ
FT                   "
FT   CDS_pept        567261..568055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TauB"
FT                   /locus_tag="PTH_0576"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58757"
FT                   /db_xref="GOA:A5D4T4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T4"
FT                   /protein_id="BAF58757.1"
FT                   /translation="MELRVENLSKVFVIGTVAYTVLKELTFSVHEGQFVALLGPSGCGK
FT                   TTLLTIIAGFQAASGGRVLVNGRQVTRPGPDRGFVFQNYALFPWMTVRDNILFPMKQRR
FT                   VPAPERERRLKELLAMAQLEGKERLYPHQLSGGMKQRTAFVRALAGRPEVLLMDEPLGA
FT                   VDHQMRQTLQEELEALWLKDKTTVIMVTHDVDEAVYLGDRVIVMSAREGRIIEDTPISL
FT                   PRPRDRKSKRYGKYKEHLAGILKNDVVRDPDLLRQESRLSLA"
FT   CDS_pept        568101..568433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0577"
FT                   /product="hypothetical protein"
FT                   /note="containing DsrE (COG1553), uncharacterized conserved
FT                   protein involved in intracellular sulfur reduction"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58758"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T5"
FT                   /protein_id="BAF58758.1"
FT                   /translation="MKVAYVFSSTNSQKILNNMILPQLEKDTHGAEVAGMFFFMDNTFF
FT                   LLDGTEMGDRLQQLQEKTGMLLMACDQCAIERGIENSLIPGARIGCFPQLYSALGGAGV
FT                   DQVITL"
FT   CDS_pept        568530..569819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HgdB"
FT                   /locus_tag="PTH_0578"
FT                   /product="benzoyl-CoA reductase/2-hydroxyglutaryl-CoA
FT                   dehydratase subunit"
FT                   /note="BcrC/BadD/HgdB"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58759"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T6"
FT                   /protein_id="BAF58759.1"
FT                   /translation="MSADYRKMWESLGVDLEAHDRLMGVLPPTYGNVYLSQENRPAGME
FT                   YFDFVISEVHGQRIVELQEHKAGGGKVVGAFCVFVPEEVVRAAGGICVGLCSGVEIGRT
FT                   QAEKVLPRSICPLIKSFMGFKLSRVCPYFESCDMVVGETTCDGKKKAFEILNDYIPVHV
FT                   MEIPQMRRDKDFALWRSEVRDFALAMEELTGNKITPESLLRSIKEVNGKRRALLRLSEL
FT                   RKNSPAPISGKDSLLIEQIAMYDDVERFTAQVNELCEELETRVKEGSGVQKPGDMRIIV
FT                   SGTPMAVPNWKVPHIIETSGAVIVAEELCTGLRYFENTVAEDGGSLEQMIDAIARRYLE
FT                   INCACFSPNRQRMERIVQLARDYRADGVIHVSLAFCDPYLIEANRVEKTLKENGIPVLT
FT                   LETDYGQEDTGQLKTRIEAFLEMLGCGKKR"
FT   CDS_pept        569999..572065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BisC"
FT                   /locus_tag="PTH_0579"
FT                   /product="anaerobic dehydrogenases"
FT                   /note="typically selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58760"
FT                   /db_xref="GOA:A5D4T7"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T7"
FT                   /protein_id="BAF58760.1"
FT                   /translation="MPGQTLSSPQKAQEGVYRTVCGLCNGNCGISVAVENGRVVHVEGR
FT                   KNHPVTRGYICPKGRAVKELLEAPDRLRRPLKKTAGGRWQEISWEEALHLIAQKLNDIK
FT                   AGYGAEAVAVHVGQAGVRKESTLYAKRFCRAFGTPNFSTAGSHCHISKMMANMVTCGVL
FT                   PVSDYRNSNCIVLWGYNPAASCPPLLDPINEALRRGAGLIVVDPRVTPLAKRAGCHLQL
FT                   RPGTDCALALSMLHVIIEEGLYDRDFVGRWTAGFDRLAKHAAGYPPEKVAQVTWVPAEK
FT                   IKEAARLYAKSSPACISTGIAVELNTNGFQAARAIAILQAVTGNLDVRGGALFVPEAKL
FT                   ASLKLDDIDRGSFKPAVGQDEFPLFYKYTRQAQANIYTEAILEGKPYPLKGMVIAGSNP
FT                   VLTWPNAGRVKSALASLEFLAVVDHFMTETAALADVVLPAAAFPGRNELWSIAHVYGLP
FT                   VIGLAPAVLEEEGVMTDWVFWKELAGRMGYDEYFPFKSEEDAINFRLEPLEMTVEDLKQ
FT                   EPSGHAYAKWKEKKYERRGFKTPSGKVEIYSEELEKYGYDPLPVYREADAQGSSGYPLV
FT                   LTTGARTIGYIHSRFRNLPSLRRLSPEPLVEVHKDKARELGVEEGETVVVETLNGSVEV
FT                   RVKIVDQADPRVIFIPHGWSGANANILTGNDVLDPVTGFPACRSVPARIVKIK"
FT   CDS_pept        572536..572952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58761"
FT                   /db_xref="GOA:A5D4T8"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4T8"
FT                   /protein_id="BAF58761.1"
FT                   /translation="MGKVLSINVSAEKGIEKTSVEEIEVVEGWGLKGDAHGGDWDRQVS
FT                   IFPVEALSKVPDNKMAEVLNGGYTENFTISGVPLEQLAVGRTVELGEARVKILHVGKEE
FT                   FKEHGRPYIVSREGRFGRVVKGGKVKTGDEVRLI"
FT   CDS_pept        573025..573477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="IscU"
FT                   /locus_tag="PTH_0581"
FT                   /product="NifU homolog"
FT                   /note="involved in Fe-S cluster formation"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58762"
FT                   /db_xref="GOA:A5D4Q3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q3"
FT                   /protein_id="BAF58762.1"
FT                   /translation="MEEKVEKQYILDMIGKYSDTVIDHARNPRNVGNIPNCDGFSQETG
FT                   ECGDTMAIWLKVIDNKINNATFWTDGCGTTIACGSMVTEMAKNLSVEEALKIKAEDILN
FT                   ALGGLPEDHAHCAALAAEALRNAVKDYIDTSKFPWKKAYQKKNSTA"
FT   CDS_pept        573734..574096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0582"
FT                   /product="uncharacterized conserved protein"
FT                   /note="containing NifB domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58763"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q4"
FT                   /protein_id="BAF58763.1"
FT                   /translation="MKVAITSQGESLESMLDQRFGRCGWFVVADTEEGNWEAVSNEQNL
FT                   SSAQGAGIQSAETVCRCGAEAVITGHVGPKAFKVLNAAGIKVYCCTGGTVAEALEKFKK
FT                   GELKETLEANVEGHWI"
FT   CDS_pept        574421..574762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58764"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q5"
FT                   /protein_id="BAF58764.1"
FT                   /translation="MPGFDGTGPRGMGPMTGRGRGYCMSYIDANAGFFCGFGRGRGWRN
FT                   RYYATGLPWWARRPAGNIPAGAVYAPPAGGEQELNFLKEQAIYLENALEQVKARIKDLF
FT                   KKFEGKEKE"
FT   CDS_pept        574793..575653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MinD"
FT                   /locus_tag="PTH_0584"
FT                   /product="MinD superfamily P-loop ATPase"
FT                   /note="containing an inserted ferredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58765"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q6"
FT                   /protein_id="BAF58765.1"
FT                   /translation="MTKKLTVAVASGKGGTGKTTISTCLAYAAVEAGYETAYIDCDVEE
FT                   PNGHLFLKPLLERSYPVSLPVPAVDEEKCVACGACGEICQYSAIVCINKSVLTFEKMCH
FT                   GCGGCSLVCPAGAISEKKRELGIVEEGRAGKISFYHGRLNIGEAMSPPLIKAVRSAGRE
FT                   SLLNIVDAPPGTSCPVISAVRNADYVLLVAEPTLFGLNDLGLAVDMVKELEIPHAVVVN
FT                   RSCPGNTLARKFCAERGIKVLAEIPDDRRVAEAYSRGELPYLSVPGYQRRFAKLLISIL
FT                   KEARR"
FT   CDS_pept        575653..576528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MinD"
FT                   /locus_tag="PTH_0585"
FT                   /product="MinD superfamily P-loop ATPase"
FT                   /note="containing an inserted ferredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58766"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q7"
FT                   /protein_id="BAF58766.1"
FT                   /translation="MEIAVISGKGGTGKTSLVASFAALAARPVVADCDVDAADLHLVLK
FT                   PQIKKMEDFTGGKKARIIPDRCSGCGMCFELCRFGAIIKNGSYRPAYAVDRISCEGCGV
FT                   CSHFCPEKAIEFSPAVNGRWFVSDTRYGPMVHARLGVAEENSGKLVTLVRNQAREIALK
FT                   EKRPVIIIDGPPGIGCPVIASITGTDAVLIVAEPTVSGEHDLERVAELVKYFNIPSFLC
FT                   VNKYDINPGVSKKIEEKAAASGIVAVGRIRYDRSVTEAQIKGLPVVDLKSAPAAEDIKQ
FT                   AWARLMNEIN"
FT   CDS_pept        576544..576897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0586"
FT                   /product="uncharacterized conserved protein"
FT                   /note="containing NifB domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58767"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q8"
FT                   /protein_id="BAF58767.1"
FT                   /translation="MKIMKIALPIAGGQLCQHFGHCEEFFFFNVDPGTKKITSKEVLKA
FT                   PPHQPGLLPRLLHEKGVNVVIAGGMGVRAQDLFRQNGIEVVVGVSPSNGSPENIIMSYL
FT                   AGSLQTGANLCDH"
FT   CDS_pept        576984..577868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Mrp"
FT                   /locus_tag="PTH_0587"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58768"
FT                   /db_xref="GOA:A5D4Q9"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q9"
FT                   /protein_id="BAF58768.1"
FT                   /translation="MEEKANCGCEEGKGCGCKEEKDCGCGEGKDCGCESEETKTPVPGK
FT                   IPVNNFSEVKNVIAVMSGKGGVGKSSVTSLLACGFRKKGFEVGVLDADITGPSLPRMFG
FT                   VKGLLEATPFGLLPSESSTGIKVMSMNLLMHDEDEPVIWRGPVLSNTVKQFWTEVVWDY
FT                   LDYLFVDLPPGTGDVPLTVMQSLPLNGLIVVTSPQDLAAMIVKKAVKMANLMNIPIMGL
FT                   IENMSGAVCPKCGEEFQLFGPGHGREVAEKFNLRFLGSLPVDPELSVLCDEGKIEDYKS
FT                   DIFTNVIPEILLQ"
FT   CDS_pept        578068..578466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0588"
FT                   /product="predicted DNA-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58769"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D4R0"
FT                   /protein_id="BAF58769.1"
FT                   /translation="MPRPPKCRRVEQFPGFTFFKPSGIPMSELSEVVLSVEELEAIRLR
FT                   DLEGMEHEECAGKMSVSRPTFHRILASARQKVAHALINGTALRITGGNFKLVQYMLECR
FT                   RCGHRWKGAICRRMLCPSCSSMDWHRIE"
FT   CDS_pept        578788..578934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58770"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4R1"
FT                   /protein_id="BAF58770.1"
FT                   /translation="MIKSLPQELIRELELELKREAMVEEKLQEAYYLWYAEKEETCPSP
FT                   SAA"
FT   CDS_pept        579077..579199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58771"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4R2"
FT                   /protein_id="BAF58771.1"
FT                   /translation="MDLQGFRHFLRWFYPDVIGLGSLFPGVYESFARAGCRHVF"
FT   CDS_pept        579168..579404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58772"
FT                   /db_xref="InterPro:IPR023988"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4R3"
FT                   /protein_id="BAF58772.1"
FT                   /translation="MPEPVAGMFFELFYFNGAHGLPGKESKGGYKFMEQNGDRDMQAGA
FT                   GRPAEEQETVWEQFVVEDIVIETLAIDGICGVY"
FT   CDS_pept        579434..580237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FabG"
FT                   /locus_tag="PTH_0592"
FT                   /product="dehydrogenases with different specificities"
FT                   /note="related to short-chain alcohol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58773"
FT                   /db_xref="GOA:A5D4R4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4R4"
FT                   /protein_id="BAF58773.1"
FT                   /translation="MGKLDGKVAFITGAARGQGRAAALAMAAEGADIACFDICRNLDYP
FT                   SYCLATREDMEVTVSGIRALGRKAAVFYGDVRRFNEVRAAVEGTIEVFGKIDILLNNAG
FT                   IAGIGASHELKEEEWDTMLDINLKGVWLCCKAVIPHMIERKGGVIISTSSVNGVKALPY
FT                   SVHYTCAKWGVIGLTKTLAQELAPYNIRVNSISPGTVATRMVAGLAREAGLEYEEAARQ
FT                   FCSGHLISGLIPPEAVAAAALWLSSEEARYITGHNLLVDGGWAST"
FT   CDS_pept        580326..580658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58774"
FT                   /db_xref="InterPro:IPR023850"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4R5"
FT                   /protein_id="BAF58774.1"
FT                   /translation="MKPDSRYALRAGTRFRHEDFGGIVYQRDADRLHIIRSRLAVRLLT
FT                   LAGTGTVNEIAAGLAAGSSNEKAVRDRVLEALCRLEELGIIYEIQHLDNAAEGAGMPDL
FT                   ADHRQV"
FT   CDS_pept        580585..581601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0594"
FT                   /product="predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58775"
FT                   /db_xref="GOA:A5D4R6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR023913"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4R6"
FT                   /protein_id="BAF58775.1"
FT                   /translation="MKSSTWTMRLKAPVCLTWQITGRCNLSCIHCLAGSSGDGPDRLSM
FT                   GEVRHFLDDLARMKVFYINIGGGEPLLHPRFFDIVDYALKRDIYVQFSTNGTLIDRAVA
FT                   AEIAGRGLRVQVSLDGWKPAVNDPVRGRGTFQQAVKAIRLLRERNVDVSVNCVVTRETI
FT                   AGLDEMLRLANRFGAGLRLSRLRPAGRARDRWRKMVPDREQYRRLYHWLMEHPEVRTGD
FT                   SFFFLSAFGAPLPGLCFCGAGKLTCSVDPAGNVYPCPFTVDKALIAGNIREKPLSELWL
FT                   EGLLNYWPAAGPEACRGCPAYGRCRGGCRGASFLVYGNCNMADPECLRGVVNERAFV"
FT   CDS_pept        581582..583531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NemA"
FT                   /locus_tag="PTH_0595"
FT                   /product="NADH:flavin oxidoreductases"
FT                   /note="Old Yellow Enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58776"
FT                   /db_xref="GOA:A5D4R7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR023987"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4R7"
FT                   /protein_id="BAF58776.1"
FT                   /translation="MKGHLYKRILSRLKIGNIELPNRIVFGAHPTNFASRNLLSDRHVA
FT                   YYRERARGGAGMIVLEEQLVHPSDLPYEKALFGFSEEIIPGYRRVAEAVHEHGAVVVAQ
FT                   LNHSGMQSEGSTAMHVLWAPGTVPDVVSREVPKAMEESDIAEVTGGFARAAGHAVAGGL
FT                   DGVEINAAQFSLVRQFMSPLTNRRADSYGGSLANRLRFCIEILKAVRAVLGEDRLLGIR
FT                   LCGDELAPWGGLTPEDAAEIAVELEKLDVLDYLTVSAGSLYSLHLSAATFYIEPGFAVE
FT                   AAAKIKKAVRLPVFAEGRIHRPEYAARIVDEGLVDGVYMNRALICDPWLPRKLERGEVE
FT                   RVRECLSCNQGCQVRHAMGKPLSCAVNPVAGREYEEETAGLRPAGAPKKVLVVGGGPAG
FT                   MEAARTAAIRGHRVILWEAGPAPGGALAACAHIGEFARLLKTWARELADCGVAVVTGKY
FT                   CRPEDVLAERPDALVLATGSRTAKPAFPVRKCPAVTAREAAVKPDGVGKTVLFWDEVGD
FT                   RVMARAVEKLLAGGKTVYFVTPDLFAGGKLAATLELTPFYRRFMAGAAEIFTSSLVIEV
FT                   DGGRAVVENRFGGRTVTLTGIDTLVYNCWPRPDESLYLALKDRVEEVYRAGDCLAPRGI
FT                   AEAVRDGYLIGKSL"
FT   CDS_pept        583548..585503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NemA"
FT                   /locus_tag="PTH_0596"
FT                   /product="NADH:flavin oxidoreductases"
FT                   /note="containing TrxB (COG0492), thioredoxin reductase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58777"
FT                   /db_xref="GOA:A5D4R8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR023987"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4R8"
FT                   /protein_id="BAF58777.1"
FT                   /translation="MNPDYHFLFSPIRIGPVTVRNRIVFPAHLTNYAVNNLPSDRHAFY
FT                   YGERARGGAGLIITEEQSVHPTDRAYEKLIDGCNPAVVPGYRRITGEVHRYGGKIFAQL
FT                   NHNGQQASGAFSGLPVWGPSSIPDPLFREVPKAMEKSDIQEVIRGFCLVAGHVIRGGFD
FT                   GIEVQASHSSLLRQFMSPLTNERTDEYGGSFENRMRLTVELMTALRRITGGRLALGIRL
FT                   SGDELVDGGLTLAEARKAAAYLCELKLVDFINTSIASFHNLYMVMGSMHVPPGYGAFIA
FT                   ASIREVADVPVFAAGRINTPAQAERLLASGQADMVAIARGQICDPEFAVKALEGREDEI
FT                   RYCISCNQCCAARTGLNRDLSCLQNPAAGREEVFGCHSVVKPARLKKIMVIGGGPAGLA
FT                   AAGEAARRGHQVTLFERENMLGGQVNLIARLPGRSEFAEVIRNQVKELRSLPVKVELGV
FT                   EVTAGLVEREKPDAVIVAAGSEAVPCGLPGAGLPHVMTFYEVLAGREVPGKRVLVVDET
FT                   GFYQGAGTAEYLARLNKKVFILTSCLYAGPDLMPTMDLPLWYRRVLGLGAEMIVNSIVT
FT                   SIEPGRVTVMNHYTGRENVLEGIDNVVLALHPGPRDEIYRMIKGKVPEVYRIGDCLAPR
FT                   RVEHAIYEGFKTGRSI"
FT   CDS_pept        585856..586854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixB"
FT                   /locus_tag="PTH_0597"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58778"
FT                   /db_xref="GOA:A5D4R9"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4R9"
FT                   /protein_id="BAF58778.1"
FT                   /translation="MQKILLVLDQNGEGIDEPSLNLCTSVKRFARRPADRVEAVLFGPC
FT                   QASLSRLLGGYGVRRVYQAPGPAGYFYSPERRAKQVLELAEAIKPSLIVLPGTVSGREI
FT                   APLLALKLEAGLVSDCVQLSFEGGKTEAVVSVYNGRYQMVCEFTGSPNVVLMADVDCGE
FT                   AETDNFGDAEVVLLDDPGFHGKPALEVLEAYGVPAGEIDIGEADVVVGIGGGIKTAEDF
FT                   KMMKELAAALGAAVGGTRAAVDAGWIPRAGQIGQTGRAIAPLLYLAAGVSGAPQHISGV
FT                   KKGKIVAVNCDPQAPVFDLAALGAVGDFREIVPLLIQKLRRGKGRGNIGRE"
FT   CDS_pept        586841..588142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixC"
FT                   /locus_tag="PTH_0598"
FT                   /product="dehydrogenases"
FT                   /note="flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58779"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S0"
FT                   /protein_id="BAF58779.1"
FT                   /translation="MGGNEFDALIVGAGPAGATAALVLARRGCKVAVIERGEFPGAKNM
FT                   FGGTLFGSVLNDIIPGFWKKAPVERFVGRRVISLLAEDSAVSLDFSPAAFKKAPYNGFT
FT                   VQRARFDRWYAGEAVKAGALLINRTVVDDIIWKNGRVAGVKVRRPGGEIRAKVVIAADG
FT                   ALSLLARKAGLRGEPAPGQFSLGVKEVLQLPPEVLEERFGLGGDEGVSCEFLGLMGGLP
FT                   GGAFLYTNRESLSVGVVVRVSLLKEKGKSIYGALEQFKRHPAVAPLLEGGRFLEYSAHL
FT                   IPEAGPQMLSRLYTGGMLVAGDAAGLVLSGGVFLEGVNLAVASGRLAAETALQALEKGK
FT                   FDAPAMAGYQAAMEESFVLKDLQRYKRASAMLLNERLYQFYPSFACRVLENWLKVDGTG
FT                   HPKLAGVIRSVLGGGTGLRQAAKDAWQIGRALVW"
FT   CDS_pept        588136..588411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FixX"
FT                   /locus_tag="PTH_0599"
FT                   /product="ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58780"
FT                   /db_xref="GOA:A5D4S1"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4S1"
FT                   /protein_id="BAF58780.1"
FT                   /translation="MVNIQVRLRLNRYNLDGEPHIRADTEKCRACLHRACLAACPARCY
FT                   LPHPENGVAFHYEHCLECGTCFLICDHGALKWHYPSGGCGVSYRFA"
FT   CDS_pept        588444..589322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0600"
FT                   /product="hypothetical protein"
FT                   /note="containing partial FixA (COG2086), electron transfer
FT                   flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58781"
FT                   /db_xref="GOA:A5D4N4"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N4"
FT                   /protein_id="BAF58781.1"
FT                   /translation="MKIVVLLRNVVDCRAPLPADVYGERPLPEGMETIINPPDWYALEY
FT                   SLSLCAQGICSEVAALSLGGKEAEESLRWCLAAGVRRAVRVWDEALAGADVLGKGRALA
FT                   AAAAALKPDLIVCGEGCLDQIDTMLPGAVAAAAGMTSVAGIVALEKVEGGRAFAVRRSG
FT                   RGRRERVAIRLPALVALEEGECPGRTAGLPELLAALAVPVPCLDLASLGLSAAKCGAAG
FT                   AKVHNLLVRFPVPPVSRPFTPDSRLPAERRLREILAGGMSGGRGEVITGAPERLAEKIY
FT                   RFLNSIPVNLP"
FT   CDS_pept        589517..590794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0601"
FT                   /product="hypothetical glycosyltransferase"
FT                   /note="containing COG1216, predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58782"
FT                   /db_xref="GOA:A5D4N5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023981"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N5"
FT                   /protein_id="BAF58782.1"
FT                   /translation="MEKIFPTLPEELLPFVSVVVPTRNRQDVLVSCVESLLDVDYPADK
FT                   LEIIVVDDASDPPVALEGYRRRVKSIRLDENRGPGAARNEAAKLARGEIIAFIDDDCLA
FT                   GRGWLKDLVPCFQYRDVAAAGGMVEPAGLTRLLEKYERCQSPLSMGKVQRKAAKNTAVS
FT                   YLPACNLLVRKDLFAAAGGFDPALQVGEDVDLCWRLLEKGGQIYYIPGGAVYHRHRAGL
FT                   LPFLKRRYDYGRSEALLRKKHPQDKKKHVCFPGSGFVLAAALAWFLAGATAALAALSGL
FT                   AVLNLFLQSFCRFKGIRRAGGALGFGGVLKAAARSQGAAVYLCSRRFARYRSIPALAAS
FT                   LLVFPGLAPFFLAFHMLPGFVDFVLKKPGLNLFCFVFYHTLEDFAYQAGVIAGINISKL
FT                   SNNIKKFQKEDPGNGIERTQPVKGPH"
FT   CDS_pept        complement(591082..591966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TupB"
FT                   /locus_tag="PTH_0602"
FT                   /product="ABC-type tungstate transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58783"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N6"
FT                   /protein_id="BAF58783.1"
FT                   /translation="MKNFKKSCVSLLVLTFMLVLAAVQGCGKASQPQQAGQQPQNKEVI
FT                   LATTTSTQDTGLLDVLLPIFEQKTGYKVKPIAVGSGAAMEMGKKGEADVLLVHAPQSEK
FT                   ELVDSGVGINYRLVMHNDFVIVGPAGDPAGIKGSKAVDAFKKIAEKKAVFVSRGDESGT
FT                   HKKEKEIWAAAGIKPEGSWYQQSGTGMGQTLSIASEKNGYTLTDRGTYLAQQKNIKLEV
FT                   LAEGDKALLNIYHVMQVNPEKFSKVNKDGGKAFVEFMVDPETQKIIGDFGRDKYGQALF
FT                   TPDAGKKEEDLGK"
FT   CDS_pept        complement(592011..592874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TupB"
FT                   /locus_tag="PTH_0603"
FT                   /product="ABC-type tungstate transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58784"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N7"
FT                   /protein_id="BAF58784.1"
FT                   /translation="MKLKVLIAAVLPALLLLAAGCAGQKNQPSGTGQILLASTIGPIDA
FT                   GIVSALEDSFEKKTGIRVRHVGAGTGAALKMAESGNFDLVMAHAKALEEKFVADGFGTR
FT                   RIDLMYNDFVIMGPESDPAGIKGLKAYEALKRIMESKSLFISRGDNSGTHVAEKELWQA
FT                   AGLKPAGDWYRVYEKGAEGNAKTLKYADEQKAYTFIDRATYLTMKNDISLKVLVEKDES
FT                   LLNFISLIPVNPQKFPGVKYKQAMQFVEFCTSKEGQTIIRDFGKDKYGEPLFFPNSTEG
FT                   KALSKT"
FT   CDS_pept        593416..594066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="THI80"
FT                   /locus_tag="PTH_0604"
FT                   /product="thiamine pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58785"
FT                   /db_xref="GOA:A5D4N8"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N8"
FT                   /protein_id="BAF58785.1"
FT                   /translation="MRMRFLIMANGDYGDIDWYRRQVGRFDRIICVDGGAGRAKKMGIV
FT                   PDWIVGDMDSIAGADRRHMEEAGACFKVFPPEKDFTDTQLALELAEKEGAGEIVVWGGT
FT                   GSRLDHTLSNLCSASSFALKGIKVIFDSPALTIHLVKDRLVLPGDLGDTVSLIVLGDRA
FT                   TGVSLKGFRYPLEGATLEGNWQWAVSNVITGADPVIQVSSGVLAVFHYKECVP"
FT   CDS_pept        594348..595895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AtoC"
FT                   /locus_tag="PTH_0605"
FT                   /product="response regulator"
FT                   /note="containing CheY-like receiver, AAA-type ATPase, and
FT                   DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58786"
FT                   /db_xref="GOA:A5D4N9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N9"
FT                   /protein_id="BAF58786.1"
FT                   /translation="MNENHQVLVVDDEPQVGAFFQRLLGRKKLQVVLAYSGEEARHVLR
FT                   EHEFKLALLDLKLPDACGLELLREVKNLQPHCEVIIMTGYGTTRTAVKAIQLGAYDFLE
FT                   KPFENIDELEKLIEDAISVSLGQVDSADAARWEELADQVGFVVGSTQQMRRLASIAYKI
FT                   APKNINVLIHGETGTGKELLARFIHAASSRSGGKFVAVNCGAFPDNLLESELFGHERGA
FT                   FTGAVNMRRGIFELANGGTLFLDEVGEASLAVQVKLLRVLETGEFMRIGGEKPIRTNVR
FT                   LIAATNVDLEQAIKEKAFREDLFYRLDVVRLVLPPLRKRREDIPLLVSHFVQKYAKAAE
FT                   YSGLRVSSECLRLLQNYDWPGNIRELANTIEQAVALCDGPELMPQHLVGKIRLSEAKSL
FT                   QMRKEAGGQPVASGVAAGDPVSQLQACLADEFPWEQMPTDQLLAANRLAHALIHRLGKA
FT                   MERRNLASEQRFSLRDIECQSISRALACYGNNFSLAARALGIARSTLYRKVKEYGLS"
FT   CDS_pept        596322..597485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="EutG"
FT                   /locus_tag="PTH_0606"
FT                   /product="alcohol dehydrogenase"
FT                   /note="class IV"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58787"
FT                   /db_xref="GOA:A5D4P0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P0"
FT                   /protein_id="BAF58787.1"
FT                   /translation="MALGEQVYGFYIPTVTLMGVGAVKQLGEQVKTLGGTRALIVTDKG
FT                   LAKLGLADQIKAQVEEAGVKAVVYDGAEPNPTDVNVHDGLKVFKDNKCDMIISLGGGSS
FT                   HDCAKGIGILATNGGNIRDYEGINKSTKAMPPFIAINTTAGTASEMTRFCIITNTSNHV
FT                   KMAIVDWRVTPNIAINDPVLMVGMPPALTAATGMDALTHAVEAYVSTIATPVTDACALM
FT                   AIKLISENLRSAVANGQNMEARDKMAYAEYLAGMAFNNASVGYVHAMAHQLGGFYNLPH
FT                   GVCNAILLPAVEEFNMLSNLKRFVDIAVAMGENVEGLSDREAAEKAIASIRKLSADIGI
FT                   PDGLKGLGVKESDLETMAKFAMKDACSFTNPRTATLEDVINIYKAAM"
FT   CDS_pept        598271..598840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0607"
FT                   /product="hypothetical regulator protein"
FT                   /note="containing an HD domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58788"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P1"
FT                   /protein_id="BAF58788.1"
FT                   /translation="MDKLNELSFLSDLMGSGLRGHHSRVTLYSKKIAGAICPDLINKVA
FT                   FAASVHDIGKIAIPDKILLKPGPLTRSEWVLVRLHPLVGARILQKSMNDEINREMIKAV
FT                   MHHHEWWDGKGYPYCLKEKDIPIISRILAVADSFDAMTSLRPYKASLSKDEALKELQEH
FT                   SGTQFDPEIVDIFLRIMLDRDEIQGL"
FT   CDS_pept        599198..600553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0608"
FT                   /product="predicted alternative tryptophan synthase
FT                   beta-subunit"
FT                   /note="paralog of TrpB"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58789"
FT                   /db_xref="GOA:A5D4P2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P2"
FT                   /protein_id="BAF58789.1"
FT                   /translation="MSDTKILLKEKEMPEAWYNIQADMPNLPKPPLHPVTKEPVGPQDL
FT                   KPIFPMGLIEQEVSRDRWIEIPDEVREIYRLWRPSPLCRARRLEKALDTPAHIYYKYEG
FT                   VSPAGSHKLNTSVPQAYYNKKEGIKRLATETGAGQWGVALSQACSFFGLECTVYMVKVS
FT                   YHQKPYRRSLMQVFGSNVIPSPSELTSSGRKILEKDPDSLGSLGIAISEAVEDAAGRED
FT                   TNYALGSVLNHVILHQTVIGLEAKKQMEKADHYPDVVIACCGGGSNFGGMAFPFAHDKL
FT                   VKGKKVRLLAVEPISCPTLTRGHFGYDYGDVAGFTPLLWMYTLGKDFMPPGIHAGGLRY
FT                   HGDSPLVSQLVHDGIVEARAYGQTAVFQSAVLFARSEGVLPAPESSHAIHAAVEEALAA
FT                   KEAGEKRIILFNLSGHGLLDLSSYDAYLEGKLIDYPLPEEELEKALAALPKV"
FT   CDS_pept        600731..601198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HycB"
FT                   /locus_tag="PTH_0609"
FT                   /product="Fe-S-cluster-containing hydrogenase components 2"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58790"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P3"
FT                   /protein_id="BAF58790.1"
FT                   /translation="MIHKTLLVDPAKCTGCRTCEMACSLRHEAKCSPLLSRTRVIKFEA
FT                   KGLNFPTVCAHCSKPHCMTACTQGAIRVDEETGAVVINEALCSGCRACLTACPHGQVGF
FT                   HPEKRVAFKCDLCGGDPNCARQCPTGAIKYSGVDQFLMARRRALLARSIEA"
FT   CDS_pept        601236..603173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0610"
FT                   /product="aldehyde:ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58791"
FT                   /db_xref="GOA:A5D4P4"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P4"
FT                   /protein_id="BAF58791.1"
FT                   /translation="MLYGWTGKRLRVDLSTGSVKVEEIDGTYREKWLGGRGFNSALLYR
FT                   EVGPDVEPLAPENKLIFGVGPLTGTFAPSSGRTTVTAKSPMGSPPGFGDSNMGGHWGPE
FT                   LKYAGYDQLVIQGKAAHPVYLWIEDGRVEIRDARHIWGKLVPEADAIIKEELGNADIHV
FT                   AVIGPAGENLVRFACILNDVYRAAGRSGMGAVMGSKNLKAVAVRGTGAVSIARPDEFYS
FT                   ICAGIRERLRKDLMVQMLYDQGTWLLTMPANYEQGWFCWRNFQKGNHPDARLLSGENHR
FT                   DNYLAHREGCFACPISCGRFSRIPGGRYAGETTGGPEYETLTAIGPRVGLLDPEAVIHN
FT                   NKLVNELGMDSCSCGGAIAWAMECWEKGLLSGEDTGGLALNWGDQELVDKLIKMIARRE
FT                   GFGNILAEGSYRAAEHFGRGQDYTMTIKGHDMSQDDPRGLGFAFGIGFATGRRGGDHLQ
FT                   GLPCLELTGAFYPGLVKKILGTDEAEDRLSPVKKPEMERYQEDLKAVGDSLTQCTFTHS
FT                   WSFAVQPEDMARLLSAAAGIDCDAEELLKTGGRIVHLERAYWNRLLVGRLEDKNPKRFT
FT                   REPMPDGPNKGTVFPEDELIPRYYEVRGWDGETGFPLPEVLKDYDLGDIADELEIYRKK
FT                   YLDKIKMSQS"
FT   CDS_pept        603269..603568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MoaD"
FT                   /locus_tag="PTH_0611"
FT                   /product="molybdopterin converting factor, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58792"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P5"
FT                   /protein_id="BAF58792.1"
FT                   /translation="MRITARYYGFFSTVTKKLFEQLNVAENITVGDLIEMLAGLYGYKF
FT                   RDLCFIRPLYSERDYINVNVNTLDLNNVKKFPAGLDTPLREGDTVSFGPVGGAA"
FT   CDS_pept        603602..604321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiF"
FT                   /locus_tag="PTH_0612"
FT                   /product="dinucleotide-utilizing enzymes"
FT                   /note="involved in molybdopterin and thiamine biosynthesis
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58793"
FT                   /db_xref="GOA:A5D4P6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P6"
FT                   /protein_id="BAF58793.1"
FT                   /translation="MENERWKRQLAIPQFGMEAQQKLRESRVVVLGLGGVGGVAALYLA
FT                   AAGVGCMVLVDRDVVELSNLNRQILFSTADIGKPKAEIGAERLLALDPGLKLEAVVKDI
FT                   RETDLKALLQGSHFVLDGFDKNAHRLAVNRACVRMGLPAVHGFAQDFSSELIAVLPGQS
FT                   ACLACVMDENFPEVKETPVLGVSVGVIGVAMAAAAIRCITGLGEVMAGCRLIYDLAFPE
FT                   LIKIPLERDPLCPVCGR"
FT   CDS_pept        604474..606894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0613"
FT                   /product="secreted protein"
FT                   /note="containing C-terminal beta-propeller domain
FT                   distantly related to WD-40 repeats"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58794"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR019198"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P7"
FT                   /protein_id="BAF58794.1"
FT                   /translation="MKIKYIIIPVVFLALSVVFIPWLQPGVDAAPNHKAVFVIGQETYI
FT                   ADGVARAMDVAPFVHDGRSYVPARFLGNALGIPDKNITWDSATQSATLSLNGAALRLTA
FT                   GSFSLYSGERELTMDVAPVLREGRMFLPAYWVANALGYEAKWDEAEQAVLIGPPGDLPE
FT                   PPAGLDELPSVGTYENLISLLEKAQGRSSVQYRMKSLDAAAAPELGQAGVPAPSGTGAV
FT                   DYSRTNVQVEGVDEADIVKTDGSYIYAVSGDRIVIAKAYPAEEMKVVSVLNFAEKEFSP
FT                   LEMYVDERYLVVIGHACKYPEDPVFRPMVEGNVKKVSRMMPPYYRDMVRAVIYDISDKS
FT                   NVSQVRELELDGTYVSSRKIGPAFYLVADKSIYYHPDKESEDLRPSCRDTAIGNELVKI
FT                   DCSEIKCFPGFVVPNYLIVAGLNLDRPEDKANINTYLGSGENIYCSVKNLYVAVTDYGT
FT                   GQAEIDLSSEEKPMDGEARPGIWPRPRPAVNKTRVYRFAMNDGKLAYSGSGEVPGTILS
FT                   QFSMDEHNGYFRIATTKGEIWRTDEHTSKNNVYILDGNLNITGKIEDIAPGEKIYSVRF
FT                   MGDRAYMVTFKTVDPFYVIDLKDPRRPAILGALKIPGYSDYLHPYDENHIIGFGKDTVE
FT                   LGQKGGQADGSGSMAFYTGMKMAIFDVSDVNNPVEMFREIIGDRGTDSELLHNHKALLF
FT                   SREKGLLAFPVRLMEVKDGSKVLETGFPQYGEFVFQGAYVYNMNLVDGFNLRGKITHLS
FT                   DQDYLKAGYYWYYSAKNVERIIYINDTLYTISKKIIKANSLGDLREIKTIEIS"
FT   CDS_pept        607071..607985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0614"
FT                   /product="membrane protein"
FT                   /note="containing SLH domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58795"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P8"
FT                   /protein_id="BAF58795.1"
FT                   /translation="MRKFLVLFVVLPLLIALPAGAALAKPGNVKASGERARIEAESRGG
FT                   LLGGDVKASSERARIETENRGVLKGLKQRLGALNSKEGENQVRFSDVKEHWAKSSINKM
FT                   SAIGLFNGYGDGTFRPDDPITGAEAVALVMRMADVDEPEEDIDTGDAPDWAKKSVQKAV
FT                   YKGVININRFHSQVQASRAQTAVMVAKALNLSPVDTAGIPFEDGVLISPEDAGYIMALY
FT                   QAGIIKGTPDGRFNPNSSITRAEMAVIMERIVSQQQDESQTNAEGGTGGVQTSNEETAG
FT                   SGAMTQTGDAEQAGENTQTSGTQ"
FT   CDS_pept        complement(608617..609453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SIR2"
FT                   /locus_tag="PTH_0615"
FT                   /product="NAD-dependent protein deacetylases"
FT                   /note="SIR2 family"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58796"
FT                   /db_xref="GOA:A5D4P9"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4P9"
FT                   /protein_id="BAF58796.1"
FT                   /translation="MEDREKFKKAAEAIKNAKAVVITAGAGMGVDSGLPDFRGDKGFWK
FT                   AYPLYERLGISFVEAANPAHFAFDPAFGWGFYGHRASLYRETAPHAGFQLLLDWIGRFG
FT                   LDYFVATSNVDGHFQKAGFSGEKIYEVHGSIHYLQCLTPCSEEIWENNESIPVDHSTMR
FT                   AQYIPKCPRCGAAARPNILMFGDFSWLSGRTDRQGARFRDFLHRHQEDRMAVIEIGAGT
FT                   AVPTIRRLSEHLGSRRGATVIRINPREPQIGFPHLSLACGALEGLRGIDSFLEGKT"
FT   CDS_pept        610314..611585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="KamA"
FT                   /locus_tag="PTH_0616"
FT                   /product="lysine 2,3-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58797"
FT                   /db_xref="GOA:A5D4Q0"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="InterPro:IPR030801"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q0"
FT                   /protein_id="BAF58797.1"
FT                   /translation="MSIPVVEQRWRFSDEEKRAIALMRAAELKDKISDYLEKKDLIKTG
FT                   FDFQETALRNKERLLKYFNSTESDWEDWRWQMSHRISDSGALAELFGFNEMQCAQIKRV
FT                   GMRYRWAISPYYASLMEGDIEHDPIRLQSVPSIEELNETGHPDPMAEELTSPAPCVTRR
FT                   YPDRLIINVTNKCAMYCRHCQRRRNIGEVDRHSPHESLVAALEYIRKNREIRDVLITGG
FT                   DALLLSDSKIDWLLSELDKIKHVEIKRLGTRAIVTLPQRITPELCDVLKKHPPIYVNTQ
FT                   FNHPREVTPESKQACDMLAEAGVVLGNQAVLLKGVNNDPHVMKKLNQELLKIMVRPYYI
FT                   FHAKPVKGTLHFITAVDEGISIMEKLRGYTSGLAVPTYIINAPNGYGKTPVLPCYVLGN
FT                   NGDKIKLRTWENRVLEYSFLPGGE"
FT   CDS_pept        611588..612883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RfaG"
FT                   /locus_tag="PTH_0617"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58798"
FT                   /db_xref="GOA:A5D4Q1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q1"
FT                   /protein_id="BAF58798.1"
FT                   /translation="MVFPGKVMLISVHGDPLARLGGIQSGGQNVYVREMARALDSMGIQ
FT                   VDVFTHWSDPGLPRSEPLGRKSRVIRLTGGSKGFHSKHQMFGMLPMFVKELIQHVGNPC
FT                   HYAVIHSNYWLSGWVGLQLQKILRIPRIHTSHSLGTVRKDAIGTKGNEPLAVRLRVERE
FT                   VLKKADRVIATTPFEEKILKKHYFVPNDNISVVPCGVNTELFRPLKNSKLDRRFSDQER
FT                   KTVLFVGRFEENKGLGVLLKSFKILKEKYPLTAARTRLVIAGGDCLELPLNALSAEKKQ
FT                   YLKFIGENRISELVEFAGPLKHEDLLAYYNDASITVVPSYYESFGLVAVEAMACGCPVI
FT                   ASRTGGLRHNVIHGKTGLLVEPKSPEELASAINFLLTDEKARKQMSAEAAIHGKRFSWL
FT                   KVASQISGIYREVTGWKEKYDPKSQDISWLQI"
FT   CDS_pept        612829..613581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Cof"
FT                   /locus_tag="PTH_0618"
FT                   /product="predicted hydrolase"
FT                   /note="HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58799"
FT                   /db_xref="GOA:A5D4Q2"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4Q2"
FT                   /protein_id="BAF58799.1"
FT                   /translation="MERKVRPKKPRHILATDLDGTLVGNRMALAEFNRYMLKNISNFLL
FT                   VYVTGRTFSSAWRLILEENLLFPDVLITDVGTEIYLSPRFKHDPIWEKKMSSSWDAGKI
FT                   RAVIDNVGGLHSQEIYPRFRLAYCTDKAAFKDIALKLSLAVEMAKLPVRVVPSMGHIID
FT                   IIPKDAGKGPALCYVREMYSIKKEHTFVCGDSGNDLSMFLRGFKGIVVGNARPELKQAI
FT                   KLKSREVYFSKSFYASGILEGLKKYGMV"
FT   CDS_pept        complement(613838..614938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="MscS"
FT                   /locus_tag="PTH_0619"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58800"
FT                   /db_xref="GOA:A5D4L6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L6"
FT                   /protein_id="BAF58800.1"
FT                   /translation="MLLNIMSPTAQNAVIASLIFLFFLFLSKIFTTHVFHLVLKIFSKT
FT                   NTEFDEKILLSFERPLRVFFVAFGIYAALLYLPFDAGLQLLITKFFRSVIIVLTTWGLY
FT                   NLQDVHSIFFKKIQEKLNVQIDKILFPFISKFLRVVTIFFAFTIIAQEWDYDINGLIAG
FT                   LGLGGLAFALAAKDALANIFGGMVIILDKPFSIGDWIKTPSVEGTVEDINFRSTKIRTF
FT                   AQALVTVPNSTLANESITNWSRMGKRRITFYLGVTYNTPRKKLEKCISEIRTMLENHPE
FT                   IHKETIIVRFEEFGESSLNIFLYFFTVTTAWGEYLRVKEDVNYKIMEILEREEVSVAFP
FT                   SRSIYFETPLPGEAKDSQHNIKERIN"
FT   CDS_pept        615411..617180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0620"
FT                   /product="hypothetical protein"
FT                   /note="containing partial COG0218, predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58801"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L7"
FT                   /protein_id="BAF58801.1"
FT                   /translation="MDIGFGYLKEKVLNELEAVDFYAHQRESLHLAAYVKEVREKLRQD
FT                   RFNLVVLGEFKRGKTTFLNALLGAEILPTAVVPLTSIITEIRYGEILKCKVCFLHGGTK
FT                   EIELSEVAGYVTEEGNPGNEKKVKLVQLEYPSPYLKEGVVLIDTPGVGSVYQNNTHETY
FT                   NYLPKVDAAIFMLSSDQPLSQAECDFLKTIKQYSTKTFFVLNKIDYLEDKDRQKALDFA
FT                   RKILKEKAGFENVDVIPLSAKMALEGKLEGDEKKLSGSNIQEFTRTLEQFLLAEKGAAM
FT                   LIAACSKGINTADELLMGIELEIKTLVTPLEELRSKTSLFDKMAGKLCQEKQDTKYIFQ
FT                   GELDKVYHVLEEEITRFQKRQSISIENEVDRLYQEKRSLSGRELLKSLETLIESKLKFA
FT                   FENWEPEVNEKVNVAFEKVVARFTDKANKAIEELLRQSADIFEITVEGFTKMDVLTDDS
FT                   KLYYIFGQEQSMLLPDPVKVGAILLPRFISGPRILKEMKKKVERELDRNCGRLRSDYSD
FT                   RIYKSAMKFQRTFEEKLSQIIEGTRTVLTRAMDKKQRSEKEVNEVIAMLNKERDQLVNI
FT                   KARLKTVMEEIKF"
FT   CDS_pept        complement(617177..617632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58802"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L8"
FT                   /protein_id="BAF58802.1"
FT                   /translation="MDSLLKDLADFYARLDHFLLPSSRACGICGECCKAVSSLRVYPLE
FT                   MENIRMHIKNELLLDKFRNFANSDVISIWGSSSGNCPFQEGVLCGIYPVRPYHCRIYGH
FT                   YDPRGKSLLKGCVYQGHALSYYKREELPMIDELDRLNDAFSKLSNKP"
FT   CDS_pept        618003..619223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0622"
FT                   /product="predicted archaeal sugar kinases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58803"
FT                   /db_xref="GOA:A5D4L9"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L9"
FT                   /protein_id="BAF58803.1"
FT                   /translation="MAVNKVSFIEQKQKIEIGIIGGPFDRITTVLEEFEPGQKNFIVYP
FT                   EQCGVAPRKVAEVAEREVEVTVPARLHPTVLDMNRFNVSRPGGGGMGIAVGVYLKARVR
FT                   STPGPEIVVKGERPLIATHFARVFREILGYKGGFEIELYDHKRRHVGMGSSTGTMCAAC
FT                   IGINEVLGRPFNNRELRRILGYNACEESPRGSRYLIRGFETGMGAMVSIHGGMVLGTDD
FT                   MEIIYRTALPGTRAIIVIPDVPSLKDEFTGKDTAAESEVELLMRRARYLDYLQCGTKSQ
FT                   IVLLDLLPAMVRGDLKGIGDAMFDLCFLGSKRAECEQHGVWGTHIYNFIGSFRELGAEV
FT                   AGMSSVGPTVFALTRSGQVQERIMDFLASRQVAPSRIIVTEVDNIGARILENGKERNYQ
FT                   HEGWLSG"
FT   CDS_pept        619201..619911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TrpF"
FT                   /locus_tag="PTH_0623"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58804"
FT                   /db_xref="GOA:A5D4M0"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M0"
FT                   /protein_id="BAF58804.1"
FT                   /translation="MKAGCQVKICGITSIEDARLAAGAGADFIGVVVEIGFSPRSLTVE
FT                   EAKAVFASAPVPAVALVFEMKPERIEHMVLKLKPFAVQFISPEGPDLAGRLKRLQPRLN
FT                   IWQSLHLPAKAGSSGVSFDEREVLRRVRQCREAGVDAVLFDTAAVLNGVTRLGGTGQTS
FT                   NWEVAGRLVKASPLPAFLAGGINPANVRQAVEKVRPYGIDLCSGVEKSPGKKCPVKLKA
FT                   LMESLRQAGGTGNV"
FT   CDS_pept        619845..620963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AdhP"
FT                   /locus_tag="PTH_0624"
FT                   /product="Zn-dependent alcohol dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58805"
FT                   /db_xref="GOA:A5D4M1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M1"
FT                   /protein_id="BAF58805.1"
FT                   /translation="MPGQIKGFDGIVKAGRGDGKRMMMKAAVVHGKGDIRIEPVPVPET
FT                   GYGEVLVKVRASGICATDIKTLLGQGLPEKLPAILGHEVAGTVERVGPGVRGDLSPGKR
FT                   VAVYPIAVCGECFFCKRGRHNLCLREYGLAHGIDGGFAQYVRIPREIVAIGGLVELPEH
FT                   LSYEQAAMAEPLSCCLAAARAGKLEEGDTMLVVGAGPMGLLHLKTGLWRGARVIVADLR
FT                   RDRLEMAARMGAAHCIDAGEKDVVEEVRRLTDGLGAGLVVASLGAPEAAAQYLPAVRNG
FT                   GTFNIFGGPPANRPVNVDFRWIHYSEVVLTGTFASTPEDFRLALKLIAGGQILVDDLIS
FT                   HRFELENMLEAVELARKQEIIKGVLIMPGEDG"
FT   CDS_pept        620964..621773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="FbaB"
FT                   /locus_tag="PTH_0625"
FT                   /product="DhnA-type fructose-1,6-bisphosphate aldolase and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58806"
FT                   /db_xref="GOA:A5D4M2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M2"
FT                   /protein_id="BAF58806.1"
FT                   /translation="MDGLQIRLKRIFRKNTGRTLVVAIDHGMALGPMAGIRNIRETVER
FT                   LDSTGLVDAWLLTKGILRYGFEPAGTPGIILRISGGATIAGPELTREGLTATLEEALAA
FT                   GADAVAVSAFIGSPYEHETLVNLAAAAGRCRRWNVPLLGVVGLGKTNEDKKKDPKFIAL
FT                   ATRVAAEHGADLVKTYYTEENFDQVVAGCPVPVLIAGGPKCDTDGDTLKMVYGAVQGGA
FT                   RGIVMGRNVWQSPHPRALLAAVHGIIHRGLSLREACELLEEKARKNE"
FT   CDS_pept        complement(621805..621927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58807"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M3"
FT                   /protein_id="BAF58807.1"
FT                   /translation="MMFSPGSFLQNKSLHLILIIRIALRSHIYNGKFDIILFFI"
FT   CDS_pept        621927..622898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0626"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58808"
FT                   /db_xref="GOA:A5D4M4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M4"
FT                   /protein_id="BAF58808.1"
FT                   /translation="MYFPVSGVEVFPLIPPAVAFLVSSFTASAGVSGAFLLLPFQVSVL
FT                   GFTSPSVSPTNLIYNIVATPGGLYRFIREGRMVWPLTWAVITGTLPGVFSGAWIRVRYL
FT                   TDPGAFKVFVGVLLLYLGLRLLRETAGCFMEYNSRAHNAGSNFGERYRTVGKGNGSKVP
FT                   PGFSAGAGVRVRRFSYGKVEYEFMGQTFSFSTAAVFFLALAVGLIGGIYGIGGGAIIAP
FT                   FCVSFLGLPVYTVAGAALAGTFLTSIGGVFFFSLLAATPAGAQAAVAPDWVLGALFGAG
FT                   GLFGTYLGAWLQKFLPERFIRGTLGALVTFLAAQYILQFFFR"
FT   CDS_pept        622975..624084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AraJ"
FT                   /locus_tag="PTH_0628"
FT                   /product="arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58809"
FT                   /db_xref="GOA:A5D4M5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M5"
FT                   /protein_id="BAF58809.1"
FT                   /translation="MKENEDGRRSRRWLIGLVNFLLNFATQSSITFIPLLGAQLGASDF
FT                   QVGLVGSVYGAAFLASSLFSGWKSDSMGRLLFVRWGLFISSAAFAAQLLASSVLLLMIL
FT                   RGAVGFALGITVAANLAFAFESGADMGKFSSYGSLGWIFGALAAALVGDIYLLFKISFL
FT                   VCLSAFFLSLFFEEAPSIKFSAPPNLWHVLRRDYRIYLAVFLRHLGATAVWVILPLYLS
FT                   CLGMDKFWIGLLWGINFFVQFVVMRHLDGFSEYKVFAFGQLLSIFVFVAYAFVAGKPFL
FT                   VIVQVLLGVAWSCLYVGALLIVLRSGEERGTAGGVFQSTLNLCNAVGPLLGGLIAQGFG
FT                   YRGVMFFAAALGVLGMLVAVPAGQKESGC"
FT   CDS_pept        624162..624635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Bfr"
FT                   /locus_tag="PTH_0629"
FT                   /product="bacterioferritin"
FT                   /note="cytochrome b1"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58810"
FT                   /db_xref="GOA:A5D4M6"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M6"
FT                   /protein_id="BAF58810.1"
FT                   /translation="MAGQIQLEQVINGLNLDLSWEYAAMVQYIQHASMLTGPEYVAVIS
FT                   ELQEHAREEHNHAVILSDLIQYLGGVPTVEVATRLTSLNNVEMLRQDLQAEYDAIRRYL
FT                   QRIEQLEALHLYDSAQKIRNIAATEQEHAIDLEKALGIQKVRPGTAYPFTLSP"
FT   CDS_pept        complement(624682..625281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0630"
FT                   /product="hypothetical protein"
FT                   /note="containing partial IbpA (COG0071), molecular
FT                   chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58811"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M7"
FT                   /protein_id="BAF58811.1"
FT                   /translation="MNFSNKDWLKFALDLYEKTRDMGFMNGIDKNGLESLIDMAGKLNF
FT                   SGPWPAQPGKGGKIQQEAAPAEQEKAENEAFWQQKSHPFYGGKQPAQTKSGRNIPVSVF
FT                   ETAGEVSIHIVLPELASRNDLALFISPEALELSGTMVCGGTAGGDKRTENFHKTVRLPA
FT                   PVDPSGASAVYRNGTMYVRAPKKNFFSPQKIEVRFE"
FT   CDS_pept        complement(625394..625639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58812"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M8"
FT                   /protein_id="BAF58812.1"
FT                   /translation="MVLLALIIGGLNIEIQSGGIFNYGEIALNCAKSNIHQEADANSFC
FT                   VGDGNLFYGTTDQPSVSVNGIITDIIDGDGARTILP"
FT   CDS_pept        625749..625883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58813"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4M9"
FT                   /protein_id="BAF58813.1"
FT                   /translation="MKISVALVEGVDISCHMQIIFVNNQKHAANVRFCAGLYGCPYRP"
FT   CDS_pept        complement(626378..626587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0633"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58814"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N0"
FT                   /protein_id="BAF58814.1"
FT                   /translation="MVAQIIIGSFKINCIHSGAVLNIGEVIFSLPGNKIELSAGSNSFC
FT                   SGDGITSIASKERQVPDSEKNSHS"
FT   CDS_pept        complement(626725..627075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58815"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N1"
FT                   /protein_id="BAF58815.1"
FT                   /translation="MIKFLFLKLRKFIHQSYSPEDLLNKIRELEKQIEQIKLQIDNAPV
FT                   IKIEKIIIDKIICEKFETSYNIDSVATENLSGTMNIGTTYSASEQKFELNQEEKPIRQP
FT                   EPEKKKINLIYK"
FT   CDS_pept        complement(627290..627472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58816"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N2"
FT                   /protein_id="BAF58816.1"
FT                   /translation="MMSMLSRQTLQSCIQRCQATANDIKSMATDAPAPAKQSLDQAYQS
FT                   IDACIKQCQDALNKI"
FT   CDS_pept        627968..628822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0636"
FT                   /product="hypothetical protein"
FT                   /note="containing partial Tar (COG0840), methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58817"
FT                   /db_xref="GOA:A5D4N3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4N3"
FT                   /protein_id="BAF58817.1"
FT                   /translation="MKVCIIGGGRGGRAILDAFYNLKEVEIVGICDKNMDAPGIVLARQ
FT                   LKVPVYSDFNELIKKPGLNLIFEVTGNEKVSEAIINSCPPGVFVVNAHAAKLMMDLIEK
FT                   NNSLLRQLEEQAQHLAEVAQEINQAMKLIVTAIEEIAQGAKNLNLHTEKLSSSARETEG
FT                   HLKETGSILEFIQGVGDQTKLLGLNAAIEAARAGEHGRGFTIVAQEIRKMADNSANSAK
FT                   QINVILKNIEKSVTVIVHNIEEASNIIQKQAAATSEVVGATKKVNDTVEQLYAVATKLA
FT                   SIK"
FT   CDS_pept        628975..629232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58818"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J8"
FT                   /protein_id="BAF58818.1"
FT                   /translation="MPIFEYKCNNCNRVSEILQLPGHNGEIACKGCGSTNLTKMISAPF
FT                   LPSSVGKPANDDLKCSASDKECEFKDRSCDAGSCCGQAVN"
FT   CDS_pept        629432..629968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0638"
FT                   /product="hypothetical protein"
FT                   /note="containing AbrB regulators of stationary/sporulation
FT                   gene expression (COG2002) domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58819"
FT                   /db_xref="GOA:A5D4J9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J9"
FT                   /protein_id="BAF58819.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTMRIREGDPLEIFTDREGEVI
FT                   LKKYSPIGELGEFASEYADSLNEALGHISCIADKDSIIAVAGAPKKQLLNKQISPDVEK
FT                   VMADRKVVVFNEPCFLTFDEDISYNSAVIAPIIAEGDAVGAVIIASKEPGVQMGTLETK
FT                   LAETAAGFLAKQMES"
FT   CDS_pept        630329..630529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiS"
FT                   /locus_tag="PTH_0639"
FT                   /product="sulfur transfer protein"
FT                   /note="involved in thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58820"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4K0"
FT                   /protein_id="BAF58820.1"
FT                   /translation="MKIILNGREEVLEEGMTVAGLVALKGVNPDAVIVEYNYSLVKKED
FT                   WAGITLKENDRLEILRFVGGG"
FT   CDS_pept        630532..631302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiG"
FT                   /locus_tag="PTH_0640"
FT                   /product="Uncharacterized enzyme"
FT                   /note="thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58821"
FT                   /db_xref="GOA:A5D4K1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D4K1"
FT                   /protein_id="BAF58821.1"
FT                   /translation="MEDTFKIGGRELTSRLFLGTGKFSSNRLIPEAVRASGAQVVTVAL
FT                   RRIDLEYEEENIAAYVPKDCILMPNTSGARNAQEAVRIARLARAAGCGNWVKIEVITDN
FT                   RYLLPDNYETIKATEILAAEGFVVLPYMSPDLMVAKKLAEAGAAAVMPLGAPIGSNRGL
FT                   RTKELVRILIDEIPLPIIVDAGLGRPSEAAEAMEMGAAAVLVNTAIATAGDPVAMARAF
FT                   GLAVKAGRLAYLAGPGETQEYARASSPLTGFLRD"
FT   CDS_pept        631333..632433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiH"
FT                   /locus_tag="PTH_0641"
FT                   /product="thiamine biosynthesis enzyme ThiH and related
FT                   uncharacterized enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58822"
FT                   /db_xref="GOA:A5D4K2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4K2"
FT                   /protein_id="BAF58822.1"
FT                   /translation="MSFYEVRKEYAGFDFKGFFAGVTVDRVKRALSKSRLTEWDYLALL
FT                   SPAAEECLEEMARKAHRLTVQHFGRVILLYTPLYLANYCVNRCVYCGFKANNRLERKKL
FT                   TPAEVEREAGIIAATGLKHILILTGESRRHSPVSYIRECVKILKKYFTSISIEIYPLEE
FT                   SEYAELIAAGVDGLTIYQEVYDEEVYAELHPAGPKRNYRYRLEAPERACRAGMRTVNVG
FT                   ALLGLHDWRTEAFFTGLHASYLQDTFPDVEVSISPPRMRPQLGGFQPRVKVNDKDLVQY
FT                   MLAFRLYMPRGGITISTRERAELRDHLVRLGATKMSAGSCTAVGGRSGHESTGQFEISD
FT                   GRSVAEMARMLYDQGYQPVYKDWQMI"
FT   CDS_pept        632443..633075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0642"
FT                   /product="predicted dinucleotide-utilizing enzyme"
FT                   /note="ThiF/HesA family"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58823"
FT                   /db_xref="GOA:A5D4K3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4K3"
FT                   /protein_id="BAF58823.1"
FT                   /translation="MNAFETALAGILGKEKLAAIQRLKVGIAGAGGLGSNCAAFLVRSG
FT                   FKRFRIVDFDVVESGNLNRQFYFAAQVGKSKVAALKENLLLINPGLEIEALPEKIDEGN
FT                   VTALFSCCDVVVEALDRAEYKRMLVEACLGTGKLLVAASGLAGWGRSDGIKIHRVKENF
FT                   YLVGDLVSEAGPGCPAMAPGVSVAAAKQADVILAYFLENLAGRDCCG"
FT   CDS_pept        633068..633724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiE"
FT                   /locus_tag="PTH_0643"
FT                   /product="thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58824"
FT                   /db_xref="GOA:A5D4K4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D4K4"
FT                   /protein_id="BAF58824.1"
FT                   /translation="MVRRRGLSGLLEADIYGITAWEYSLGRSNIEVVAQMIEAGIKVIQ
FT                   YREKERPARQKYEECLKIREMTREAGVTFIVNDHVDLALLVDADGVHLGQDDLPADRVR
FT                   ELVGDKMIIGLSTHSPAQARAAEKMGVDYIGVGPIFATKTKKDVCDPVGLEYLEFVVKN
FT                   ISLPFVAIGGIKEHNIAEVSSRGAKCIALVTEIVGAEDIKAKVRALRAIISRKED"
FT   CDS_pept        633727..635025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ThiC"
FT                   /locus_tag="PTH_0644"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58825"
FT                   /db_xref="GOA:A5D4K5"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D4K5"
FT                   /protein_id="BAF58825.1"
FT                   /translation="MNYATQMEAARKGIITREMETVARKEMVDPAKLRELIAEGRVVIP
FT                   ANKNHASLDPCGIGQGLRTKINVNLGVSRDCCNIGMELEKARLAIELKADAIMDLSCYG
FT                   RTEEFRRRLIEMSPAAVGTVPVYDAVGFYGKELKEISAEEFLGVVEKHAQDGVDFMTIH
FT                   AGINRETAARFKKNPRLTNIVSRGGSLLFAWMELNGRENPFYEYFDELLEICRKYDVTI
FT                   SLGDACRPGSVKDATDASQIQELIVLGELTKRAWEKDVQVMIEGPGHMPLNEIIPNMLL
FT                   EKKLCHGAPFYVLGPLVTDVAPGYDHITSAIGGAIAAASGADFLCYVTPAEHLRLPTLE
FT                   DMKEGIIASRIAAHAADIAKGVPGARQWDDKMSEARRNLDWQKMFELALDPEKARRYRA
FT                   ESQPESEDTCTMCGKMCAVRNMNRVLSGAGPDG"
FT   CDS_pept        635266..635712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0645"
FT                   /product="conserved protein"
FT                   /note="domain typically associated with flavoprotein
FT                   oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58826"
FT                   /db_xref="GOA:A5D4K6"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4K6"
FT                   /protein_id="BAF58826.1"
FT                   /translation="MCSEPPTVYVSVRPVGRYSYRQLKESGEFVINIPSADLARVVDYC
FT                   GNVSGGEVDKFKETGLTPVPAAHVRAPLIAECPVNVECRVKQVIPLGSHDAFIADVLAV
FT                   HFNEDVLDERGRPDLDKIKPYGYCINEYRLVSGKLGFYGYSRKE"
FT   CDS_pept        635600..636298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0646"
FT                   /product="predicted phosphatase homologous"
FT                   /note="the C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58827"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4K7"
FT                   /protein_id="BAF58827.1"
FT                   /translation="MKGAGPTWIKSSLTATASTNTGLYPESWAFTGIRGKSELEKEGCF
FT                   VEARLGNTVIKIIKGDITLQDTEAIVNAANSSLMGGGGVDGAIHRAGGPQILQECKEIR
FT                   ARQGMLPTGQAVITGGGRLKARYVIHTVGPVWSGGSKGEDGLLRSAYHNSLSLAREKGI
FT                   RSISFPSISTGVYRFPVDRAARIALRTVRDFVTANPGIDEVRFVLFTDQILREFEAAWA
FT                   EINAGPACTG"
FT   CDS_pept        636426..636776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArsR"
FT                   /locus_tag="PTH_0647"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58828"
FT                   /db_xref="GOA:A5D4K8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4K8"
FT                   /protein_id="BAF58828.1"
FT                   /translation="MEEAIDLLEERAELLKALAHPSRLAILETLKEGERCVCEIIDRVV
FT                   LEQSNTSQHLNVLKKSGILGSRKEGARVIYWVTNPEIYKLLDILDAVIMDKAEKSSRLL
FT                   VQSRSTGGTGSV"
FT   CDS_pept        complement(636779..637951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0648"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58829"
FT                   /db_xref="GOA:A5D4K9"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4K9"
FT                   /protein_id="BAF58829.1"
FT                   /translation="MKERDKFFILLGIFLIAFYLPLQNPRVQSAILEAFYMLQDYAQKH
FT                   VLTCLVPAFFIAGAIAVFVSQASVLKYFGAGANKILSYSVASVSGTVLAVCSCTVLPLF
FT                   AGIYKRGAGIGPAVAFLYSGPAINVLAIILTARVLGFELGVARAVGAVFFSIIIGLLMH
FT                   LFFLKEEREKKAAALSLPPPPEDRRALWQYAVYFATMVLILIFAAWGKPPQPVGFFNAV
FT                   YQVHWYLTLFFLAVLAVILIIWFNKEEMAAWVESTWNFAKQIFPLLLGGVLAAGFLMGR
FT                   PDADAGIIPAKHISALVGGNSFSANLIAAVAGAFMYFATLTEVPILQGLLGSGMGRGPA
FT                   LALLLAGPALSLPSMIVIGKILGTKKTLVFISLVIILSTFAGMIFGAIQG"
FT   CDS_pept        complement(638011..638256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58830"
FT                   /db_xref="InterPro:IPR014958"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L0"
FT                   /protein_id="BAF58830.1"
FT                   /translation="MYCLAGVGGHIESFIESSKGNRLVVIDGCPVSCVKKIFEHAELPV
FT                   DVHIVVTGLGIKKEGSFQLHEEDIAKVCNEIKRQLK"
FT   CDS_pept        complement(638406..638645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58831"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L1"
FT                   /protein_id="BAF58831.1"
FT                   /translation="MEIKILGPGCPKCKALYKAVTETVEEMGVSADVKKVEKLDEIIEA
FT                   GVMLTPGLIINGKVKVTGKVPGKEDIKKYIQQEI"
FT   CDS_pept        639102..639464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ArsR"
FT                   /locus_tag="PTH_0651"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58832"
FT                   /db_xref="GOA:A5D4L2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L2"
FT                   /protein_id="BAF58832.1"
FT                   /translation="MTDVLKALSDPHRQSILKMLAHQEMGACEIIHSIGLSQPAVSHHL
FT                   KILRQARLITSQKQGKMVFYSLNKSGLKNFFNQINCFLHELSCFNDAMPRPSQLRQNPD
FT                   LCESLGFKAEVCEKEV"
FT   CDS_pept        639506..640576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ACR3"
FT                   /locus_tag="PTH_0652"
FT                   /product="arsenite efflux pump ACR3 and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58833"
FT                   /db_xref="GOA:A5D4L3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L3"
FT                   /protein_id="BAF58833.1"
FT                   /translation="MPESTSAKLSLLDRFLTLWIFLAMFLGVGLGYAVPEVANLLNRFQ
FT                   VGTTSIPIAIGLIVMMYPPLAKVKYEEIGKVFKNGRVLSLSLVQNWIIGPILMFFLAII
FT                   FLQKYPEYMAGLIIIGLARCIAMVIVWNSLAKGDSEYAAALVALNSIFQVLFFSVYAYF
FT                   FVTLAPQWLGIKSMEVHVSMAEVAKSVAIYLGIPFAGGVITRFSLIPAMGRDWYEKKFI
FT                   PKISPLALIALLFTIVVMFSLKGNYIINLPLDVVRIAVPLLAYFIIMFFISFFLSKQLG
FT                   VNYEQSATLAFTAASNNFELAIAVAVAVFGINSGQAFAAVIGPLIEVPVMIGLVNVALA
FT                   LKQKYFASPPLGAGNI"
FT   CDS_pept        641064..642011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GloB"
FT                   /locus_tag="PTH_0653"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58834"
FT                   /db_xref="GOA:A5D4L4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L4"
FT                   /protein_id="BAF58834.1"
FT                   /translation="MSAKVCDLGNGIYMVDVFDQEPERTSCYIVAAEKPAVIETGATPG
FT                   IGHLKASLRELGIPPEKVEYIIVTHIHLDHSGGAGALARDLPNARVFAHPRGAKHLIDP
FT                   SRLAAGARSIYGERFDTLFGEIVPVPAERVHTPEDGETLDLGGGRVLTFYHTPGHARHH
FT                   FVVYDPASRGIFGGDAAGIRFYALSRLAGYDFTLPSTPPSEFDPQATIETLDRLKDLDL
FT                   ENIYFTHYGKAAGASAILERNRKLTGVFEATGRQVLESGGGVKEIEEALWDLVMKELEQ
FT                   NGVAAGREHPAVKFLALDMELNAAGIAQYLERKK"
FT   CDS_pept        642217..643554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0654"
FT                   /product="hypothetical regulator protein"
FT                   /note="containing LytS (COG3275), putative regulator of
FT                   cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58835"
FT                   /db_xref="GOA:A5D4L5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4L5"
FT                   /protein_id="BAF58835.1"
FT                   /translation="MRNLYDIAVGIAFRWAAVQLAAVAVVLLLVPVLWGGIALMVLASA
FT                   LSTYMVVDYIQKHKGVKVKLDDHPIDPTLQIANETLPFMRRGLNEETAQKIAEIILKIS
FT                   DVSAVAITDREKVLAYIGEGSDHHKAGGPIITYATKQALETGELIIIKDKKGLNCPEKN
FT                   CSLQAAVIAPLKCKGEVAGTVKLYQTSQGDLQPAVVKLTVAVAQLLGLQMELAELDRQA
FT                   QLVTKAELEALHAQINPHFLFNTLNTIITYSRTHPETARRLLIRLAAFFRQALKRHGHF
FT                   NTLREEIEYVNTYLILEKARFREKLRIHREIDPALLDYHVPVLTLQPIIENAIKHGIQP
FT                   KMGTGTVQIIARLFNGEMLFIIKDDGVGINRDKMPKIFLPWFGSGNGVGLSNVHERLKS
FT                   LFGEDYGLRIVSEEGKGTSVYIRVPLNANTTERGGQAGETQSAYCG"
FT   CDS_pept        643526..644323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="LytT"
FT                   /locus_tag="PTH_0655"
FT                   /product="response regulator"
FT                   /note="LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58836"
FT                   /db_xref="GOA:A5D4H6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H6"
FT                   /protein_id="BAF58836.1"
FT                   /translation="MKLKALIVDDEYPARQELRYALSGFGNVEIVGEATNAQEAMALIR
FT                   ALDYQVLFLDISMPGMNGLDLGAAIQELPRRPYIIFVTAYDEYAVSAFEVNAVDYILKP
FT                   VEPKRLKKALDKVIKLTQEGAPAAKVLITGQEGPAVRIGDANGQAPQSQIKIDRIPAEK
FT                   QGKTILVTGSDIFYAFTEKDYVYLKTYSDKLFTRFTLKELEARLNPQVFFRTHRCYLVN
FT                   LHKVREIVPFFNGTYNLIVEDKERSEVPVSRAQAKKLRKILGF"
FT   CDS_pept        644512..644973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AcpS"
FT                   /locus_tag="PTH_0656"
FT                   /product="phosphopantetheinyl transferase"
FT                   /note="holo-ACP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58837"
FT                   /db_xref="GOA:A5D4H7"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H7"
FT                   /protein_id="BAF58837.1"
FT                   /translation="MPAKKCNNRSFCQGVGGVSQLWPSGAGLAGIGADIIEIERIRRAA
FT                   ERSNCRFLERVFTTAERDYCDAKRDRYACYAARFAAKEAVLKAMGRGLSGCRWSDVEIR
FT                   RADEGRPEVHLHGRAAEMAKERGIGQVLVSLSHDKRRALAFAVAVREEA"
FT   CDS_pept        644977..646560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0657"
FT                   /product="predicted Carbohydrate kinase"
FT                   /note="containing predicted sugar kinase (COG0063) and
FT                   uncharacterized conserved protein (COG0062) domains"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58838"
FT                   /db_xref="GOA:A5D4H8"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H8"
FT                   /protein_id="BAF58838.1"
FT                   /translation="MRVVTAGEMKALDKAAIEEYGISGLVLMENAGRQVAEVVRQVLGE
FT                   VRGRVITVFIGKGNNGGDGLVAARHLLNMGAEVKVMALADTAEITGDALVNLEIWQKMG
FT                   QRVYSLRHGDGINIVRLALMNTDLIVDAIYGTGFKGRVAEKAGRIIEVLNGSGKPVVAV
FT                   DIPSGLEADTGRVNGPCLRAAHTVTFGLPKLGLLLEPGAGYAGRLHVADISIPAGLVSK
FT                   AAPRRYVITAGLVREWLPSRPLESHKGDYGRVLVVAGSRGMTGAACLAGEAALRAGAGL
FT                   VTVAVPETLHDIMEVKLTEVMTAPLPDTGGGALSREAGQRILAMLERADVLAIGPGLST
FT                   SSEVAAVVRELLPQVKVPCVIDADGLNVLAGAGDILRKIQAPAVITPHPGEMARLLGTT
FT                   VQEVQRDRLAAALKASAAWNVTVLLKGARTIVASPDGAVYINPTGNPGMATGGSGDVLT
FT                   GTVAALVAQGLEPEKAAAAGAYMHGLAGDLAAAEKGMMSLVAGDILAALPASAKKVMSE
FT                   KCADFNIVMR"
FT   CDS_pept        646566..647735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Ald"
FT                   /locus_tag="PTH_0658"
FT                   /product="alanine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58839"
FT                   /db_xref="GOA:A5D4H9"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H9"
FT                   /protein_id="BAF58839.1"
FT                   /translation="MIIGVPKEIKPYEDRVAVTPAGVLALTAEGHKVLIEAGAGLGSGI
FT                   TDEAYAAAGAVLVDGPAEVFGHADIIMKVKEPLPQEYNLLREDQILFAYLHLASEPELT
FT                   EVLLEKKVVAVAYETIQLDNGVLPLLTPMSEIAGRMAVQVGAHYLEKPYGGKGILLGGV
FT                   PGVPPADVVIIGAGTVGTSAARVAMGMGAQVTIIDKNLDRLRYLDELYGGRIKTLASNQ
FT                   FNIEMSVRYADLLIGAVLVVGAKAPKLVTVEMVKQMKQGSVIVDVAVDQGGSIETVDRV
FT                   TVHSDPVYEKYGVIHYAVDNMPGAVARTSTFALTNATLPYALELANRGCPRAFTNRALA
FT                   RGVNTYKGKLTCRAVGESLNMECHDLGDVLRSDAALNFRQKLQKRREDE"
FT   CDS_pept        647735..648034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58840"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4I0"
FT                   /protein_id="BAF58840.1"
FT                   /translation="MSAAENLLDDARYLLKKVAFLDGQDLKSLCRDLDLPVMNMAAGDM
FT                   IDQISKKVLAAAEAYSKMPDGESKKILSTFRYNMLVKSRFLERYLDRVKRSVAV"
FT   CDS_pept        648468..649592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Alr"
FT                   /locus_tag="PTH_0660"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58841"
FT                   /db_xref="GOA:A5D4I1"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5D4I1"
FT                   /protein_id="BAF58841.1"
FT                   /translation="MSIFPVWAEINLRAIAHNIREIRRVTEPGAKVMAVVKANAYGHGA
FT                   EEVSQTALAGGAEWLGVARVAEGVSLRQAGIEAPVLVLGYTTPEQAADVIRHNLSQTVY
FT                   TRNAALFLAEAAAREGKRARVHFKVDTGMGRIGWLAGPGAVREILELARLPQLEVEGIF
FT                   THFAAADAADKRYTLEQFQKFIEMIDELQKNGLEFPLRHAANSAAIMELPGTHLDMVRA
FT                   GIILYGLYPSDEVDRRRIDLRPAMSLKARVAHVKEVPAGFKVSYGCTYTTGRPGVIATL
FT                   PLGYADGYSRLLSSKGEALIHGRRAPVVGRVCMDQVMVDVSGIPGVKAGDEAVLIGRQG
FT                   GETISADEVAAKLGTINYEVTCMVSGRVPRVYIR"
FT   CDS_pept        649630..650499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0661"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58842"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4I2"
FT                   /protein_id="BAF58842.1"
FT                   /translation="MQSFVECVYCYLKQAVTCMSIAGTDEDRQHRILFELMDEIKALDR
FT                   SRTPAENSTEVLLKLYKLLGNEDPYREVKRKSNLLALEWYPLLKDMLKRSEDRLYDALR
FT                   ISVAGNVIDLGINKSFDLGASLKHSLGAGFARDDYALFAEKLAGEDEVILVGDNAGEIV
FT                   FDRLLAEELAARGKKVTCIVKGGPILNDATMEDAVQAGMDKVARVVTTGSNFLGVPLER
FT                   VSGEVRKMLAGAGLVISKGQANFESLEHERGTAGRVFFLLKIKCECVARVAGANFGDVV
FT                   FFTRQGGV"
FT   CDS_pept        650503..651024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NfnB"
FT                   /locus_tag="PTH_0662"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58843"
FT                   /db_xref="GOA:A5D4I3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4I3"
FT                   /protein_id="BAF58843.1"
FT                   /translation="MSGDFLELCKRRQSVRRFTAEPVPDEALQQILEAARAAPSAGNLQ
FT                   AYEIVVVKDPQTRQKLAAASRGQGFVAQAPVVLVFLALPQASARVYGERGARLYSVQDA
FT                   TIACTCAMLAATSLGLATTWVGAFYDNEVMAAVGAGPHQVPVALLPVGHAGENPRRTSR
FT                   RPLQNMIRVI"
FT   CDS_pept        651054..651170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0663"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58844"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4I4"
FT                   /protein_id="BAF58844.1"
FT                   /translation="MLGQMEAKKILWKIGLFRDFLAGAAVCLLKICGESNLP"
FT   CDS_pept        651504..652922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AmtB"
FT                   /locus_tag="PTH_0664"
FT                   /product="ammonia permease"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58845"
FT                   /db_xref="GOA:A5D4I5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4I5"
FT                   /protein_id="BAF58845.1"
FT                   /translation="MKNRLLRTASLAAVFLMTVPALAWAEEAAEAVAGAAPVDTGDTAW
FT                   VLASTALVMLMTLPGLALFYGGLSRKKNVLSTIMYSFFAMVIISIQWALYGYSLSFGPD
FT                   LGHFIGSLAWLGLNNVGAAPNPDYSATIPHQVFMIFQMMFAVITPALISGAFAERMRFP
FT                   AFLAFLILWATFVYDPVAHWVWGVGGWLRNLGALDFAGGTVVHILSGVSGLVACLVLGR
FT                   RKGYGSEPMIPHNLPFVVVGAALLWFGWFGFNAGSALGANGLAAGAFVVTHLATAAAAL
FT                   SWVAAEWLHHGKPTTLGAASGAVAGLVAVTPASGFVEPMPALIIGLVAGALCYLAVGVL
FT                   KARLRYDDALDAFGVHGIGGTWGAIATGLFATTAVNPAGADGLFYGNPGLLANQLIAVA
FT                   ASWAAALAGTFIILKIVGAFTRLRATDEEQDTGLDLTQHGEDAYTDFVLSASPFSSAGA
FT                   MTAKAPAGEARPAL"
FT   CDS_pept        653047..653385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GlnK"
FT                   /locus_tag="PTH_0665"
FT                   /product="nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58846"
FT                   /db_xref="GOA:A5D4I6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4I6"
FT                   /protein_id="BAF58846.1"
FT                   /translation="MTKIECILRPGKLEDVKEAINRYGIHGMTVTQVMGCGLQKGRTEV
FT                   YRGTEYSINLLPKVKIEMVVPDKDVDSIVALIIEAARTGEIGDGKIFTCRIDNAIRIRT
FT                   GEKGEAAI"
FT   CDS_pept        653519..654751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0666"
FT                   /product="hypothetical signaling protein"
FT                   /note="containing Rtn (COG2200), FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58847"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4I7"
FT                   /protein_id="BAF58847.1"
FT                   /translation="MRLVAGENCCLARIIGQDTLFIHFQPIMSVKKKTVFGLEALCRCV
FT                   DPAGGKIPPGILFELARAEDMALVLDRLCRRKTLENYSKKCSKNPDLFLFLNMDVSIID
FT                   KGVVGSGNLLNTVRMFGLNPNSIVIEIVESRVKDLAALKCFVERHKHYGFLIALDDVGS
FT                   GNSNLDRIPLVKPDILKIDRSLVSEIDKKYYKQEVFRSLVNLSRKIGALVVAEGVEREE
FT                   EAIMVLELGADLLQGYYFAEPRPLTGNPAEMGIEKINYLACKFKSYMAGKINTIVFQHR
FT                   QYETILNEIMARISGKSFRDFDYYLQQMIADYPGLECAYVLDEYGIQVTDTHCNPFSLP
FT                   EPGRAFYKPAEKGADHSFKDYYYLLVHTCLNKFTTEPYVSMASGNLCITVSSSFTDDKD
FT                   DRYILCVDFKQ"
FT   CDS_pept        654919..656307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Tar"
FT                   /locus_tag="PTH_0667"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58848"
FT                   /db_xref="GOA:A5D4I8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4I8"
FT                   /protein_id="BAF58848.1"
FT                   /translation="MLLARKQYRRCLERLSWATARVAAGNVTGVPGESFYPGEYRDLIR
FT                   ELNNVSMLMRSIAENSQATAGQVAAAAEQVDMIVGHARQAVMDFDRIKELAGSLAAVTG
FT                   KLKRKTVENEQAVAECRRGMNAARQAMDRINADSEQIAGLISRLDAAVGRVDTILTVIG
FT                   EISDRTRLLALNAAIEAARAGEHGKGFAVVAREVKKLSDSTSAAVNETGDILRAVRAEA
FT                   RKVAGTVLLSKQNIKSGMDQLVSADEGLVKISRAVASVSSAVEESGREIEDYLLQVDAN
FT                   VGAQKKNLEEITAVLDLLKRAAKTLDEVGKKVKISVFGAGGRAGLGSLADRLMELLKSV
FT                   AQRPGFVSLIEEEHRHVLTGLLQQVKELEAVYSNRADGTFIFSEPPAGLVNARAREWWQ
FT                   RAMAGDNYISDVYVSAITRKPCLTLSVPIRGEDGSVRGVLGADVRLDTIENKNSSDESY
FT                   NPRF"
FT   CDS_pept        657240..658832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0668"
FT                   /product="iron only hydrogenase large subunit, C-terminal
FT                   domain"
FT                   /note="containig ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58849"
FT                   /db_xref="GOA:A5D4I9"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4I9"
FT                   /protein_id="BAF58849.1"
FT                   /translation="MEDSKRGIEQENINQEKKEMTRRSFLKMIAGTGLLVGLSGALAGC
FT                   VEKSPEHAGGKGWLPYQYNVAGNLPAQVRGRVPIDADNPSITRDDQKCILCGQCLEVCK
FT                   NVESVYGYYDLPVVDETICINCGQCSMACPSGAISERDDTKKVFEALADKDKFVLVQTA
FT                   PATRVALGEEFGLPPGTWVQGQQVAALRRLGFNAVLDTNFAADLTIMEEATELIKRIKG
FT                   EVKKPLPQFTSCSPGWIKFCEYFYPELIPNISSCKSPQQMFGALAKTYYARARGIDPEN
FT                   IVSVSVMPCTAKKFEAQRPEMNASAKYWKRGNLRDVDVVLTTRELARMLKEKQIDLTAL
FT                   PEENYDKLMGEETGGAVIFGATGGVMEAAARTAYFLITGQEPPALFLNLTPVRGLAGVK
FT                   EAAAEIPGVGTLRVAVSHGMANGRKILNAVREGKAPWHFVEFMTCPGGCIAGGGQPRTA
FT                   VPPSDTVREQRLAALYKADASLSKRKSYENEEVAALYRDFLGHPMSELAEELLHTEYHS
FT                   RADRLKRILAQAV"
FT   CDS_pept        658898..659713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="HybA"
FT                   /locus_tag="PTH_0669"
FT                   /product="Fe-S-cluster-containing hydrogenase components 1"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58850"
FT                   /db_xref="GOA:A5D4J0"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J0"
FT                   /protein_id="BAF58850.1"
FT                   /translation="MASTKGVLVDITRCIGCESCVVACRLYNGLEPGQKNRGKTKQNGN
FT                   TELAPDKWTAVQGYRVDKDGNKVRRFVKKQCLHCLEPACASACFARALQKTPEGPVVYN
FT                   EKLCVGCRYCMIACPFGILRFEWDKPFPRVLKCQMCLARVADNQMPACASVCPTGAVTF
FT                   GERDKIVEEAKKRQASNPNLYVSQIYGLKEAGGTSWLYLSDVAFDKLGFRTDVPEKPIP
FT                   EYTWQVLRWTPHIFIGWGALLTGMYLYTKRRAAVHAEEEMYAPVDVDEK"
FT   CDS_pept        659716..659985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58851"
FT                   /db_xref="GOA:A5D4J1"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J1"
FT                   /protein_id="BAF58851.1"
FT                   /translation="MGVLTASLLVVAGVIFNRMNVVFTGMAKSAGGYYFPTVWEFLITI
FT                   GMWSALILIYCFIAENFPILPKEERKATYAYSSGKRADFITADP"
FT   CDS_pept        660352..660891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="RpoE"
FT                   /locus_tag="PTH_0671"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /note="sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58852"
FT                   /db_xref="GOA:A5D4J2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J2"
FT                   /protein_id="BAF58852.1"
FT                   /translation="MDENLIRKAQSGDNDAFAQLVQKHSADAYRTAFMVLRNRSEAEDV
FT                   VQEAFLTCYSKLHSFRMESSFKTWLYRIVANLCYDRLRRQNRESMAYSRLSLSINMRAG
FT                   NDDMAEIEKRLDLKEVVSSLRPEHRLVLALYYGMDFGVQQVARMLGIPAGTVKSRLSTA
FT                   RSLIKERLERGREYAL"
FT   CDS_pept        660881..661951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0672"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58853"
FT                   /db_xref="GOA:A5D4J3"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J3"
FT                   /protein_id="BAF58853.1"
FT                   /translation="MHCETVKRLMNDLLDQTLPAAREREIEAHMAVCEGCRSEFQKLGA
FT                   ADELLKKVICEMMTEIEVPPGLSRRIEKVLAEAKHRGPAWMRLAALLKAPAVAAALLLA
FT                   VAAAGFLGWQKPFSTAVKQPEVALNGPVAAENQSEVVTRDADRTAAPEEVPAADKLEVL
FT                   QKYDSGAVQDGAGGGNSAEPEEKQELRDAGEVPAGVSREPGGQLRQNKIFSGASVETLN
FT                   SGAPLLKKGTLEEAAAGAGFYPVKPAYLPEGARFLEAAWVPGAVYQNYRAGQLAFTVSQ
FT                   SRANGIKPGEGSRAGPGVAVEINGVPAVLQETGPEPGDGASRVRTVLRWVSGEWAFSVE
FT                   GELPKEEIIKIAESLR"
FT   CDS_pept        662098..663945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AsnB"
FT                   /locus_tag="PTH_0673"
FT                   /product="asparagine synthase"
FT                   /note="glutamine-hydrolyzing"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58854"
FT                   /db_xref="GOA:A5D4J4"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J4"
FT                   /protein_id="BAF58854.1"
FT                   /translation="MCGITGWINWEADLTRQGHILEKMVETLSRRGPDAAGVWLSPRAA
FT                   VGHRRLIVVDPEGGSQPMTRRLGERACTITYNGELYNAPELRRELESRGHRFYTRNSDT
FT                   EALLLAYMEWGTACVERLNGIFAFAVWDEAGQSLFLARDRLGVKPLFYAVRGSSFLFGS
FT                   ELKALLAHPAVKPEVDEEGLAEVFAVGPSRTPGHAVYRGIAELRPGCCLVFARNGLRLR
FT                   RYWALESHPHPDDFETTVATVRELFMDAVERQLVSDVPVCTFLSGGLDSSAIAAVAAGA
FT                   FRRKGLGKLRTYSVDYTGNDRFFRPDYFQPNSDAWWTGRVADCLGTSHHVVEIDTPELI
FT                   EALVPALLANDLPGMADIDSSLYLFCREIKKGATVALSGESADEVFGGYPWFYDEEALA
FT                   AGTFPWIRKLRERVQFLSPELAGRIKPEEYVAERYQEALAEVPRLPGETPFEARLREMF
FT                   YLNITRFMQMLLDRKDRMSMAAGLEVRVPFCDHRLVEYVWNIPWEMKSCDGMAKGILRR
FT                   ALSGILPEEVLRRRKSPYPKTHNPAYLAAVRSLVLRLLDDPGSPLLPLINVEAVREAAL
FT                   SGSALFDRPWFSQLMGDAQFFAYLIQVDAWLRNYGVTIR"
FT   CDS_pept        complement(664047..665003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0674"
FT                   /product="Periplasmic molybdate-binding protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58855"
FT                   /db_xref="GOA:A5D4J5"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J5"
FT                   /protein_id="BAF58855.1"
FT                   /translation="MKNETSLTPEEVAGILKIAKNTVYELIKRGELPAYRIGRKIRIDL
FT                   QDVENYKKQGKKTEHLPETTPAGRITAGTKPSIEGQTAFSGLVICGQDVLLDILTRHLE
FT                   RHPNGTRAFRHYVGSFSGLLALYQEKADMSAVHLWDGDTGVYNIPYVRRLLPGIPAVII
FT                   HLACRMQGFYALKGNPKGIKQWQDLTRPDISFINREKGCGTRVLLDEKLRVLGIDRRQI
FT                   NGYKREENSHLAIASAVARGEADTGLGIEKAALQVRGIEFVPLHKERYELVIKKEDLEK
FT                   PHFQAVIEILQSEEFKRELQGLGDYDLTETGKIVAEV"
FT   CDS_pept        665262..666050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ModA"
FT                   /locus_tag="PTH_0675"
FT                   /product="ABC-type molybdate transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58856"
FT                   /db_xref="GOA:A5D4J6"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J6"
FT                   /protein_id="BAF58856.1"
FT                   /translation="MKKYLFLLIILLLTAAAAAGCGTGKEQPKAAAEPVNLTVSAAASL
FT                   QDALEELKTVYAGQNPGVTVTYNFAASGTLQKQIEEGAPVDLFISAGKSQMDALSEKGL
FT                   ILNDSRKDLLGNELVLIARKDSELTGFEDLAGPDVARISIGTPETVPAGQYAREALSKL
FT                   KLWDKLQPKFVLAKDVRQVLTYVETGNVDAGLVYRSDALAGKEIKVVAAAPADSHAPIV
FT                   YPMAIIKSTKHQKEAEAFASFLSGAEAMQVFTKYGFKTLR"
FT   CDS_pept        666083..666760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ModC"
FT                   /locus_tag="PTH_0676"
FT                   /product="ABC-type molybdate transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58857"
FT                   /db_xref="GOA:A5D4J7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4J7"
FT                   /protein_id="BAF58857.1"
FT                   /translation="MTIQPSDWHPVLLSLRVAVIALFAVTCLGVPLSRLLARRDFFGKD
FT                   VLEAIITLPLVLPPSVIGYGLLMLIGKNGLLGKTLAGMGLTLVFTWWAAVLASTVVAFP
FT                   LMYQSAKAAFKSVDTNLEKAARTLGAGEIRIFFTITLPLAWPGIIAGLVLSFTRALGEF
FT                   GATLMVAGNIPGQTQTIPLAIYFAVEAGDTVTARVLVAIITVFSFVVIFWVNRWARRQD
FT                   YQR"
FT   CDS_pept        666770..667483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ModC"
FT                   /locus_tag="PTH_0677"
FT                   /product="ABC-type molybdate transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0677"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58858"
FT                   /db_xref="GOA:A5D4G0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G0"
FT                   /protein_id="BAF58858.1"
FT                   /translation="MLEAQFTKKLWHFNLDVQLKVKNQILVLWGPSGSGKTTVLNCLAG
FT                   IMKPSSGYIRLDDQMLFSSGEKIDVPTRFRNVGYLFQDYALFPHMTVRQNVLYGIRCKK
FT                   KHGQEAFPNFMELLSFFGVGHLIDRYPCQLSGGEKQRVALARALVMRPRLLLLDEPFSA
FT                   LDKNTRINLRCELKKLHQRWQIPFILVSHDEEDAKFLGDIILVLEKGKTREASLKALSL
FT                   QDVAPAQSSSMLRKV"
FT   CDS_pept        667934..669571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AtoC"
FT                   /locus_tag="PTH_0678"
FT                   /product="response regulator"
FT                   /note="containing CheY-like receiver, AAA-type ATPase and
FT                   DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58859"
FT                   /db_xref="GOA:A5D4G1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G1"
FT                   /protein_id="BAF58859.1"
FT                   /translation="MSGVNVLIVDDEEDIGTLVSRLLKKKGYEVKIALNGMEAEGFIRE
FT                   TPVDVALVDLNLPDTDGFTLLRKIKKVNPRCEVILMTGNGTPGTAEKAVRSGAFNYLGK
FT                   PFRDISEVETMVERAASYGKKFLQSQPSGAEWAPIAERLGFQVGRSAVMCSLVDIAYKI
FT                   AKKDINVLIQGETGTGKEMLAKFIHAASNRSHEIFIPVNCGALPKDLVETELFGHEKGA
FT                   FTGAVSMRRGLFEMASGGTLFLDEIGEVSPAIQVKLLRVLETGEFLRVGGEKYVKTDVR
FT                   LIAATNVDLRLALQNKTFREDLFYRLEGVRLEIPPLRERREDIPLLAEYFVRKANPGLL
FT                   ISSRAVELLCNYSWPGNVRELSNIIRQAVALCDGNIILPEHLSAKIAARNSVQVKTRDT
FT                   NDHSETGKKGAYGSGSREGSAGAGFYEKSLPTLLERYFAAAALEGASSEELMDILERVR
FT                   RLEKRVLHVMREKGLNSAMPPSLAEAEVRAITEALDYHQGIIVNAARSLGIGRNTLSRK
FT                   IKQYGIKIEKRKYGCSAGPLCFKKHKYP"
FT   CDS_pept        670107..672878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0679"
FT                   /product="aerobic-type carbon monoxide dehydrogenase"
FT                   /note="containing COG1229 CoxL and COG2080 CoxS"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58860"
FT                   /db_xref="GOA:A5D4G2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G2"
FT                   /protein_id="BAF58860.1"
FT                   /translation="MMQKKFLNINGVAHTLIVDPEASLADVLRGQLRLTGTKIGCGKAQ
FT                   CGACSVIMNGKVIMSCATKMKRVPDEAIITTIEGIGTPTNLHALQMAWVKHGAAQCGFC
FT                   APGFIVSAKVLLDQNPNPTREEVRDWFQKHRNVCRCTGYKPIVDAVMDAARLMRGEITP
FT                   EALGFKMPADGKIWGTDYPRPSAIGKATGTINYGSDLGLKMPPGTLQLKLVQAQVSHAR
FT                   ILSIDTSEAEKMPGVYKVVTHKDVKGKNRITGLITFPTNKGDGWDRPILCDEKVFQFGD
FT                   AIAIVCADTEANAQAAVEKVKVELEVLPPYMSAPAAMAPDAIEIHPGTPNVYFRQNIAK
FT                   GEDTGPIMEKADYVVAIEDYYVGRQPHLPIEPDVAAAYFDEQGRLVIMSKSIGLDLHHA
FT                   MIAPGLGIEPEKLILAQFPAVGGTFGYKFSPTIEALVGAAAMATGKPVFLNFNYFQQIT
FT                   YTGKRSPFFIDLKYGANKDGKIIAMESNWAVDHGPYSEFGDLLTLRGAQFIGAGYGIPN
FT                   IRGAGYTVCTNHAWGSAFRAYGSPQSFFASESLMDILAEKMGIDPLELRYRNVYRPGDT
FT                   SPTGQPPEVYTLPQMIDILRPKYKAALEEARRLSTPEKKRGVGVSIGIYGCGLDGPDSA
FT                   EVWVELLPDGRVQVSTNWQDHGQGADMGLLATSHESLRPMGIKPEQIKLVMNDMAVAPA
FT                   GGPAGGSRSQFVIGNAVKNGCEQLLNAMRKPDGTYRTYEEMVRENIPLKYVGKWTTPCT
FT                   PCDENAQGSPFASYMYGVFMAEVEVDTRTGKVQVLKMTLVADIGKIANKTVVDGQIYGG
FT                   LAQGIGLALTEDFEDLNKHTTMAACGIPYIKDVPDNLEVIYVDSPRELGPHGASGVGEL
FT                   PLTSPHAAIANAIYNACGVRITQLPALPEKILAGLQGKQIPVVRRPIKNPPF"
FT   CDS_pept        673052..675382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0680"
FT                   /product="hypothetical protein"
FT                   /note="containing GlpC (COG0247), Fe-S oxidoreductase and
FT                   partial GltD (COG0493), NADPH-dependent glutamate synthase
FT                   beta chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58861"
FT                   /db_xref="GOA:A5D4G3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G3"
FT                   /protein_id="BAF58861.1"
FT                   /translation="MDQKELRELEDRCIQECPPACVTACPVHVDVKLFLAEMKKGNFDG
FT                   ALKIFSRTVPFPGILGRICDHPCQDACRRREAGGAVSIGALEKACVQLSPALPVRVTPP
FT                   PKKKEKIAVVGGGLSGLTAAFDLAGKGYGVTIFEAEGRLGGKLWEIPEEVLPRQVIKEE
FT                   IGLLEKMGVEVRLNTTVGKDITLEDLGREFDAVYLGLGANPKDTLGLKLDQQGRIEVHP
FT                   VTLTTGHTGVFAGGGLRAGGFKPSPVGAVSDGRRAAVSIDRYLQKVSLTAAREKEGPYQ
FT                   TRLYTSLEGVEPLPAVAAGDPVRGYTREEAIREAGRCLQCQCLECVKACEYLARFGSYP
FT                   RRYVREVYNNESIVMGMHLANKLINSCSLCGLCQVICPNDFHMGEVCKKARESMVSRGK
FT                   MPPSVHDFALRDMQFSNGEKFALVRPDPGTAAGGSAFFPGCQLSASAPEYVEKVYAYLR
FT                   ERVPGGVGLVFRCCGAPADWAGRKDIFLQGREEILRLWKDMGEPRFILACSSCYQVFKT
FT                   FMPEIEIISLWEIYDRLGLPQALPEGSPRTVAVHDACSTRHEEHIHRSVRSILKRLGYS
FT                   VQELKYSGEKTGCCGYGGLMTFANPELAARVVDRRAGESGADYVAYCAMCRDRLAAGGK
FT                   RALHLLDLIYGDNYDRLACRKGPGYSQRHENRARLKRKMLKEVWGEEVEDKKGFETIEL
FT                   YIGDDIRELMENRLILVEDIQKVIDYAEKTGKKLFNEDSKHYLACYRPVSVTYWVEYSP
FT                   QGAGYKVYNAYSHRMQIIEEVKS"
FT   CDS_pept        675379..675591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58862"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G4"
FT                   /protein_id="BAF58862.1"
FT                   /translation="MSNPRGNTAKTAWQCFRCGLPLVLGKVTVTYMDNKFPVELFKCPG
FT                   CGLVLVPEEMATGKMAEVEKTLEDK"
FT   CDS_pept        675640..676389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58863"
FT                   /db_xref="GOA:A5D4G5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G5"
FT                   /protein_id="BAF58863.1"
FT                   /translation="MDKAPSAGAGERCRIYESGALHRVTGDFIRPGGIVLTDRALSFCS
FT                   FPPGARVLDVGCGAGATVEHLITVYNLNAVGVDPSPALLEQGRRRRPGLPLLEASGEDL
FT                   PFDDGVMDGVFAECTLSVMGSPDRALAEIWRVLKKRGLLVVTDVYARNPEGIAALRRLP
FT                   PAGCLTGAMSRDEITEKMSLHGFEILLWEDHSRLLAELAARLIMVNGSLDALWRNSACD
FT                   AAQCLEIGETVKRSRPGYFLLIAGKKG"
FT   CDS_pept        676396..676878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0683"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58864"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G6"
FT                   /protein_id="BAF58864.1"
FT                   /translation="MLAGKGHKAGMNDELFRMMELYQQGFNCSQILLLLGLENLGRSSP
FT                   DLIRAMTGLGGGLGFSGKICGALTGGVCLLGLYAGRGAPEEKEHDRFLLLIDELVQWFE
FT                   GEAGRLYGGINCADILGEELTYRAVTPKCGTLIGSTYNKVKEILVSNGINPAGEEK"
FT   CDS_pept        676875..678266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0684"
FT                   /product="predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58865"
FT                   /db_xref="GOA:A5D4G7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G7"
FT                   /protein_id="BAF58865.1"
FT                   /translation="MSEQAKVLSKTESLCPDCLRRIPAKRVARGNCVYLEKACPEHGMY
FT                   RTKIWQGEPSFQSWVRPKVPATVKVPFTGIDRGCPFDCGLCPAHRQLTCCVLLEVTGRC
FT                   NLKCPFCFAGAGNGDADPDLDTIRNWYRRLLDAGGPFNVQLSGGEPTLRDDLPELVALG
FT                   RSMGFSYIQLNTNGLRLSREPRYLESLKKAGLSSVFLQFDGTEQEIHRRMRGRDLLEEK
FT                   LEAVRLCGETGIGVVLVPTVVPGINDHNLGQIIKLALELMPAVRGVHFQPVSYFGRFPG
FT                   TPSDRARITLPEIISGIEAQTEGLIRAENFRPPGCENALCSFHGNFVLMPDGKLLATTR
FT                   HKPPENCCGRPETAEEGARRARNFVAAHWPAPESSKCGCSEDNKAADGLDLFLARARTH
FT                   TLCISGMAFQDVWNIDLERLKDCCIHTVAPDGRIIPFCAYNLTGKTGRPLYRGCESTWP
FT                   SGGRR"
FT   CDS_pept        678242..679585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PaaK"
FT                   /locus_tag="PTH_0685"
FT                   /product="coenzyme F390 synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58866"
FT                   /db_xref="GOA:A5D4G8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G8"
FT                   /protein_id="BAF58866.1"
FT                   /translation="MAIRRTPLESWFLKKAADAGGAEPLTRTLIESYQLQKLKETLALA
FT                   RAASPFYRRHLENFPAEQLRSLKDLQAFPFTTAGDISKNPLLFLCVSQDQINRVVTINS
FT                   SGTTGRPKRVFFTGGDQELIRDFFRYGMSTLVEPGDTVLVLLPGGRPGSVGALLAEALE
FT                   RSQVRCILHGFVRDPRETLQIMAGQKVDSLVGVPTQVLALARYEAPGKKSFPVRLKNML
FT                   LTTDHVPRAIVNEIERTWYCRVYNHYGMTEMGLGGGVECEARDGCHLREADLYFEIVDP
FT                   ATGEAVPEGEEGEVVFTTLTRQGMPLIRYRTGDIARFVPGTCSCGSLLKRIAPVRDRIG
FT                   GRVPLAGGGFISMSVLDEALFAVKGVIDFQAAVSSAGGADLLTVKVQAAVWAGEEVNDL
FT                   VREALLSVPVIAGNIAKGALILGPVDVERSQKIRAPAKRIIQDLRGKE"
FT   CDS_pept        679591..680640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="XdhC"
FT                   /locus_tag="PTH_0686"
FT                   /product="xanthine and CO dehydrogenases maturation factor"
FT                   /note="XdhC/CoxF family"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58867"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4G9"
FT                   /protein_id="BAF58867.1"
FT                   /translation="MKEIYDACARLLAGGEDVVLATIISRSGSVPRTAGTKMLVRRDGS
FT                   FTGTIGGGLLEARVLEEAREVFRTGRPVIREFHLTGADAASMDMICGGELEVFVDFLSA
FT                   GLPENIQVFKAIGDLLNSRRRTLLATRLPAQTGSSERPCKCLLVQGEQPVGCRLPAGQQ
FT                   EKLLQCGWVRYPQVVPVDGAVFLVEPVSIPGTVYLFGAGHVSQKVAQLASFVDFCTVIL
FT                   DDREEFANRQRFPWADEIIVLESFENALKDLPVTRDSYLVIVTRGHQHDLTVLAQALQT
FT                   GAGYIGMIGSCRKRDAVYQALRERGVTGEQLSRVYSPIGLDINAETPEEIAVSIVAEII
FT                   KVRGELMGN"
FT   CDS_pept        680708..681766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58868"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H0"
FT                   /protein_id="BAF58868.1"
FT                   /translation="MLKLGSCTALEHAVRCFFRAGVRDVRVVAGYRAETVAEAVKPLGV
FT                   RVVVNQYFDKGMYSSVQAGVRTLEPEVRAFFLLPADYPLVRKSTVGKMLECFHTGSKGI
FT                   VYPVFQGRRGHPPLISARYAGDIINSFPAGGLRELLGKYEHDALGVPVSDEAVLLDMDT
FT                   PEDYEVLLQYLKNRAVPTLEECRSILRECRVSELVWKHSHRVAGLALLLVKHLKKAGAA
FT                   LDEDLVLAGALLHDVARSQPDHAGAGARLLEARGYPLVAKVVAAHMDIDSSEDMPLSEP
FT                   EVVFLADKMIKDQSMIPIPERFAVMLEMYKDDRQACEAVLRRLKQALLIKRKVEKLLGR
FT                   PLESVCRAKTGI"
FT   CDS_pept        681796..682821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0688"
FT                   /product="hypothetical protein"
FT                   /note="containing partial MoaB (COG0521), molybdopterin
FT                   biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58869"
FT                   /db_xref="GOA:A5D4H1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H1"
FT                   /protein_id="BAF58869.1"
FT                   /translation="MHKKIPVEKAVGMVLCHDITQIVPGKFKGRAFKKGHIVRREDIPK
FT                   LLQLGKENLYVLEKNEGCLHEDEAAQRIARAVAGSGIALSEPVEGKVNLVSTRRGLLKI
FT                   NAGALHAINNIEQVMLASLHTNQVVQANTVVAGTRVIPLVIDEKIIKEVEELSARFAPV
FT                   VEVKPLASLRVGMVVTGSEVYKGRIEDRFGPVVKEKIENLGSYVFRKINVTDDVKMIVE
FT                   AIHSLIAERADLVVITGGMSVDPDDLTPAGVVAAGGRIVSYGAPTLPGAMFMVAYMGDI
FT                   PVLGLPGCVMFAKSTVFDLVLPRIMAGEVIERKEIVALGHGGLCMGCPTCRFPACSFGK
FT                   A"
FT   CDS_pept        682871..683482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GpmB"
FT                   /locus_tag="PTH_0689"
FT                   /product="fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58870"
FT                   /db_xref="GOA:A5D4H2"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H2"
FT                   /protein_id="BAF58870.1"
FT                   /translation="MKPRRIYLVRHGEVAGGGSRRFIGQIDLPLSEAGRKQAACLRDAL
FT                   ARAELNGIFCSDLDRSVTTALIIGEKHNLKPVPKKELREISLGAWEGLTFEEVRRKYPG
FT                   EFEKRGACIVHYRPPWGESFARCAARVIPALKEIVSSVEGNILIVGHAGVNRIILCLAL
FT                   GAPLENLFRIKQDYGCLNVLLLDNSGIKIIMLNRTFTPEI"
FT   CDS_pept        683700..684509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0690"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58871"
FT                   /db_xref="GOA:A5D4H3"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H3"
FT                   /protein_id="BAF58871.1"
FT                   /translation="MLFIKYILPYVSVCVFLLGMACKLHRWLKAPSLFPVTVFPAPGSS
FT                   SGRLAVFLKEVLLFNSLYLHSRLLWLLSWTMHLSLGVIFAGHLAGIYFSGEQFVFLGIS
FT                   REKSLLLSNSLGMAAGVVLVVSLLGLALRRIFDAEAKAATLPSGCFELALLTGIALTGI
FT                   GLRLTIDEAGLAEIRAYLAGLILFRPADFPVFPWFFWHFVLANVLLMYIPFANLKHWLG
FT                   VWIVRLMLIEPPPVYPTAAGKPLRSPFAAPLKGDFQRNRLAAGNKVR"
FT   CDS_pept        684514..685845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58872"
FT                   /db_xref="GOA:A5D4H4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H4"
FT                   /protein_id="BAF58872.1"
FT                   /translation="MRIPLHMAKEKELKDAGMVMVPPESLPRQLLAEVGNMVRSSRTVR
FT                   VMLETCTRCGACAAACHSYLGTGDSCNIPALRADLLRNFYHRHFTLTGRLASWLTGRRT
FT                   DVNEEIERWIDYSYQCNLCRRCAYYCPFGVDTAEIVMAMRYILARVGFVPRFYAVIVAN
FT                   LLKAGNNSGMLKPAVLDCCQFLEEELKEETGLDIKIPVDKPQADILYVPSSTEFTHNVD
FT                   TLLGVAKVFHALGLNWTISSAMTEAANYGMFIDLDVLKLHNRRIVDAAREAGAALVVMG
FT                   ECGHAWRVARMFSEGANGNIPFKIMHVLELAAQNLDKLTLEKAKMRVTLHDPCNYARAG
FT                   GIADAPRQILQACVTDFVEMTPNREMNYCCGGGSGMLMDEMMEVRMKLAKMKAEQLRAL
FT                   GRLDALAAPCATCKAQLPHVVRHYKLDIARVTGVMEILGQCLKL"
FT   CDS_pept        complement(685944..686765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4H5"
FT                   /protein_id="BAF58873.1"
FT                   /translation="MDPKNPGAVDEIIHLGDHWNERGLRGNKKEILAINKEIGRLFKRA
FT                   YAYLAGAKLFLDEVESYYTESGAFNAGAFDRLVLELIHEIFNGKPRAAENPKVRRLFAT
FT                   AITPDGPVSHLETVVGHLDKRYIISGDDGTGKTTLVRRLMEASLARGYNVTAFHCALNP
FT                   YAVDHLIIHELGLAIINNVEPHFYRPKEGDTVIDTMTCVRRFDNETFLAEKGAARGLYR
FT                   QCMEQAVSFISRAKKMHDEMEKYYIPYMDFEAINARREKTLQRILQLADET"
FT   CDS_pept        complement(686755..688356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="PinR"
FT                   /locus_tag="PTH_0693"
FT                   /product="site-specific recombinases"
FT                   /note="DNA invertase Pin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58874"
FT                   /db_xref="GOA:A5D4E3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4E3"
FT                   /protein_id="BAF58874.1"
FT                   /translation="MSAALIYLRVSTEEQAERGYSIAAQREECRARAQESGATEIIEFV
FT                   DEGVSGSILERPALVAALEKLKAGGIRWFICLDTSRLSRSVAHQLLLIDEIKKAGTELI
FT                   FVNSRFTDTPEDRFHLTVLSAVDEYERARTRLRSLIGKRAKAKAGKLTHSPGLYGYEFD
FT                   KETDTLRIIEEEAKIIRLMYQWFASGEDASPYKIANRLNAMGIPSPRGKRWSKQTVKRI
FT                   LANSAYAGTLYISRYDTKDVKFNKYKPPEERVSRKERPREEWVPISVPAIVDKQTWEAA
FT                   QKRFENSRRRWRSFSTYPYLLSGLMRCGKCGATMHGNLVTSKGKKRAYYVCTAKSPGLP
FT                   GRQHCQSSYLNAAEIEEVIWQKVSAWLTNPEKLRTELQAAFPDETAQALETELDAVEKE
FT                   LVRAYEERSRVATMFQKGFIPEAEMEERLGEIKGRRDYLSRRREQILGELSRCDLAARE
FT                   LKRLEELAAGMGNALDSLSSEEKKCLINLLIAEIAVFGRRADIRARIPDAVPENIEAFA
FT                   VESSFFGRHDTACSGP"
FT   CDS_pept        complement(688704..689186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0694"
FT                   /product="predicted nucleic acid-binding protein"
FT                   /note="contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58875"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4E4"
FT                   /protein_id="BAF58875.1"
FT                   /translation="MKVVSNSTPLIALARIRQVNLLHAVFRRIIIPQGVYNEVIPQGTE
FT                   LPGVKEVREATWIETLQVQNVLAVSLLRTDLDQGEAEAIVLAREVEADYLLVDEKKARR
FT                   IARNSGLRIMGTLGVVALGVKKGLLPAIDPILDSLEQNGFRFSERVRIKIKEEIGK"
FT   CDS_pept        complement(689170..689583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58876"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4E5"
FT                   /protein_id="BAF58876.1"
FT                   /translation="MTISQMDYNKIYRWIIINIKLRTCISYGMILLKLVLPGGDRMPDH
FT                   TIRIDLELPKELFIKGRASDQWVKMEALKRLAATFYADGSLSLGKAAELANVSKREFLD
FT                   FLGAHNIPLNYDLDELEEDLATVKEFLQNESGL"
FT   CDS_pept        689785..690474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58877"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4E6"
FT                   /protein_id="BAF58877.1"
FT                   /translation="MFKKPAVPLQRREMEAALQLYQKCKGWQATDEALDSLARSFPDFD
FT                   FKSTLLKAAAVNALYGTQVYAVAEVAEHLCSVLGNTTVPAAPALVEELAKVKFVRGSKH
FT                   ITWAFRSFASKFAHFFIDPDQFPIYDSYAVKMLTYHLNGKGREGLSYEQFAAGFSALKD
FT                   ALDFPVTTRELDRYLWLAGQLRAWKGLLPWRRPYTGINSELQRLFESPAGEVQELTRAV
FT                   LGKGENP"
FT   CDS_pept        690471..690947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58878"
FT                   /db_xref="InterPro:IPR025375"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4E7"
FT                   /protein_id="BAF58878.1"
FT                   /translation="MRNTGHEGRTFRSTASFGKRQEYVVIAELLRRGFDVYQTLVDDQG
FT                   IDCIIRQEREGGLRYLDLQIKARSKDCNPRNAGRFAAMDIVNPRPNYFFVFYSEQANTY
FT                   WVVPSEELVRLARRNKTGRNKGRYTINFCNVRADGTVAPRPKFDRYKNNFSLLE"
FT   CDS_pept        complement(691303..692613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="YSH1"
FT                   /locus_tag="PTH_0698"
FT                   /product="predicted exonuclease of the beta-lactamase fold"
FT                   /note="involved in RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58879"
FT                   /db_xref="GOA:A5D4E8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4E8"
FT                   /protein_id="BAF58879.1"
FT                   /translation="MRVRICRGTHDIGGSCVELQSGDSRIIIDLGLPLAAKDDSRFDSS
FT                   TLRLRTGAELVNSGILPDIRGLYAWDTECRRIDALFLSHAHIDHYGLVNFISPDVPVYS
FT                   GEATRRLMELTTMFWPLGRVGGKPSTFANGVPVYTGEFRVTPFLVDHSAFDAYAFLIEA
FT                   EGKSVFYSGDFREHGRKPSALRAIVKALSGKPVDVMLLEGTTFGRPEEKILTEKELEDN
FT                   LVRVIGSRNEICLVCSSGQNIDRLVTFYRAALRCDKIFVVDVYTAVVLDALRDFARIPY
FT                   PSSQYSNLRVFFPYWLSRRLSGSGHVDVLYRYRGLKITRRELEEQQRRVLMLVRPSMIG
FT                   DLRRINFTGGSFIYSMWLGYQKEPAMARLLNFAREQDLEYYYIHTSGHAPPQTLKKLVD
FT                   TLRPKEVIPIHTFYPDEYQALGVKVRCMNDGDIYWLN"
FT   CDS_pept        complement(692610..693914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0699"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58880"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4E9"
FT                   /protein_id="BAF58880.1"
FT                   /translation="MEEKERRKEILKRWGKVDPSKIQVISPFDPDEPLEEFLTLHFESK
FT                   HMLVINTDAKGKKHVLRVLKKFAENKGLEFKIFNTSGASVEDVRGQIEIAWLDGRPYHQ
FT                   RKKPSYWPENRGMIVVEGVDQETDIEVLRAFLYVAAMPYGEDRLQPDQLPYGSGFVFLA
FT                   YHDFPVQSFASITDYFGDEYTSITWPPAPYTRERVIYETAVAMQNIGQLYQQPFLNWRG
FT                   KTRDDQQQLFTEVIAEELLKSNMAARLRSLPAILRKEYRVETHDGNIRQQTNRAEEILA
FT                   KRLFNYSERGNNLGELGKVFDYQVPLKSTQKDKAGKIDLVSFNQDTDTVWLVEFKRAGN
FT                   KDTLLRCLLEIATYYQLLDKEGFIESHRDMLGNLGPDCIRKAVLIFRGQPQHEEIEEMK
FT                   DGKRPMLKQLAESLEITFFLLEESGSTFTAEKVLL"
FT   CDS_pept        complement(693959..694615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58881"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F0"
FT                   /protein_id="BAF58881.1"
FT                   /translation="MSEVLSLLNPMTKRPFAFNEYYSFNDTILIFGLETSLTTRICDIA
FT                   AKLNIKVYECRSIEDLLAIPAFIAVVNPRKITQVEAVILAELWQEYDTSEFKVIFIETP
FT                   YSYWPQPLPSCVKVEPDLFADLEKLRLNILKQKTPANRQDRIARQYEERISRILMILKR
FT                   LQKGPVKTKELAKEFKVSARTVQRDIRVLECIGEPIGYDEQEKAFFLLNRGSLWD"
FT   CDS_pept        695841..696437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0701"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58882"
FT                   /db_xref="GOA:A5D4F1"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F1"
FT                   /protein_id="BAF58882.1"
FT                   /translation="MKLNTNGQSRWPKKFTGGRYPSPTRMEKNKPRRRTVLLPAQSTNI
FT                   FSPARCNWRRVRASKIWGMFAPKDLSYDFDRDPAKQPGQAEMTSKAMEVLSKDKDGFFL
FT                   MVEESKIDWAAHANDPVGVISDILAFDNAVKAALDFAKKDKQTVLLLIARLLRPWGRRA
FT                   ILSARNTSRSCFHLILRHFPGQYYGEVRTANPFSW"
FT   CDS_pept        696525..696776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58883"
FT                   /db_xref="GOA:A5D4F2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F2"
FT                   /protein_id="BAF58883.1"
FT                   /translation="MFAKISKKGQVTLPAEVRKLLNLHPGARVRFVVEKNAARILPVEG
FT                   GIETLKGAVKVSAPQDFKAARHKAMEERSREKSARTRC"
FT   CDS_pept        696748..697158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0703"
FT                   /product="predicted nucleic acid-binding protein"
FT                   /note="contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58884"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F3"
FT                   /protein_id="BAF58884.1"
FT                   /translation="MRKVRALDANVILRFLTNDVPEQANRCAELLKRVEAGTEEVWLPD
FT                   LVLADIIWTLEKFYKQPKQQIRDLLAPILNLRSLRFSSKKTAQKALQLYAKKNLDWTDA
FT                   VIAAQILARKQSEIYSYDRDFDKLEGVTRLEP"
FT   CDS_pept        697173..697301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58885"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F4"
FT                   /protein_id="BAF58885.1"
FT                   /translation="MLSSRTCGSVTSGLPPSGKTTLIPPPYSWPRFYSDYGITRFA"
FT   CDS_pept        complement(697355..697600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0705"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0705"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58886"
FT                   /db_xref="GOA:A5D4F5"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F5"
FT                   /protein_id="BAF58886.1"
FT                   /translation="MFVKLERITVAPQICMGQPTIRGTRLTVAFVLKLLAAGMDIPAIL
FT                   NAYPELEEEDIRQSLMYGAWLAAEQTRPIPWEAQGS"
FT   CDS_pept        698519..702199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58887"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F6"
FT                   /protein_id="BAF58887.1"
FT                   /translation="MKYADLIHFEPVETIVQLREADAKSRAGELVKTYVISERMAEQIT
FT                   EVVFPQLQYDHPQDNKGLLIVGNYGTGKSHLMSVLSAIAEYPDLATEIRHPAVAKKSEV
FT                   IAGKFKVIRTEIGSTTMSLRNIICAELEEQLANLGVQYRFPEADKVTNNKDPFIEVMTA
FT                   FQEVYPDHGLLLVVDELLDYLRTRKDQELILDLNFLREIGEVCRLTRFRFMAGVQEAIF
FT                   DSPRFQFVAETLRRVKDRFEQIRIVREDIAYVVAQRLLRKDDRQKALIREHLQRFTRLY
FT                   GTLAERMDEFVALFPVHPAYLETFERVYVAEKREVLKTISAAMKKLLDKEVPETAPGLI
FT                   AYDSYWQNLKDNPSFRSDPDIREVIEKSQVLENRVQQAFTRPQYKPVAFRIIHALSVHR
FT                   LTTGDIYAPIGVTAQELRDDLCLYLPLPEEDAEFLKTTIESILREILRTVSGQFISFNQ
FT                   DNGQYYLDLKKDIDFDSLIEQKAETLTPNQLDRYYFKALARAMECPEATYVPNFQIWEH
FT                   EIEWREKKATRLGYLFFGAPNERSTAHPPRDFYLYFLQPFDPPAFEDEKKPDEVFFRLV
FT                   QRDEDFDRALKLFASASEMASTASKGTRQVYENKANDQLKKIVEWLRNNIATAYEVTYR
FT                   GATKKFVEWVKHSANPHASVRDLVNLVGSSCLAPYFRELAPEYPIFAILVTIKNRPQAA
FT                   QEAIKWILGSIRTRPGAAVLDALELLDGDKLRPQNSRYAKHILGQLDKKGPGQVLNRGE
FT                   IIADFRGVEFEPRFRLEPEWVVVILASLIYSGDVTLSMPGKKIDASNLEELGKVPLEEL
FT                   IKFKHIERPKDLPLGPLQALFEFLGLPPGLIVNQSTREEGVRQLQEAVDKLLERTAQAQ
FT                   QAIQQELSLWGISLFDQKKKTGLRDELASFKGFLESLRVFNTPGKLKNFRYSERDINKQ
FT                   KAYLATLKRVEELAGLAKEIMPLLSYLSTAEAVLPADAGWTTKARERREELKGKLSGLD
FT                   EASVPDLRRELVQVLLELKNSYIEAYLEAHTKARLNASLDQKKSGLLKDERLSKLSRLA
FT                   GIELMPRAQLTDFQNRLAELKTCFSLTRENLGKTPICPHCNYRPAQEQIKLSAEAALRQ
FT                   LEEDLERLYQDWEKTLVANLEDPTVKENIYLLKPEQQKALEQVIKEQQLPYTVDASFVK
FT                   AVQEALSGMEKVSVTAADLKKALAQGGTPCTVSELKQRFEDYIQSLTRGRDPQKVRIVL
FT                   E"
FT   CDS_pept        702243..703280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0707"
FT                   /product="hypothetical protein"
FT                   /note="containing partial COG1367, Uncharacterized protein
FT                   predicted to be involved in DNA repair (RAMP superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58888"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR007522"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F7"
FT                   /protein_id="BAF58888.1"
FT                   /translation="MEVEVKTLTPLWTGGAKSGAVDRVHETGIIGSLRWWFEAMVRGMG
FT                   GNACSPEQAEQKCIYDPEKPNKGICHVCEIFGATGWRRRFQLMVNDYTEPDHSITKVML
FT                   ENCRYIDSKGRTRVPTWYFPGRLDDKPRIGSLTLRIRQTAPDFQTAIIGGLLQFMADWV
FT                   AIGARAQLGFGVFELPNGRLDTRPLYERLIANAGNCTYTRLPSLQNIFLARIWLENATV
FT                   QDTFNLKYDIRQLFSGQQNKSLRHFIMGTIKGERLVAKVKISRPYGNGLIRVWGWIPKE
FT                   AGVYKNGWNREKVVDAIYQYLRKNYTLEVWREMDSPRDTVTPNISSAQAFLRSILGLRE
FT                   EDYEA"
FT   CDS_pept        703270..704364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0708"
FT                   /product="hypothetical protein"
FT                   /note="containing partial COG1604, Uncharacterized protein
FT                   predicted to be involved in DNA repair (RAMP superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58889"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F8"
FT                   /protein_id="BAF58889.1"
FT                   /translation="MKRDYYVLQWKKLNSNMSALEQAIIALEEAKKRDSNEYKRLAIKI
FT                   IQIVGHPHLAYLWFAAIKAKVANAIREAWQEVLPDTIKAIPDVFGFVPDVEDEEKFIFL
FT                   PLYSFALKIPFQLEKPYMSRDDVDFYLLDSPLRKEKIFKVPTVASTSWKGALRAALWQL
FT                   GYEEDNEVIIRLLGNSRESDEKQAGRLYFYPTFFDKISFEVINPHHHETGVGQGPILME
FT                   CVPRGAAGILQILYVPFGRPDQNERECRAEVAGDLEVLVKGVHAMLTTCGFGAKTSSGF
FT                   GTVKDQLNDRGALILRAKTTDADVPPAEDSPPSSEVNHLESKPEEIPQLTGKPHVSKWT
FT                   FSTLGELCQVARQVAAKLREGGLR"
FT   CDS_pept        704361..707237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58890"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4F9"
FT                   /protein_id="BAF58890.1"
FT                   /translation="MNSSFWRPDTNQKRAILFMEALGLIHDLGKLSDTFLQSQEPNSTL
FT                   EYIHNLLVDPRQIDIYKNHRPIPNNKASSMIAEWLRDAGGKPAAFQERPDLTSLLLNLQ
FT                   FDDWTGTKYCLAELMPLVARPALARKTPSSEWGKVLGKEMTPGLLIGYLHGVAHFEKQG
FT                   DPDDKNKQPYSAVFRATPFGLEDRIETGKNELTTTLKYLPLSNIEPITSNQRRDWLRAM
FT                   EENMKRGLADTRRPHNEVSLWDWGYMTATLAKAAAAWIFKNGWPRDNDLGKIPYRTLCI
FT                   TLNRLVLYSRCDKIGDLLGVRQVLDEAYRKVQRLLEEEYALANRFYRDETGEYYLFPDL
FT                   GYSNEEMIALREAIQAQFPPDLRPQVHLGEPVTAGQLDDSNPSAVRKLVAEPRGQSMQE
FT                   HTMRAGNNLCLFEWEWGNGRPENAEICSACGVYPIGYPREGSSHDLERSLSYWATQAEA
FT                   QRLQVCRVCLDRRRRRAEDWAKNNFQGTIWIDEVADDNGLVALFVGKFGLEGWLDGSLV
FT                   STIKVTHNEVKYPSPARLYRIVETCRSFWQQVTDDLTRKTVGQRPFRLALYPATNEVSK
FT                   LGNFHAYELKADSIALSVIWDKSHRRFLTIENLTYLASRCRIPEDALMDKLRGNNLHVV
FT                   EPSEFLSPARTSAKVRVERVDKLNGYTPTIPLLAEPSVYMAMVPAVKALELARNVKRKY
FT                   EEEMGRVRDRLPIYLGLVFFRRHTPLRAVLEAGRAMLNMDGGDKWEGWRLVDKNLNNGV
FT                   CELAFDNGITWKVPTVAGDGQTRDEWYPRMYEGDSRDSKKVKHVNDLRVRNPQIPPDKG
FT                   WKVWVKPSRFDFEFLDTNSRRFEIYYDQNGRRPRRTRPFYLEDLDRLDTLWTLLKLKLP
FT                   AKAQRYQVIRTIEDTRQKWYGRDREEDSWHDPVFQQFVADTLAQAAWPKTWKWTEIEQD
FT                   PQKKQLIEAGVKGELADLAELYMEILKE"
FT   CDS_pept        complement(707316..708203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0710"
FT                   /product="hypothetical protein"
FT                   /note="containing partial COG3547, transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0710"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58891"
FT                   /db_xref="GOA:A5D4C6"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4C6"
FT                   /protein_id="BAF58891.1"
FT                   /translation="MLRLGRTPTTKLPSETVLKLQTLSRLRFEFVRQVGGLKNRVLGIL
FT                   DRIFPEYPGCFSDVFIRTSRELLKSYPEPEELATVDLSELAAFLKEHSRGRFGEERAKK
FT                   IQSLAKGTFGITLALDAFALQLRLLLEQIEFIEEQVKVIEEAINEVMEELRPDRDTPYR
FT                   HVIETIPGIGPVLAAAIIGEIGDVSRFPNARALVAYAGLDASVRVSGLFEGTRNRMSKR
FT                   GSPMLRNSLWLSAVLARRFNQELKEYYELKCSQGKHSSVATGAVARRLVHLIYALWKEN
FT                   RPYDPNYQWSPPRK"
FT   CDS_pept        complement(708317..708532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0711"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58892"
FT                   /db_xref="GOA:A5D4C7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4C7"
FT                   /protein_id="BAF58892.1"
FT                   /translation="MFYGGIDVAKYRHEVCLLDDAGNVVLQMHIDNNQKGMNKFLQALE
FT                   RLDIEPDSVKFCLEATDITGSPFTAT"
FT   CDS_pept        708844..709845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0712"
FT                   /product="Uncharacterized protein"
FT                   /note="predicted to be involved in DNA repair (RAMP
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0712"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58893"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4C8"
FT                   /protein_id="BAF58893.1"
FT                   /translation="MATYERRRYLFMTTDPVHVGTGGYRLGRVDLSIVREPGTRVPKIP
FT                   GTSLHGAARAYSARIYESPACAGQGTNQEGRSGHCGRDDCPICYTFGYLSRKTDQEDST
FT                   VGYSGVVNVFDARVLLFPVYSMAGPVWVSTVDIMQDAGFKVTNVPSNWNVGTALLTWER
FT                   NDALNLGWLMVEIAGKVLVTASQEWSKDERWKQVQDKIVLVQPALFSQVVNSNLEVRTS
FT                   VAIDPERGAAEDKALYTYEALPRATFLTCEVVLDDYRDGFPKDDGKNPLQGKKKWEGPL
FT                   DVLDAGLRMIEWLGVGGMGTRGFGRLAVVGQTISNVWPDEEGQKNEQQHGTS"
FT   CDS_pept        709820..710272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PTH_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PTH_0713"
FT                   /db_xref="EnsemblGenomes-Tr:BAF58894"
FT                   /db_xref="UniProtKB/TrEMBL:A5D4C9"
FT                   /protein_id="BAF58894.1"
FT                   /translation="MSNSMAQANLDRLAAQHAQNIIRRLVDEDKDGNKRAEKELKKVAS
FT                   SADNTVTKALGVLQENGVYACFLYLKAKEKDNGDVVIKEMLKLLNSLGFEWGLPTNDKG
FT                   EVDTRAEVVLKYVTEKVTVDLERLLLAKETLEKMLIYARYGAKARG"
FT   CDS